1GY5A

D92n,d94n double point mutant of human nuclear transport factor 2 (ntf2)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
b'KPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKANENPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title Structural Basis for the Interaction between Ntf2 and Nucleoporin Fxfg Repeats
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear transport
total genus 36
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gy5A00
4XBXA 5KP1A 2JQ5A 1W00A 5IEOA 3F8XA 5STDA 5FW5A 1NDOB 1OHPA 4GB5A 3HX8A 1OPYA 2YFJB 1OGZA 3S5CA 3M8CA 4ORLA 3ROBA 3RGAA 3SEDA 1OH0A 3OXAA 3GZYB 5IEPA 1OF5A 2UX0A 1NWWA 1Q42A 3OWYA 3SOYA 2QGUA 1ULJB 5D82A 3MYTA 5TGNA 3FF0A 1O7HB 1QJGA 1ZO2A 8CHOA 5JPPA 3VSYA 2HMLB 3NV0B 2GBWB 5IERA 6STDA 1OCVA 1IDPA 5IF6A 4HM0B 2INXA 3E99A 5AEWB 2YFIB 5D83A 4XDVA 4HVNA 2XR8B 1GY6A 3DMCA 4LGQA 3EBTA 2F86B 1E3VA 3GZXB 3FSDA 3A76A 2HMNB 4FCJA 4LEHA 3B7CA 4HJLB 2K54A 3OX9A 3KE7A 3F14A 4IIAA 3EF8A 4STDA 1EA2A 4HM1B 4HM3B 7STDA 3MHEA 2HMMB 2BMOB 1JB5A 3EN8A 1JB2A 1ZX2A 4XBYA 5CK6A 2GEXA 1DMMA 1Q40A 4LMIA 5AEUB 4K1UA 1WQLB 1ULIB 3ER7A 2R4IA 5AIGA 4L8PA 5KP3A 3DZLA 3FLJA 3LZAA 1JB4A 2XRXB 1U5OA 4XDWA 1SJWA 2GBXB 3BB9A 1OGXA 1S5AA 5IG5A 4H3UA 1W01A 4HKVB 2Z77A 3SOAA 4X2HA 3H3HA 2IMJA 3LYGA 1HKXA 4OVMA 3MG2A 1OHOA 4PEJA 3DXOA 3GZBA 1GY7A 4HZBB 5D81A 2F98A 1NU3A 1DMNA 1Q40B 5KP4A 3VGNA 1O7GB 2PZVA 3GRDA 2Z76A 3F7SA 4L8OA 3EX9A 1OHSA 1UUVB 4X2OA 1O7PB 3G16A 3FKAA 3DUKA 5CF2A 3NM2A 2RCDA 5AI1A 3CPOA 2RFRA 5CF1A 2CHCA 2RGQA 3BLZA 2GEYA 3NBRA 2QIYA 5IG3A 2BMRB 5BVBA 2HMKB 5IENA 3KZTA 1VZZA 4I4KA 5IG4A 1JN5A 1OF5B 3CNXA 1O7MB 1O7NB 1CQSA 3GZRA 1K41A 2GXFA 4HM7B 3MKIA 2HMOB 3WMDA 2B1XB 3NUVA 3MSOA 4HM4B 4MJDA 3B8LA 2BMQB 5DRVA 1E3RA 5CXOA 4XM4A 4HM6B 3OWUA 3UNLA 4J9AA 1EG9B 5CLKA 1DMQA 3G8ZA 1W02A 3T8NA 1ASKA 3EHCA 5AIIA 1O7WB 3EJVA 3EBYA 5IG0A 4XB5A 3K7CA 3CU3A 3T8UA 3KKGA 4WWUC 3FGYA 3NXJA 3FF2A 5BXQA 3CNMA 2BNGA 2Z7AA 5AIHA 1TUHA 1JKGA 3G0KA 4R9KA 4L7KA 3F8HA 3F9SA 4KVHA 5AIFA 2B24B 3JUPA 2STDA 3HK4A 2YFLB 3OV4A 5JPUA 1OUNA 3DM8A 3EC9A 3H51A 4HM2B 3FZWA 1QMAA 1ISKA 3STDA 3MG1A 4R1KA 1STDA 3K0ZA 2W2CA 3RGRA 1BUQA 2XSOB 5DREA 1C7HA 1GS3A 5HGRA 4N3VA 4RZMA 3D9RA 3JUQA 3B4OA 1E97A 2XSHB 4Q53A 3JUMA 3JUOA 3ECFA 5G2GA 1JKGB 4WYKA 2HMJB 1TP6A 1UUWB 4R9LA 3OWSA 4HM5B 3GWRA 2CKFB 4U13A 4WP5A 1AR0A 4FCMA 1GYBA 3F7XA 3B4PA 3NHXA 1GY5A 2A15A 2I9WA 4K1VA 4J8TA 3Q90A 3EN1B 3F40A 4CDLA 3UJMA 3HZPA 3FH1A 3NV0A 2OWPA 3JUNA 3EQQB 3MG3A 3I0YA 1W6YA 3IPTA 1A2KA 1JN5B 1Z1SA 3KSPA 4HZ9B 4WYKB 4OUQA 4XBTA 4HM8B 5EVHA 2F99A
chains in the Genus database with same CATH superfamily
4XBXA 1BSBA 5KP1A 3I553 1GMRA 4OK0A 2JQ5A 1T5YA 1VQN3 2WOFA 2BU4A 1I0VA 1I2GA 1YJW3 1W00A 1LOVA 3RNTA 1J2BA 5IEOA 1N5HA 2CWVA 1A67A 2R41A 2W9PA 3U97A 8RNTA 3F8XA 5STDA 1GD3A 1NDOB 5FW5A 1G02A 1OHPA 1I0XA 3HX8A 4GB5A 1V74A 1OPYA 2YFJB 1C54A 1RGAA 3V98A 1MGWA 1OGZA 3S5CA 3X40A 3M8CA 4HOHA 4ORLA 3RGAA 3N54B 3ROBA 3SEDA 1AV4A 1OH0A 2P0XA 3NBBA 1FUSA 4AKYA 3OXAA 3GZYB 5IEPA 1UCIA 1HU9A 1FGRA 1OF5A 4CJNA 2UX0A 1NWWA 1Q42A 3OWYA 3SOYA 2QGUA 4FMAA 1ULJB 2AAEA 4MMXB 1EUIC 5D82A 3MYTA 5TGNA 2QA43 2O3OA 4R4KA 3FF0A 1NNVA 1O7HB 1QJGA 1ROAA 3CC43 1JRQA 1Q814 1ZO2A 8CHOA 5JPPA 3VSYA 2HMLB 3O8YA 2HOHA 2V1LA 3MPHA 2GBWB 3NV0B 5IERA 6STDA 1VQ53 1W6CA 2CK3H 3ZFZA 1OCVA 3LMLA 1KD14 1F8NA 1WMPA 1IDPA 1VQL3 2JDIH 1UCLA 1BSEA 2GSPA 3LH4A 3FCSB 1WTHA 4HM0B 3NQYA 5IF6A 1UI7A 4IPBA 2INXA 3E99A 1IV7A 1RGLA 4N6V0 3WR2A 3ZG5A 5AEWB 4J5KA 1CYUA 1N8QA 2YFIB 1K8A4 5D83A 3V92A 4XDVA 4HVNA 4TX4A 1T2IA 2XR8B 5AYSC 1GY6A 2F5WA 3DMCA 2CWTA 4BTYA 4LGQA 3D4AA 3AHSA 1VQ93 1B2UA 5ELUA 3EBTA 4MEIA 1YIT3 3LTDA 3DGLA 2F86B 4EYCA 1E3VA 1W5ZA 3GZXB 1DVCA 1K28A 1NO3A 1X1YA 1RMSA 2E2UA 2ML5A 3FSDA 3MWZA 2WO0A 1RHLA 3A76A 3CD63 3FG3A 3WOFB 2KXGA 4G1MB 1A2VA 2HMNB 1JBRA 3K63A 1BRKA 3HOHA 1IVWA 2XF3A 1JJ22 1I3IA 2CWUA 4FCJA 2XH9A 4LEHA 3B7CA 1V57A 4O02B 1IVVA 4HJLB 1M1XB 2CC3A 2AADA 2K54A 1UI8A 3OX9A 4N6MA 3SX1A 1BAOA 3KE7A 1VQK3 3F14A 4IIAA 3DY5A 3S29A 3EF8A 4FMCA 7GSPA 4KFFA 3BNEA 4FMDA 3S28A 2Q07A 4STDA 1HYFA 2KAAA 2BO9B 1EA2A 4HM1B 4HM3B 7STDA 3MHEA 2HMMB 2K0MA 2BMOB 4O8SA 1FUTA 1JB5A 1RGCA 2OTL3 3EN8A 4KFEA 6GSPA 3Q2PA 1PY3A 3CCS3 3FG1A 1PU4A 1JB2A 2ZHXB 1W2B2 1ZX2A 4XBYA 1HZ1A 1GOVA 5CK6A 2GEXA 1DMMA 1Q40A 1LQGC 2Y73A 1WNHA 4LMIA 2SBLA 1LQMB 5AEUB 4K1UA 1WQLB 2UGIA 1M9GA 1ULIB 2L1SA 2XFTA 1VQQA 4ILFA 2ZA4A 1FGOA 5FGOA 1QAKA 1AVKA 3ER7A 1AVLA 1GD4A 2R4IA 1BNGA 5AIGA 1BRNL 2Y74A 1LOXA 3K9MC 4L8PA 1MNLA 1T3BA 4QWTA 4R80A 3DZLA 5KP3A 1BNRA 3FLJA 2OQEA 1BUJA 3LZAA 4NHFA 2RBIA 1IT7A 1KC84 1JB4A 1VQ73 4K90B 1Q824 1IK3A 3UB1A 3LTBA 3PXMA 2XRXB 1U5OA 1RRLA 4XDWA 2CW9A 1Q864 1SJWA 5GSPA 4N6NB 2GBXB 3BB9A 3CCM3 4AKZA 1OGXA 1S5AA 2CIUA 1FGMA 5IG5A 2BHMA 4H3UA 1SARA 1NJI4 1W01A 3PGBA 4HKVB 5M19A 2Z77A 1DETA 1TTOA 2XGNA 5M1AA 1S723 1K9M4 1CH0A 4I5QA 3CPW2 3SOAA 1YNVX 3D79A 1RGHA 1BNSA 1IU7A 3J7Yd 4X2HA 3IJEB 1VQM3 1YGEA 1Y4KA 4HBRA 3H3HA 3V99A 2IMJA 1FW7A 3LYGA 4AEQA 1HKXA 1VQP3 4OVMA 2C11A 3MG2A 4NREA 3WODG 1OHOA 2KRTA 3NQZA 4PEJA 3PS8A 3DXOA 2SARA 3GZBA 2F56A 1GY7A 4HZBB 1A90A 2OOVA 1SPUA 9RNTA 1LOYA 5D81A 2F98A 1BRGA 2KF4A 1NU3A 1X1XA 2XFSA 1DMNA 1IQ8A 1Q40B 5KP4A 2KF5A 3D5GA 4J5GA 1MGRA 4LYLB 5LC6A 3VGNA 2ZL8A 3K5TA 1QALA 1O7GB 2PZVA 4ZM8A 2OQEC 2Z76A 3F7SA 3GRDA 3T0UA 4N6TA 3X3ZA 1N9JA 4L8OA 3EX9A 1OHSA 2W56A 3EE1A 3PCSA 1RGGA 1UUVB 4X2OA 4EW5A 1EQKA 4LZIA 4O3VA 1DYUA 1TJDA 5RNTA 1RGKA 2ML6A 2CG0A 2C10A 2CX1A 1OACA 1O7PB 3G16A 1TIJA 3FKAA 3DUKA 3NX0A 5CF2A 1IQXA 3LT8A 3NM2A 2RCDA 5AI1A 3SLUA 5G1KA 4RNTA 3CPOA 3I563 1RN4A 1WMOA 2RFRA 3WHOA 1B21A 1I2EA 3CCU3 5CF1A 2CHCA 1BRSA 2RGQA 1BNFA 1K734 2E2VA 2IYJA 2W03A 3BLZA 4KT3B 2GEYA 1VQO3 5HOHA 2PNCA 7RNTA 1LVNA 3NBRA 1UDII 1SQWA 3A5EA 1YVBI 2QEX3 3PCRA 2QIYA 2L4VA 3AGNA 5IG3A 2XEPA 2BMRB 5BVBA 1LNIA 1KQS2 1RN7A 2HMKB 1I8VA 2FGTA 3L0RA 1BRIA 1GMPA 2MC8A 2IUJA 2OOVC 3AHWA 5IENA 1M904 3KZTA 1RRHA 1VZZA 4EC6A 3VF1A 1B2ZA 4I4KA 5IG4A 1JN5A 1T2HA 1LRAA 1YI23 1YJ93 3CMA3 1SIIA 3QRDA 1OF5B 1WMNA 3CNXA 1RCKA 3PZWA 2D42A 3SYUA 3N9HA 1O7MB 2F5MA 4JF8A 4N6OB 2CG1A 2LYXA 3CCL3 1O7NB 2CX0A 1CQSA 3GZRA 1K41A 2GXFA 4HM7B 3MKIA 2HMOB 3BNBA 5I97A 1W4NA 1TRQA 1X1WA 3WMDA 4BIRA 1AQZA 3CCR3 2B1XB 1RTUA 1FGQA 2W0QA 3NUVA 3MSOA 3LTAA 4HM4B 1QVG2 1B3SA 2Z6BA 4MJDA 1BSDA 1D6ZA 3B8LA 2BMQB 4BTWA 1JNQA 5DRVA 5BU4A 2IY2A 1RSNA 4BL3A 1VQ43 1E3RA 5CXOA 1ROVA 4XM4A 4HM6B 1TFOA 2H0GA 2CH9A 1ZGXA 3OWUA 1VQ63 3WOEB 3UNLA 4J9AA 1EG9B 2C4BA 1Q9EA 3CCE3 1BGSA 5CLKA 5G1LA 3SXXA 3CCQ3 1DMQA 3KSED 1D6YA 3G8ZA 1IT8A 1JZOA 1RNTA 1I2FA 1IQYA 1W02A 1I70A 3AMOA 1JZDA 2WGOA 2ZDJA 3KFQC 3T8NA 1ASKA 1UW1A 3EHCA 1YVSA 5AIIA 3CCJ3 1N9EA 2GU1A 1VQ83 4FR9A 1O7WB 5BIRA 1BANA 1FGTA 1US1A 3EBYA 1G96A 3EJVA 3KIIA 4XB5A 5IG0A 3K7CA 3CU3A 1U8CB 3CCV3 4NPBA 3T8UA 3WA3A 1R4CA 3UL6A 4EV2A 1A2PA 2O9UX 3KKGA 4WWUC 1IVUA 3FGYA 4N6UA 1BIRA 1LNHA 1W7CA 2OCTA 3QK9A 4MMYB 1RKYA 1TRPA 2YX9A 3HIGA 3NXJA 3LTCA 3CXC2 2W9QA 1M1K4 1RLSA 2XGLA 1CEWI 1B2SA 3FF2A 1BNEA 5A0OB 4FMBA 5BXQA 1QAFA 3CNMA 3KCHA 2BNGA 2Z7AA 5AIHA 4KZ1A 1DVDA 1TUHA 1JKGA 3G0KA 2W04A 4KFDA 3DGNA 4R9KA 2FNQA 4L7KA 2E2TA 2CFLA 3D3LA 3F8HA 1X1UA 3F9SA 1Q7Y4 4KVHA 1BU4A 3NM7A 3KN4A 2P05A 2M7OA 2RNTA 5AIFA 4BU4A 3G4S3 2B24B 3DGMA 3GSPA 3JUPA 4RNZA 1IV9A 1RDSA 2STDA 2RSXA 2CFDA 3HK4A 1JV2B 3Q1CA 4LSOA 2YFLB 1NB5I 3TDGA 1RGEA 3OV4A 1MWSA 3FG4A 5JPUA 1OUNA 4EXRA 3S27A 1UCJA 1RN1A 3SVAA 4N6LA 3DM8A 3WA2X 1TU5A 1QVF2 2BT3A 2K3DA 1RNBA 1MWRA 3EC9A 3H51A 4HM2B 3DGOA 3AMOB 3FZWA 2W6JH 2F4YA 1YGWA 2KF3A 1QMAA 4HYZA 2H0HA 4IT7A 4WFOA 1L5GB 1ISKA 3STDA 3MG1A 4R1KA 1JBSA 2CFWA 1V58A 1STDA 1D6UA 1IVXA 4FCZA 1B2XA 3K0ZA 1R4YA 1YJN3 1GMQA 3X3XA 1BNJA 2W2CA 1RCLA 3RGRA 6RNTA 1BUQA 1BRJA 2MF7A 2XSOB 1RJOA 1W2ZA 1PYLA 1B20A 3U1WA 3X42A 5DREA 1C7HA 1GS3A 5HGRA 4HAAA 4H61A 1KSIA 1LOWA 4N3VA 4CCVA 4RZMA 2P0MA 3D9RA 1G0TA 1TFKA 3JUQA 3N8BA 4JRFA 1JBTA 1DE3A 5AYRB 3RDEA 3B4OA 3UL5A 1E97A 1GSPA 1KWIA 2WGQA 2XSHB 1FZUA 4Q53A 3X3YA 3CME3 3EB8A 3JUMA 3D5IA 1FUWA 1RGFA 1MWUA 2WOHA 3JUOA 1UGHI 1UCKA 3ECFA 4RNYA 1BRHA 3OW22 5G2GA 1JKGB 4WYKA 3NBJA 1YIJ3 3Q3FA 2HMJB 2KCDA 2P09A 5EQLA 3HIIA 1TP6A 1UUWB 3URPA 1IYYA 4R9LA 4BL2A 1MOLA 2BIRA 3OWSA 1N8R4 3BU4A 3CC23 3LOYA 4HM5B 2H0IA 3GWRA 1BSCA 2CKFB 1N5PA 2CFGA 1EEJA 3LT9A 1BOXA 2OTJ3 3S67A 2IUKA 4U13A 4WP5A 1AR0A 4FCMA 2D1WA 1B2MA 2W56B 3AGOA 1GYBA 1UGIA 4MMZB 3WDGB 3BNDA 1FA3A 1B27A 2FXTA 2UUGC 3F7XA 2P38A 3B4PA 3X41A 1W6GA 4O2HA 4GSPA 3ALAA 3NHXA 1GY5A 2A15A 2I9WA 3JVCA 1YHQ3 3BIRA 4K1VA 1BNIA 4J8TA 3Q90A 3EN1B 3G713 1I3FA 1LXEA 3IMAB 1FYSA 4GL6A 4RBNA 4WHAA 2GU3A 3F40A 3HI7A 4CDLA 3UJMA 5EEOA 5M18A 5JBSA 2IA7A 3HZPA 4K61A 4DKIA 1ZS7A 1CYVA 5ELJA 4BTXA 1AY7A 2KF6A 3FH1A 3NV0A 1Q7HA 2OWPA 2CFKA 3GAXA 1BSAA 3JUNA 3EQQB 1UUGB 3MG3A 3LXUX 3DGYA 3ZG0A 3I0YA 5LC7A 1W6YA 3IPTA 3DH2A 1A2KA 3BNCA 3G6E3 1JN5B 2LQVA 1SIHA 1Z1SA 3KSPA 4HZ9B 1NB3I 4WYKB 3CC73 1GOUA 5IW9A 4CPKA 4EBGA 1BVIA 1GOYA 1PFPA 4OUQA 1MWTA 2J8XB 4XBTA 4EV5A 4HM8B 5EVHA 4GHOA 1EKMA 1STFI 2F99A 3PYJA
chains in the Genus database with same CATH topology
4XBXA 3I553 5KP1A 4OK0A 2JQ5A 1T5YA 1VQN3 2WOFA 1YJW3 1W00A 1J2BA 5IEOA 1N5HA 2CWVA 1A67A 2W9PA 3U97A 3F8XA 5STDA 1GD3A 1NDOB 5FW5A 1OHPA 4GB5A 3HX8A 1V74A 1OPYA 2YFJB 3V98A 1OGZA 3S5CA 3X40A 3M8CA 4ORLA 3ROBA 3RGAA 3N54B 3SEDA 1AV4A 1OH0A 2P0XA 3NBBA 4AKYA 3OXAA 3GZYB 5IEPA 1HU9A 1FGRA 1OF5A 2UX0A 1NWWA 1Q42A 3OWYA 3SOYA 2QGUA 4FMAA 1ULJB 4MMXB 5D82A 3MYTA 5TGNA 2QA43 2O3OA 4R4KA 3FF0A 1O7HB 1ROAA 1QJGA 3CC43 1JRQA 1Q814 1ZO2A 8CHOA 5JPPA 3VSYA 2HMLB 3O8YA 2V1LA 3MPHA 3NV0B 2GBWB 5IERA 1VQ53 6STDA 1W6CA 2CK3H 1OCVA 3LMLA 1KD14 1F8NA 1WMPA 1IDPA 1VQL3 2JDIH 5IF6A 3LH4A 4HM0B 3FCSB 1WTHA 1NB5I 3NQYA 1UI7A 4IPBA 2INXA 3E99A 1IV7A 4N6V0 5AEWB 1CYUA 1N8QA 2YFIB 1K8A4 5D83A 3V92A 4XDVA 4HVNA 4TX4A 2XR8B 5AYSC 1GY6A 3DMCA 2CWTA 4BTYA 4LGQA 1VQ93 5ELUA 3EBTA 4MEIA 1YIT3 3LTDA 3DGLA 2F86B 4EYCA 1E3VA 1W5ZA 3GZXB 1DVCA 1K28A 1NO3A 2ML5A 3MWZA 2E2UA 3FSDA 2WO0A 3A76A 3CD63 3FG3A 3WOFB 2KXGA 4G1MB 1A2VA 2HMNB 3K63A 1JJ22 1IVWA 2XF3A 2CWUA 4FCJA 2XH9A 4LEHA 3B7CA 4O02B 1IVVA 4HJLB 1M1XB 2CC3A 2K54A 1UI8A 3OX9A 4N6MA 3SX1A 3KE7A 1VQK3 3F14A 4IIAA 3DY5A 3S29A 3EF8A 4FMCA 4KFFA 3BNEA 4FMDA 3S28A 2Q07A 4STDA 2BO9B 1EA2A 4HM1B 4HM3B 7STDA 3MHEA 2HMMB 2K0MA 2BMOB 4O8SA 1JB5A 2OTL3 3EN8A 4KFEA 3Q2PA 3CCS3 3FG1A 1PU4A 1JB2A 1W2B2 1ZX2A 4XBYA 5CK6A 2GEXA 1DMMA 1Q40A 4LMIA 2Y73A 1WNHA 2SBLA 5AEUB 4K1UA 1WQLB 1M9GA 1ULIB 2XFTA 1FGOA 5FGOA 1QAKA 1AVKA 3ER7A 1AVLA 1GD4A 2R4IA 5AIGA 2Y74A 1LOXA 3K9MC 4L8PA 1MNLA 4QWTA 4R80A 3DZLA 5KP3A 3FLJA 2OQEA 3LZAA 4NHFA 1IT7A 1KC84 1JB4A 1VQ73 4K90B 1Q824 1IK3A 3UB1A 3LTBA 3PXMA 2XRXB 1U5OA 1RRLA 4XDWA 2CW9A 1Q864 1SJWA 4N6NB 2GBXB 3BB9A 3CCM3 4AKZA 1OGXA 1S5AA 2CIUA 1FGMA 5IG5A 2BHMA 4H3UA 1NJI4 1W01A 3PGBA 4HKVB 2Z77A 1K9M4 2XGNA 3CPW2 3SOAA 1IU7A 3J7Yd 4X2HA 3IJEB 1VQM3 1YGEA 1Y4KA 4HBRA 3H3HA 3V99A 2IMJA 3LYGA 4AEQA 1HKXA 1VQP3 4OVMA 2C11A 3MG2A 4NREA 3WODG 1OHOA 2KRTA 3NQZA 4PEJA 3PS8A 3DXOA 3GZBA 1GY7A 4HZBB 1A90A 2OOVA 1SPUA 5D81A 2F98A 1NU3A 2XFSA 1DMNA 1IQ8A 1Q40B 5KP4A 3VGNA 5LC6A 2ZL8A 3K5TA 1QALA 1O7GB 2PZVA 4ZM8A 2OQEC 2Z76A 3F7SA 3GRDA 3T0UA 4N6TA 3X3ZA 1N9JA 4L8OA 3EX9A 1OHSA 2W56A 3EE1A 3PCSA 1UUVB 4X2OA 1EQKA 4LZIA 4O3VA 1DYUA 2ML6A 2CG0A 2C10A 1OACA 1O7PB 3G16A 1TIJA 3FKAA 3DUKA 3NX0A 5CF2A 1IQXA 3LT8A 3NM2A 2RCDA 5AI1A 3SLUA 3I563 3CPOA 1WMOA 2RFRA 3CCU3 5CF1A 2CHCA 2RGQA 1K734 2E2VA 2W03A 3BLZA 1VQO3 2GEYA 2PNCA 1LVNA 3NBRA 2QEX3 1SQWA 1YVBI 3PCRA 2QIYA 2L4VA 5IG3A 2XEPA 2BMRB 5BVBA 1KQS2 1RN7A 2HMKB 2IUJA 2FGTA 3L0RA 5IENA 2MC8A 1M904 2OOVC 3KZTA 1RRHA 1VZZA 4EC6A 3VF1A 4I4KA 5IG4A 1JN5A 1YI23 1YJ93 3CMA3 1SIIA 3QRDA 1OF5B 1WMNA 3CNXA 3PZWA 2D42A 3N9HA 1O7MB 4JF8A 4N6OB 2CG1A 2LYXA 3CCL3 1O7NB 1CQSA 3GZRA 1K41A 2GXFA 4HM7B 3MKIA 2HMOB 3BNBA 5I97A 1W4NA 3WMDA 3CCR3 2B1XB 1FGQA 2W0QA 3NUVA 3MSOA 3LTAA 4HM4B 1QVG2 2Z6BA 4MJDA 1D6ZA 3B8LA 2BMQB 4BTWA 1JNQA 5DRVA 1VQ43 1E3RA 5CXOA 1ROVA 4XM4A 4HM6B 1TFOA 2CH9A 1VQ63 3OWUA 3WOEB 3UNLA 4J9AA 1EG9B 3CCE3 5CLKA 3SXXA 3CCQ3 1DMQA 3KSED 1D6YA 3G8ZA 1IT8A 1W02A 1IQYA 3T8NA 3AMOA 2WGOA 2ZDJA 3KFQC 1ASKA 1UW1A 3EHCA 5AIIA 3CCJ3 1N9EA 2GU1A 1VQ83 4FR9A 1O7WB 1FGTA 1US1A 3EBYA 3EJVA 1G96A 5IG0A 3KIIA 4XB5A 1S723 3K7CA 3CU3A 1U8CB 3CCV3 3T8UA 3WA3A 1R4CA 3UL6A 4EV2A 2O9UX 3KKGA 4WWUC 1IVUA 3FGYA 4N6UA 2OCTA 1LNHA 1W7CA 3QK9A 4MMYB 1RKYA 2YX9A 3HIGA 3NXJA 3LTCA 3CXC2 2W9QA 1M1K4 2XGLA 1CEWI 3FF2A 5A0OB 4FMBA 5BXQA 1QAFA 3CNMA 2BNGA 2Z7AA 5AIHA 4KZ1A 1DVDA 1TUHA 1JKGA 3G0KA 2W04A 4KFDA 3DGNA 4R9KA 2FNQA 4L7KA 2E2TA 2CFLA 3D3LA 3F8HA 3F9SA 1Q7Y4 4KVHA 3NM7A 3KN4A 2P05A 2M7OA 5AIFA 3G4S3 2B24B 3DGMA 3JUPA 4RNZA 1IV9A 2STDA 2RSXA 2CFDA 3HK4A 1JV2B 3Q1CA 4LSOA 2YFLB 3TDGA 3OV4A 3FG4A 5JPUA 1OUNA 4EXRA 3S27A 3SVAA 4N6LA 3DM8A 3WA2X 1TU5A 1QVF2 2BT3A 3EC9A 3H51A 4HM2B 3DGOA 3AMOB 3FZWA 2W6JH 4HYZA 4IT7A 4WFOA 1QMAA 1L5GB 1ISKA 3STDA 3MG1A 4R1KA 2CFWA 1STDA 1D6UA 1IVXA 4FCZA 3K0ZA 1YJN3 3X3XA 2W2CA 3RGRA 1BUQA 2MF7A 2XSOB 1RJOA 1W2ZA 3U1WA 3X42A 5DREA 1C7HA 1GS3A 5HGRA 4H61A 1KSIA 4N3VA 4CCVA 4RZMA 2P0MA 3D9RA 3JUQA 1TFKA 3N8BA 4JRFA 5AYRB 3RDEA 3B4OA 3UL5A 1E97A 1KWIA 2WGQA 2XSHB 4Q53A 3X3YA 3CME3 3EB8A 3JUMA 1FUWA 2WOHA 3JUOA 3ECFA 4RNYA 3OW22 5G2GA 1JKGB 4WYKA 3NBJA 1YIJ3 2HMJB 2KCDA 2P09A 5EQLA 3HIIA 1TP6A 1UUWB 4R9LA 1MOLA 3OWSA 1N8R4 3CC23 3LOYA 4HM5B 3GWRA 2CKFB 1N5PA 2CFGA 3LT9A 2OTJ3 3S67A 2IUKA 4U13A 4WP5A 1AR0A 4FCMA 2D1WA 2W56B 1GYBA 4MMZB 3WDGB 3BNDA 1FA3A 2FXTA 3F7XA 2P38A 3B4PA 3X41A 1W6GA 4O2HA 3ALAA 3NHXA 1GY5A 2A15A 2I9WA 3JVCA 1YHQ3 4K1VA 4J8TA 3Q90A 3EN1B 3G713 1LXEA 3IMAB 4GL6A 4RBNA 4WHAA 2GU3A 3F40A 3HI7A 4CDLA 3UJMA 5EEOA 5JBSA 2IA7A 3HZPA 4K61A 1CYVA 5ELJA 4BTXA 3FH1A 3NV0A 2OWPA 3GAXA 2CFKA 3JUNA 3EQQB 3MG3A 3LXUX 3I0YA 5LC7A 1W6YA 3IPTA 1A2KA 3BNCA 3G6E3 1JN5B 2LQVA 1SIHA 1Z1SA 3KSPA 4HZ9B 1NB3I 4WYKB 3CC73 5IW9A 4EBGA 1PFPA 4OUQA 4XBTA 4EV5A 4HM8B 5EVHA 1EKMA 1STFI 2F99A 3PYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBX A;  5KP1 A;  2JQ5 A;  1W00 A;  5IEO A;  3F8X A;  5STD A;  5FW5 A;  1NDO B;  1OHP A;  4GB5 A;  3HX8 A;  1OPY A;  2YFJ B;  1OGZ A;  3S5C A;  3M8C A;  4ORL A;  3ROB A;  3RGA A;  3SED A;  1OH0 A;  3OXA A;  3GZY B;  5IEP A;  1OF5 A;  2UX0 A;  1NWW A;  1Q42 A;  3OWY A;  3SOY A;  2QGU A;  1ULJ B;  5D82 A;  3MYT A;  5TGN A;  3FF0 A;  1O7H B;  1QJG A;  1ZO2 A;  8CHO A;  5JPP A;  3VSY A;  2HML B;  3NV0 B;  2GBW B;  5IER A;  6STD A;  1OCV A;  1IDP A;  5IF6 A;  4HM0 B;  2INX A;  3E99 A;  5AEW B;  2YFI B;  5D83 A;  4XDV A;  4HVN A;  2XR8 B;  1GY6 A;  3DMC A;  4LGQ A;  3EBT A;  2F86 B;  1E3V A;  3GZX B;  3FSD A;  3A76 A;  2HMN B;  4FCJ A;  4LEH A;  3B7C A;  4HJL B;  2K54 A;  3OX9 A;  3KE7 A;  3F14 A;  4IIA A;  3EF8 A;  4STD A;  1EA2 A;  4HM1 B;  4HM3 B;  7STD A;  3MHE A;  2HMM B;  2BMO B;  1JB5 A;  3EN8 A;  1JB2 A;  1ZX2 A;  4XBY A;  5CK6 A;  2GEX A;  1DMM A;  1Q40 A;  4LMI A;  5AEU B;  4K1U A;  1WQL B;  1ULI B;  3ER7 A;  2R4I A;  5AIG A;  4L8P A;  5KP3 A;  3DZL A;  3FLJ A;  3LZA A;  1JB4 A;  2XRX B;  1U5O A;  4XDW A;  1SJW A;  2GBX B;  3BB9 A;  1OGX A;  1S5A A;  5IG5 A;  4H3U A;  1W01 A;  4HKV B;  2Z77 A;  3SOA A;  4X2H A;  3H3H A;  2IMJ A;  3LYG A;  1HKX A;  4OVM A;  3MG2 A;  1OHO A;  4PEJ A;  3DXO A;  3GZB A;  1GY7 A;  4HZB B;  5D81 A;  2F98 A;  1NU3 A;  1DMN A;  1Q40 B;  5KP4 A;  3VGN A;  1O7G B;  2PZV A;  3GRD A;  2Z76 A;  3F7S A;  4L8O A;  3EX9 A;  1OHS A;  1UUV B;  4X2O A;  1O7P B;  3G16 A;  3FKA A;  3DUK A;  5CF2 A;  3NM2 A;  2RCD A;  5AI1 A;  3CPO A;  2RFR A;  5CF1 A;  2CHC A;  2RGQ A;  3BLZ A;  2GEY A;  3NBR A;  2QIY A;  5IG3 A;  2BMR B;  5BVB A;  2HMK B;  5IEN A;  3KZT A;  1VZZ A;  4I4K A;  5IG4 A;  1JN5 A;  1OF5 B;  3CNX A;  1O7M B;  1O7N B;  1CQS A;  3GZR A;  1K41 A;  2GXF A;  4HM7 B;  3MKI A;  2HMO B;  3WMD A;  2B1X B;  3NUV A;  3MSO A;  4HM4 B;  4MJD A;  3B8L A;  2BMQ B;  5DRV A;  1E3R A;  5CXO A;  4XM4 A;  4HM6 B;  3OWU A;  3UNL A;  4J9A A;  1EG9 B;  5CLK A;  1DMQ A;  3G8Z A;  1W02 A;  3T8N A;  1ASK A;  3EHC A;  5AII A;  1O7W B;  3EJV A;  3EBY A;  5IG0 A;  4XB5 A;  3K7C A;  3CU3 A;  3T8U A;  3KKG A;  4WWU C;  3FGY A;  3NXJ A;  3FF2 A;  5BXQ A;  3CNM A;  2BNG A;  2Z7A A;  5AIH A;  1TUH A;  1JKG A;  3G0K A;  4R9K A;  4L7K A;  3F8H A;  3F9S A;  4KVH A;  5AIF A;  2B24 B;  3JUP A;  2STD A;  3HK4 A;  2YFL B;  3OV4 A;  5JPU A;  1OUN A;  3DM8 A;  3EC9 A;  3H51 A;  4HM2 B;  3FZW A;  1QMA A;  1ISK A;  3STD A;  3MG1 A;  4R1K A;  1STD A;  3K0Z A;  2W2C A;  3RGR A;  1BUQ A;  2XSO B;  5DRE A;  1C7H A;  1GS3 A;  5HGR A;  4N3V A;  4RZM A;  3D9R A;  3JUQ A;  3B4O A;  1E97 A;  2XSH B;  4Q53 A;  3JUM A;  3JUO A;  3ECF A;  5G2G A;  1JKG B;  4WYK A;  2HMJ B;  1TP6 A;  1UUW B;  4R9L A;  3OWS A;  4HM5 B;  3GWR A;  2CKF B;  4U13 A;  4WP5 A;  1AR0 A;  4FCM A;  1GYB A;  3F7X A;  3B4P A;  3NHX A;  1GY5 A;  2A15 A;  2I9W A;  4K1V A;  4J8T A;  3Q90 A;  3EN1 B;  3F40 A;  4CDL A;  3UJM A;  3HZP A;  3FH1 A;  3NV0 A;  2OWP A;  3JUN A;  3EQQ B;  3MG3 A;  3I0Y A;  1W6Y A;  3IPT A;  1A2K A;  1JN5 B;  1Z1S A;  3KSP A;  4HZ9 B;  4WYK B;  4OUQ A;  4XBT A;  4HM8 B;  5EVH A;  2F99 A; 
#chains in the Genus database with same CATH topology
 4XBX A;  1BSB A;  5KP1 A;  3I55 3;  1GMR A;  4OK0 A;  2JQ5 A;  1T5Y A;  1VQN 3;  2WOF A;  2BU4 A;  1I0V A;  1I2G A;  1YJW 3;  1W00 A;  1LOV A;  3RNT A;  1J2B A;  5IEO A;  1N5H A;  2CWV A;  1A67 A;  2R41 A;  2W9P A;  3U97 A;  8RNT A;  3F8X A;  5STD A;  1GD3 A;  1NDO B;  5FW5 A;  1G02 A;  1OHP A;  1I0X A;  3HX8 A;  4GB5 A;  1V74 A;  1OPY A;  2YFJ B;  1C54 A;  1RGA A;  3V98 A;  1MGW A;  1OGZ A;  3S5C A;  3X40 A;  3M8C A;  4HOH A;  4ORL A;  3RGA A;  3N54 B;  3ROB A;  3SED A;  1AV4 A;  1OH0 A;  2P0X A;  3NBB A;  1FUS A;  4AKY A;  3OXA A;  3GZY B;  5IEP A;  1UCI A;  1HU9 A;  1FGR A;  1OF5 A;  4CJN A;  2UX0 A;  1NWW A;  1Q42 A;  3OWY A;  3SOY A;  2QGU A;  4FMA A;  1ULJ B;  2AAE A;  4MMX B;  1EUI C;  5D82 A;  3MYT A;  5TGN A;  2QA4 3;  2O3O A;  4R4K A;  3FF0 A;  1NNV A;  1O7H B;  1QJG A;  1ROA A;  3CC4 3;  1JRQ A;  1Q81 4;  1ZO2 A;  8CHO A;  5JPP A;  3VSY A;  2HML B;  3O8Y A;  2HOH A;  2V1L A;  3MPH A;  2GBW B;  3NV0 B;  5IER A;  6STD A;  1VQ5 3;  1W6C A;  2CK3 H;  3ZFZ A;  1OCV A;  3LML A;  1KD1 4;  1F8N A;  1WMP A;  1IDP A;  1VQL 3;  2JDI H;  1UCL A;  1BSE A;  2GSP A;  3LH4 A;  3FCS B;  1WTH A;  4HM0 B;  3NQY A;  5IF6 A;  1UI7 A;  4IPB A;  2INX A;  3E99 A;  1IV7 A;  1RGL A;  4N6V 0;  3WR2 A;  3ZG5 A;  5AEW B;  4J5K A;  1CYU A;  1N8Q A;  2YFI B;  1K8A 4;  5D83 A;  3V92 A;  4XDV A;  4HVN A;  4TX4 A;  1T2I A;  2XR8 B;  5AYS C;  1GY6 A;  2F5W A;  3DMC A;  2CWT A;  4BTY A;  4LGQ A;  3D4A A;  3AHS A;  1VQ9 3;  1B2U A;  5ELU A;  3EBT A;  4MEI A;  1YIT 3;  3LTD A;  3DGL A;  2F86 B;  4EYC A;  1E3V A;  1W5Z A;  3GZX B;  1DVC A;  1K28 A;  1NO3 A;  1X1Y A;  1RMS A;  2E2U A;  2ML5 A;  3FSD A;  3MWZ A;  2WO0 A;  1RHL A;  3A76 A;  3CD6 3;  3FG3 A;  3WOF B;  2KXG A;  4G1M B;  1A2V A;  2HMN B;  1JBR A;  3K63 A;  1BRK A;  3HOH A;  1IVW A;  2XF3 A;  1JJ2 2;  1I3I A;  2CWU A;  4FCJ A;  2XH9 A;  4LEH A;  3B7C A;  1V57 A;  4O02 B;  1IVV A;  4HJL B;  1M1X B;  2CC3 A;  2AAD A;  2K54 A;  1UI8 A;  3OX9 A;  4N6M A;  3SX1 A;  1BAO A;  3KE7 A;  1VQK 3;  3F14 A;  4IIA A;  3DY5 A;  3S29 A;  3EF8 A;  4FMC A;  7GSP A;  4KFF A;  3BNE A;  4FMD A;  3S28 A;  2Q07 A;  4STD A;  1HYF A;  2KAA A;  2BO9 B;  1EA2 A;  4HM1 B;  4HM3 B;  7STD A;  3MHE A;  2HMM B;  2K0M A;  2BMO B;  4O8S A;  1FUT A;  1JB5 A;  1RGC A;  2OTL 3;  3EN8 A;  4KFE A;  6GSP A;  3Q2P A;  1PY3 A;  3CCS 3;  3FG1 A;  1PU4 A;  1JB2 A;  2ZHX B;  1W2B 2;  1ZX2 A;  4XBY A;  1HZ1 A;  1GOV A;  5CK6 A;  2GEX A;  1DMM A;  1Q40 A;  1LQG C;  2Y73 A;  1WNH A;  4LMI A;  2SBL A;  1LQM B;  5AEU B;  4K1U A;  1WQL B;  2UGI A;  1M9G A;  1ULI B;  2L1S A;  2XFT A;  1VQQ A;  4ILF A;  2ZA4 A;  1FGO A;  5FGO A;  1QAK A;  1AVK A;  3ER7 A;  1AVL A;  1GD4 A;  2R4I A;  1BNG A;  5AIG A;  1BRN L;  2Y74 A;  1LOX A;  3K9M C;  4L8P A;  1MNL A;  1T3B A;  4QWT A;  4R80 A;  3DZL A;  5KP3 A;  1BNR A;  3FLJ A;  2OQE A;  1BUJ A;  3LZA A;  4NHF A;  2RBI A;  1IT7 A;  1KC8 4;  1JB4 A;  1VQ7 3;  4K90 B;  1Q82 4;  1IK3 A;  3UB1 A;  3LTB A;  3PXM A;  2XRX B;  1U5O A;  1RRL A;  4XDW A;  2CW9 A;  1Q86 4;  1SJW A;  5GSP A;  4N6N B;  2GBX B;  3BB9 A;  3CCM 3;  4AKZ A;  1OGX A;  1S5A A;  2CIU A;  1FGM A;  5IG5 A;  2BHM A;  4H3U A;  1SAR A;  1NJI 4;  1W01 A;  3PGB A;  4HKV B;  5M19 A;  2Z77 A;  1DET A;  1TTO A;  2XGN A;  5M1A A;  1S72 3;  1K9M 4;  1CH0 A;  4I5Q A;  3CPW 2;  3SOA A;  1YNV X;  3D79 A;  1RGH A;  1BNS A;  1IU7 A;  3J7Y d;  4X2H A;  3IJE B;  1VQM 3;  1YGE A;  1Y4K A;  4HBR A;  3H3H A;  3V99 A;  2IMJ A;  1FW7 A;  3LYG A;  4AEQ A;  1HKX A;  1VQP 3;  4OVM A;  2C11 A;  3MG2 A;  4NRE A;  3WOD G;  1OHO A;  2KRT A;  3NQZ A;  4PEJ A;  3PS8 A;  3DXO A;  2SAR A;  3GZB A;  2F56 A;  1GY7 A;  4HZB B;  1A90 A;  2OOV A;  1SPU A;  9RNT A;  1LOY A;  5D81 A;  2F98 A;  1BRG A;  2KF4 A;  1NU3 A;  1X1X A;  2XFS A;  1DMN A;  1IQ8 A;  1Q40 B;  5KP4 A;  2KF5 A;  3D5G A;  4J5G A;  1MGR A;  4LYL B;  5LC6 A;  3VGN A;  2ZL8 A;  3K5T A;  1QAL A;  1O7G B;  2PZV A;  4ZM8 A;  2OQE C;  2Z76 A;  3F7S A;  3GRD A;  3T0U A;  4N6T A;  3X3Z A;  1N9J A;  4L8O A;  3EX9 A;  1OHS A;  2W56 A;  3EE1 A;  3PCS A;  1RGG A;  1UUV B;  4X2O A;  4EW5 A;  1EQK A;  4LZI A;  4O3V A;  1DYU A;  1TJD A;  5RNT A;  1RGK A;  2ML6 A;  2CG0 A;  2C10 A;  2CX1 A;  1OAC A;  1O7P B;  3G16 A;  1TIJ A;  3FKA A;  3DUK A;  3NX0 A;  5CF2 A;  1IQX A;  3LT8 A;  3NM2 A;  2RCD A;  5AI1 A;  3SLU A;  5G1K A;  4RNT A;  3CPO A;  3I56 3;  1RN4 A;  1WMO A;  2RFR A;  3WHO A;  1B21 A;  1I2E A;  3CCU 3;  5CF1 A;  2CHC A;  1BRS A;  2RGQ A;  1BNF A;  1K73 4;  2E2V A;  2IYJ A;  2W03 A;  3BLZ A;  4KT3 B;  2GEY A;  1VQO 3;  5HOH A;  2PNC A;  7RNT A;  1LVN A;  3NBR A;  1UDI I;  1SQW A;  3A5E A;  1YVB I;  2QEX 3;  3PCR A;  2QIY A;  2L4V A;  3AGN A;  5IG3 A;  2XEP A;  2BMR B;  5BVB A;  1LNI A;  1KQS 2;  1RN7 A;  2HMK B;  1I8V A;  2FGT A;  3L0R A;  1BRI A;  1GMP A;  2MC8 A;  2IUJ A;  2OOV C;  3AHW A;  5IEN A;  1M90 4;  3KZT A;  1RRH A;  1VZZ A;  4EC6 A;  3VF1 A;  1B2Z A;  4I4K A;  5IG4 A;  1JN5 A;  1T2H A;  1LRA A;  1YI2 3;  1YJ9 3;  3CMA 3;  1SII A;  3QRD A;  1OF5 B;  1WMN A;  3CNX A;  1RCK A;  3PZW A;  2D42 A;  3SYU A;  3N9H A;  1O7M B;  2F5M A;  4JF8 A;  4N6O B;  2CG1 A;  2LYX A;  3CCL 3;  1O7N B;  2CX0 A;  1CQS A;  3GZR A;  1K41 A;  2GXF A;  4HM7 B;  3MKI A;  2HMO B;  3BNB A;  5I97 A;  1W4N A;  1TRQ A;  1X1W A;  3WMD A;  4BIR A;  1AQZ A;  3CCR 3;  2B1X B;  1RTU A;  1FGQ A;  2W0Q A;  3NUV A;  3MSO A;  3LTA A;  4HM4 B;  1QVG 2;  1B3S A;  2Z6B A;  4MJD A;  1BSD A;  1D6Z A;  3B8L A;  2BMQ B;  4BTW A;  1JNQ A;  5DRV A;  5BU4 A;  2IY2 A;  1RSN A;  4BL3 A;  1VQ4 3;  1E3R A;  5CXO A;  1ROV A;  4XM4 A;  4HM6 B;  1TFO A;  2H0G A;  2CH9 A;  1ZGX A;  3OWU A;  1VQ6 3;  3WOE B;  3UNL A;  4J9A A;  1EG9 B;  2C4B A;  1Q9E A;  3CCE 3;  1BGS A;  5CLK A;  5G1L A;  3SXX A;  3CCQ 3;  1DMQ A;  3KSE D;  1D6Y A;  3G8Z A;  1IT8 A;  1JZO A;  1RNT A;  1I2F A;  1IQY A;  1W02 A;  1I70 A;  3AMO A;  1JZD A;  2WGO A;  2ZDJ A;  3KFQ C;  3T8N A;  1ASK A;  1UW1 A;  3EHC A;  1YVS A;  5AII A;  3CCJ 3;  1N9E A;  2GU1 A;  1VQ8 3;  4FR9 A;  1O7W B;  5BIR A;  1BAN A;  1FGT A;  1US1 A;  3EBY A;  1G96 A;  3EJV A;  3KII A;  4XB5 A;  5IG0 A;  3K7C A;  3CU3 A;  1U8C B;  3CCV 3;  4NPB A;  3T8U A;  3WA3 A;  1R4C A;  3UL6 A;  4EV2 A;  1A2P A;  2O9U X;  3KKG A;  4WWU C;  1IVU A;  3FGY A;  4N6U A;  1BIR A;  1LNH A;  1W7C A;  2OCT A;  3QK9 A;  4MMY B;  1RKY A;  1TRP A;  2YX9 A;  3HIG A;  3NXJ A;  3LTC A;  3CXC 2;  2W9Q A;  1M1K 4;  1RLS A;  2XGL A;  1CEW I;  1B2S A;  3FF2 A;  1BNE A;  5A0O B;  4FMB A;  5BXQ A;  1QAF A;  3CNM A;  3KCH A;  2BNG A;  2Z7A A;  5AIH A;  4KZ1 A;  1DVD A;  1TUH A;  1JKG A;  3G0K A;  2W04 A;  4KFD A;  3DGN A;  4R9K A;  2FNQ A;  4L7K A;  2E2T A;  2CFL A;  3D3L A;  3F8H A;  1X1U A;  3F9S A;  1Q7Y 4;  4KVH A;  1BU4 A;  3NM7 A;  3KN4 A;  2P05 A;  2M7O A;  2RNT A;  5AIF A;  4BU4 A;  3G4S 3;  2B24 B;  3DGM A;  3GSP A;  3JUP A;  4RNZ A;  1IV9 A;  1RDS A;  2STD A;  2RSX A;  2CFD A;  3HK4 A;  1JV2 B;  3Q1C A;  4LSO A;  2YFL B;  1NB5 I;  3TDG A;  1RGE A;  3OV4 A;  1MWS A;  3FG4 A;  5JPU A;  1OUN A;  4EXR A;  3S27 A;  1UCJ A;  1RN1 A;  3SVA A;  4N6L A;  3DM8 A;  3WA2 X;  1TU5 A;  1QVF 2;  2BT3 A;  2K3D A;  1RNB A;  1MWR A;  3EC9 A;  3H51 A;  4HM2 B;  3DGO A;  3AMO B;  3FZW A;  2W6J H;  2F4Y A;  1YGW A;  2KF3 A;  1QMA A;  4HYZ A;  2H0H A;  4IT7 A;  4WFO A;  1L5G B;  1ISK A;  3STD A;  3MG1 A;  4R1K A;  1JBS A;  2CFW A;  1V58 A;  1STD A;  1D6U A;  1IVX A;  4FCZ A;  1B2X A;  3K0Z A;  1R4Y A;  1YJN 3;  1GMQ A;  3X3X A;  1BNJ A;  2W2C A;  1RCL A;  3RGR A;  6RNT A;  1BUQ A;  1BRJ A;  2MF7 A;  2XSO B;  1RJO A;  1W2Z A;  1PYL A;  1B20 A;  3U1W A;  3X42 A;  5DRE A;  1C7H A;  1GS3 A;  5HGR A;  4HAA A;  4H61 A;  1KSI A;  1LOW A;  4N3V A;  4CCV A;  4RZM A;  2P0M A;  3D9R A;  1G0T A;  1TFK A;  3JUQ A;  3N8B A;  4JRF A;  1JBT A;  1DE3 A;  5AYR B;  3RDE A;  3B4O A;  3UL5 A;  1E97 A;  1GSP A;  1KWI A;  2WGQ A;  2XSH B;  1FZU A;  4Q53 A;  3X3Y A;  3CME 3;  3EB8 A;  3JUM A;  3D5I A;  1FUW A;  1RGF A;  1MWU A;  2WOH A;  3JUO A;  1UGH I;  1UCK A;  3ECF A;  4RNY A;  1BRH A;  3OW2 2;  5G2G A;  1JKG B;  4WYK A;  3NBJ A;  1YIJ 3;  3Q3F A;  2HMJ B;  2KCD A;  2P09 A;  5EQL A;  3HII A;  1TP6 A;  1UUW B;  3URP A;  1IYY A;  4R9L A;  4BL2 A;  1MOL A;  2BIR A;  3OWS A;  1N8R 4;  3BU4 A;  3CC2 3;  3LOY A;  4HM5 B;  2H0I A;  3GWR A;  1BSC A;  2CKF B;  1N5P A;  2CFG A;  1EEJ A;  3LT9 A;  1BOX A;  2OTJ 3;  3S67 A;  2IUK A;  4U13 A;  4WP5 A;  1AR0 A;  4FCM A;  2D1W A;  1B2M A;  2W56 B;  3AGO A;  1GYB A;  1UGI A;  4MMZ B;  3WDG B;  3BND A;  1FA3 A;  1B27 A;  2FXT A;  2UUG C;  3F7X A;  2P38 A;  3B4P A;  3X41 A;  1W6G A;  4O2H A;  4GSP A;  3ALA A;  3NHX A;  1GY5 A;  2A15 A;  2I9W A;  3JVC A;  1YHQ 3;  3BIR A;  4K1V A;  1BNI A;  4J8T A;  3Q90 A;  3EN1 B;  3G71 3;  1I3F A;  1LXE A;  3IMA B;  1FYS A;  4GL6 A;  4RBN A;  4WHA A;  2GU3 A;  3F40 A;  3HI7 A;  4CDL A;  3UJM A;  5EEO A;  5M18 A;  5JBS A;  2IA7 A;  3HZP A;  4K61 A;  4DKI A;  1ZS7 A;  1CYV A;  5ELJ A;  4BTX A;  1AY7 A;  2KF6 A;  3FH1 A;  3NV0 A;  1Q7H A;  2OWP A;  2CFK A;  3GAX A;  1BSA A;  3JUN A;  3EQQ B;  1UUG B;  3MG3 A;  3LXU X;  3DGY A;  3ZG0 A;  3I0Y A;  5LC7 A;  1W6Y A;  3IPT A;  3DH2 A;  1A2K A;  3BNC A;  3G6E 3;  1JN5 B;  2LQV A;  1SIH A;  1Z1S A;  3KSP A;  4HZ9 B;  1NB3 I;  4WYK B;  3CC7 3;  1GOU A;  5IW9 A;  4CPK A;  4EBG A;  1BVI A;  1GOY A;  1PFP A;  4OUQ A;  1MWT A;  2J8X B;  4XBT A;  4EV5 A;  4HM8 B;  5EVH A;  4GHO A;  1EKM A;  1STF I;  2F99 A;  3PYJ A; 
#chains in the Genus database with same CATH homology
 4XBX A;  3I55 3;  5KP1 A;  4OK0 A;  2JQ5 A;  1T5Y A;  1VQN 3;  2WOF A;  1YJW 3;  1W00 A;  1J2B A;  5IEO A;  1N5H A;  2CWV A;  1A67 A;  2W9P A;  3U97 A;  3F8X A;  5STD A;  1GD3 A;  1NDO B;  5FW5 A;  1OHP A;  4GB5 A;  3HX8 A;  1V74 A;  1OPY A;  2YFJ B;  3V98 A;  1OGZ A;  3S5C A;  3X40 A;  3M8C A;  4ORL A;  3ROB A;  3RGA A;  3N54 B;  3SED A;  1AV4 A;  1OH0 A;  2P0X A;  3NBB A;  4AKY A;  3OXA A;  3GZY B;  5IEP A;  1HU9 A;  1FGR A;  1OF5 A;  2UX0 A;  1NWW A;  1Q42 A;  3OWY A;  3SOY A;  2QGU A;  4FMA A;  1ULJ B;  4MMX B;  5D82 A;  3MYT A;  5TGN A;  2QA4 3;  2O3O A;  4R4K A;  3FF0 A;  1O7H B;  1ROA A;  1QJG A;  3CC4 3;  1JRQ A;  1Q81 4;  1ZO2 A;  8CHO A;  5JPP A;  3VSY A;  2HML B;  3O8Y A;  2V1L A;  3MPH A;  3NV0 B;  2GBW B;  5IER A;  1VQ5 3;  6STD A;  1W6C A;  2CK3 H;  1OCV A;  3LML A;  1KD1 4;  1F8N A;  1WMP A;  1IDP A;  1VQL 3;  2JDI H;  5IF6 A;  3LH4 A;  4HM0 B;  3FCS B;  1WTH A;  1NB5 I;  3NQY A;  1UI7 A;  4IPB A;  2INX A;  3E99 A;  1IV7 A;  4N6V 0;  5AEW B;  1CYU A;  1N8Q A;  2YFI B;  1K8A 4;  5D83 A;  3V92 A;  4XDV A;  4HVN A;  4TX4 A;  2XR8 B;  5AYS C;  1GY6 A;  3DMC A;  2CWT A;  4BTY A;  4LGQ A;  1VQ9 3;  5ELU A;  3EBT A;  4MEI A;  1YIT 3;  3LTD A;  3DGL A;  2F86 B;  4EYC A;  1E3V A;  1W5Z A;  3GZX B;  1DVC A;  1K28 A;  1NO3 A;  2ML5 A;  3MWZ A;  2E2U A;  3FSD A;  2WO0 A;  3A76 A;  3CD6 3;  3FG3 A;  3WOF B;  2KXG A;  4G1M B;  1A2V A;  2HMN B;  3K63 A;  1JJ2 2;  1IVW A;  2XF3 A;  2CWU A;  4FCJ A;  2XH9 A;  4LEH A;  3B7C A;  4O02 B;  1IVV A;  4HJL B;  1M1X B;  2CC3 A;  2K54 A;  1UI8 A;  3OX9 A;  4N6M A;  3SX1 A;  3KE7 A;  1VQK 3;  3F14 A;  4IIA A;  3DY5 A;  3S29 A;  3EF8 A;  4FMC A;  4KFF A;  3BNE A;  4FMD A;  3S28 A;  2Q07 A;  4STD A;  2BO9 B;  1EA2 A;  4HM1 B;  4HM3 B;  7STD A;  3MHE A;  2HMM B;  2K0M A;  2BMO B;  4O8S A;  1JB5 A;  2OTL 3;  3EN8 A;  4KFE A;  3Q2P A;  3CCS 3;  3FG1 A;  1PU4 A;  1JB2 A;  1W2B 2;  1ZX2 A;  4XBY A;  5CK6 A;  2GEX A;  1DMM A;  1Q40 A;  4LMI A;  2Y73 A;  1WNH A;  2SBL A;  5AEU B;  4K1U A;  1WQL B;  1M9G A;  1ULI B;  2XFT A;  1FGO A;  5FGO A;  1QAK A;  1AVK A;  3ER7 A;  1AVL A;  1GD4 A;  2R4I A;  5AIG A;  2Y74 A;  1LOX A;  3K9M C;  4L8P A;  1MNL A;  4QWT A;  4R80 A;  3DZL A;  5KP3 A;  3FLJ A;  2OQE A;  3LZA A;  4NHF A;  1IT7 A;  1KC8 4;  1JB4 A;  1VQ7 3;  4K90 B;  1Q82 4;  1IK3 A;  3UB1 A;  3LTB A;  3PXM A;  2XRX B;  1U5O A;  1RRL A;  4XDW A;  2CW9 A;  1Q86 4;  1SJW A;  4N6N B;  2GBX B;  3BB9 A;  3CCM 3;  4AKZ A;  1OGX A;  1S5A A;  2CIU A;  1FGM A;  5IG5 A;  2BHM A;  4H3U A;  1NJI 4;  1W01 A;  3PGB A;  4HKV B;  2Z77 A;  1K9M 4;  2XGN A;  3CPW 2;  3SOA A;  1IU7 A;  3J7Y d;  4X2H A;  3IJE B;  1VQM 3;  1YGE A;  1Y4K A;  4HBR A;  3H3H A;  3V99 A;  2IMJ A;  3LYG A;  4AEQ A;  1HKX A;  1VQP 3;  4OVM A;  2C11 A;  3MG2 A;  4NRE A;  3WOD G;  1OHO A;  2KRT A;  3NQZ A;  4PEJ A;  3PS8 A;  3DXO A;  3GZB A;  1GY7 A;  4HZB B;  1A90 A;  2OOV A;  1SPU A;  5D81 A;  2F98 A;  1NU3 A;  2XFS A;  1DMN A;  1IQ8 A;  1Q40 B;  5KP4 A;  3VGN A;  5LC6 A;  2ZL8 A;  3K5T A;  1QAL A;  1O7G B;  2PZV A;  4ZM8 A;  2OQE C;  2Z76 A;  3F7S A;  3GRD A;  3T0U A;  4N6T A;  3X3Z A;  1N9J A;  4L8O A;  3EX9 A;  1OHS A;  2W56 A;  3EE1 A;  3PCS A;  1UUV B;  4X2O A;  1EQK A;  4LZI A;  4O3V A;  1DYU A;  2ML6 A;  2CG0 A;  2C10 A;  1OAC A;  1O7P B;  3G16 A;  1TIJ A;  3FKA A;  3DUK A;  3NX0 A;  5CF2 A;  1IQX A;  3LT8 A;  3NM2 A;  2RCD A;  5AI1 A;  3SLU A;  3I56 3;  3CPO A;  1WMO A;  2RFR A;  3CCU 3;  5CF1 A;  2CHC A;  2RGQ A;  1K73 4;  2E2V A;  2W03 A;  3BLZ A;  1VQO 3;  2GEY A;  2PNC A;  1LVN A;  3NBR A;  2QEX 3;  1SQW A;  1YVB I;  3PCR A;  2QIY A;  2L4V A;  5IG3 A;  2XEP A;  2BMR B;  5BVB A;  1KQS 2;  1RN7 A;  2HMK B;  2IUJ A;  2FGT A;  3L0R A;  5IEN A;  2MC8 A;  1M90 4;  2OOV C;  3KZT A;  1RRH A;  1VZZ A;  4EC6 A;  3VF1 A;  4I4K A;  5IG4 A;  1JN5 A;  1YI2 3;  1YJ9 3;  3CMA 3;  1SII A;  3QRD A;  1OF5 B;  1WMN A;  3CNX A;  3PZW A;  2D42 A;  3N9H A;  1O7M B;  4JF8 A;  4N6O B;  2CG1 A;  2LYX A;  3CCL 3;  1O7N B;  1CQS A;  3GZR A;  1K41 A;  2GXF A;  4HM7 B;  3MKI A;  2HMO B;  3BNB A;  5I97 A;  1W4N A;  3WMD A;  3CCR 3;  2B1X B;  1FGQ A;  2W0Q A;  3NUV A;  3MSO A;  3LTA A;  4HM4 B;  1QVG 2;  2Z6B A;  4MJD A;  1D6Z A;  3B8L A;  2BMQ B;  4BTW A;  1JNQ A;  5DRV A;  1VQ4 3;  1E3R A;  5CXO A;  1ROV A;  4XM4 A;  4HM6 B;  1TFO A;  2CH9 A;  1VQ6 3;  3OWU A;  3WOE B;  3UNL A;  4J9A A;  1EG9 B;  3CCE 3;  5CLK A;  3SXX A;  3CCQ 3;  1DMQ A;  3KSE D;  1D6Y A;  3G8Z A;  1IT8 A;  1W02 A;  1IQY A;  3T8N A;  3AMO A;  2WGO A;  2ZDJ A;  3KFQ C;  1ASK A;  1UW1 A;  3EHC A;  5AII A;  3CCJ 3;  1N9E A;  2GU1 A;  1VQ8 3;  4FR9 A;  1O7W B;  1FGT A;  1US1 A;  3EBY A;  3EJV A;  1G96 A;  5IG0 A;  3KII A;  4XB5 A;  1S72 3;  3K7C A;  3CU3 A;  1U8C B;  3CCV 3;  3T8U A;  3WA3 A;  1R4C A;  3UL6 A;  4EV2 A;  2O9U X;  3KKG A;  4WWU C;  1IVU A;  3FGY A;  4N6U A;  2OCT A;  1LNH A;  1W7C A;  3QK9 A;  4MMY B;  1RKY A;  2YX9 A;  3HIG A;  3NXJ A;  3LTC A;  3CXC 2;  2W9Q A;  1M1K 4;  2XGL A;  1CEW I;  3FF2 A;  5A0O B;  4FMB A;  5BXQ A;  1QAF A;  3CNM A;  2BNG A;  2Z7A A;  5AIH A;  4KZ1 A;  1DVD A;  1TUH A;  1JKG A;  3G0K A;  2W04 A;  4KFD A;  3DGN A;  4R9K A;  2FNQ A;  4L7K A;  2E2T A;  2CFL A;  3D3L A;  3F8H A;  3F9S A;  1Q7Y 4;  4KVH A;  3NM7 A;  3KN4 A;  2P05 A;  2M7O A;  5AIF A;  3G4S 3;  2B24 B;  3DGM A;  3JUP A;  4RNZ A;  1IV9 A;  2STD A;  2RSX A;  2CFD A;  3HK4 A;  1JV2 B;  3Q1C A;  4LSO A;  2YFL B;  3TDG A;  3OV4 A;  3FG4 A;  5JPU A;  1OUN A;  4EXR A;  3S27 A;  3SVA A;  4N6L A;  3DM8 A;  3WA2 X;  1TU5 A;  1QVF 2;  2BT3 A;  3EC9 A;  3H51 A;  4HM2 B;  3DGO A;  3AMO B;  3FZW A;  2W6J H;  4HYZ A;  4IT7 A;  4WFO A;  1QMA A;  1L5G B;  1ISK A;  3STD A;  3MG1 A;  4R1K A;  2CFW A;  1STD A;  1D6U A;  1IVX A;  4FCZ A;  3K0Z A;  1YJN 3;  3X3X A;  2W2C A;  3RGR A;  1BUQ A;  2MF7 A;  2XSO B;  1RJO A;  1W2Z A;  3U1W A;  3X42 A;  5DRE A;  1C7H A;  1GS3 A;  5HGR A;  4H61 A;  1KSI A;  4N3V A;  4CCV A;  4RZM A;  2P0M A;  3D9R A;  3JUQ A;  1TFK A;  3N8B A;  4JRF A;  5AYR B;  3RDE A;  3B4O A;  3UL5 A;  1E97 A;  1KWI A;  2WGQ A;  2XSH B;  4Q53 A;  3X3Y A;  3CME 3;  3EB8 A;  3JUM A;  1FUW A;  2WOH A;  3JUO A;  3ECF A;  4RNY A;  3OW2 2;  5G2G A;  1JKG B;  4WYK A;  3NBJ A;  1YIJ 3;  2HMJ B;  2KCD A;  2P09 A;  5EQL A;  3HII A;  1TP6 A;  1UUW B;  4R9L A;  1MOL A;  3OWS A;  1N8R 4;  3CC2 3;  3LOY A;  4HM5 B;  3GWR A;  2CKF B;  1N5P A;  2CFG A;  3LT9 A;  2OTJ 3;  3S67 A;  2IUK A;  4U13 A;  4WP5 A;  1AR0 A;  4FCM A;  2D1W A;  2W56 B;  1GYB A;  4MMZ B;  3WDG B;  3BND A;  1FA3 A;  2FXT A;  3F7X A;  2P38 A;  3B4P A;  3X41 A;  1W6G A;  4O2H A;  3ALA A;  3NHX A;  1GY5 A;  2A15 A;  2I9W A;  3JVC A;  1YHQ 3;  4K1V A;  4J8T A;  3Q90 A;  3EN1 B;  3G71 3;  1LXE A;  3IMA B;  4GL6 A;  4RBN A;  4WHA A;  2GU3 A;  3F40 A;  3HI7 A;  4CDL A;  3UJM A;  5EEO A;  5JBS A;  2IA7 A;  3HZP A;  4K61 A;  1CYV A;  5ELJ A;  4BTX A;  3FH1 A;  3NV0 A;  2OWP A;  3GAX A;  2CFK A;  3JUN A;  3EQQ B;  3MG3 A;  3LXU X;  3I0Y A;  5LC7 A;  1W6Y A;  3IPT A;  1A2K A;  3BNC A;  3G6E 3;  1JN5 B;  2LQV A;  1SIH A;  1Z1S A;  3KSP A;  4HZ9 B;  1NB3 I;  4WYK B;  3CC7 3;  5IW9 A;  4EBG A;  1PFP A;  4OUQ A;  4XBT A;  4EV5 A;  4HM8 B;  5EVH A;  1EKM A;  1STF I;  2F99 A;  3PYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...