1GY6A

Ntf2 from rat, ammonium sulphate conditions
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
DKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title Structural Basis for the Interaction between Ntf2 and Nucleoporin Fxfg Repeats
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Nuclear transport
total genus 35
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gy6A00
2Z77A 3ECFA 2Z7AA 2BMOB 1OCVA 3KSPA 2BMQB 1EG9B 5IEPA 2RFRA 5IERA 3FF2A 3SOYA 4HJLB 1O7NB 2W2CA 3EN1B 3DZLA 5AIHA 2HMJB 3EBYA 3NXJA 3OXAA 4N3VA 2YFJB 1OGZA 1GY5A 5IG4A 3MHEA 1JN5A 4L7KA 3ER7A 3NBRA 2PZVA 2R4IA 2HMLB 4HZBB 4R1KA 2F98A 1ULJB 2GBWB 3B4PA 4J8TA 4XB5A 1W6YA 4XDVA 4XBYA 3A76A 1OHOA 2A15A 4WYKA 3GZRA 1E97A 3OWUA 4L8OA 2CHCA 3T8UA 3DXOA 3F40A 1VZZA 4CDLA 2HMNB 3F9SA 4GB5A 4HM4B 1OGXA 4LEHA 3KKGA 3MG3A 3I0YA 3NM2A 2I9WA 5D82A 3RGAA 3T8NA 2STDA 1EA2A 3VGNA 4OVMA 4OUQA 5AIIA 3FH1A 3EHCA 5JPUA 4HM2B 5KP1A 1IDPA 1W02A 1QJGA 1TUHA 2B1XB 4K1VA 4R9KA 2CKFB 1DMQA 2GBXB 4HM8B 4HVNA 1JN5B 4Q53A 2XRXB 1E3VA 1UUWB 3FF0A 3JUMA 5IF6A 3DUKA 2XR8B 3BLZA 1ASKA 5HGRA 3H3HA 5AEWB 4WYKB 3FZWA 1WQLB 2BMRB 3KE7A 5KP3A 3F8HA 3MKIA 1W00A 3Q90A 5KP4A 4H3UA 3HX8A 1GY7A 3JUNA 3EN8A 3SOAA 2JQ5A 3DMCA 3KZTA 1ZO2A 2XSHB 2K54A 5CF1A 1NWWA 4XBXA 1W01A 3G16A 1JKGA 3G0KA 4FCJA 3HK4A 3VSYA 1NU3A 1Q42A 2INXA 2IMJA 1JB4A 3MG2A 5IG5A 5DRVA 2QIYA 3S5CA 1A2KA 4LGQA 3NV0A 2YFLB 2GXFA 5IG3A 3E99A 4HM3B 1OUNA 1JB5A 5CXOA 1O7MB 5STDA 4IIAA 3EX9A 4XDWA 5DREA 4HM1B 3OV4A 2BNGA 5G2GA 3FSDA 3GWRA 4HZ9B 4I4KA 3F8XA 1ZX2A 3LYGA 2HMMB 4ORLA 3F7XA 1O7WB 5CF2A 4XM4A 3F14A 1U5OA 7STDA 1NDOB 1OF5A 3B8LA 3JUQA 3GZYB 1GY6A 1SJWA 1AR0A 1JKGB 4LMIA 5D83A 1OHSA 8CHOA 2XSOB 2F86B 3CU3A 3HZPA 4HKVB 3JUOA 1OHPA 3LZAA 4STDA 3EC9A 2UX0A 3DM8A 3FLJA 2HMOB 2OWPA 2RGQA 5CK6A 4HM6B 3D9RA 3NV0B 1C7HA 3ROBA 4K1UA 3STDA 5AIGA 3CNXA 1S5AA 3MSOA 3MYTA 1Q40A 3K7CA 1O7PB 2RCDA 1QMAA 4WP5A 3EF8A 1Z1SA 2HMKB 3FGYA 3H51A 3JUPA 2Z76A 4WWUC 4XBTA 3GZXB 5FW5A 5D81A 5IENA 4KVHA 4HM5B 4HM0B 4PEJA 3UNLA 4J9AA 3GZBA 1GYBA 4L8PA 3GRDA 5IEOA 5EVHA 3CNMA 1OF5B 3K0ZA 1O7HB 5AIFA 1HKXA 2QGUA 3SEDA 3OWYA 4X2OA 1DMNA 4X2HA 1K41A 1CQSA 5AEUB 5JPPA 3CPOA 4R9LA 3IPTA 3OX9A 1DMMA 3NHXA 1TP6A 5IG0A 3EBTA 3EJVA 1JB2A 3RGRA 1ULIB 1Q40B 2B24B 1ISKA 3B4OA 5BXQA 1BUQA 2F99A 3M8CA 3UJMA 4U13A 3EQQB 3NUVA 1O7GB 1GS3A 1UUVB 3F7SA 1OH0A 2GEXA 3MG1A 3FKAA 5CLKA 3OWSA 5BVBA 5AI1A 3G8ZA 3WMDA 2YFIB 6STDA 2GEYA 3BB9A 1E3RA 4HM7B 5TGNA 1STDA 4MJDA 1OPYA 3B7CA 4FCMA 4RZMA
chains in the Genus database with same CATH superfamily
3ALAA 1NO3A 2Z77A 4K61A 3ECFA 2GSPA 2Z7AA 1AQZA 4N6NB 3T0UA 1B2MA 4AEQA 3WHOA 3QK9A 3CCL3 2CH9A 2O3OA 2BMOB 2H0HA 1OCVA 2C11A 3KSPA 1QVG2 1I0XA 1BNEA 2Y73A 4GL6A 1EQKA 2BMQB 4R4KA 1EG9B 5BU4A 1B3SA 1IV9A 5IEPA 4KFDA 1G96A 1Q9EA 2AAEA 2RFRA 5IERA 2WOHA 3WOFB 3G713 3FF2A 2CFLA 3SOYA 2ZDJA 4HJLB 5FGOA 3HI7A 1O7NB 2W2CA 3EN1B 2CK3H 3DZLA 1RKYA 5AIHA 5LC6A 2HMJB 1JNQA 2IA7A 3SYUA 1BAOA 3ZFZA 1CYVA 3X40A 3S27A 3EBYA 3NXJA 3DH2A 4KFEA 1TRQA 3OXAA 3Q2PA 1BNRA 4N3VA 2YFJB 1BANA 3QRDA 1I8VA 1BUJA 3RNTA 1OGZA 3MPHA 1GY5A 3URPA 5IG4A 1DYUA 3MHEA 2IUJA 1JN5A 1BU4A 4L7KA 3V92A 3KSED 4EW5A 1NB5I 2ML5A 3N54B 3FG1A 3ER7A 3DGYA 1B2XA 1A2PA 3NBRA 1JBSA 2PZVA 1JRQA 2E2TA 2HMLB 1RGKA 2F98A 2R4IA 4HZBB 4R1KA 5M1AA 1ULJB 3WOEB 4DKIA 4K90B 2GBWB 1BRHA 3B4PA 4J8TA 4XB5A 1C54A 4MEIA 1W6YA 4XDVA 3BU4A 4XBYA 3NQYA 3A76A 3X3YA 5EQLA 9RNTA 1OHOA 1TRPA 1VQ53 2A15A 4WYKA 1IYYA 3NX0A 3GZRA 1M1K4 5GSPA 1E97A 1FGQA 2F56A 3OWUA 1IVXA 1X1XA 1Y4KA 4GSPA 3ZG5A 1T3BA 3WDGB 1SARA 3CCS3 2MC8A 1B27A 1A67A 1UDII 4CJNA 1IV7A 3AMOB 3BIRA 4L8OA 4WFOA 3IJEB 1FA3A 1RCLA 4N6TA 2BT3A 2CHCA 2IUKA 3T8UA 2BIRA 4N6UA 1L5GB 1GMRA 3DXOA 1YIJ3 3F40A 4ZM8A 2F4YA 1RGFA 3VF1A 3X3XA 1VZZA 4R80A 4CDLA 1CH0A 1S723 1EUIC 4J5GA 1STFI 2KXGA 2HMNB 1AVLA 4RNTA 4IT7A 3NBBA 1KD14 3LOYA 4FMCA 1UGIA 2KRTA 3CC73 3F9SA 1TFKA 4GB5A 1DETA 4HM4B 1MWUA 4O8SA 1OGXA 4LEHA 4WHAA 3KKGA 3MG3A 1JZDA 2OQEA 1SIHA 4O2HA 1VQP3 1IVWA 3BNDA 4JF8A 2GU3A 1RJOA 3I0YA 4H61A 3CCV3 3NM2A 2RSXA 2I9WA 5D82A 1BNFA 1IVVA 1UCKA 3RGAA 3T8NA 4BL2A 1EA2A 2STDA 1GD3A 4NHFA 3VGNA 4OVMA 4OUQA 5AIIA 4GHOA 1B2ZA 3FH1A 3EHCA 1YGWA 1LNHA 5JPUA 1JBTA 3KIIA 2KF3A 4HM2B 1A2VA 5KP1A 1IDPA 3CC23 2P0MA 4EBGA 2XFTA 1U8CB 4NPBA 1BSEA 1W02A 2IYJA 1X1YA 3AGNA 1QJGA 1MGWA 1TUHA 2B1XB 4K1VA 4N6MA 4R9KA 2CKFB 1DMQA 3X42A 1WMPA 1TU5A 3SVAA 2GBXB 2KF5A 4HM8B 4HVNA 1JN5B 2CG1A 3LTCA 5IW9A 3U1WA 2MF7A 1KC84 1BRNL 2F5WA 4Q53A 2XRXB 3D4AA 1E3VA 1UW1A 1UUWB 1VQL3 4CCVA 3FF0A 3JUMA 3CXC2 5IF6A 3DUKA 1BOXA 2XR8B 3BLZA 3NM7A 1RTUA 4JRFA 1FYSA 3PZWA 1FGMA 2HOHA 5EEOA 4FR9A 1ASKA 1LOWA 2CFKA 3PCRA 6GSPA 5JBSA 1Q7Y4 5HGRA 3H3HA 1TJDA 1I0VA 5AEWB 1MWTA 1UUGB 2ZL8A 1GOVA 3CC43 2C4BA 2W0QA 1RGCA 3GAXA 4WYKB 2OQEC 1IVUA 3FZWA 1WQLB 2BMRB 3KE7A 5KP3A 4BTYA 1CEWI 3AHSA 1W00A 1PY3A 3F8HA 3MKIA 3DGMA 3MWZA 3Q90A 4H3UA 1B21A 3U97A 3HX8A 2JDIH 7RNTA 1JBRA 1GY7A 1Q814 1YJW3 3G4S3 1RGHA 4FMBA 3JUNA 1GSPA 3EN8A 2XEPA 1FW7A 1IT8A 3UB1A 3SOAA 2JQ5A 3DMCA 4EXRA 3KZTA 1ZO2A 2XSHB 2K54A 1N9EA 1HU9A 2L1SA 3JVCA 5M19A 5CF1A 4OK0A 1NWWA 4XBXA 1W01A 3CCR3 3G16A 1G02A 1JKGA 1LRAA 3G0KA 4FCJA 1VQ43 2H0IA 1EEJA 2PNCA 3CCU3 3HK4A 3VSYA 1VQ83 1NU3A 1Q42A 4HAAA 2INXA 1I2EA 3EE1A 1ROVA 2IMJA 4BL3A 1DVCA 3J7Yd 1JB4A 1V57A 2F5MA 3MG2A 3A5EA 5IG5A 4TX4A 5DRVA 1TIJA 1W5ZA 2QIYA 2WGQA 2W04A 2D42A 2W9PA 1FUTA 1BIRA 1FGRA 2K0MA 1N8R4 2L4VA 3CCJ3 1JJ22 3S5CA 3WR2A 1A2KA 1BVIA 3CPW2 4N6LA 5AYRB 2KAAA 4LGQA 1RN4A 3S28A 4AKZA 1D6UA 1OACA 3NV0A 8RNTA 2YFLB 1ZGXA 4KFFA 2GXFA 3WA3A 2BHMA 2LYXA 1GD4A 1RNTA 3DY5A 3E99A 5IG3A 1WMOA 3DGOA 4HM3B 3KFQC 5A0OB 4BTWA 1IT7A 1R4CA 1OUNA 1RDSA 1I70A 1JB5A 2UGIA 1VQM3 2C10A 2FGTA 1BRGA 1O7MB 2WGOA 5CXOA 1B2UA 4IIAA 1BSBA 5STDA 1TFOA 3EX9A 4KZ1A 1GOUA 4XDWA 1W6GA 2CWTA 3S29A 5DREA 2SARA 1G0TA 4HM1B 3OV4A 1BSAA 5AYSC 2BNGA 5G2GA 3PCSA 1NB3I 1YGEA 2FXTA 3FSDA 2QEX3 3GWRA 4HZ9B 1EKMA 1BNJA 1RLSA 1LQMB 1W2B2 1RN1A 1K28A 4I4KA 1YNVX 2GU1A 3F8XA 3Q1CA 1ZX2A 1PYLA 3K5TA 1QAKA 2CG0A 3LMLA 3LYGA 4IPBA 1MWSA 2HMMB 4ORLA 2IY2A 4EV2A 3F7XA 1O7WB 1N5HA 5CF2A 2OTJ3 4AKYA 4XM4A 2OOVC 3D5GA 3EB8A 1LNIA 3F14A 4G1MB 1U5OA 7STDA 4BTXA 3CME3 1W7CA 1M1XB 1B20A 1NDOB 1OF5A 2H0GA 3LT8A 3LXUX 3TDGA 3OW22 3B8LA 3N9HA 2XF3A 3JUQA 3GZYB 1GY6A 1SJWA 1AR0A 1JV2B 2CFDA 2Z6BA 1JKGB 3S67A 4LMIA 1YVBI 1GMPA 5D83A 4MMZB 1OHSA 8CHOA 1RSNA 3K63A 1VQK3 2XSOB 1R4YA 2F86B 2W56A 2D1WA 3CU3A 4O02B 2QA43 2OCTA 1T2HA 3HZPA 3CCM3 3BNBA 3JUOA 4HKVB 1I3IA 1OHPA 3LZAA 1KSIA 2W9QA 1I3FA 3EC9A 4STDA 3RDEA 1X1UA 2UX0A 3DM8A 1UGHI 1RGEA 3FLJA 5G1LA 2W6JH 3HIIA 1T5YA 1IU7A 2HMOB 3FG3A 4LZIA 1B2SA 2OWPA 2RGQA 1AV4A 4HM6B 5CK6A 1AVKA 1N9JA 2J8XB 3N8BA 1W6CA 2FNQA 3D9RA 1ZS7A 3NV0B 1C7HA 3ROBA 3V99A 6RNTA 4K1UA 1N5PA 2W03A 3STDA 1RGGA 1FZUA 3CCE3 5AIGA 3CNXA 3D79A 1VQO3 1SPUA 2KF6A 1S5AA 3MSOA 1RCKA 3MYTA 4LYLB 4I5QA 1I2FA 1Q40A 3K7CA 1F8NA 3X3ZA 4QWTA 4FMDA 1O7PB 2RCDA 1QMAA 4WP5A 5LC7A 5I97A 4HOHA 3EF8A 4EV5A 2WO0A 1Z1SA 3SLUA 2HMKB 2CW9A 3NQZA 5RNTA 2P09A 3FGYA 3H51A 3JUPA 2Z76A 4WWUC 4XBTA 5G1KA 2BU4A 3WODG 3GZXB 2P38A 5FW5A 1CYUA 3D5IA 4O3VA 1FUWA 2ZA4A 5D81A 1YIT3 5IENA 4KVHA 4HM5B 4HM0B 2XH9A 2UUGC 3I563 1YHQ3 2ML6A 3LTAA 4NREA 4PEJA 4EYCA 1NJI4 1IQXA 3UNLA 1HZ1A 1LOXA 1VQ93 3IMAB 4J9AA 3GZBA 5KP4A 2P05A 1LQGC 3BNCA 2O9UX 1PFPA 2CFWA 1GYBA 3FG4A 4L8PA 1YJ93 4ILFA 1VQ63 3GRDA 1VQ73 5IEOA 5EVHA 1ROAA 1RGAA 3CNMA 4KT3B 1OF5B 1YJN3 3K0ZA 5BIRA 1O7HB 2OOVA 2XFSA 4FMAA 5AIFA 1GOYA 1DE3A 1QALA 3DGLA 1BRSA 3GSPA 1HKXA 7GSPA 1US1A 2RBIA 2KCDA 1KWIA 2QGUA 1UCLA 1WTHA 3HIGA 3SEDA 1TTOA 3PGBA 2W56B 1RN7A 3HOHA 1D6ZA 3CD63 1M9GA 4RBNA 2CWVA 1MGRA 4RNYA 3OWYA 1M904 4X2OA 3D3LA 1DMNA 4X2HA 2KF4A 1K41A 4RNZA 2E2VA 5ELJA 1RRHA 1FGTA 1BRIA 3FCSB 1UI7A 1CQSA 5M18A 3I553 1D6YA 2M7OA 3DGNA 1FGOA 1LVNA 3WA2X 5AEUB 1J2BA 3ZG0A 1LOYA 2RNTA 3CPOA 1WNHA 3L0RA 3K9MC 5JPPA 4R9LA 2SBLA 2AADA 2CIUA 2CWUA 2WOFA 1HYFA 3IPTA 3OX9A 1JZOA 1DMMA 3CMA3 1T2IA 3NHXA 4J5KA 1TP6A 2Y74A 3NBJA 1YI23 5IG0A 3EBTA 1K8A4 2YX9A 1BNIA 3EJVA 3BNEA 1JB2A 3PS8A 3RGRA 1Q864 2V1LA 1VQQA 1BSCA 3X41A 1ULIB 1Q40B 1MNLA 2B24B 4MMXB 1RRLA 3CCQ3 1ISKA 3Q3FA 3LTDA 3LH4A 3B4OA 4HBRA 1PU4A 3AHWA 1AY7A 2ZHXB 5BXQA 1BUQA 2F99A 4BIRA 2CFGA 1BNSA 3PYJA 3KN4A 1LOVA 3M8CA 2K3DA 1RGLA 3UJMA 4U13A 2E2UA 2CX0A 3AGOA 1BSDA 2BO9B 3EQQB 1UCIA 3NUVA 1BRKA 1IK3A 3UL6A 4EC6A 2OTL3 1N8QA 1O7GB 1GS3A 1UUVB 1MWRA 3F7SA 1K734 1OH0A 1YVSA 1BRJA 2GEXA 3MG1A 1W4NA 1KQS2 2LQVA 3FKAA 4N6V0 2CX1A 5CLKA 1Q824 1DVDA 3SXXA 1K9M4 1MOLA 1VQN3 1RNBA 3O8YA 1RHLA 5ELUA 4BU4A 3OWSA 1NNVA 5BVBA 5AI1A 1WMNA 3G8ZA 1V74A 1SIIA 1LXEA 3SX1A 2Q07A 3LTBA 3WMDA 2YFIB 2R41A 6STDA 2GEYA 2XGLA 3V98A 1A90A 1V58A 1QVF2 3PXMA 1QAFA 1IQ8A 1IQYA 3BB9A 3KCHA 1SQWA 2P0XA 4HYZA 1E3RA 1RMSA 1UI8A 4HM7B 5HOHA 5TGNA 4LSOA 4N6OB 2XGNA 4FCZA 1W2ZA 4MMYB 1FUSA 1BNGA 1I2GA 4CPKA 1STDA 4MJDA 1X1WA 3UL5A 1BGSA 1GMQA 1OPYA 3G6E3 3AMOA 3B7CA 1UCJA 3LT9A 4FCMA 4RZMA 1Q7HA 2CC3A
chains in the Genus database with same CATH topology
3ALAA 1NO3A 2Z77A 4K61A 3ECFA 2Z7AA 4N6NB 3T0UA 4AEQA 3QK9A 3CCL3 2CH9A 2O3OA 2BMOB 1OCVA 2C11A 3KSPA 2Y73A 1EQKA 4GL6A 2BMQB 4R4KA 1EG9B 1IV9A 5IEPA 4KFDA 1G96A 2RFRA 5IERA 2WOHA 3WOFB 3G713 3FF2A 2CFLA 3SOYA 2ZDJA 4HJLB 5FGOA 3HI7A 1O7NB 2W2CA 3EN1B 2CK3H 3DZLA 1RKYA 5AIHA 5LC6A 2HMJB 1JNQA 2IA7A 1CYVA 3X40A 3S27A 3EBYA 3NXJA 4KFEA 3OXAA 3Q2PA 4N3VA 2YFJB 3QRDA 1OGZA 3MPHA 1GY5A 5IG4A 1DYUA 3MHEA 2IUJA 1JN5A 4L7KA 3V92A 3KSED 1NB5I 2ML5A 3N54B 3FG1A 3ER7A 3NBRA 2PZVA 1JRQA 2E2TA 2HMLB 2R4IA 2F98A 4HZBB 4R1KA 1ULJB 3WOEB 4K90B 2GBWB 3B4PA 4J8TA 4XB5A 4MEIA 1W6YA 4XDVA 4XBYA 3NQYA 3A76A 3X3YA 5EQLA 1VQ53 1OHOA 2A15A 4WYKA 3NX0A 3GZRA 1M1K4 1E97A 1FGQA 3OWUA 1IVXA 1Y4KA 3WDGB 2MC8A 1A67A 1IV7A 3AMOB 4L8OA 4WFOA 3IJEB 1FA3A 4N6TA 2BT3A 2CHCA 2IUKA 3T8UA 4N6UA 1L5GB 1YIJ3 3DXOA 3F40A 4ZM8A 3VF1A 3X3XA 1VZZA 4R80A 4CDLA 1S723 1STFI 2KXGA 2HMNB 1AVLA 4IT7A 3NBBA 1KD14 3LOYA 4FMCA 3CC73 2KRTA 3F9SA 1TFKA 4GB5A 4HM4B 4O8SA 1OGXA 4LEHA 4WHAA 3KKGA 3MG3A 2OQEA 1SIHA 4O2HA 1VQP3 1IVWA 3BNDA 4JF8A 2GU3A 1RJOA 3I0YA 4H61A 3CCV3 3NM2A 2RSXA 2I9WA 5D82A 1IVVA 3RGAA 3T8NA 2STDA 1EA2A 1GD3A 4NHFA 3VGNA 4OVMA 4OUQA 5AIIA 3FH1A 3EHCA 5JPUA 1LNHA 3KIIA 4HM2B 1A2VA 5KP1A 1IDPA 3CC23 2P0MA 4EBGA 2XFTA 1U8CB 1W02A 1QJGA 1TUHA 2B1XB 4K1VA 4N6MA 4R9KA 2CKFB 1DMQA 3X42A 1WMPA 1TU5A 3SVAA 2GBXB 4HM8B 4HVNA 2CG1A 1JN5B 5IW9A 3LTCA 3U1WA 2MF7A 1KC84 4Q53A 2XRXB 1E3VA 1UW1A 1UUWB 1VQL3 4CCVA 3FF0A 3JUMA 3CXC2 5IF6A 3DUKA 2XR8B 3BLZA 3NM7A 4JRFA 3PZWA 1FGMA 5EEOA 4FR9A 1ASKA 3PCRA 2CFKA 1Q7Y4 5JBSA 5HGRA 3H3HA 5AEWB 2ZL8A 3CC43 2W0QA 3GAXA 4WYKB 2OQEC 1IVUA 3FZWA 1WQLB 2BMRB 3KE7A 5KP3A 4BTYA 1CEWI 3F8HA 1W00A 3MKIA 3MWZA 3Q90A 3DGMA 4H3UA 3U97A 5KP4A 3HX8A 2JDIH 1GY7A 1Q814 1YJW3 3G4S3 4FMBA 3JUNA 3EN8A 2XEPA 1IT8A 3UB1A 3SOAA 2JQ5A 3DMCA 4EXRA 3KZTA 1ZO2A 2XSHB 2K54A 1N9EA 1HU9A 3JVCA 5CF1A 4OK0A 1NWWA 4XBXA 1W01A 3CCR3 3G16A 1JKGA 3G0KA 4FCJA 1VQ43 2PNCA 3CCU3 3HK4A 3VSYA 1VQ83 1NU3A 1Q42A 2INXA 3EE1A 1ROVA 2IMJA 1DVCA 3J7Yd 1JB4A 3MG2A 5IG5A 4TX4A 5DRVA 1TIJA 1W5ZA 2QIYA 2WGQA 2W04A 2W9PA 2D42A 1FGRA 2K0MA 1N8R4 2L4VA 3CCJ3 1JJ22 3S5CA 1A2KA 3CPW2 4N6LA 5AYRB 4LGQA 3S28A 4AKZA 1D6UA 1OACA 3NV0A 2YFLB 4KFFA 2GXFA 3WA3A 2BHMA 2LYXA 1GD4A 3DY5A 5IG3A 3E99A 1WMOA 3DGOA 4HM3B 3KFQC 5A0OB 4BTWA 1IT7A 1R4CA 1OUNA 1JB5A 1VQM3 2C10A 2FGTA 2WGOA 1O7MB 5CXOA 5STDA 3CCS3 4IIAA 1QVG2 1QVF2 1TFOA 3EX9A 4KZ1A 4XDWA 1W6GA 2CWTA 3S29A 5DREA 4HM1B 3OV4A 5AYSC 2BNGA 5G2GA 3PCSA 1NB3I 1YGEA 2FXTA 3FSDA 2QEX3 3GWRA 4HZ9B 1EKMA 1W2B2 1K28A 4I4KA 2GU1A 3F8XA 3Q1CA 1ZX2A 3K5TA 1QAKA 2CG0A 3LMLA 3LYGA 4IPBA 2HMMB 4ORLA 4EV2A 3F7XA 1O7WB 1N5HA 5CF2A 2OTJ3 4AKYA 4XM4A 2OOVC 3EB8A 3F14A 4G1MB 1U5OA 7STDA 4BTXA 3CME3 1W7CA 1M1XB 1NDOB 1OF5A 3LT8A 3LXUX 3TDGA 3OW22 3B8LA 3N9HA 2XF3A 3JUQA 3GZYB 1GY6A 1SJWA 1AR0A 1JV2B 2CFDA 2Z6BA 1JKGB 3S67A 4LMIA 1YVBI 5D83A 4MMZB 1OHSA 8CHOA 3K63A 1VQK3 2XSOB 2F86B 2W56A 2D1WA 3CU3A 4O02B 2QA43 2OCTA 3HZPA 3CCM3 3BNBA 3JUOA 4HKVB 1OHPA 3LZAA 1KSIA 2W9QA 4STDA 3EC9A 3RDEA 2UX0A 3DM8A 3FLJA 2W6JH 3HIIA 1T5YA 1IU7A 2HMOB 3FG3A 4LZIA 2OWPA 2RGQA 1AV4A 4HM6B 5CK6A 1AVKA 1N9JA 3N8BA 1W6CA 2FNQA 3D9RA 3NV0B 1C7HA 3ROBA 3V99A 4K1UA 1N5PA 2W03A 3STDA 3CCE3 5AIGA 3CNXA 1VQO3 1SPUA 1S5AA 3MSOA 3MYTA 1Q40A 3K7CA 1F8NA 3X3ZA 4QWTA 4FMDA 1O7PB 2RCDA 1QMAA 4WP5A 5LC7A 5I97A 4EV5A 3EF8A 2WO0A 1Z1SA 3SLUA 2HMKB 2CW9A 3NQZA 2P09A 3FGYA 3H51A 3JUPA 2Z76A 4WWUC 4XBTA 3WODG 3GZXB 2P38A 5FW5A 1CYUA 4O3VA 1FUWA 5D81A 1YIT3 5IENA 4KVHA 4HM5B 4HM0B 2XH9A 3I563 1YHQ3 2ML6A 3LTAA 4NREA 4PEJA 4EYCA 1NJI4 1IQXA 3UNLA 1LOXA 1VQ93 3IMAB 4J9AA 3GZBA 2P05A 3BNCA 2O9UX 1PFPA 2CFWA 1GYBA 3FG4A 4L8PA 1YJ93 1VQ63 3GRDA 1VQ73 5IEOA 5EVHA 1ROAA 3CNMA 1OF5B 1YJN3 3K0ZA 1O7HB 2OOVA 2XFSA 4FMAA 5AIFA 1QALA 3DGLA 1HKXA 1US1A 2KCDA 1KWIA 2QGUA 1WTHA 3HIGA 3SEDA 3PGBA 2W56B 1RN7A 1D6ZA 3CD63 1M9GA 4RBNA 2CWVA 4RNYA 3OWYA 1M904 4X2OA 3D3LA 1DMNA 4X2HA 1K41A 4RNZA 2E2VA 5ELJA 1RRHA 1FGTA 3FCSB 1UI7A 1CQSA 3I553 1D6YA 2M7OA 3DGNA 1FGOA 1LVNA 3WA2X 5AEUB 5JPPA 3CPOA 1WNHA 3L0RA 3K9MC 4R9LA 2SBLA 2CIUA 2CWUA 2WOFA 3IPTA 3OX9A 3CMA3 1DMMA 3NHXA 1TP6A 2Y74A 3NBJA 1YI23 5IG0A 3EBTA 1K8A4 2YX9A 3EJVA 3BNEA 1JB2A 3PS8A 3RGRA 1Q864 2V1LA 3X41A 1ULIB 1Q40B 1MNLA 2B24B 4MMXB 1RRLA 3CCQ3 1ISKA 3LTDA 3LH4A 3B4OA 4HBRA 1PU4A 5BXQA 1BUQA 2F99A 2CFGA 3PYJA 3KN4A 3M8CA 3UJMA 4U13A 2E2UA 2BO9B 3EQQB 3NUVA 1IK3A 3UL6A 4EC6A 2OTL3 1N8QA 1O7GB 1GS3A 1UUVB 3F7SA 1K734 1OH0A 2GEXA 1J2BA 3MG1A 1W4NA 1KQS2 2LQVA 3FKAA 4N6V0 5CLKA 1Q824 1DVDA 3SXXA 1K9M4 1MOLA 1VQN3 3O8YA 5ELUA 3OWSA 5BVBA 5AI1A 1WMNA 3G8ZA 1V74A 1SIIA 1LXEA 3SX1A 2Q07A 3LTBA 3WMDA 2YFIB 6STDA 2GEYA 2XGLA 3V98A 1A90A 3PXMA 1QAFA 1IQ8A 1IQYA 3BB9A 1SQWA 2P0XA 4HYZA 1E3RA 1UI8A 4HM7B 5TGNA 4LSOA 4N6OB 2XGNA 4FCZA 1W2ZA 4MMYB 1STDA 4MJDA 3UL5A 3G6E3 1OPYA 3AMOA 3B7CA 3LT9A 4FCMA 4RZMA 2CC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z77 A;  3ECF A;  2Z7A A;  2BMO B;  1OCV A;  3KSP A;  2BMQ B;  1EG9 B;  5IEP A;  2RFR A;  5IER A;  3FF2 A;  3SOY A;  4HJL B;  1O7N B;  2W2C A;  3EN1 B;  3DZL A;  5AIH A;  2HMJ B;  3EBY A;  3NXJ A;  3OXA A;  4N3V A;  2YFJ B;  1OGZ A;  1GY5 A;  5IG4 A;  3MHE A;  1JN5 A;  4L7K A;  3ER7 A;  3NBR A;  2PZV A;  2R4I A;  2HML B;  4HZB B;  4R1K A;  2F98 A;  1ULJ B;  2GBW B;  3B4P A;  4J8T A;  4XB5 A;  1W6Y A;  4XDV A;  4XBY A;  3A76 A;  1OHO A;  2A15 A;  4WYK A;  3GZR A;  1E97 A;  3OWU A;  4L8O A;  2CHC A;  3T8U A;  3DXO A;  3F40 A;  1VZZ A;  4CDL A;  2HMN B;  3F9S A;  4GB5 A;  4HM4 B;  1OGX A;  4LEH A;  3KKG A;  3MG3 A;  3I0Y A;  3NM2 A;  2I9W A;  5D82 A;  3RGA A;  3T8N A;  2STD A;  1EA2 A;  3VGN A;  4OVM A;  4OUQ A;  5AII A;  3FH1 A;  3EHC A;  5JPU A;  4HM2 B;  5KP1 A;  1IDP A;  1W02 A;  1QJG A;  1TUH A;  2B1X B;  4K1V A;  4R9K A;  2CKF B;  1DMQ A;  2GBX B;  4HM8 B;  4HVN A;  1JN5 B;  4Q53 A;  2XRX B;  1E3V A;  1UUW B;  3FF0 A;  3JUM A;  5IF6 A;  3DUK A;  2XR8 B;  3BLZ A;  1ASK A;  5HGR A;  3H3H A;  5AEW B;  4WYK B;  3FZW A;  1WQL B;  2BMR B;  3KE7 A;  5KP3 A;  3F8H A;  3MKI A;  1W00 A;  3Q90 A;  5KP4 A;  4H3U A;  3HX8 A;  1GY7 A;  3JUN A;  3EN8 A;  3SOA A;  2JQ5 A;  3DMC A;  3KZT A;  1ZO2 A;  2XSH B;  2K54 A;  5CF1 A;  1NWW A;  4XBX A;  1W01 A;  3G16 A;  1JKG A;  3G0K A;  4FCJ A;  3HK4 A;  3VSY A;  1NU3 A;  1Q42 A;  2INX A;  2IMJ A;  1JB4 A;  3MG2 A;  5IG5 A;  5DRV A;  2QIY A;  3S5C A;  1A2K A;  4LGQ A;  3NV0 A;  2YFL B;  2GXF A;  5IG3 A;  3E99 A;  4HM3 B;  1OUN A;  1JB5 A;  5CXO A;  1O7M B;  5STD A;  4IIA A;  3EX9 A;  4XDW A;  5DRE A;  4HM1 B;  3OV4 A;  2BNG A;  5G2G A;  3FSD A;  3GWR A;  4HZ9 B;  4I4K A;  3F8X A;  1ZX2 A;  3LYG A;  2HMM B;  4ORL A;  3F7X A;  1O7W B;  5CF2 A;  4XM4 A;  3F14 A;  1U5O A;  7STD A;  1NDO B;  1OF5 A;  3B8L A;  3JUQ A;  3GZY B;  1GY6 A;  1SJW A;  1AR0 A;  1JKG B;  4LMI A;  5D83 A;  1OHS A;  8CHO A;  2XSO B;  2F86 B;  3CU3 A;  3HZP A;  4HKV B;  3JUO A;  1OHP A;  3LZA A;  4STD A;  3EC9 A;  2UX0 A;  3DM8 A;  3FLJ A;  2HMO B;  2OWP A;  2RGQ A;  5CK6 A;  4HM6 B;  3D9R A;  3NV0 B;  1C7H A;  3ROB A;  4K1U A;  3STD A;  5AIG A;  3CNX A;  1S5A A;  3MSO A;  3MYT A;  1Q40 A;  3K7C A;  1O7P B;  2RCD A;  1QMA A;  4WP5 A;  3EF8 A;  1Z1S A;  2HMK B;  3FGY A;  3H51 A;  3JUP A;  2Z76 A;  4WWU C;  4XBT A;  3GZX B;  5FW5 A;  5D81 A;  5IEN A;  4KVH A;  4HM5 B;  4HM0 B;  4PEJ A;  3UNL A;  4J9A A;  3GZB A;  1GYB A;  4L8P A;  3GRD A;  5IEO A;  5EVH A;  3CNM A;  1OF5 B;  3K0Z A;  1O7H B;  5AIF A;  1HKX A;  2QGU A;  3SED A;  3OWY A;  4X2O A;  1DMN A;  4X2H A;  1K41 A;  1CQS A;  5AEU B;  5JPP A;  3CPO A;  4R9L A;  3IPT A;  3OX9 A;  1DMM A;  3NHX A;  1TP6 A;  5IG0 A;  3EBT A;  3EJV A;  1JB2 A;  3RGR A;  1ULI B;  1Q40 B;  2B24 B;  1ISK A;  3B4O A;  5BXQ A;  1BUQ A;  2F99 A;  3M8C A;  3UJM A;  4U13 A;  3EQQ B;  3NUV A;  1O7G B;  1GS3 A;  1UUV B;  3F7S A;  1OH0 A;  2GEX A;  3MG1 A;  3FKA A;  5CLK A;  3OWS A;  5BVB A;  5AI1 A;  3G8Z A;  3WMD A;  2YFI B;  6STD A;  2GEY A;  3BB9 A;  1E3R A;  4HM7 B;  5TGN A;  1STD A;  4MJD A;  1OPY A;  3B7C A;  4FCM A;  4RZM A; 
#chains in the Genus database with same CATH topology
 3ALA A;  1NO3 A;  2Z77 A;  4K61 A;  3ECF A;  2GSP A;  2Z7A A;  1AQZ A;  4N6N B;  3T0U A;  1B2M A;  4AEQ A;  3WHO A;  3QK9 A;  3CCL 3;  2CH9 A;  2O3O A;  2BMO B;  2H0H A;  1OCV A;  2C11 A;  3KSP A;  1QVG 2;  1I0X A;  1BNE A;  2Y73 A;  4GL6 A;  1EQK A;  2BMQ B;  4R4K A;  1EG9 B;  5BU4 A;  1B3S A;  1IV9 A;  5IEP A;  4KFD A;  1G96 A;  1Q9E A;  2AAE A;  2RFR A;  5IER A;  2WOH A;  3WOF B;  3G71 3;  3FF2 A;  2CFL A;  3SOY A;  2ZDJ A;  4HJL B;  5FGO A;  3HI7 A;  1O7N B;  2W2C A;  3EN1 B;  2CK3 H;  3DZL A;  1RKY A;  5AIH A;  5LC6 A;  2HMJ B;  1JNQ A;  2IA7 A;  3SYU A;  1BAO A;  3ZFZ A;  1CYV A;  3X40 A;  3S27 A;  3EBY A;  3NXJ A;  3DH2 A;  4KFE A;  1TRQ A;  3OXA A;  3Q2P A;  1BNR A;  4N3V A;  2YFJ B;  1BAN A;  3QRD A;  1I8V A;  1BUJ A;  3RNT A;  1OGZ A;  3MPH A;  1GY5 A;  3URP A;  5IG4 A;  1DYU A;  3MHE A;  2IUJ A;  1JN5 A;  1BU4 A;  4L7K A;  3V92 A;  3KSE D;  4EW5 A;  1NB5 I;  2ML5 A;  3N54 B;  3FG1 A;  3ER7 A;  3DGY A;  1B2X A;  1A2P A;  3NBR A;  1JBS A;  2PZV A;  1JRQ A;  2E2T A;  2HML B;  1RGK A;  2F98 A;  2R4I A;  4HZB B;  4R1K A;  5M1A A;  1ULJ B;  3WOE B;  4DKI A;  4K90 B;  2GBW B;  1BRH A;  3B4P A;  4J8T A;  4XB5 A;  1C54 A;  4MEI A;  1W6Y A;  4XDV A;  3BU4 A;  4XBY A;  3NQY A;  3A76 A;  3X3Y A;  5EQL A;  9RNT A;  1OHO A;  1TRP A;  1VQ5 3;  2A15 A;  4WYK A;  1IYY A;  3NX0 A;  3GZR A;  1M1K 4;  5GSP A;  1E97 A;  1FGQ A;  2F56 A;  3OWU A;  1IVX A;  1X1X A;  1Y4K A;  4GSP A;  3ZG5 A;  1T3B A;  3WDG B;  1SAR A;  3CCS 3;  2MC8 A;  1B27 A;  1A67 A;  1UDI I;  4CJN A;  1IV7 A;  3AMO B;  3BIR A;  4L8O A;  4WFO A;  3IJE B;  1FA3 A;  1RCL A;  4N6T A;  2BT3 A;  2CHC A;  2IUK A;  3T8U A;  2BIR A;  4N6U A;  1L5G B;  1GMR A;  3DXO A;  1YIJ 3;  3F40 A;  4ZM8 A;  2F4Y A;  1RGF A;  3VF1 A;  3X3X A;  1VZZ A;  4R80 A;  4CDL A;  1CH0 A;  1S72 3;  1EUI C;  4J5G A;  1STF I;  2KXG A;  2HMN B;  1AVL A;  4RNT A;  4IT7 A;  3NBB A;  1KD1 4;  3LOY A;  4FMC A;  1UGI A;  2KRT A;  3CC7 3;  3F9S A;  1TFK A;  4GB5 A;  1DET A;  4HM4 B;  1MWU A;  4O8S A;  1OGX A;  4LEH A;  4WHA A;  3KKG A;  3MG3 A;  1JZD A;  2OQE A;  1SIH A;  4O2H A;  1VQP 3;  1IVW A;  3BND A;  4JF8 A;  2GU3 A;  1RJO A;  3I0Y A;  4H61 A;  3CCV 3;  3NM2 A;  2RSX A;  2I9W A;  5D82 A;  1BNF A;  1IVV A;  1UCK A;  3RGA A;  3T8N A;  4BL2 A;  1EA2 A;  2STD A;  1GD3 A;  4NHF A;  3VGN A;  4OVM A;  4OUQ A;  5AII A;  4GHO A;  1B2Z A;  3FH1 A;  3EHC A;  1YGW A;  1LNH A;  5JPU A;  1JBT A;  3KII A;  2KF3 A;  4HM2 B;  1A2V A;  5KP1 A;  1IDP A;  3CC2 3;  2P0M A;  4EBG A;  2XFT A;  1U8C B;  4NPB A;  1BSE A;  1W02 A;  2IYJ A;  1X1Y A;  3AGN A;  1QJG A;  1MGW A;  1TUH A;  2B1X B;  4K1V A;  4N6M A;  4R9K A;  2CKF B;  1DMQ A;  3X42 A;  1WMP A;  1TU5 A;  3SVA A;  2GBX B;  2KF5 A;  4HM8 B;  4HVN A;  1JN5 B;  2CG1 A;  3LTC A;  5IW9 A;  3U1W A;  2MF7 A;  1KC8 4;  1BRN L;  2F5W A;  4Q53 A;  2XRX B;  3D4A A;  1E3V A;  1UW1 A;  1UUW B;  1VQL 3;  4CCV A;  3FF0 A;  3JUM A;  3CXC 2;  5IF6 A;  3DUK A;  1BOX A;  2XR8 B;  3BLZ A;  3NM7 A;  1RTU A;  4JRF A;  1FYS A;  3PZW A;  1FGM A;  2HOH A;  5EEO A;  4FR9 A;  1ASK A;  1LOW A;  2CFK A;  3PCR A;  6GSP A;  5JBS A;  1Q7Y 4;  5HGR A;  3H3H A;  1TJD A;  1I0V A;  5AEW B;  1MWT A;  1UUG B;  2ZL8 A;  1GOV A;  3CC4 3;  2C4B A;  2W0Q A;  1RGC A;  3GAX A;  4WYK B;  2OQE C;  1IVU A;  3FZW A;  1WQL B;  2BMR B;  3KE7 A;  5KP3 A;  4BTY A;  1CEW I;  3AHS A;  1W00 A;  1PY3 A;  3F8H A;  3MKI A;  3DGM A;  3MWZ A;  3Q90 A;  4H3U A;  1B21 A;  3U97 A;  3HX8 A;  2JDI H;  7RNT A;  1JBR A;  1GY7 A;  1Q81 4;  1YJW 3;  3G4S 3;  1RGH A;  4FMB A;  3JUN A;  1GSP A;  3EN8 A;  2XEP A;  1FW7 A;  1IT8 A;  3UB1 A;  3SOA A;  2JQ5 A;  3DMC A;  4EXR A;  3KZT A;  1ZO2 A;  2XSH B;  2K54 A;  1N9E A;  1HU9 A;  2L1S A;  3JVC A;  5M19 A;  5CF1 A;  4OK0 A;  1NWW A;  4XBX A;  1W01 A;  3CCR 3;  3G16 A;  1G02 A;  1JKG A;  1LRA A;  3G0K A;  4FCJ A;  1VQ4 3;  2H0I A;  1EEJ A;  2PNC A;  3CCU 3;  3HK4 A;  3VSY A;  1VQ8 3;  1NU3 A;  1Q42 A;  4HAA A;  2INX A;  1I2E A;  3EE1 A;  1ROV A;  2IMJ A;  4BL3 A;  1DVC A;  3J7Y d;  1JB4 A;  1V57 A;  2F5M A;  3MG2 A;  3A5E A;  5IG5 A;  4TX4 A;  5DRV A;  1TIJ A;  1W5Z A;  2QIY A;  2WGQ A;  2W04 A;  2D42 A;  2W9P A;  1FUT A;  1BIR A;  1FGR A;  2K0M A;  1N8R 4;  2L4V A;  3CCJ 3;  1JJ2 2;  3S5C A;  3WR2 A;  1A2K A;  1BVI A;  3CPW 2;  4N6L A;  5AYR B;  2KAA A;  4LGQ A;  1RN4 A;  3S28 A;  4AKZ A;  1D6U A;  1OAC A;  3NV0 A;  8RNT A;  2YFL B;  1ZGX A;  4KFF A;  2GXF A;  3WA3 A;  2BHM A;  2LYX A;  1GD4 A;  1RNT A;  3DY5 A;  3E99 A;  5IG3 A;  1WMO A;  3DGO A;  4HM3 B;  3KFQ C;  5A0O B;  4BTW A;  1IT7 A;  1R4C A;  1OUN A;  1RDS A;  1I70 A;  1JB5 A;  2UGI A;  1VQM 3;  2C10 A;  2FGT A;  1BRG A;  1O7M B;  2WGO A;  5CXO A;  1B2U A;  4IIA A;  1BSB A;  5STD A;  1TFO A;  3EX9 A;  4KZ1 A;  1GOU A;  4XDW A;  1W6G A;  2CWT A;  3S29 A;  5DRE A;  2SAR A;  1G0T A;  4HM1 B;  3OV4 A;  1BSA A;  5AYS C;  2BNG A;  5G2G A;  3PCS A;  1NB3 I;  1YGE A;  2FXT A;  3FSD A;  2QEX 3;  3GWR A;  4HZ9 B;  1EKM A;  1BNJ A;  1RLS A;  1LQM B;  1W2B 2;  1RN1 A;  1K28 A;  4I4K A;  1YNV X;  2GU1 A;  3F8X A;  3Q1C A;  1ZX2 A;  1PYL A;  3K5T A;  1QAK A;  2CG0 A;  3LML A;  3LYG A;  4IPB A;  1MWS A;  2HMM B;  4ORL A;  2IY2 A;  4EV2 A;  3F7X A;  1O7W B;  1N5H A;  5CF2 A;  2OTJ 3;  4AKY A;  4XM4 A;  2OOV C;  3D5G A;  3EB8 A;  1LNI A;  3F14 A;  4G1M B;  1U5O A;  7STD A;  4BTX A;  3CME 3;  1W7C A;  1M1X B;  1B20 A;  1NDO B;  1OF5 A;  2H0G A;  3LT8 A;  3LXU X;  3TDG A;  3OW2 2;  3B8L A;  3N9H A;  2XF3 A;  3JUQ A;  3GZY B;  1GY6 A;  1SJW A;  1AR0 A;  1JV2 B;  2CFD A;  2Z6B A;  1JKG B;  3S67 A;  4LMI A;  1YVB I;  1GMP A;  5D83 A;  4MMZ B;  1OHS A;  8CHO A;  1RSN A;  3K63 A;  1VQK 3;  2XSO B;  1R4Y A;  2F86 B;  2W56 A;  2D1W A;  3CU3 A;  4O02 B;  2QA4 3;  2OCT A;  1T2H A;  3HZP A;  3CCM 3;  3BNB A;  3JUO A;  4HKV B;  1I3I A;  1OHP A;  3LZA A;  1KSI A;  2W9Q A;  1I3F A;  3EC9 A;  4STD A;  3RDE A;  1X1U A;  2UX0 A;  3DM8 A;  1UGH I;  1RGE A;  3FLJ A;  5G1L A;  2W6J H;  3HII A;  1T5Y A;  1IU7 A;  2HMO B;  3FG3 A;  4LZI A;  1B2S A;  2OWP A;  2RGQ A;  1AV4 A;  4HM6 B;  5CK6 A;  1AVK A;  1N9J A;  2J8X B;  3N8B A;  1W6C A;  2FNQ A;  3D9R A;  1ZS7 A;  3NV0 B;  1C7H A;  3ROB A;  3V99 A;  6RNT A;  4K1U A;  1N5P A;  2W03 A;  3STD A;  1RGG A;  1FZU A;  3CCE 3;  5AIG A;  3CNX A;  3D79 A;  1VQO 3;  1SPU A;  2KF6 A;  1S5A A;  3MSO A;  1RCK A;  3MYT A;  4LYL B;  4I5Q A;  1I2F A;  1Q40 A;  3K7C A;  1F8N A;  3X3Z A;  4QWT A;  4FMD A;  1O7P B;  2RCD A;  1QMA A;  4WP5 A;  5LC7 A;  5I97 A;  4HOH A;  3EF8 A;  4EV5 A;  2WO0 A;  1Z1S A;  3SLU A;  2HMK B;  2CW9 A;  3NQZ A;  5RNT A;  2P09 A;  3FGY A;  3H51 A;  3JUP A;  2Z76 A;  4WWU C;  4XBT A;  5G1K A;  2BU4 A;  3WOD G;  3GZX B;  2P38 A;  5FW5 A;  1CYU A;  3D5I A;  4O3V A;  1FUW A;  2ZA4 A;  5D81 A;  1YIT 3;  5IEN A;  4KVH A;  4HM5 B;  4HM0 B;  2XH9 A;  2UUG C;  3I56 3;  1YHQ 3;  2ML6 A;  3LTA A;  4NRE A;  4PEJ A;  4EYC A;  1NJI 4;  1IQX A;  3UNL A;  1HZ1 A;  1LOX A;  1VQ9 3;  3IMA B;  4J9A A;  3GZB A;  5KP4 A;  2P05 A;  1LQG C;  3BNC A;  2O9U X;  1PFP A;  2CFW A;  1GYB A;  3FG4 A;  4L8P A;  1YJ9 3;  4ILF A;  1VQ6 3;  3GRD A;  1VQ7 3;  5IEO A;  5EVH A;  1ROA A;  1RGA A;  3CNM A;  4KT3 B;  1OF5 B;  1YJN 3;  3K0Z A;  5BIR A;  1O7H B;  2OOV A;  2XFS A;  4FMA A;  5AIF A;  1GOY A;  1DE3 A;  1QAL A;  3DGL A;  1BRS A;  3GSP A;  1HKX A;  7GSP A;  1US1 A;  2RBI A;  2KCD A;  1KWI A;  2QGU A;  1UCL A;  1WTH A;  3HIG A;  3SED A;  1TTO A;  3PGB A;  2W56 B;  1RN7 A;  3HOH A;  1D6Z A;  3CD6 3;  1M9G A;  4RBN A;  2CWV A;  1MGR A;  4RNY A;  3OWY A;  1M90 4;  4X2O A;  3D3L A;  1DMN A;  4X2H A;  2KF4 A;  1K41 A;  4RNZ A;  2E2V A;  5ELJ A;  1RRH A;  1FGT A;  1BRI A;  3FCS B;  1UI7 A;  1CQS A;  5M18 A;  3I55 3;  1D6Y A;  2M7O A;  3DGN A;  1FGO A;  1LVN A;  3WA2 X;  5AEU B;  1J2B A;  3ZG0 A;  1LOY A;  2RNT A;  3CPO A;  1WNH A;  3L0R A;  3K9M C;  5JPP A;  4R9L A;  2SBL A;  2AAD A;  2CIU A;  2CWU A;  2WOF A;  1HYF A;  3IPT A;  3OX9 A;  1JZO A;  1DMM A;  3CMA 3;  1T2I A;  3NHX A;  4J5K A;  1TP6 A;  2Y74 A;  3NBJ A;  1YI2 3;  5IG0 A;  3EBT A;  1K8A 4;  2YX9 A;  1BNI A;  3EJV A;  3BNE A;  1JB2 A;  3PS8 A;  3RGR A;  1Q86 4;  2V1L A;  1VQQ A;  1BSC A;  3X41 A;  1ULI B;  1Q40 B;  1MNL A;  2B24 B;  4MMX B;  1RRL A;  3CCQ 3;  1ISK A;  3Q3F A;  3LTD A;  3LH4 A;  3B4O A;  4HBR A;  1PU4 A;  3AHW A;  1AY7 A;  2ZHX B;  5BXQ A;  1BUQ A;  2F99 A;  4BIR A;  2CFG A;  1BNS A;  3PYJ A;  3KN4 A;  1LOV A;  3M8C A;  2K3D A;  1RGL A;  3UJM A;  4U13 A;  2E2U A;  2CX0 A;  3AGO A;  1BSD A;  2BO9 B;  3EQQ B;  1UCI A;  3NUV A;  1BRK A;  1IK3 A;  3UL6 A;  4EC6 A;  2OTL 3;  1N8Q A;  1O7G B;  1GS3 A;  1UUV B;  1MWR A;  3F7S A;  1K73 4;  1OH0 A;  1YVS A;  1BRJ A;  2GEX A;  3MG1 A;  1W4N A;  1KQS 2;  2LQV A;  3FKA A;  4N6V 0;  2CX1 A;  5CLK A;  1Q82 4;  1DVD A;  3SXX A;  1K9M 4;  1MOL A;  1VQN 3;  1RNB A;  3O8Y A;  1RHL A;  5ELU A;  4BU4 A;  3OWS A;  1NNV A;  5BVB A;  5AI1 A;  1WMN A;  3G8Z A;  1V74 A;  1SII A;  1LXE A;  3SX1 A;  2Q07 A;  3LTB A;  3WMD A;  2YFI B;  2R41 A;  6STD A;  2GEY A;  2XGL A;  3V98 A;  1A90 A;  1V58 A;  1QVF 2;  3PXM A;  1QAF A;  1IQ8 A;  1IQY A;  3BB9 A;  3KCH A;  1SQW A;  2P0X A;  4HYZ A;  1E3R A;  1RMS A;  1UI8 A;  4HM7 B;  5HOH A;  5TGN A;  4LSO A;  4N6O B;  2XGN A;  4FCZ A;  1W2Z A;  4MMY B;  1FUS A;  1BNG A;  1I2G A;  4CPK A;  1STD A;  4MJD A;  1X1W A;  3UL5 A;  1BGS A;  1GMQ A;  1OPY A;  3G6E 3;  3AMO A;  3B7C A;  1UCJ A;  3LT9 A;  4FCM A;  4RZM A;  1Q7H A;  2CC3 A; 
#chains in the Genus database with same CATH homology
 3ALA A;  1NO3 A;  2Z77 A;  4K61 A;  3ECF A;  2Z7A A;  4N6N B;  3T0U A;  4AEQ A;  3QK9 A;  3CCL 3;  2CH9 A;  2O3O A;  2BMO B;  1OCV A;  2C11 A;  3KSP A;  2Y73 A;  1EQK A;  4GL6 A;  2BMQ B;  4R4K A;  1EG9 B;  1IV9 A;  5IEP A;  4KFD A;  1G96 A;  2RFR A;  5IER A;  2WOH A;  3WOF B;  3G71 3;  3FF2 A;  2CFL A;  3SOY A;  2ZDJ A;  4HJL B;  5FGO A;  3HI7 A;  1O7N B;  2W2C A;  3EN1 B;  2CK3 H;  3DZL A;  1RKY A;  5AIH A;  5LC6 A;  2HMJ B;  1JNQ A;  2IA7 A;  1CYV A;  3X40 A;  3S27 A;  3EBY A;  3NXJ A;  4KFE A;  3OXA A;  3Q2P A;  4N3V A;  2YFJ B;  3QRD A;  1OGZ A;  3MPH A;  1GY5 A;  5IG4 A;  1DYU A;  3MHE A;  2IUJ A;  1JN5 A;  4L7K A;  3V92 A;  3KSE D;  1NB5 I;  2ML5 A;  3N54 B;  3FG1 A;  3ER7 A;  3NBR A;  2PZV A;  1JRQ A;  2E2T A;  2HML B;  2R4I A;  2F98 A;  4HZB B;  4R1K A;  1ULJ B;  3WOE B;  4K90 B;  2GBW B;  3B4P A;  4J8T A;  4XB5 A;  4MEI A;  1W6Y A;  4XDV A;  4XBY A;  3NQY A;  3A76 A;  3X3Y A;  5EQL A;  1VQ5 3;  1OHO A;  2A15 A;  4WYK A;  3NX0 A;  3GZR A;  1M1K 4;  1E97 A;  1FGQ A;  3OWU A;  1IVX A;  1Y4K A;  3WDG B;  2MC8 A;  1A67 A;  1IV7 A;  3AMO B;  4L8O A;  4WFO A;  3IJE B;  1FA3 A;  4N6T A;  2BT3 A;  2CHC A;  2IUK A;  3T8U A;  4N6U A;  1L5G B;  1YIJ 3;  3DXO A;  3F40 A;  4ZM8 A;  3VF1 A;  3X3X A;  1VZZ A;  4R80 A;  4CDL A;  1S72 3;  1STF I;  2KXG A;  2HMN B;  1AVL A;  4IT7 A;  3NBB A;  1KD1 4;  3LOY A;  4FMC A;  3CC7 3;  2KRT A;  3F9S A;  1TFK A;  4GB5 A;  4HM4 B;  4O8S A;  1OGX A;  4LEH A;  4WHA A;  3KKG A;  3MG3 A;  2OQE A;  1SIH A;  4O2H A;  1VQP 3;  1IVW A;  3BND A;  4JF8 A;  2GU3 A;  1RJO A;  3I0Y A;  4H61 A;  3CCV 3;  3NM2 A;  2RSX A;  2I9W A;  5D82 A;  1IVV A;  3RGA A;  3T8N A;  2STD A;  1EA2 A;  1GD3 A;  4NHF A;  3VGN A;  4OVM A;  4OUQ A;  5AII A;  3FH1 A;  3EHC A;  5JPU A;  1LNH A;  3KII A;  4HM2 B;  1A2V A;  5KP1 A;  1IDP A;  3CC2 3;  2P0M A;  4EBG A;  2XFT A;  1U8C B;  1W02 A;  1QJG A;  1TUH A;  2B1X B;  4K1V A;  4N6M A;  4R9K A;  2CKF B;  1DMQ A;  3X42 A;  1WMP A;  1TU5 A;  3SVA A;  2GBX B;  4HM8 B;  4HVN A;  2CG1 A;  1JN5 B;  5IW9 A;  3LTC A;  3U1W A;  2MF7 A;  1KC8 4;  4Q53 A;  2XRX B;  1E3V A;  1UW1 A;  1UUW B;  1VQL 3;  4CCV A;  3FF0 A;  3JUM A;  3CXC 2;  5IF6 A;  3DUK A;  2XR8 B;  3BLZ A;  3NM7 A;  4JRF A;  3PZW A;  1FGM A;  5EEO A;  4FR9 A;  1ASK A;  3PCR A;  2CFK A;  1Q7Y 4;  5JBS A;  5HGR A;  3H3H A;  5AEW B;  2ZL8 A;  3CC4 3;  2W0Q A;  3GAX A;  4WYK B;  2OQE C;  1IVU A;  3FZW A;  1WQL B;  2BMR B;  3KE7 A;  5KP3 A;  4BTY A;  1CEW I;  3F8H A;  1W00 A;  3MKI A;  3MWZ A;  3Q90 A;  3DGM A;  4H3U A;  3U97 A;  5KP4 A;  3HX8 A;  2JDI H;  1GY7 A;  1Q81 4;  1YJW 3;  3G4S 3;  4FMB A;  3JUN A;  3EN8 A;  2XEP A;  1IT8 A;  3UB1 A;  3SOA A;  2JQ5 A;  3DMC A;  4EXR A;  3KZT A;  1ZO2 A;  2XSH B;  2K54 A;  1N9E A;  1HU9 A;  3JVC A;  5CF1 A;  4OK0 A;  1NWW A;  4XBX A;  1W01 A;  3CCR 3;  3G16 A;  1JKG A;  3G0K A;  4FCJ A;  1VQ4 3;  2PNC A;  3CCU 3;  3HK4 A;  3VSY A;  1VQ8 3;  1NU3 A;  1Q42 A;  2INX A;  3EE1 A;  1ROV A;  2IMJ A;  1DVC A;  3J7Y d;  1JB4 A;  3MG2 A;  5IG5 A;  4TX4 A;  5DRV A;  1TIJ A;  1W5Z A;  2QIY A;  2WGQ A;  2W04 A;  2W9P A;  2D42 A;  1FGR A;  2K0M A;  1N8R 4;  2L4V A;  3CCJ 3;  1JJ2 2;  3S5C A;  1A2K A;  3CPW 2;  4N6L A;  5AYR B;  4LGQ A;  3S28 A;  4AKZ A;  1D6U A;  1OAC A;  3NV0 A;  2YFL B;  4KFF A;  2GXF A;  3WA3 A;  2BHM A;  2LYX A;  1GD4 A;  3DY5 A;  5IG3 A;  3E99 A;  1WMO A;  3DGO A;  4HM3 B;  3KFQ C;  5A0O B;  4BTW A;  1IT7 A;  1R4C A;  1OUN A;  1JB5 A;  1VQM 3;  2C10 A;  2FGT A;  2WGO A;  1O7M B;  5CXO A;  5STD A;  3CCS 3;  4IIA A;  1QVG 2;  1QVF 2;  1TFO A;  3EX9 A;  4KZ1 A;  4XDW A;  1W6G A;  2CWT A;  3S29 A;  5DRE A;  4HM1 B;  3OV4 A;  5AYS C;  2BNG A;  5G2G A;  3PCS A;  1NB3 I;  1YGE A;  2FXT A;  3FSD A;  2QEX 3;  3GWR A;  4HZ9 B;  1EKM A;  1W2B 2;  1K28 A;  4I4K A;  2GU1 A;  3F8X A;  3Q1C A;  1ZX2 A;  3K5T A;  1QAK A;  2CG0 A;  3LML A;  3LYG A;  4IPB A;  2HMM B;  4ORL A;  4EV2 A;  3F7X A;  1O7W B;  1N5H A;  5CF2 A;  2OTJ 3;  4AKY A;  4XM4 A;  2OOV C;  3EB8 A;  3F14 A;  4G1M B;  1U5O A;  7STD A;  4BTX A;  3CME 3;  1W7C A;  1M1X B;  1NDO B;  1OF5 A;  3LT8 A;  3LXU X;  3TDG A;  3OW2 2;  3B8L A;  3N9H A;  2XF3 A;  3JUQ A;  3GZY B;  1GY6 A;  1SJW A;  1AR0 A;  1JV2 B;  2CFD A;  2Z6B A;  1JKG B;  3S67 A;  4LMI A;  1YVB I;  5D83 A;  4MMZ B;  1OHS A;  8CHO A;  3K63 A;  1VQK 3;  2XSO B;  2F86 B;  2W56 A;  2D1W A;  3CU3 A;  4O02 B;  2QA4 3;  2OCT A;  3HZP A;  3CCM 3;  3BNB A;  3JUO A;  4HKV B;  1OHP A;  3LZA A;  1KSI A;  2W9Q A;  4STD A;  3EC9 A;  3RDE A;  2UX0 A;  3DM8 A;  3FLJ A;  2W6J H;  3HII A;  1T5Y A;  1IU7 A;  2HMO B;  3FG3 A;  4LZI A;  2OWP A;  2RGQ A;  1AV4 A;  4HM6 B;  5CK6 A;  1AVK A;  1N9J A;  3N8B A;  1W6C A;  2FNQ A;  3D9R A;  3NV0 B;  1C7H A;  3ROB A;  3V99 A;  4K1U A;  1N5P A;  2W03 A;  3STD A;  3CCE 3;  5AIG A;  3CNX A;  1VQO 3;  1SPU A;  1S5A A;  3MSO A;  3MYT A;  1Q40 A;  3K7C A;  1F8N A;  3X3Z A;  4QWT A;  4FMD A;  1O7P B;  2RCD A;  1QMA A;  4WP5 A;  5LC7 A;  5I97 A;  4EV5 A;  3EF8 A;  2WO0 A;  1Z1S A;  3SLU A;  2HMK B;  2CW9 A;  3NQZ A;  2P09 A;  3FGY A;  3H51 A;  3JUP A;  2Z76 A;  4WWU C;  4XBT A;  3WOD G;  3GZX B;  2P38 A;  5FW5 A;  1CYU A;  4O3V A;  1FUW A;  5D81 A;  1YIT 3;  5IEN A;  4KVH A;  4HM5 B;  4HM0 B;  2XH9 A;  3I56 3;  1YHQ 3;  2ML6 A;  3LTA A;  4NRE A;  4PEJ A;  4EYC A;  1NJI 4;  1IQX A;  3UNL A;  1LOX A;  1VQ9 3;  3IMA B;  4J9A A;  3GZB A;  2P05 A;  3BNC A;  2O9U X;  1PFP A;  2CFW A;  1GYB A;  3FG4 A;  4L8P A;  1YJ9 3;  1VQ6 3;  3GRD A;  1VQ7 3;  5IEO A;  5EVH A;  1ROA A;  3CNM A;  1OF5 B;  1YJN 3;  3K0Z A;  1O7H B;  2OOV A;  2XFS A;  4FMA A;  5AIF A;  1QAL A;  3DGL A;  1HKX A;  1US1 A;  2KCD A;  1KWI A;  2QGU A;  1WTH A;  3HIG A;  3SED A;  3PGB A;  2W56 B;  1RN7 A;  1D6Z A;  3CD6 3;  1M9G A;  4RBN A;  2CWV A;  4RNY A;  3OWY A;  1M90 4;  4X2O A;  3D3L A;  1DMN A;  4X2H A;  1K41 A;  4RNZ A;  2E2V A;  5ELJ A;  1RRH A;  1FGT A;  3FCS B;  1UI7 A;  1CQS A;  3I55 3;  1D6Y A;  2M7O A;  3DGN A;  1FGO A;  1LVN A;  3WA2 X;  5AEU B;  5JPP A;  3CPO A;  1WNH A;  3L0R A;  3K9M C;  4R9L A;  2SBL A;  2CIU A;  2CWU A;  2WOF A;  3IPT A;  3OX9 A;  3CMA 3;  1DMM A;  3NHX A;  1TP6 A;  2Y74 A;  3NBJ A;  1YI2 3;  5IG0 A;  3EBT A;  1K8A 4;  2YX9 A;  3EJV A;  3BNE A;  1JB2 A;  3PS8 A;  3RGR A;  1Q86 4;  2V1L A;  3X41 A;  1ULI B;  1Q40 B;  1MNL A;  2B24 B;  4MMX B;  1RRL A;  3CCQ 3;  1ISK A;  3LTD A;  3LH4 A;  3B4O A;  4HBR A;  1PU4 A;  5BXQ A;  1BUQ A;  2F99 A;  2CFG A;  3PYJ A;  3KN4 A;  3M8C A;  3UJM A;  4U13 A;  2E2U A;  2BO9 B;  3EQQ B;  3NUV A;  1IK3 A;  3UL6 A;  4EC6 A;  2OTL 3;  1N8Q A;  1O7G B;  1GS3 A;  1UUV B;  3F7S A;  1K73 4;  1OH0 A;  2GEX A;  1J2B A;  3MG1 A;  1W4N A;  1KQS 2;  2LQV A;  3FKA A;  4N6V 0;  5CLK A;  1Q82 4;  1DVD A;  3SXX A;  1K9M 4;  1MOL A;  1VQN 3;  3O8Y A;  5ELU A;  3OWS A;  5BVB A;  5AI1 A;  1WMN A;  3G8Z A;  1V74 A;  1SII A;  1LXE A;  3SX1 A;  2Q07 A;  3LTB A;  3WMD A;  2YFI B;  6STD A;  2GEY A;  2XGL A;  3V98 A;  1A90 A;  3PXM A;  1QAF A;  1IQ8 A;  1IQY A;  3BB9 A;  1SQW A;  2P0X A;  4HYZ A;  1E3R A;  1UI8 A;  4HM7 B;  5TGN A;  4LSO A;  4N6O B;  2XGN A;  4FCZ A;  1W2Z A;  4MMY B;  1STD A;  4MJD A;  3UL5 A;  3G6E 3;  1OPY A;  3AMO A;  3B7C A;  3LT9 A;  4FCM A;  4RZM A;  2CC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...