1GYCA

Crystal structure determination at room temperature of a laccase from trametes versicolor in its oxidised form containing a full complement of copper ions
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
499
structure length
499
Chain Sequence
AIGPAASLVVANAPVSPDGFLRDAIVVNGVFPSPLITGKKGDRFQLNVVDTLTNHTMLKSTSIHWHGFFQAGTNWADGPAFVNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDNESTVITLTDWYHTAARLGPRFPLGADATLINGLGRSASTPTAALAVINVQHGKRYRFRLVSISCDPNYTFSIDGHNLTVIEVDGINSQPLLVDSIQIFAAQRYSFVLNANQTVGNYWIRANPNFGTVGFAGGINSAILRYQGAPVAEPTTTQTTSVIPLIETNLHPLARMPVPGSPTPGGVDKALNLAFNFNGTNFFINNASFTPPTVPVLLQILSGAQTAQDLLPAGSVYPLPAHSTIEITLPATALAPGAPHPFHLHGHAFAVVRSAGSTTYNYNDPIFRDVVSTGTPAAGDNVTIRFQTDNPGPWFLHCHIDFHLEAGFAIVFAEDVADVKAANPVPKAWSDLCPIYDGLSEANQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACCASE 2
publication title Crystal Structure of a Laccase from the Fungus Trametes Versicolor at 1.90-A Resolution Containing a Full Complement of Coppers.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 142
structure length 499
sequence length 499
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gycA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gycA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gycA03
1AANA 1ASQA 3N55A 4F2EA 4G7SB 4KNTA 5EHFA 4G72B 3QJTB 2VW7A 4GY4A 1SJMA 1WA1X 3EH3B 3PAVA 1A8ZA 4NERA 3S3CB 3ABMB 2W8CA 3ZX1A 2X87A 1AS8A 1EHKB 5B1KA 5B7MA 2FJSA 2I85A 2YAEA 2QPDB 2VM3A 1A4BA 2VW6A 1J9QA 3TASA 3S8GB 3FPYA 4G7QB 4K9JA 2GBAA 5AZUA 4E9XA 3GXUB 3C75A 1AS6A 4DP7X 2Y69B 2UXTA 2RACA 1AG6A 2YXWA 2XV3A 1BXUA 1L9RA 4DPBX 3CG8A 2DV6A 1GS6X 4HZ1A 5I26A 1OE2A 5F7BA 2PP9A 4E9YA 1A3ZA 3DKHA 1ET8A 3X2QB 1V55B 1WA2X 3ASNB 3MX0B 4DP8X 1KCWA 2PPCA 3NSCA 1JZGA 1KGYE 3EHBB 4KOCA 4YVNA 2FQEA 4FAAB 1OCZB 1J9RA 1PAZA 4BWUA 2YARA 1FFTB 4A2DA 2HLEB 3SBPA 3QJRB 1SDDA 3S3BB 4BWWA 1BQKA 1T5KA 3DIVA 3ASOB 4EF3A 1E5YA 1FA4A 3DTUB 1L9TA 1NIDA 1ZV2A 1OCRB 1SFDA 5I6OA 1TEGA 2XYBA 2IWKA 3NJIA 4L0PB 1ASOA 3JT2A 4YSRA 1XMEB 1BAWA 4A2EA 2N0MA 1ZDSA 1MZYA 1ZIAA 1JZHA 2QDVA 4KNUA 1JZEA 1XB3A 3FT0A 2Q5BA 1A4CA 4ZK8A 5IY5B 2IWEA 1NIFA 4HAKA 4YSOA 4NAJA 3FSAA 1AZUA 2HRHA 1BEXA 1PNDA 4DP9X 1MDAA 1L9PA 2WO2B 1URIA 4ENZA 5D4IA 1ADWA 2FT7A 1E65A 2BP8B 4DP4X 4W1TA 4YSSA 5D4HA 1ZDQA 3CVBA 4Q8BA 2XXFA 1KBWA 2HRGA 3PLYA 2TSAA 4BDVB 3T6VA 1M56B 3QJUB 1IUZA 4KNSA 3ZDWA 1IBYA 1NIEA 4YSDA 2PP8A 3CVDA 4F2FA 3EH4B 2IH9A 2R7EB 2PPEA 2EIKB 2BP0B 4AKPA 4DP0X 2FNWA 2JXMA 3QQXA 3UADA 2DYRB 3AG1B 3NJKA 1SF5A 2FQGA 2IWFA 2DWTA 4P5SA 5B1JA 2BWIA 2GSMB 1V10A 3EF4A 3KW7A 2PPAA 4A68A 1M57B 1CUOA 2PPDA 1W6LA 3NP4A 4A2GA 1A65A 3ZIYA 3FQ2A 2BZ7A 1IC0A 3NJFA 2Q9OA 2I7SA 2FT8A 1JZIA 3NP3A 2GHZA 1L9SA 4AX3A 3FU9A 1AZCA 3NJMA 4DPCX 1VLXA 4E9TA 3NJNA 3ABGA 3UGEA 1AZRA 1RCYA 3G5WA 5I28A 4KOBA 2H3XC 4HCGA 5I6LA 3IEAA 3BVDB 3V9EA 1NICA 4GP4B 2J5WA 2IAAC 2ZWNA 5B1AB 4JHVA 1ID2A 4UAHA 5B1JC 4KO7A 4BXSV 1X9RA 3PAUA 1R1CA 3OQRA 1GS8A 1FWXA 2GC4C 1AAJA 3CZUB 3L45A 3T9WA 1WS7A 5FC9A 3RYMA 1N68A 6PCYA 4PAZA 7PAZA 1GS7A 1OOWA 2IDFA 5A7EA 1AS7A 1AG0A 1AZBA 1L9OA 3FYIB 5B7EA 2WSDA 2XV2A 4E9WA 5LDUA 2BP8A 2AZUA 4HCIA 3WKPA 2IH8A 2XU9A 2XVBA 4BDVA 4G71B 1UATA 2XV0A 1AQ8A 4F7KA 1DZ0A 1L9QA 5I6KA 2R7EA 2XUWA 3NT0A 2J55A 2CCWA 3CDZA 5I6MA 1IKOP 4RH4A 1WA0X 2IDUA 2VSKB 1OCOB 1NDTA 1PY0A 3UACA 3N2JA 4HHWA 4YL4A 5I6NA 1J9TA 1KBVA 4BXVA 4M3HA 2AVFA 1OE1A 5AFAA 2YAMA 3T6XA 2TSBA 5PCYA 3NSDA 8PAZA 3TA4D 1QNIA 3QJQB 2VM4A 6PAZA 2OV0A 2YAFA 2B3IA 2FQDA 3S8FB 5I5JA 1F56A 1XB6A 1SHWA 1DYZA 3UABA 2BW4A 1NPJA 1RKRA 2E86A 3MBWB 2MRYA 3U25A 3AG3B 7PCYA 1EZLA 2B08A 2JFCA 2EINB 1E30A 2XX0A 2YAQA 4HCFA 1J5DA 4YSPA 1JZJA 2XXGA 3GYRA 1NIAA 4E9SA 2XX1A 3OMIB 3GDCA 2WO3B 3ABLB 4G70B 2HX8A 1GW0A 3ERXA 2PP7A 4YSUA 3KW8A 4YSCA 5ANHA 2ZOOA 4A67A 3ABKB 1SF3A 1GY1A 2P80D 1GR7A 3NJLA 1J9SA 3FSWA 3D12B 4GXFA 1ZPUA 3NJGA 1KYAA 4CSPA 3WNIA 4DP2X 1RZPA 4YSEA 3NYKA 3AZUA 3QJVB 1BQRA 3PXLA 1PF3A 3SBQA 3AY2A 3ZBMA 2Y1AA 2UXVA 1AR1B 4GP5B 2GC7C 3X1NA 4DPAX 2VW4A 3S3DB 1BYOA 1CURA 3FSVA 5I5IA 2ZONA 2YAHA 2YQBA 2X88A 1JERA 2PCYA 1KDIA 1M9WA 4N8UA 2DYSB 1X9UA 3AG4B 1BQ5A 1CYWA 2FT6A 1JVOA 3H56A 1OF0A 4KO9A 4N4YB 1MG3C 2IDTA 4YVUA 3IN2A 3JTBA 2ZXWB 1NWOA 2I7OA 3TBCA 3WNJA 1AZNA 1AOZA 2BO0A 1KDJA 3CVCA 3WI9A 2GIMA 4MFHA 4X4KA 3X1BA 2BHFA 4HALA 4HIPA 5B3SB 1PCSA 1NIBA 2UX7A 5I6PA 4YSTA 1HAUA 4FA7B 2BZCA 2P80A 4QKTA 3X1GA 4W9ZA 3EH5B 4G7RB 4HHGA 1BYPA 4AZUA 4PCYA 2BW5A 1KV7A 2YAOA 2IDQA 1GY2A 5PAZA 2CJ3A 9PCYA 1OE3A 3NJHA 4A2HA 2CUAA 1TEFA 4E9RA 1CYXA 2HX9A 4UF7C 3IE9A 1YLBB 1PZAA 2FTAA 3NSYA 4NB7A 4Q89A 3FU7B 3V9CA 4E9VA 4WKXA 5I5MA 4JKNA 1HAWA 1CC3A 2HX7A 1JXFA 2NRDA 5F7AA 3AW5A 3FQ1A 4UANA 2VSMB 3QJSB 3T6WA 1ZIBA 4DP5X 1NINA 4DP1X 2BP0A 5B1BB 3HB3B 4DP6X 1ET5A 1PLCA 3TBBA 2EIJB 1AIZA 2FWLB 4KO5A 2CALA 3OMNB 4M4RB 2QDWA 3WG7B 1OCCB 1BXAA 4AKOA 2XLLA 4E9QA 1ETJA 3BQVA 4QLWA 2DWSA 5AKRA 2HZHA 2XWZA 1V54B 3NSFA 4A66A 3H4FA 3TU6A 2YAPA 3FS9A 4BK5C 4GYBA 1B3IA 2JKWA 3PCYA 1PLAA 3AG2B 2FQFA 5TK2A 2EILB 2MTAA 1PNCA 2YXVA 1BXVA 1W8EA 2GI0A 3FSZA 1TKWA 1JXGA 1MZZA 1JXDA 1W6WA 2OJ1A 3T71A 1E5ZA 3IN0A 2UX6A 1ILUA 2AFNA 1SFHA 3FU8A 1NZRA 3SBRA 1TU2A 2QT6A 1AACA 2AANA 3X1EA 1WAEA 2UXGA 2PCFA 1XB8A 1N70A 1PLBA 1A4AA 1NTDA 1PZBA 5D4JA 2CAKA 1QHQA 4BWTA 3OM3B 3T6ZA 2VMJA 3UAEA 2BWDA 5TK4A 1PMYA 1GSKA 3FYEB 4P5RA 2HXAA 5B7FA 4WTQA 1I53A 1GYCA 1ILSA 3WIAA 2VN3A 1KCBA 1WS8A 2IDSA 5E9NA 3FQYA 2H5UA 1JVLA 3PAZA 3OD3A 1HFUA 3H4HA 4CSZA 1NWPA 2GB2A 3SQRA 2J57A 3NJJA 1SNRA 3FU7A 3UAAA 1E67A 1SDDB 3IBOA 2W88A 4A2FA 3CDZB 2UXFA 4KO6A 4TXVB 3WKQA 1RZQA 2LLNA 1ET7A 1JOIA 2H47C 2EIMB 2OCCB 4AKQA 1QLEB 3QPKA 2PPFA 4YSQA 2QPEB 4GP8B 4YSAA 2A3TA 4AI7A 1J5CA 3PPSA 3X1FA 1MG2C 1ASPA 1NPNA 1IBZA 4JHUA 1JZFA 2J56A 2DY2A 1SHXA 1OV8A 2PLTA 1PZCA 2CBPA 3FPXA 3HEIB 2AZAA 3OMAB
chains in the Genus database with same CATH superfamily
3N55A 1WISA 1RZGA 3FTVA 2Y6SC 3SCMA 3FZUC 3BI9X 3DSNA 3KPNB 3QFJE 4LEXL 3BZEB 3WMSA 1WA1X 4K5OA 5MP6L 4NKOA 1BOYA 1LO4L 3DYPA 4UQ9A 4YLQT 3DDGA 3UG3A 4WNSA 3BH9A 3HFMH 3OB8A 3VA2C 1HVXA 1FPTH 4J4PA 1M7IA 3GRBA 4X6DA 5DEJA 1ACYH 1QAWA 2NY7L 1H9DA 3C6LC 2BXYA 3LEVL 4OAWA 4IBUA 4MJ2A 1T03L 3BSZL 3GSNL 4XOBA 3VXPB 3NBNA 4E9XA 4ELKA 3QNXB 4A6YA 4NP4L 2VXTH 2HRPH 3C75A 5HHMD 4K5NA 5CN1A 2Z4QA 4GAYA 2AS5M 4MZIA 5C0DA 4PS3A 5C71A 2RQEA 4BZ2A 4K4KA 2OTUB 2E6JA 2X0VA 2B39A 4WTWA 3WLWC 2FB4H 3OX8B 3ULVC 3WIFB 3L3DB 2ITDB 4C54A 2H6UA 5DQJA 2EE3A 4P46A 5F9WB 3BYYA 5ALCH 3UG5A 4RMRA 5AYUL 2BJMH 4DIXA 5EF2A 2CXGA 4MNHA 1JZGA 5L6YH 3IFOB 3UBXB 3ZYZA 5HGHB 3DGDA 5CHNB 4JFXB 5A2FA 1UFGA 5E0FA 2F15A 5C0GB 5CZXC 5JW4M 1Z5HA 2YMOA 5D2LB 4S2SA 2DIJA 1X5YA 1AQMA 3FN0L 3KPLA 5HHOD 4ZYKA 3IFNH 3D6GA 1CL7I 4XR8C 4F91B 3NRFA 4Q56A 1DJGA 3DIVA 3I2CH 5GSRA 4DGYL 4ZJ9A 1NIDA 2MQGA 2B59B 4LGRB 1U8LB 2X1OA 3NJIA 1CVSC 3WTVA 5F1OB 1I3GL 3IDIB 4AJYV 1OAUL 2BVQB 2NTSP 3U2SA 1AY1H 4MNGB 2F53D 2E9IA 2J4WH 1BD2A 1YNTA 3R1GL 1MZYA 1Q94B 3GMLA 4KNUA 1IVLA 1W72B 1WFJA 1XGTA 4ODHH 5CJOH 4FMKA 4IU3B 5AW4B 3UIZA 4CUCA 4P5KA 5C0JB 3EOTL 5LBSL 1FSKB 3FQUB 2DIBA 3K74B 4HAKA 2XWBA 2ZUVA 2ZUTA 4FL4C 1BEXA 3MBEA 4NT6B 5CCKL 3NABL 2HWZL 3T0EB 4YSSA 3A22A 3CVBA 5I82A 3BZEA 3KPNA 4JQXA 4XZ4A 2QKIB 1M56B 4MDIB 3IPFA 1PW3A 1NIEA 4PI2A 4ZUTB 1IAIM 2KBGA 2OX5B 5LBVA 1EMTH 2Y7QB 4AKPA 4DVRL 3DV6B 3BCDA 4X6CE 4HIHB 2R2BB 3VXPA 5CKAA 3QWRA 4OZIB 2ZUSA 5C0CB 2DWTA 3VI4E 1V10A 4JDTL 4JGNA 2LGNA 1A7PL 5I75B 4FABH 5JUEL 3P73B 1MOEA 3H3PL 4HT1L 5HVWA 2EEXA 2OTUA 5HYJE 2VXQL 3ZIYA 3OX8A 5EO1B 3WIFA 1U8NB 2PCXA 3QCUL 2BZ7A 2H1PH 2ZKWA 3CCHB 2G2NA 4XWOD 1L9SA 2QADB 3QDAA 5GRYA 3IFOA 3UBXA 1VLXA 1FGNL 1XGYH 5CHNA 4JFXA 2YMTA 4F7EB 4JGUA 3L4VA 4X6DF 5C0GA 2XETA 2LU3A 5ES4B 1NBQA 4PN6A 4HCGA 3D0LB 3GMRB 3HIZA 5D2LA 1M1XB 2ZWSA 1T5XB 2IFFH 4HHAA 5IVXE 4HF5L 4BHUI 4YL9A 2ZOUA 4KO7A 2EXTA 2B59A 2GBUA 1EEUA 1UHVA 1U8LA 3W1ZA 1HKFA 4GRWF 4CADB 4G6AC 4L5FL 3AFLA 5DYOB 3IDIA 4MNGA 4LF3B 3L45A 1DLFL 1Q94A 3H9SD 3NIFF 1W72A 2JE8A 3NAAH 3S36X 3U9UB 4IU3A 5EA0H 5KAQF 3FQUA 4LSQL 3SYAA 5BO1L 2NSMA 2FSEB 4R97B 4NT6A 4N6QA 2WXLA 1WFIA 3T0EA 5JHMA 2IH8A 5AALA 1CJYA 5I8KH 3DX3A 2E7LA 1CN4A 3N0PB 2QKIA 5EU6D 4F57H 4MDIA 1A14H 4G8GE 2HFGH 4UNIA 1A1NB 4PRID 4XMPL 1L9QA 4ZUTA 5F7EL 4KITB 3LKPB 4TQPA 1GC1H 3QDME 2OX5A 4PI0A 3UMNA 3V0WH 4AC4A 4L29A 5CF3A 4XO8A 2H9GB 1IIKA 1YNTF 5BQDA 4U1SB 4ELME 3TZVD 1RERA 2CCWA 2R2BA 1IKOP 2XBZA 1XBRA 1WA0X 1PZUB 4OZIA 1RZJL 1P7QB 5C0CA 5EUOB 2NNAB 3I6LE 4JPVH 4KZDH 1CTNA 1AHWB 1KTKE 1KYOK 2XWCA 3MOBH 4UZUA 4HHWA 4PJCE 1BMWA 4HKZB 3D48R 5SX4I 5AFAA 1A3RL 4UOW1 4XWOC 4WSKA 1KN4H 1U8NA 5EO1A 3TVMB 4Q4IA 5IQOA 3CCHA 1KTCA 1XSIA 2NCEA 1AE6H 5CSBA 2XSKA 4AYDC 2VR7A 2QLYA 4NXSA 4PPTA 4DW2H 3HI1B 4F7EA 5BRZE 1R3KB 1QFUL 2WLHA 4ZSOE 1W0VB 4KUCD 3D0LA 3GMRA 3QWOB 1JZJA 5IVNA 1M1XA 4WU5B 1CU4L 4HJSA 3WEBA 1T5XA 4H1LG 2VC2L 1X5XA 4ABUA 3ULUH 4HUUB 4NYLB 3GDCA 3APNA 2GTZB 3CN3A 2B1AH 1ZT4B 3QDJE 4R5TA 1YNLL 1ZTXE 3ARWA 3P54A 4IKIA 4CADA 5AVYB 3SE9L 4ATTA 5IHUL 4JAMB 5C0AB 1CGVA 4O2FA 2V9QA 1I9RH 4MDRA 3ZTNH 4K3DH 1CDHA 3K6IA 4RDBA 5T1KD 2P52A 4Z7AA 4LF3A 1ZLSH 3NJLA 3SSGA 2XJLA 1RZFH 4R0LC 4OJDH 5CLXA 2D7OA 1VF5C 3UTPE 4GSDH 4NQCE 3U9UA 2VZTA 4R6UA 5TDOB 4PCSA 1HZKA 1BIHA 3PXLA 4XNZB 2Y1AA 5MEQB 2FSEA 3VH8B 3KGRA 2EYTB 2YUZA 1CE1H 2WB7A 5SWZD 3CH1B 3II2A 4UTAH 4XBPB 4HZAA 1TTCA 4OLWH 1PGRB 3HI6H 4PLKD 2OL3B 1A1NA 2I32A 4I77L 2AF2A 3CBJB 4MSWB 1AVAA 3CXHJ 3TZVC 1A5FL 1R75A 3EYQD 1NMAH 5F1SA 4DVBB 2H9GA 2R83A 3TX4A 2IDTA 1KY6A 3IN2A 1AFVL 5EG6C 3HBQA 2PCFB 1P7QA 2F74B 2PW2A 2NZ1A 3X1BA 4ADJA 2NNAA 4L4VB 3D05A 3L3JB 4ZFZB 1AHWA 3CJJA 2DI9A 4NM4L 4KROD 2F7RA 3FUDA 2R1YB 4LSSH 1F11B 4TSCL 4HKZA 3KEDA 4G5AA 1BZQK 5BXFB 3RWEA 4OM0H 2XC8A 3TVMA 1TSRA 1HKLH 3ME0B 2OW6A 2Q2LA 1X5MA 3RKDD 4D8PB 2XT1B 2I5YH 1RZKC 2FDBP 1D7CA 3HI1A 4LLDB 1G1YA 3EJCA 2VKWA 1R3KA 4R4FH 1NMCC 4LPYA 5E7BA 3V6OC 4CILA 1V3MA 1W0VA 2F58H 2NW3B 2NQCA 3PPEA 2K9FB 4PP2B 1E6OL 3QWOA 3CHPA 3C2SA 1KPRB 4XPBL 1PDKA 4WU5A 5I74C 4OZIF 2VMEA 5EEZA 5FM5M 1R47A 4HUUA 3MLXL 4NYLA 5IFAL 2F19H 2GTZA 3AWFA 2OXGA 1HYRC 4ES8A 5C0AA 4OFPA 1RAMA 4QRRB 4HUKB 3T2PA 1TQUA 1YEKL 3WAKA 3WHE1 3ZZLA 3K72B 1OCCB 1BXAA 2KLTA 5D1QE 1QRNE 2H3NB 2F5AL 4G1EB 3K2UL 1QWUA 4LSDA 5DLML 5TDOA 1X5LA 3WNLA 3IS0X 3NSFA 4N2BA 4RFNB 1JGDB 1SBSH 2NYYD 3CDFA 2YD8A 5L2KE 1F00I 1F1DA 4LCWD 1ZS8B 4O02B 4QGTA 5MEQA 3UAJA 5I1HH 2EYTA 2JKWA 4IGBD 3IPBA 5GS2D 3CH1A 3DVGB 4F20A 4LKXB 4PLKC 5DUML 3TJPA 4BV1A 2JI3A 3FSZA 3KPTA 2OL3A 1JXDA 5FUCE 4MSWA 2CR0A 3LDBC 3K8MA 5TE7H 1ETZB 3VVWA 3MJ9H 4DVBA 4N8VG 1BV8A 3ARDB 1VAHA 4NUMA 1I9IH 2VDKH 2PCFA 1N70A 2BOBB 2F74A 1ZVYA 1ORSB 2CAKA 4LSPH 3WL9B 2WVUA 2GG1A 5ISZB 2GEEA 2GY5A 4L4VA 4MJIB 3F7VB 4ZFZA 4H26B 1IMHC 1L7IH 2R1YA 5KYUB 1F11A 1T83C 2YZ8A 4YDJB 2KPNA 5ITFB 5AB0A 5HHPB 3RKDC 2EVJA 3EJJX 4PV8A 4M8VA 3CFTA 4FERA 1CE6B 2X28A 3S98A 2FE0A 3ME0A 4RESB 4F7CB 2ADYA 1F90L 1QA9B 5D96B 3ZTJG 4DCQB 4LEBA 4UM9A 1S78D 1F42A 3BUPA 3BGFC 3IRZA 4LLDA 4WIQA 3O9WA 5E6SB 2DS4A 3V2AR 3TV8A 4XO4A 2BRRH 2NW3A 5DQDH 5IJDC 4PP2A 3E8UH 4FF9A 4PJ8B 1KPRA 1EO5A 2BP3A 3IJ8A 1IU1A 5EUOF 2PCPB 4HMDA 4HPOL 3VFPB 1MAMH 4TXVB 5DMIL 3EJQA 3RGHA 5KJRH 2ADJA 1CDJA 4XPHL 1IGJB 3SGDI 4UI2A 3BKYH 2D9CA 3REWB 4GMSH 4KMTH 4QRRA 2WXKA 2YQGA 4AI7A 2OM5A 5E2UH 5ERWB 4YDKH 3K72A 1U92B 2V9TA 4OQ1A 1QHPA 1BVNT 2WVTA 1NPNA 3VJ6A 5A1AA 3FQRA 2H3NA 3KE0A 4G1EA 2QZQA 2NYYC 4KDWA 5AKVA 4Q6YA 1HZHL 3L9EA 1JGDA 3TWYA 4FD0A 2AXWA 4IGBC 3RL1B 4XOCA 2R9HD 1ZS8A 2VO8A 4O02A 5IB5B 3IJSB 4UIKH 5LCVA 3N42B 3HE6D 3R8QA 4WO4D 2YKLH 1IM9D 4ODSL 4IJ3C 3US0A 3W82A 4LKXA 4R7LA 4HVBA 4EZMA 2I9LB 4DNLA 2JMRA 2QELA 1BQHG 2ESVB 1VHPA 1UM5H 5CIPB 4PP1D 2QBWA 4HGMA 1AI1L 2YUWA 2Y24A 1U2CA 3VXSD 1ETZA 1OAZL 4LCIH 1XSJA 1EERB 3N1QC 3T6QC 3HNTL 1FYTD 3GSXB 2YBGA 1NCAH 2BOBA 3WFCH 2VR3A 4J6RH 1ORSA 4KI5C 5ISZA 3WL9A 3ZHLA 4MJIA 1U91B 5E2TL 3F7VA 4H26A 5GPRA 1FIGL 5SV4A 4I7ZC 4Z1PA 5KYUA 4YDJA 5F7BA 5ITFA 5D2NE 4EOWL 5HHPA 4X7SH 3NZ8A 1ET8A 2ATAA 2DJUA 5DHXB 1CE6A 1OWWA 4F7CA 2AXGA 5D6DA 4HWBA 1Q9WB 1QA9A 2FH8A 4DCQA 5HPMB 3K8KA 4PYGA 2FQEA 1S5HB 3QCTL 5IG7B 3CSBA 1S9WB 4XE0A 1RPUA 2F68X 3VXQB 1F3DJ 3QJRB 4P2RB 4EN3A 4PJ8A 5KSAD 2MNWA 3T1FB 3UP1A 1ROCA 3NFNB 2PCPA 2IV9A 1FA4A 3BESR 3VFPA 5JYMA 4ZFFB 5I6OA 1WVZA 4HJGB 3GMNB 3MLSH 4HJIA 4TSBL 4Z78B 3JT2A 1QTSA 5J13B 4FQCL 3B7UX 2K7PA 1NCCH 1KGJA 4XMKL 2JJSC 3WS3B 4FI7A 2ZUQC 5ERWA 2YPLB 4RVBA 3SO5A 1U92A 2WZPA 4M56A 4A55A 5I1GL 3QUHA 2BWQA 2X6AA 3OKKB 4G6JH 1A4CA 5AOMA 2AJZB 4Q0XH 5IT2H 2F08A 2R9HC 3CSGA 2YKKA 4NAJA 3MC0A 4IJTA 2FECL 4WO4C 1LQSR 1HE7A 4U6VH 3RL1A 4ODVH 2WQRA 3D5OF 4EUPH 5IB5A 3IJSA 5D4HA 4ODUB 4W9GC 3RI5K 1RZKL 1HXKA 1J48A 4NQVB 4YHMH 2I9LA 3F7KA 2R1WB 2ESVA 1MHEB 1CD8A 5J1TC 2R15A 1HDMB 1XL6A 3BT0A 4XNUL 2CM5A 2KC0A 1MFAH 3WKYA 2V7HB 5FIEA 4X7FC 4XNYH 2E3VA 5KVDH 2FWOB 4I48A 3GSXA 2BWIA 1MI5D 2J7LA 2XA3A 1CXLA 2E9GA 1U91A 5AZEL 5C08B 5IB4B 5LNDA 3GI8H 1NCIA 3NOIA 2Y1ZA 4MJ6B 4K9EC 5B8CC 3K71B 1IC0A 4FNQA 3I6SA 4J3OG 5TFSL 4NHCL 3H42L 2DQCL 5F3HB 1E9QB 2Y3AA 3CFDB 4HH9B 1AZCA 3G7TA 4XP9L 2P9RA 3D3VD 3P2TA 5HPMA 2M2DA 1LWRA 1S5HA 2X4OA 4M5YH 5AVVB 5IG7A 4DFHA 3HI5L 1S9WA 4X6FB 1MJJB 5KSAC 1CLZH 1J8HD 4PFEA 2FGWH 4PJ9D 4EPSA 4P2RA 1DJYA 1UOWA 3FCGA 1FNSH 3BKCL 3T1FA 2W9LA 2F7PA 3NFNA 4RAUB 2OMNA 5TE6H 3MV9D 5I1DB 1JAEA 5FYKE 4HJGA 1XIWD 2AP2A 3GMNA 3PHSA 3DBXB 4Z78A 4YX2L 4B9JA 5CBEB 4ANWA 3WS3A 3MLVH 4XAWH 3D30A 4E42B 3UO8B 2YPLA 2GTWB 3DVNB 2IGFL 1JK9B 5CGYD 1Q1JL 3DJTA 1G7MB 5F6HJ 3A6CL 3V4LA 1HNGA 3GHBH 1A1OB 2XZZA 2LHAA 2X1PA 3BSHA 3FQTB 3FYIB 4N2LA 5C7XH 3U1QA 1SLWA 2VDQL 3L5HA 3UFIA 2AJXL 1N12A 5SX5K 2HB0A 3RWGB 3WKPA 1KCRL 2H0FA 2Y2YA 4R7VA 3CSYB 2M8XA 4QR7A 4A6YH 3I3BA 4ODUA 1QYGL 1ZS2A 4OBRA 4OZGB 1LWHA 4WV1B 3DROB 4NQVA 1UXSB 5SWQB 5C0IB 3PXJA 4WEUD 1NJ9B 3HKZA 1RURL 1UH3A 3GSRB 1MHEA 1B2WL 3FQ4A 1HDMA 2AK1H 4LESA 5FGCB 2JJVA 1DN2A 2OK0L 5D7LB 1E4WL 1DBAL 3OAUH 4IRZL 2DL2A 3D18A 2PXYB 4UNVA 3VSUA 1RUML 2FWOA 2FO1A 4FNLH 4KTGA 4P23B 1PD6A 4ZTEA 3RAJH 3S35H 5TPWH 5EO9B 3V52H 3EH2A 3PWPE 5C08A 3NPSB 5IB4A 4HC1A 3U6RB 4PGZA 3ZRSA 2WBJD 4ZW3A 8FABB 1M7DA 1U8PB 4TL5A 3N42F 3K71A 5C7ZA 2ZX7A 2Q0ZX 2MFNA 2VM4A 1BX2B 4JPKH 1TVHB 1E9QA 3CFBB 3CFDA 1ZV5A 4IK7A 2FO8A 1O5PA 3WO4C 3MV8B 1JN6B 3SE4C 3DX2A 3J07A 4PJ9C 4G3YL 4X6FA 2X12A 3DLQR 1MJJA 2GJZB 3CZKA 2XXGA 2ATPB 3L1FA 2IJ0C 4FJ6A 9CGTA 1XIWC 3KM2A 1IGIL 4RAUA 3KPSD 5GGTH 6TAAA 5I1DA 4YUEH 3VG0H 1A6TB 5E24E 3DBXA 4FMVA 3EDKA 4HQQL 1EXGA 4D9LL 4KPHH 5CBEA 5F96H 4NFBA 5CGYC 1EDQA 1H6TA 2ZOOA 3SOBH 4AGMA 4E42A 3DVNA 2GTWA 2E8YA 2OR9H 1JK9A 4A1RA 3QS3A 3SCMD 4V1DD 4U6YB 3RIFF 1G7MA 1Z1WA 2PWHA 1EDHA 3FH8A 4OZHB 3AZUA 4PD4K 1A1OA 1AO7D 5E8NB 4MA7H 5E6UB 2E6PA 3TS8A 2DQTH 4GP5B 1Z5LB 4DPAX 3W57A 2W9EH 3S3DB 3RWGA 3D39B 1KYDA 5EZIL 4LRNH 4TPRL 3CSYA 2FCBA 2ZONA 2YN5A 1WO2A 1U41A 4OZGA 2V5TA 3CFJA 4WV1A 3DROA 1UXSA 2DYSB 1OHQA 4RQQB 5SWQA 4CDGC 1X9UA 4XMZA 4M3JA 1NJ9A 5C0IA 3GSRA 2LABA 3IU4H 2VDMB 5KBDA 1YZZA 4XPGL 1GIGH 1NCBL 5D7LA 5SV3A 2WQAA 4ZUVB 1D5RA 1SOKA 2Y25A 3TBWB 4GKZB 3KHOA 1EGJA 3QQ3B 2BO0A 1J7VR 3FUFA 2X2JA 4ZOEA 2LLLA 2GIMA 1LEGB 4P46D 2AV1A 3C09C 2WBJC 4CSTA 2BHFA 4HIPA 4UT6A 2DBLL 2WVSA 5CEYB 4FG4A 5I6PA 1HAUA 1SZNA 4P4KB 5CSGA 2BS8A 3U6RA 3X1GA 8FABA 1UQSB 1U8PA 2NX5B 1BQLL 2Z34A 3QRLA 2C26A 4Y4FB 3SGKA 5JHDB 2MPVA 1KLFA 1TJIH 3AU0A 1SMOA 1GY2A 1YN6B 2CJ3A 1BX2A 3AT8A 5HI5D 1R5VB 1TVHA 3CFBA 1MWAH 2DM4A 1ZEAH 1AHMA 3MV8A 4YHIB 1JN6A 1S9VB 5D1ZB 3V4UL 1A7NH 5F9OH 4X9GA 2GJZA 1MNUH 4PB0H 4D8OA 2FJUB 4W6YB 3QRFM 3CMOL 2ATPA 1BQSA 4M8QA 2DAVA 4ZW6A 1YEFH 3NZHL 3QZMA 3RURA 4G11A 3ZSSA 5CLYA 4M48H 2NW2B 2IGLA 5KOVC 3HMXH 1A6TA 4B27A 5DD5H 1GKEA 1JGUL 2R29A 3VFVB 2NXZB 4J23A 3SJVA 2FWLB 4KO5A 4H25B 3VGBA 1CICD 3MBED 3PP3H 4Z7VA 1E5UI 3SCMC 2R27A 1USZA 4Y2DB 4YDIH 3RX9A 4PGJA 4U6YA 4OI7A 4OZHA 1IGYA 3B9DA 1IZJA 4K9EL 4Y19B 1IKNC 4HEPG 3NJVA 5EV7A 1SDAB 4M1DL 2NT1A 3B34A 1Z5LA 4NJ9L 5F2FA 3D39A 2FIRT 3U9PH 4H0GA 4C56D 1FBIH 5CFHA 4FQJL 4GMTL 4PRDB 1TENA 3LOWA 1EIBA 2R69A 2ZYSA 3DPDA 1Z3RA 4TYUA 4UILH 4PJ7B 1ZA6B 2QFRA 2V2WB 3O2DL 4RQQA 2OJ1A 2IADA 4HCRA 3VFGH 2BFVH 1BM3H 4Q7DA 4DZ8B 5JOPE 3K1DA 2GHWB 2IBZX 3TBWA 4GKZA 5CNHA 4P46C 1FZJB 3UO1H 4BA0A 3AACA 4X6DE 1UACL 4R84A 4ZFOB 1FC2D 1CK0H 1LEGA 1OPOA 2O72A 3ECBA 5DVKA 5ADOH 2BWDA 4P4KA 2GI7A 4P5RA 3N6YA 2HXAA 1UQSA 1UYWH 5MENB 2NX5A 3KPMB 3QDGE 4X8CA 4Y4FA 5HI5C 5KVFH 5JHDA 1D5BB 2C9SA 1IGFH 1A1MB 3AQDA 2XWXA 4OZGF 4NN5B 2G0LA 3POCA 5E2WH 3S37X 2WQVA 1KCBA 1R5VA 3BH8B 1WS8A 4LLWB 1XXDC 2XFGB 3TLRA 3MV7B 1S9VA 4R8WH 3GGWB 5D1ZA 4JO5A 1YHPA 4UIMB 4AW4A 3NIFE 1AGBB 3X17A 2A6JB 2R2EB 4Q9BA 4KZEL 2UZIH 4N8PA 1CF1A 2UXFA 3VYPA 5FOJA 4JFZH 1UKTA 3D85B 3VW3H 1RUAH 1VCBC 3APFA 3MUHL 1YEGH 1OSYA 4WCYH 1SLUA 4FZ8L 2NW2A 5D7KD 2A9AA 1JGIA 1CICC 3MBEC 4YSQA 4GH7B 2ROYA 3GXNA 1GW6A 5DJXB 2QZ5A 4GO6B 4B6ZA 1OTUD 4TNVK 4V33A 5HI3C 1P4IL 4JQXC 5CD3B 4Y4KB 3VGAC 2DQGL 4Y2DA 5DD0L 1TQWA 4I85A 1ACZA 1BFSA 2DY2A 3HVDA 4CSSA 1N7ML 2R2HB 4GG6B 4Y19A 1BD2E 1AD0B 1QI3A 1QUNB 3LY6A 4OT1H 3RUGB 4OR1A 5FCUL 1MFVA 4BUQA 3GS4A 1UWGH 4M6NL 4DUXA 4OF6A 2ED8A 4JY5L 3ATEA 5HHQB 1A8ZA 3KAAA 4PRDA 5C0BE 3S3CB 1MCHA 4FKKA 3CVHH 3QAZB 3PRZA 4PJ7A 5DYFA 3U79A 1UH2A 1ZA6A 4MD4B 5B7MA 2E76C 2FJSA 2AQQA 2DQIL 2V33A 4BQBA 5LVEA 4KK8D 3IDYC 2Q1EA 4DZ8A 1U30A 2B4CC 3I9PA 1FZJA 5F9WC 4LLYB 2CBOA 4OZHF 4ZFOA 3QZOA 3VFWB 5JIPA 1JTTA 4OCRH 3OGOE 2C4FU 4OF8A 4B7IA 2L3BA 3JWNG 3LXCA 5B3NA 5MENA 5LWYH 1BQUA 4EBQL 3MGOA 4XCCL 1D5BA 2FH6A 1WA2X 1A1MA 4LBEB 3QPXL 4QTIH 3BH8A 3UG4A 4LLWA 3EADA 3KLSA 5T3ZE 1UWXH 3MV7A 4BWUA 2J5LB 1ZLUH 1UC6A 2V8MA 2W07B 4PHXA 2BY1A 4UIMA 1AGBA 4FJYA 3OJVC 2A77L 2R2EA 4DFIA 1RUQL 2EH7L 1F45A 3AXIA 2BM3A 5GRJH 3MLTB 3D85A 5BV7C 2CUMA 3MN8A 4ZRGA 2AKRB 3ZT7A 2P8PA 1Y0LB 3VD0A 1IGCL 1N10A 3GTNA 5H8DA 4GAJH 3H55A 4RA0C 1OTUC 2YGVA 2ZCLL 3VSTA 4UTBL 1FCGA 2FX9H 3U6XS 5JIIA 1KJ2B 3TWCH 1FYHB 3EG9B 3RWJB 2Q8BH 3D9AH 5CD3A 1XB3A 4Y4KA 1SLXA 4JG0H 5JIHA 4F7TA 4XC3L 2Y5TB 4RX4D 1RUKL 5IY5B 2E8ZA 4HW6A 1NDGB 1IC7L 2E7BA 2R2HA 4GG6A 1L9NA 1QUNA 1AD0A 1MCKA 5EZPA 2QQQA 3RUGA 5F9JB 1JP5A 1OAYL 3GSQA 5E56A 3QRGH 4TVPD 4W1TA 3RBSA 3FT1A 5DRNB 3WNPA 4JKLA 2C9QA 2WXJA 3FCBA 2EYRB 3WXWH 4JRYB 2HT3D 3LZNA 4HXAH 4BZYA 2P5EB 3ML9A 3P0YL 4ETYA 4YSDA 3ZL4H 2PP8A 3T0EE 4FNRA 4URTB 2J73A 2IH9A 4KK8C 1F97A 4LOVA 2HKFH 1RIVH 4I0PB 1OW0A 5F70A 4CSZA 3RPBA 1T1ZB 3MROB 4Y8DC 4ZTPL 5C3TA 4FFZL 4BFKA 5K5YA 3K3QA 3QHFL 4QTHA 5ENWB 2AEQH 4LLYA 5B1JA 3KLKA 2G5RA 3SPCA 4LVOB 3VFWA 3BRGC 3GI9L 3PGFH 4G1MB 1F3JB 4AEIH 2QVTA 2G3ZA 4NN6B 3RY4A 4OZIE 1TYRA 4Z3TA 3RVUD 3WTUA 4BSVB 5HY9A 3SD2A 4IRSD 3V95A 1ZWIB 3KD4A 4NKQB 3WHE0 3NJFA 2Q9OA 4U7KA 4RRPA 4AOFA 1KCUH 2JKIS 5AVRB 3DXAB 4LBEA 4PJ7F 2ZXAA 1KNOB 1X44A 2J8UB 3UGEA 5H37G 5C8JB 3IDXL 5FF6A 2Y2TA 2JKTM 3LKNB 4MX7B 3CV5A 3W38A 3NA9L 2W07A 4PWEA 3TOPA 1OTTD 1P0SE 2CBQA 2GJJA 4LL9A 3AWGA 3N85H 4L37B 1INQB 2FX7L 4LB8A 1J12A 1TQBC 1A4KB 2N1KA 4MXWL 2A9MH 4BFJA 3TNNB 4DHLA 3MLTA 3PAYA 4BZ2L 4OD3H 4UOJA 2AKRA 4LARH 1Y0LA 4A63A 1XR9B 1DR9A 1IIIA 5GJSH 3WEOA 5LQBL 4GW5B 3LNDA 4WKZB 1E7UA 4BCYA 5KN5B 4D9RD 1NAKL 5D71L 1JF5A 5I1CH 2ZKXA 1KB9J 3EG9A 3RWJA 7PAZA 4NM8H 4W9JC 2Y5TA 1JZDC 4J3VA 4U05A 2ITCB 1NDGA 1K5NB 3L3KB 4S0HA 2BNQB 2IANE 4TUUA 4J3SA 3LJ3A 2N1TE 5F9JA 1ERNA 2ZIDA 3MU3A 3FU6A 4HCIA 5INDB 2HT3C 3O45B 5DRNA 3ZN6A 3BZ5A 4KDVA 2EYRA 3M07A 2KDGA 1KXTB 3HE7B 3L4XA 1CFTB 2P43B 3I9GL 3N41B 1P7BA 5ALBL 3DRQB 3FMGH 4I0PA 3RILA 4L4VD 4NZRL 5DJ6B 5I1KL 3HAEB 1T1ZA 3MROA 3QVAA 4BKSC 1ZV9A 1EAPB 5AVZB 2UV3A 4JE0A 5ENWA 3S3SA 2A6KB 3RVUC 4NQXB 5LXGL 4G1MA 1F3JA 4IRSC 5DRWB 1BEYL 3RUGF 1HHIA 2Y07H 1HTYA 3GLAA 4UM9D 4HWEL 5EUOE 4BSVA 1ZWIA 2YAMA 3T6XA 3U0TA 3O9WD 4CVUA 1IAIH 4DT2A 4DTGL 3V8CA 5IBLD 1KNOA 2BW4A 5C8JA 4ZMVA 1YN7B 1OTTC 4O2EB 1NCGA 4MX7A 5I8EB 2B08A 3QXVA 1IT9H 4JFDE 3LQMA 2B1HL 4L37A 1INQA 2D0FA 1FP5A 4QRRD 2AXJA 4BK4A 3ABLB 5GJTH 3TNNA 5F7WC 1P7HL 3PL6B 1QEXA 1XR9A 2B4CL 4XNZC 3CN1A 5FUOL 2WQUA 3LZQA 4GW5A 1HEZB 4BQCA 3ASWA 4WKZA 4DSYA 5EC1B 4YWGL 3ABKB 4OZ4B 5KN5A 4K8RH 3QORD 5AG9A 1H15B 1RXLA 2WNXA 5C0AE 3Q6GH 1Q72L 5CIPH 1RPQA 3MA9L 2WJ5A 3QJVB 4Q9RL 4PRHD 2ITCA 1DVUA 4JQIA 3FH5A 1K5NA 3L3KA 4KX9A 2BNQA 1M53A 5GHWL 1NL0H 2WWMD 3SDAB 4KWUA 5INDA 4P2QB 1OP3K 3H7BB 4PJEB 5A6LA 3BHBB 3O45A 4B97A 2E6QA 2UWEB 3QNFA 5IFJB 3GBML 3VSVA 3NH7L 1KXTA 4ZZKA 5I0DA 1G7IB 3HE7A 1CFTA 4Q9CA 3OKMB 2NNRA 3AWEA 1TF4A 4N2CA 1OLZA 1MRFH 4MJID 2EC8A 2H32B 4L3EB 5DJ6A 2Q76B 3HAEA 2APTA 3BC9A 1JWSB 2Q7NA 2ZXWB 3DETD 2KH2B 4YVUA 2ICWI 5AKTA 5BV7L 3BAYA 4JHWH 1CLCA 4ES9A 3KS0H 3PWJB 3BUYB 3OKEB 2YPVA 2A6KA 3QO1B 4CA4A 4IW4C 4JFHD 4ZUWB 1OPGH 4X5LA 5DRWA 2ERJB 3DI2B 3UBGA 2X4NB 3O9WC 1IQDB 2ZXDA 3EH5B 1A7OH 1HH9B 3SE3A 5L0QB 5JW3H 5T8IA 5IBLC 2BY2A 1DQKA 1WEJL 2IDQA 1NGQH 2OZ4H 4Z76B 4JN2B 4AV0A 1KZQA 4EN3D 3Q8FA 1MFCL 3ARBB 4LCUA 4NWTL 3RU8L 2A83B 3TCTA 3FCUB 4ANKA 3G5ZB 4K23H 2H41A 3VMNA 1YN7A 2H0JA 3N40F 4O2EA 5I8EA 2VR8A 1H9VA 4FLSA 1H3TA 4WW2B 1K5WA 2YOAA 2B2XH 2NRDA 1QRKA 3FTUA 1HHKB 4OSUH 1VIWA 2Y2WA 3MCLH 3ZE0F 3QJSB 2DQ6A 5CP3H 3VXTB 5FYKU 2GUOB 2VZOA 5GRUH 1AZZC 3PL6A 4RFNC 4M7KH 1CGYA 3QORC 4N0CD 3MLPA 5EWIL 1HEZA 2X6BA 4G59C 5BRQA 4ZI8A 5EC1A 4OZ4A 3U1PA 1H15A 1ETJA 2SEBB 1D5ZA 1QSVA 1J0JA 5DVLA 2J8UF 1HXMB 1V54B 4FZEL 1JPTH 4DOHB 2YA2A 2ZWZA 2YD2A 5JPMC 2WWMC 4S1SH 5D55A 4Z8FL 5EIIB 4NUGH 5I71C 1X4ZA 3V6BR 1GGIH 4DGVL 3SDAA 4P2QA 3H7BA 4PJEA 1QHOA 2DLTA 3BHBA 2F54E 2EP6A 4FRWA 2C9RA 1KPVB 1GKOA 2UWEA 3GNML 5IFJA 4K55A 2NY1D 1S5IH 3P30H 5BMFH 1G7IA 1KWKA 3LKQB 3FN9A 3LS5L 3V5HA 1Q9OB 2IOOA 2Y4SA 3OKMA 3Q5OA 4JO4H 1X7SA 3NCYP 5HI4C 3DETC 3MUZ1 1S7TB 1A64A 1E4KC 2H32A 4L3EA 4Y1AA 2Q76A 1RUPL 3NCWA 1JWSA 3GSVB 2AANA 4NZDA 2ED7A 1YNKH 4HXBH 5D6DC 4MYPA 3PWJA 5D96C 3OKEA 1HINH 3QO1A 3EJPA 4ZUWA 3NCBB 4YPGB 3H9HB 3N9GL 2GIXA 5GXBB 2X4NA 4ICXA 1IQDA 4JANB 1KJ3L 3C8HA 3BAIA 1HNFA 3U7AA 3KPRE 1TDQA 1HH9A 3VD1A 1O7VA 1TZAA 1RIHH 4EN3C 4RGOH 4Z76A 5HXMA 3NFSH 4JN2A 4TVPL 1IB5A 4Z7QF 3N41F 4P2RD 4YE0A 5E9NA 3ARBA 2AEPH 3G5ZA 3MNDA 4IM8A 1B3JA 4PJGB 5T1MB 2WQXA 4OQTL 4FS0A 1NUNB 1VFBA 4OGXH 2EIZB 2M83A 4DO6A 1HHKA 3NA4A 3MGAA 3PWVB 2ZX5A 1WBXB 3GMMB 3SGEI 4I0KA 2YPLD 3VXTA 2GUOA 1QLEB 1QMUA 2J1KA 5DT1L 4EXKA 2BSDA 4PH8A 3ZDXB 2DICA 3BISA 2BVYA 4AQAB 4DK5A 2JCCB 1JPFB 1DJXA 1ASPA 1CLYH 1YAZA 1BFVH 1YEEH 5K1NA 3FFCD 2PLTA 3N1FC 1EHXA 2NY0D 4R9HA 4X9YA 2VUKA 3EBIA 4Q14A 1DQML 3JUZA 5EIIA 2WP3T 3AS3A 3OKDB 4KFZC 1H3PL 3R06B 2V5SA 2Z0UA 2L7QA 2NY1C 1KC5H 3V4VH 4HETA 5BZXA 2Q8AH 3P1VA 3EH3B 5IFHH 3Q06A 1QX1A 1IV8A 4OI9A 4QHMB 4QXGH 3GEWB 3VNYA 2YBRB 3B5GA 1F2QA 3AMKA 1N8ZB 5CBAA 1Q9OA 2MPAH 3CIQA 4XPFL 5GS0H 3I50H 3SPJA 3APMA 1S7TA 4Z7IA 2ESVE 5C08D 1T04B 2E74C 2ZOTA 5J11B 1P53A 3GSVA 2Z91B 2HKAA 3BPOB 1R0AL 2QGBA 4F37K 5JXAL 1FO0B 3VXRE 2UXTA 1ZLVK 4OD1L 3VXMD 1QBLL 1TLMA 4YPGA 5ADPH 2W1NA 3H9HA 4JANA 4OCMC 3E9TA 3NTCH 4PJEF 2AK4E 4IRJD 3OF6A 4FN0A 4PB9H 2EEFA 3X2QB 5IP4A 1MFDL 2HJFB 2JELH 4I3GA 4G8FB 3GUTB 4OJYA 2YEQA 3ZTCC 2GCYB 3B5HA 1GYWA 4G6KH 1PAMA 2OMTA 5EZJB 1N64L 2R29H 3MRIB 4M00A 3FRPB 4PJ5D 4PJGA 4XN1A 4G6FD 3SDCD 5T1MA 2L0DA 2HLEB 2W0LA 3LB6D 4JX0A 1EWHA 3MACL 3F85A 5FHBH 1AKJD 3O2WH 2EIZA 4EF3A 4HSQA 3FL7A 3TXAA 2BX5A 3PWVA 1L9TA 3V5DB 5IQ7L 1WBXA 4LAJH 3GMMA 4P3DB 2JSFA 2EXSA 4DK3A 3A67H 1JHLH 3G5VA 3UJJL 3V0DA 1T7WA 4NQSB 1BAWA 2GQHA 4AQAA 2JCCA 1JPFA 2CHZA 4GRMA 4KRLB 4YAQA 1LK2B 1ZDSA 5DD6A 2Y7SA 1R3HB 2NY0C 3QXUA 5D72H 1SY6L 3W9DB 4HYTB 3GLZA 2A1WL 4YSOA 1KTLB 3GK8L 4GSXA 2VDMH 4XWGL 4K3EL 3B1TA 3GS0A 4OI8A 1ZE3C 3GBEA 4WW2F 3OKDA 4Y5XB 2ARWA 1W15A 1ZDQA 3B9AA 3R06A 1QSFB 3VD2A 2K4WA 4UTCA 4ZOAA 4N1HB 3PLYA 2DL9A 4KNSA 4QHMA 1ZGLM 4JFUA 2YBRA 4F2FA 3BPLC 3C12A 1AXTH 1N8ZA 1ZHKB 3ARGB 4WNQB 2Q10A 4K7FB 1BMZA 5LN4A 3X3GL 3P2DA 1E4XL 4HSAC 2J88H 5HYSA 5L2JA 2AJUL 3TESA 4CU6A 4WI0B 1K4CB 3UTQB 5E00B 1Z9MA 3EXJA 2CE6A 1T04A 5AG8A 5BVJB 1XDTT 4KKNA 2B16A 4ZODA 2GK2A 2Z91A 2JNZA 4FXKB 3WY2A 1KYOJ 1N19A 4O5LH 4XPAL 4LP5A 3SPVB 3QQ4B 4XP4L 1WSST 1MVFA 4RMVA 5J7CC 2V6HA 4C58B 4KRPD 3N91A 1L9MA 3RVXD 4Q52A 5LN8A 2J71A 3BOVA 1KUMA 4WI6A 3ARFB 3CZEA 2ICCA 4CN1A 1KEGL 4I3SL 2HJFA 2MQCA 1CIDA 4WO0A 4G8FA 2Y5EA 2DKMA 4LIQH 2K8MA 2GCYA 4AM0B 2BDNH 5FW6A 4KTYA 2CRYA 3ABGA 4HFUH 1A4JB 2A74B 3HMWL 3KDMB 3LB6C 4XE5B 4ZDHB 3SKUD 3PDGA 5E1HB 5I28A 2A9NL 4ZNCD 3MRIA 3CSFA 2NY3D 5CGBA 1RZ7H 4MXVF 2C9VA 2VXSL 4EJ1C 5I1IH 5K1JA 4FLHA 1UOKA 3QUYD 1HK6A 5T3XD 2DKUA 3SJVD 3V5DA 1ED3A 1KTJA 3BQUD 5A40E 1UXLA 1IFGA 4P3DA 3W2DH 1FWXA 4P9HL 3JTTB 3EYOB 1AJ7L 4NQSA 3SGJC 2CM6A 5DI8B 1LK2A 4PAZA 2WB1A 2WSKA 1R3HA 4WY7L 2EE2A 3ZDZB 5FOBB 5M94B 3ULUD 3W9DA 1KTBA 4OCSH 2Q7AA 3RHWF 1KTLA 3ZXAC 2KZWA 3VDAA 2B1OA 2C9PA 1T80A 4NQEE 4PJGF 5H35B 1M2VB 1EJOH 2AMUA 5ELIA 3RA7H 2DIEA 5DDHB 3H2WA 4OFKA 1NMBH 2GTQA 2P24B 3BVUA 1UM6L 4WNQA 1ZHKA 3ARGA 4OZGE 4BFFA 3ZDXF 4FFYL 2JCCF 1AQKH 5AAWC 4WI0A 1K4CA 15C8L 2H0PA 5E00A 3SYCA 3SGKC 1HS6A 5DO8A 5BVJA 3JUYA 1U36A 3NCJL 5E0QA 5FGCE 4B9PA 2CGRH 3TPUB 1S8DB 4FXKA 4Z7NE 2ZKHH 2AEOA 1Q0YL 5D7LE 3SPVA 1FL6B 2QL1A 4YFEA 4KRPC 3QQ4A 2BSEA 3RVXC 1CXHA 2OJZL 2VDRL 4YL4A 1DQLL 4X0NA 2XVGA 4LQ1A 1Q38A 4FEIA 1GC1C 4NUQA 2DOCA 2VGLM 2AVFA 2AV7B 2MIZA 1HE8A 3HRZB 3ARFA 3TC9A 1CBVL 1YJDH 1NC4D 4AMWA 2VKXA 4U3CA 5AYTA 4AM0A 3UABA 3UC0L 3FUKA 1A4JA 2A74A 3KDMA 4HEMA 1J18A 4ZDHA 1WFNA 3RY5A 3N5AA 2DPKA 4NFCA 2ZXBA 3VWKA 3QUYC 1CFMA 3MV8E 1LDSA 2LVEA 1S9XB 4EZJA 5DJ0B 3L48A 4RZCB 3W0WD 1MIEH 3W56A 1GW0A 3W9EB 1E2WA 2WP3O 2RJMA 3JTTA 1XD1A 3EYOA 3L1EA 2V17H 4Y19D 1VGEH 4KH2A 4QHNB 4Y2OB 3QG6B 4DKEH 5DI8A 3VB8A 3VXUB 1H5BB 3FFDB 3HFML 3Q44A 3ULUC 1FPTL 3I9IA 3FBQA 1ACYL 3S37H 4P8QA 4N2FA 3PQYB 1D2OA 3C60D 1A3QA 3K7UA 3SBQA 4UQBA 2N4IA 5H35A 2VW4A 1M2VA 2EECA 2VXTL 4OZHE 2HRPL 1A6WH 3T08A 4ZMTA 4LPUA 1G5AA 1WWWX 2UVFA 2EEBA 1GHFH 5DDHA 3T8MA 2VLMD 4DWHA 3LPPA 2XCMC 1JZ2A 2OI9C 1G6RB 5HGAB 3AG4B 3D39E 1FNAA 2P24A 4OFVA 5DLLA 3WUWB 1ZVSB 5CP7B 3WEMA 4HD9A 1TJXA 2X2YA 5ALCL 2BJML 5L6YL 4NKDB 4PGEB 2ZOWA 1NWOA 1X5KA 1X5JA 2XKSA 4V2CB 3TPUA 1S8DA 5F89B 1Z9PA 1H19A 3Q5YA 1FL6A 3M7OA 4P99A 3IFNL 2BZCA 1SVBA 4P2OD 3I2CL 2AV7A 4UT9A 1KV3A 2NPLX 1NLDH 2QPFA 3MV7D 3HRZA 2CCVA 1U0QA 5T5NF 3GF8A 5L4MA 1FG9C 3MOAH 4BKTC 4UMSA 5D1XB 3BLBA 4BA8A 2NX5E 1NOLA 3MLRH 4YZFF 4G83A 1AY1L 5JHDE 1JPST 2DQFB 2J4WL 1HN1A 2GAZA 3VTTA 2DEXX 2UUDK 2DM2A 3DK0A 1NEZG 3LRHA 4ODHL 1KJ2H 1WHPA 2EADA 2HX7A 5CJOL 1U2HA 2IEPA 1L6PA 4MKMA 3CN2A 3K46A 1S9XA 1CGTA 4L1BA 3TN0B 4XI5D 3P0GB 3P0VH 4FMFA 2J1ZA 5DJ0A 1OD9A 2VDNH 4LXFA 4LP4A 3T6WA 4RZCA 4LE8A 3C9NB 1NINA 4Y4KD 3W9EA 4POYA 4FCAA 3VDBA 3R19A 2CKBB 4XXCA 2A73A 3L3IB 4AUUA 4CMMB 3RIAK 3OJDB 4QHNA 3DURB 1D5IH 4Y2OA 5E9DE 1Z2KA 4X9FA 1JGEB 1XHHA 3QG6A 4DK6A 2I60H 3VXUA 1H5BA 3FFDA 5EO0B 5C07D 1S9YB 2K6ZA 1OAXH 4C47A 3CFUA 4KKPA 1OKEA 5DURB 1EMTL 1MFBH 5DWPA 1NEPA 3PQYA 4B95C 1H6UA 3L4YA 3GJFB 5AVWB 2QJDA 3BN9D 3NCYS 3OSKA 1F86A 5F1KC 3OAZK 3Q8CA 5HHNB 5EC2B 3F6IA 4MCMA 2IG2H 1ADQH 3E1ZA 5JOEA 4FABL 4E68A 3BPNB 1ESOA 3DRTB 2X6UA 2X1XR 3E3QC 1G6RA 5HGAA 3WUWA 3CX5K 2F61A 4D7PA 5E8DH 1WV7T 5A2AA 5CP7A 3D2TA 2H1PL 4PY7B 4F58H 1ZANH 4NKDA 4PGEA 1MCOH 1XGYL 4ZX4A 5KANG 3IGLA 1WAEA 4JUTA 3QI9B 4NN5C 3UH8A 3ZDZF 3WIHH 1MAJA 4JFOB 1C8QA 4P2OC 4JNXA 3WTSA 4JO3H 2VMJA 1LEKB 2IQAB 1VADB 5IOKA 5D7IB 1CQKA 1WTGT 4HISA 4WFFE 4IQHA 4AUYA 2ZUYA 1YEHH 2COQA 1A6VH 2VN7A 2ZJSH 3Q1EA 3BAKA 3O81A 5D1XA 2CO1A 5MENE 2F1EA 4WU7A 3H2QA 1AC6A 3W3BA 5DC2A 3CK0L 3OD3A 3MYZA 4OVVA 5GZND 2DQFA 2V5YA 3SQRA 1E67A 4U1IB 5C9KA 1A6UH 1MCDA 2O5ZH 4XI5C 4A2FA 1E90A 3FO1B 5IJCC 3QE5A 4Y4KC 3TN0A 2CNYA 3NSXA 1TVBB 2HN7B 3RVTD 5L8LB 2LVCA 1GGYA 4M03A 5CZKA 3C9NA 4MXQD 4OKDA 5I8KL 5IBTH 2CKBA 3L3IA 1J86A 4CMMA 2NY5H 4F57L 1S7UB 1BVOA 2BVTA 3X1FA 3OJDA 1A14L 2B3RA 1MREH 2HFGL 3DURA 3O4OC 4IHBA 3I75B 1JGEA 1QTPA 4M1CD 4JHUA 1JZFA 4NQUA 5EO0A 1V7NH 1GC1L 1SHXA 1GOHA 1OV8A 3MA7B 3V0WL 3BN9C 4XBEH 4LHUD 1KWGA 3OLGA 5LHDA 4MAYB 1AGDB 1RVFH 3GJFA 5IW3A 3GS7A 3OMAB 1V8HA 3K2KA 1F1AA 2VR9A 5HHNA 3QJTB 5L4IA 4JPVL 4KZDL 3PAVA 3MOBL 2BVUA 4WFHE 1COBA 2CLZB 1MHCB 5DJZB 3RUGE 4JFEE 4WJG3 1U4EA 1U6AH 5AAPA 3DRTA 3HC4H 5B1KA 5HYIA 2Q87A 1KN4L 1DBMH 1KLUB 1I1FB 1AE6L 5E1AB 4L9LB 5AZUA 4B0MB 4DW2L 4W9DC 5FUZH 3QI9A 2HH0H 1JV2B 2VLKD 2VQUA 4JFOA 1P5VB 3FAXA 4DPBX 4PWHA 2IQAA 1VADA 1LEKA 5D7IA 3E6HB 2W38A 2PP9A 3ULUL 2J5LC 4K3JH 1ZCRA 3E6FB 4GPVA 4PMFA 2B1AL 1NEUA 4N5ED 3LPFA 5AW6B 3GRWA 4Z7WB 4KOCA 4G42B 4U7SA 5GZNC 3KYOB 5AD0B 1I9RL 3ZTNL 4N6RB 1BFOB 5IQNA 1ZLSL 3TIEB 5JTWA 1RZFL 4E5XB 4U1IA 2YFNA 4F7PB 4GSDL 3FUIA 3TYFB 1SXZA 1DUYB 2WBKA 2JH2A 1HHHB 4BWWA 3PJNA 3RVTC 1H8OA 4PJXA 2CRZA 5LJYH 4MXQC 1U4FA 2VWEC 1SXAA 1TIUA 2XYBA 1TVBA 2HN7A 1CE1L 2NY4D 1RMFH 3EJSA 4JJ5B 3UTSA 4XPTL 5JNYB 4UTAL 1E6JH 4OLWL 2JKRM 4M1CC 3HI6L 3ZY7A 5FYLH 5GS1B 2ETWA 2V2TB 3NN8A 3I75A 3ZU8A 2CA4A 2Q5BA 5C2BL 3MODH 2DLFH 3MA7A 2A4EA 2ED9A 4HUCA 1NMAL 3VWJD 3T0DA 1PNDA 1VZHA 1MDAA 1W80A 2R2CA 5EPMB 2I9TB 4MAYA 1AGDA 3CXFA 5E5UB 2VZSA 2BP8B 3HS0A 3FOMB 2FVNA 2OCFD 4XP1H 2FJGB 5DSCB 4TSAH 3W5NA 3NRPA 1KBKA 3V0EA 4HAGA 2CLZA 4LSSL 1MHCA 4L4TD 5DJZA 3ATBA 3LSOA 4ABVA 2H7WA 1E3XA 2BIIA 3ARRA 4A7UA 1ZPLA 4OM0L 1HKLL 2DW5A 4NN6C 35C8H 2QPUA 1KLUA 4JRYE 3G5YB 2P5EE 1I1FA 3HC3H 2FNWA 1I7ZB 5E1AA 1Z6JT 4L9LA 2I5YL 4TUJB 1X6NA 2DLGA 3GSNB 2FHBA 4QJ5B 1KB5L 1NC2D 4R4FL 3IJEB 1IC4H 4OV6F 5DGQA 2F58L 4AL8C 4C4KT 1JV2A 3RGVA 1D7BA 3P3TA 1P5VA 2Z35B 3CVIH 3X13B 5I19H 1N5YH 1I8IB 1QSEB 2QFPA 4ODXB 5DZAA 3N1PC 3E6HA 1A65A 4N5EC 2IPUG 4ELDA 3BUTA 4UOZA 1KTRL 3E6FA 3ZE0E 1O75A 1EA9C 2F19L 3MJ7B 4W93A 5KW9H 4MA1B 4J27A 4XCFH 4XVOA 4GS7B 4Z7WA 2EO9A 4G42A 4DPCX 3KYOA 4E9TA 1M71B 1NCDL 2GVYA 3CLEH 4Z23A 4NS0A 5TQ2H 4N6RA 3VGHA 1BFOA 3LHPH 5HJ3B 5A6IA 3TIEA 1L7TH 1TUPA 3DXAE 1U8IB 1P1ZB 4E5XA 3MCKB 2J8UE 2XIBA 3L5JA 4F7PA 3QEGH 4Z0BH 2EDLA 5EBLB 4F93B 1DUYA 4JZOB 3JV5A 3RGBA 4N22A 1HHHA 1FN4B 1DCEA 2NY4C 1SBSL 3FQNB 2YZ1A 4FG2A 1F8TH 4RFEB 3SE6A 5I1HL 1H8NA 2D2OA 4YOKA 4ZW5A 4JJ5A 1QP1A 5JNYA 5SX4H 2ODIA 1TJMA 5T33H 2NMSA 5GS1A 3R4DA 2Y6TE 3E80A 1WG3A 3MFFB 5EU5B 1JZ7A 1X5AA 4NQQA 3VWJC 3ZE2B 3SDAD 5E4IA 5EF1A 4P2QD 2RCSH 5TE7L 3MJ9L 5E2VH 2WSDA 3FTSA 2XV2A 5EPMA 5HVHC 1SYSB 2I9TA 4QRAA 1I9IL 1CS6A 1OEZW 2BP8A 4JJHA 4G2AA 3FOMA 3HG3A 1WBZB 2X4TB 4LSPL 5DSCA 1GAFH 1J0HA 2BNQE 3MBXH 1L7IL 4K71C 4L3ED 4NBYB 4Y1AD 1CIUA 5SX5H 3CPUA 3AGWA 2VITB 1Z66A 4QCIB 5IEHB 4DGUA 1QFHA 2QQNH 3QP3A 4QRBA 4ZO8A 3B6SA 5JHAA 3G5YA 1F58H 3SE3C 4Z7QE 3PABA 2XUWA 4N86A 2J55A 1I7ZA 1A66A 3Q9QA 4TUJA 3OKNB 2IDUA 4Z3IA 3BSZA 3GSNA 3EF7A 3VE0B 2VSKB 5ESVB 4DAGH 3IJEA 3IAQA 2BRRL 5DQDL 5KEZA 1PZ3A 3E8UL 2VT0A 2Z35A 3X13A 1I8IA 1QSEA 4M3HA 4ODXA 3TV3H 3ARBD 5GRVL 3ZO9A 1MAML 3ES6B 2VISB 3WSQH 5KJRL 2AXFB 1JE6A 3GBLA 5HDLA 2YAFA 3MJ7A 3S8FB 4A37A 3VQLA 3BKYL 3ZIMA 1DYZA 2BH0A 4OLEA 5DJCA 4KMTL 1EO7A 1M71A 3BZ4A 1IAMA 3DV4B 3HG1B 5E2UL 3S6CA 4YDKL 1BLNB 3MRBB 2EO1A 5I0ZA 4IDLA 1T4KB 2JFCA 1WAAA 5HJ3A 2I25N 1U8IA 1P1ZA 5FYJH 5C6WH 3MCKA 3O3DB 1J1OH 1OB0A 1N6VA 2DLIA 4JZOA 1DFXA 5DUBB 4UUJB 3UJIH 2WO3B 3FQNA 5JW5B 2G5BB 2YD6A 1A9VA 4RFEA 4UIKL 1G4MA 1YY8B 3UBXG 2WZ6A 2XWJB 1YG9A 2F8VA 2YKLL 3LIZH 4UQCA 5HGDB 3SDAC 5L88H 3BXNB 2HPTA 4Z7WF 1C5BH 3MFFA 5FK9B 1KCLA 4CSPA 5ACMA 1EFXB 3RNQB 1XSKA 2DH2A 3ESPA 3ZRFC 4NZJA 1IE5A 4KXZI 4LCIL 5DR5H 1TPXC 3KLHD 5LBSA 5E6ID 1U3YA 2QSVA 1AR1B 1SYSA 4MMXB 5JDSB 2UZYB 3L4CA 1NCAL 1OL0A 1K4DA 2X4TA 4J6RL 3WFCL 4KVCH 4XMUA 4P05A 3UTTD 1LL1A 2YQBA 3PFQA 4WSGA 2F0CA 3T0WA 1FO0H 1UASA 4N8UA 2QR0B 4NNXB 4N26A 3EYFB 1I9JH 1TKWB 4ISVB 4N2MA 1YYLL 4JY4B 2FT6A 4X7SL 5FYLE 2EDBA 4QCIA 5IEHA 3O8XD 1C8PA 2K0RA 4TRPH 1E8YA 4KGJA 2WTOA 3SDDB 3UMTA 4M9PA 4A39A 2C4XA 4X6EB 2OPCA 4Z77B 1PD0A 3OKNA 3WI9A 1F41A 3BGMB 4HJJH 4JHZA 2CNZA 5CEXA 2ENPA 3OF6D 5ESVA 2PNDA 3I3DA 4XB7A 2V3FA 5A2CA 4FTVB 3ARBC 2ENQA 4RX4A 1QFOA 4BJLA 5AWNH 2VMDA 2PUQT 4FQIH 4UQDA 3IDMB 5FA3B 4CNIB 3ES6A 2YPKB 1U58B 4L2YA 5IBUB 2VXQA 2AXFA 1TCRA 3UEQA 3GJEA 3MLSL 4TUKH 1PTZA 3OSVA 4U1MB 4NSKB 1ODUA 2I07B 1NCCL 5E70A 3JWOH 3DV4A 3HG1A 2WIIB 5IMLB 3A21A 1BLNA 3MRBA 1T4KA 4AVKA 4W4OA 3S3PA 2Q3AA 1EV2E 4G6JL 3O3DA 4Q0XL 5IT2L 4JO1H 3HBPA 2HJKB 2UZXB 4QUOA 5FW8A 4LKCB 3DK2A 4UUJA 5EOQH 4UOQA 2VC2B 4HIXH 5JW5A 4U6VL 5FO9A 2G5BA 4ODVL 2O6EA 3FTXA 1YY8A 3QXTA 3C6LB 2XWJA 4KXAA 5B1BB 3PNRB 5HGDA 3TBBA 3W39B 4Z7UB 4LLVB 2CALA 2K9UA 4ZTOH 3VNZA 4AKOA 2X3CA 3BXNA 3FCSB 4Y9BA 1B4JH 5FK9A 2A9BA 3B8SA 4XB3A 3VSQA 3QXDB 1TTUA 3B9VA 3PV6B 1EFXA 5F0JB 3RNQA 2XN1A 5CAYB 5E6IC 5HDBB 3MLZH 1MFAL 1WAAF 1K2DB 3JWDH 3T8XB 2ICEC 4CU7A 4LNRB 4XNYL 5JDSA 1NQBA 1DZBA 2UZYA 1CBJA 2VMFA 1WIPA 3PGCB 2FQFA 3FTZA 3VA6A 4Y7MA 2UY6B 3Q3GA 3INUL 5J57B 4ZO9A 1PEZA 1AMXA 2E7CA 2QR0A 2ZAHA 3GI8L 3O8XC 3EYFA 1TKWA 4ISVA 4NNXA 3IMRA 3TFBA 4C4KO 1TETH 3N50A 4JY4A 3SGDH 3RFZC 4QHKI 3CUPB 2WGNB 3PDOB 4FQHB 3SDDA 2XQYA 2X4UB 3HB3D 3KH3A 3X1EA 3ZE2F 4M5YL 1F4AA 3FUNA 4Z77A 3BGMA 1MCPH 4IIZA 4U1NA 4F3FB 1E7VA 3UGXA 4JK0D 1CLZL 3VYNA 4FTVA 2FGWL 5JPNB 4NO0B 1FHNA 4MXVE 5F3BB 3FYEB 4POZD 1FNSL 1ZHBB 3IDMA 5FA3A 2YA0A 5TE6L 2YPKA 5KBPA 1U58A 1JTPA 4JKPH 7CGTA 4KQ4H 2VN3A 4XOEA 2BINA 3L9BA 3KJ6H 1DQVA 4PG2C 4NSKA 1FVCB 2I07A 4FL4B 1HCYA 3MLVL 2H3KA 2KZ1B 4XAWL 1P4LA 5IMLA 3FNKA 2VAAB 1TVDA 3VTAA 3D69B 3QR0A 3TM6A 1EZVY 3SE8H 4JZJC 1CLOH 4KKLD 3GHBL 3QUML 2DM3A 2HJKA 2UZXA 5CGTA 5C7XL 5J89A 1HZLA 4PJGE 3QAQA 4LKCA 2FYYB 2LLGA 2FHCA 3MNZB 5G4MA 1B2YA 2BPBA 4PLOB 2ALAA 4X8JB 3X12B 1QQDB 1X6LA 5SWSD 1B88A 3W39A 4LLVA 5HHMB 3ETBJ 1MHPL 4MB5A 3ET9F 2O61B 4P3CH 1MHHB 2ICWB 3FCSA 2K70A 1IBZA 5HDWA 2WYIA 3BSGA 4M1GH 1G9NH 2AK1L 4G7VH 1BMGA 3PV6A 2JCCE 4BFEA 4EDWH 5FYJE 4JPSA 4NBZB 4PTTA 1KMGA 2PWGA 4PSRA 2ZWYA 4JDEB 3OAUL 1K2DA 4F37F 5B3JF 3T8XA 4CGTA 4LNRA 2H2PD 4FNLL 3ARGD 4QHPA 2DQEH 2VW7A 2DN7A 3RAJL 3S35L 1SJMA 2CLVB 4KU1A 5TPWL 3V52L 5J11C 1WAPA 2UY6A 4KAQH 5E08H 3ZX1A 4JW3A 1LTXA 2X53A 4LSUH 4Z95H 1XV8A 4U1LB 5HHOB 2YAEA 4BK5A 1U8CB 3D4CA 2BSED 1D9KB 4JPKL 4DGIH 3CUPA 4FQHA 5GGRY 2X4UA 3VH8G 4F33B 2YWYA 2IPUK 5BZZA 1W8OA 3DOSB 2D7QA 4W9FC 4YBLC 2CUIA 1N0LB 2RACA 5TGBB 1AG6A 3ARFD 3CFIC 4F3FA 4POZC 4UYQA 4ZPTB 4JY6B 4Y16A 4NO0A 5JPNA 4N2HA 3GKWH 4J3OH 5F3BA 2E9BA 2IPKB 2LAAA 3MRJB 1ZHBA 3BWUF 1KG0B 1O7DE 5FFOA 1JNJA 5IUCA 5GGTL 4DP8X 3MSPA 4CJ0A 4LVNB 1OARH 2DLHA 3VWKD 3MOQA 4YUEL 3MUJA 3VG0L 4JKKA 4J6IA 4XAKD 3RLSA 1QTYT 4F9PA 4KPHL 4FAAB 1OQXA 5F96L 3SOBL 2YRLA 4RBPK 5GGVY 1GPOH 2VAAA 1F4WH 2W60B 3D69A 1FUNA 1TTAA 2OR9L 4KKLC 2XPYA 1K72A 3CFMA 1E4XI 3HUJB 3S3BB 4WJKB 1MNNA 5HD8D 1C5CH 3OHMB 3MREB 4KKBD 4MA7L 4X98B 4PGCB 1TEGA 2FYYA 1PIGA 2DQTL 2PO6D 3MNZA 2A38A 2W9EL 1Z0NA 4WGVB 4LRNL 4H8PA 4APQD 3X12A 1FE8L 1QQDA 2OTWB 4YJZL 3DGGB 4M5ZH 4XP6H 5MERB 3VI3B 3NIGE 2APFA 2QDVA 2X4PB 2O61A 5EUKB 1MHHA 4HZLB 3ZKMD 4X50A 3ESNA 2KERA 4I8DA 3EZ8A 3QXWA 4FEMA 3ZK0A 4H8UA 1GIGL 4MAUH 1Y6MR 3TPKA 3AT9A 4HSCX 2ADFH 3D33A 1URIA 2H2PC 3ARGC 1ADWA 2BOCB 1WZKA 2IFGA 4GG8B 5D8JH 3ISWA 4UBDD 5JHLH 3MRFB 4JHAH 3VXOB 5L9DH 5CLZA 2FD6H 4H7VA 2CLVA 2TSAA 5H4YA 5F7DB 4Q2ZB 1YQVH 1E2ZA 3IU3B 4FXKC 1N5AB 4JM0A 4M6AA 2YUVA 2W91A 1B0GB 1QSFE 1FVEB 4U1LA 1MRDH 5HHOA 3SQOH 1TJIL 2BP0B 1U8CA 3MRNB 1H8SA 4Z7UF 1FNLA 4RMTA 4BSJA 4HS8H 1D9KA 1Y1DA 3ZYOA 5BZDB 4JLRB 2H1XA 2W0FB 1MWAL 4HDIB 4PJDB 4YZFE 4F33A 1SF5A 1KJVB 3ARFC 4P5SA 3DOSA 1MELA 1N0XH 4WUUD 2PMZA 2KUTA 1A7NL 5HDBF 3UOAB 3BWAB 2JLLA 1N0LA 5F9OL 5TGBA 1QG3A 4ETQA 1M57B 1MNUL 4PB0L 4ZPTA 2QSTA 5K9KB 3ULVF 4JY6A 3FSOA 5D5MB 3PWLA 1BP3B 2IPKA 1A6PA 2IH1B 3H9SB 3MRJA 1Y07A 4R4ND 2VLRE 1KG0A 1YEFL 3VWKC 5KVDE 2QGCA 4R0LB 4BFNA 1QO3B 4L0ZA 4M48L 1J88A 4YLCA 3EYUH 3HMXL 4LDCA 1ORQB 5DD5L 5CJQH 1I9EA 5I6LA 2X2UA 4JFFA 2W60A 2G4GA 5EU6B 2NZ9D 4KKBC 2IAAC 4YDIL 5B1AB 2G3MA 3G6JE 3BZFB 2PO6C 2MCPH 3I9AA 4HX1B 3MREA 5FFLA 3QIUD 4NRZB 4X98A 3B7RL 4PGCA 3DJSA 1IJNA 4APQC 3U0WH 2FATH 2KLRA 4UINH 3N06B 4LFHD 4LEOA 1QFPA 1VEOA 3U9PL 2R4RL 1FBIL 4WVRA 1ZGLP 4AY0A 2OTWA 4JVWA 3DGGA 5CJBA 3ZKMC 5MERA 4UILL 3VI3A 1J10A 1N68A 3SDXB 2X4PA 1U9KA 2X05A 3MUUA 4HZLA 5EUKA 2YGOA 4FQ1H 2WKGA 2YWZA 3VFGL 2BFVL 1BM3L 3U36B 4UBDC 1A7BA 3NACL 4H1LB 2AC0A 1OTSC 3UO1L 4GG8A 2BOCA 4E9WA 1FFOB 3DC0A 3ZDZE 4QD2E 1CK0L 1KZYA 3MRFA 4XMLL 1UUNA 5EEUA 1RZIA 2YSSB 3K6NA 5F7DA 4B9ZA 5ADOL 4Q2ZA 3BE1H 1VERA 3IU3A 1N5AA 4Q4EA 2O5YH 1UYWL 4ZPVB 5JW4R 1B0GA 5KVFL 1FVEA 4H8QA 4KX8A 1IGFL 2PTTB 3MRNA 3T0VA 2VLLA 2ZCHH 3DO4A 5E2WL 1QBBA 5I74B 1O9WA 4JLRA 3VXRD 2CK0L 2W0FA 5BZDA 2NXYB 4HDIA 4PJDA 3HRZC 1UJ3C 1YSOA 2J3SA 1KJVA 1JFQH 4QIRA 3FQWB 3Q8AA 4R8WL 3BWAA 4ZQTA 4Y9FA 1Z7JA 2WV3A 5BS0E 2XACC 5C70A 5T1KB 2AK4D 5K9KA 4R4NC 3B7YA 3H9SA 2IH1A 4GO8A 4JFZL 4Q74A 1HEJC 3VW3L 3DPBA 5EU7E 1RUAL 4WFGE 4KKQA 1WLHA 3OTTA 4R0LA 2B3IA 1QO3A 2ZP0T 1E3FA 4WI2A 2RTTA 5I5JA 2WQSA 1HIMH 2X5PA 1LNUB 4Y1SA 1JNLH 1MCFA 3MRLA 3IGFA 1CDGA 2NZ9C 1CDIA 3PUUA 4J3UA 2YAQA 3D09A 2NY2B 3ENEA 1DBBH 1WWBX 4CKVX 1NIAA 3QIUC 4YXKH 3BZFA 1THAA 2ZOKA 5HTSA 4OT1L 1SUJA 4QOKA 4HX1A 2BSTA 1BLIA 1E42A 4NRZA 5DA4A 2PYEE 2HTLD 2E7MA 3Q2WA 1UWGL 2Z3FA 1Q4NX 3LDBB 3Q2LA 4OLYH 3D52A 1XH1A 4UDTB 2O5NA 4DQOH 4YSCA 4A67A 1M7XA 2WMPB 1SF3A 2O26U 1K6QL 2EIEA 3CVHL 3DX8B 1NM9A 3QB7C 1SVCP 3SDXA 4NJAH 2NDGA 4KROB 3WNIA 3JYCA 2J21A 2R56H 3HHMA 1KCSH 1M7UA 4KTDH 1PG7X 3DX4A 3PU7A 3U36A 3WXVH 5LG6A 3VXUE 1MRCL 4PWJA 2UXVA 4H1LA 1ACCA 3T5WA 1INEH 2GC7C 1FFOA 3HUJF 3MYJB 2D7NA 1ZK5A 5JIQA 1T20B 2VDQB 2ZX6A 3PQYE 4OCRL 5GSVB 1LE9B 4GKSB 3TYGH 1IBGH 1MCNA 3FCTB 2YSSA 2EEDA 5F93C 5DEFB 1TZGH 1OP3H 4F5CE 1XT5A 3GB7B 3MRGB 4ZPVA 5LWYL 1A6ZB 3QI9D 2ZG2A 3GTTA 2PTTA 4YFDB 5IVOA 1CGUA 1FORH 3VI3F 4ZMOA 2JQAA 5BJTB 4L18A 4QTIL 2V3DA 5DXWA 4M3KB 1EBPA 3P9LB 4Y5VC 3HKFA 1D7DA 3DECA 3FQWA 5D1XC 1LDPH 1PCSA 1PKQB 5T1KA 1X9LA 1LK3H 4OF3A 1LMIA 4H20L 5L7XH 3B37A 3P3YA 4NUPA 5GRJL 1KYFA 3RJDA 2ZUWA 5I0YA 1OE3A 4N0FB 3PUCA 4AYSA 3RIAF 4NENB 1I1AD 2B20A 1LNUA 4O2CB 2OQJB 4K5PA 5CCJA 1CYXA 1UB6B 4N8VB 5L2JB 3NSYA 2VXVH 4JB9L 2FX9L 4IGBB 3GDBA 2ZWKA 3PJSB 1UOVA 3TWCL 4E9VA 2Q8BL 2QQKH 1HAWA 3D9AL 1CC3A 2QTVA 1DQJB 3Q2CA 4JG0L 4PJDF 3UTSD 2X1QA 4H8WC 1UD3A 3DHUA 1JGLH 1U3ZA 5E4EB 2HTLC 3V0AC 3QUXD 3SPGA 1U8KB 5IROD 2P44B 4WWOA 3T1WA 3QRGL 5D5MF 1KIUB 3TFKD 3WXWL 4UDTA 4HXAL 3HZYB 4NHUB 3KR3H 2WMPA 3WG7B 3DX8A 3ZL4L 4MAYD 1OALA 2KZBA 1HYSD 1GVIA 2GJ6A 4RGNB 1TO4A 2HKFL 3BP7B 1RIVL 4IKLA 5MP6H 3WD5H 4LCCC 2YD9A 1IRAY 5TF0A 3D08A 3HPJB 2R1XB 4M4PA 4S0TD 2X6CA 4NRYB 3BW9B 2JKNA 3MYJA 5TK2A 1T20A 2YXVA 1CGWA 3PGFL 2ZCZA 4N3UA 5GSVA 4GQPH 4GKSA 2A6DB 3FCTA 3QI9C 3CZJA 2AXHA 5DEFA 1IEAB 5I5RA 2WLMA 3GB7A 3LRGA 2A6IB 3MRGA 1A6ZA 4XZUA 5CR1A 2EZ0D 3IN0A 1KCUL 1OGTB 2WQ8A 4KZ0A 5F7UA 3L4TA 4MLSA 2BIHA 3KBFA 4K94H 3RGVD 3VFRB 3FN3A 5BJTA 3SDXF 1NUFA 4W6XB 2N56A 2CHXA 3JXAA 3P9LA 3CFQA 3LRSA 2DWEA 3G9VA 4JREC 4IRZA 3KXFD 4LPTA 3OLDA 2X7LA 4XN4A 3ISRA 1PKQA 3VXNB 3N85L 1EZSA 2BVOB 4MS6A 2TRYA 4GIOA 2ZUQB 5GS0D 1BQHB 4XNMA 1T1WB 4FULA 4B41A 4B9GA 1I1AC 1DUZB 5DJ8B 4G82A 3AT0A 4OD3L 1LWJA 4LARL 2RFXB 4N0FA 3OC5A 4KUCF 4NENA 5GJSL 4O2CA 3QUZD 4JRXD 1UKSA 2OQJA 2ZD0A 3ZPDA 5B38G 4N8VA 1T2XA 3HE6B 3CXDH 4JVUA 4WFED 4WO4B 3ZQ9A 3AS2A 1SRDA 3G3LA 1SNRA 3PJSA 3QFDA 2AEIT 4IGBA 2QHRH 2X6MA 1DCLA 2CU9A 3MZTA 3UAAA 5I1CL 5IROC 3BWSA 3QUXC 4NM8L 4LQFH 3IBOA 1DQJA 2W88A 4I87A 4YZWA 5ABZA 3SKOB 2Z8VC 5AVUB 1U8KA 1T0MB 2OMYB 2ZX9A 4JG5A 3TFKC 4WNJA 1CDUA 3VXSB 1ECZA 1OM3H 3RX8A 1JDAA 3QPKA 2YUXA 1MCBA 3EGXB 5B39G 1KIUA 2OSYA 1FYTB 4MAYC 5EBMB 1HYSC 1INDH 1AP2B 3HS0C 3R7RA 5A7BA 4NHUA 3U2JA 1AH1A 3I6GB 4AYEC 1BWMA 3WNMA 2P28B 2YLKA 2GSGB 3FC8A 4S1RH 3WTXA 4YQXH 3BP7A 3FMGL 3QJZA 2VLJD 4P9MH 1IEHA 5I9QC 4IMKA 3HPJA 2R1XA 3O4LE 1D2PA 4NRYA 4BIKA 3BW9A 3LRKA 2CDGB 3BDYH 3D50A 4LLAA 3REVA 1VPOH 5F7NC 2XVKA 2A6DA 2EZ0C 2Y07L 1IEAA 3RGVC 2NQ3A 1R24B 5ESAB 4JE4B 5KSAB 1MWOA 1YMMD 3TASA 3FPYA 1IAIL 3WHXB 1VB9A 2NYZA 3VFRA 5J6GB 3R0NA 1QSED 1EK3A 3HN8A 4B9CA 5FGBC 3QEQD 1O6SB 4QXVA 3EFFB 1IT9L 1BXUA 3TTSA 1U3NA 1VZGA 5GS0C 4QXUH 1JD9A 1MKFA 3VXNA 2APWA 2BVOA 1ZLVH 4G5ZH 4LASH 1BQHA 2YQ2A 1T1WA 5GJTL 2VMCA 5K1VA 3FO9B 5DJ8A 4ZD3H 3QUZC 4LCVA 4ODBD 5H37H 3ZKND 1SGKA 2RFXA 3RTLA 3G9AB 1A8JH 3HRPA 1SEQH 1CGXA 1J9RA 4EDXB 2ZICA 1N3NB 3HE6A 4K8RL 3V79C 4WO4A 4XP5H 4L5FH 4JM4H 3LIUA 2XIDA 3Q6GL 4M29A 1IC5H 4B5ZA 4O51A 1T5KA 4NPYB 3SKOA 1DLFH 4HBCH 2CKNA 1GMIA 1CWVA 2MSPA 3LEYH 1T0MA 3L2NA 3RL2B 1UURA 3GSWB 4L8BA 2YMXH 3WN5B 2EAEA 3MTRA 3VXSA 4L1SA 3BFWA 1PY9A 3C5SB 1A9BB 1ASOA 2Z4TA 3B1UA 5DJDB 5E9DD 3EGXA 4LSQH 4OCLC 4Y4HD 3LYRA 4NX0A 4X5WB 1MFMA 4QT5B 1FYTA 1FGVL 5EBMA 4M43H 4MNQA 1AP2A 1MI5B 3I6GA 1MJUH 4J3WA 5KSUA 1ZY9A 2OSXA 5FA4B 1E4HA 3V8OA 5AOIA 5GGSY 1TQTA 4C8XA 1MY7A 2ILLA 4G9DB 1MRFL 2HRHA 3LZOA 1U8MB 1TQCC 3NESA 3WE1A 1IGTB 5K9JH 4WTZG 1HL9A 4JHWL 4UYPA 4FP8H 4LP8A 1QATA 1YCSA 3HC0B 1GCYA 2XXFA 5TD4A 2CDGA 2OMVA 4MTMA 1OPGL 3LNEA 4OCYH 1RZJH 1PX8A 3VMPA 3EH4B 1A7OL 1J8HB 1BZDA 2R0ZH 3NSJA 4PJ9B 3QRBA 2WANA 4PVNA 4R7XA 2EIKB 4YBHA 3S97C 5ESAA 3O2DA 4H8WL 5KSAA 1NGQL 2OKMA 2OZ4L 5TQ0H 4X83A 3WHXA 3M8OH 3BAWA 1UZ6E 5J6GA 3MV9B 3UJTH 43C9B 4ZXBD 2BC4B 3GWJA 1KEMH 3MLUH 1XIWB 3H8NA 2NT0A 2YFOA 3PHQB 2AGJH 2LV4A 1JIBA 4JFQB 4GS7C 4K23L 1KB9K 4GSUA 1O6SA 1Y1UA 3EFFA 2COVD 5E9AA 4QRPD 3KLLA 3QUKB 2B2XL 3NP4A 5DUJA 1KCVH 4OSUL 2FRGP 1U93B 3ZKNC 3MCLL 5A2LH 4MCNA 4PW9A 4GW1B 5CN2A 4A7VA 2DQMA 3QJOA 5GRUL 5KBNC 1VFUA 5C09D 3RVWD 2ICWJ 1BZ7A 4N87A 4IDJH 3P4OB 3GIZH 1MAKA 4EDXA 1N3NA 4FGMA 3ESUF 2QMJA 2MEJB 4X7CC 3V9EA 4NQDA 4RA3A 5EF3A 2ITFA 1J5HA 3KWVA 1JPTL 2DB8A 4NPYA 1JPGB 3F8UB 4S1SL 3RL2A