1GYCA

Crystal structure determination at room temperature of a laccase from trametes versicolor in its oxidised form containing a full complement of copper ions
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
499
structure length
499
Chain Sequence
AIGPAASLVVANAPVSPDGFLRDAIVVNGVFPSPLITGKKGDRFQLNVVDTLTNHTMLKSTSIHWHGFFQAGTNWADGPAFVNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDNESTVITLTDWYHTAARLGPRFPLGADATLINGLGRSASTPTAALAVINVQHGKRYRFRLVSISCDPNYTFSIDGHNLTVIEVDGINSQPLLVDSIQIFAAQRYSFVLNANQTVGNYWIRANPNFGTVGFAGGINSAILRYQGAPVAEPTTTQTTSVIPLIETNLHPLARMPVPGSPTPGGVDKALNLAFNFNGTNFFINNASFTPPTVPVLLQILSGAQTAQDLLPAGSVYPLPAHSTIEITLPATALAPGAPHPFHLHGHAFAVVRSAGSTTYNYNDPIFRDVVSTGTPAAGDNVTIRFQTDNPGPWFLHCHIDFHLEAGFAIVFAEDVADVKAANPVPKAWSDLCPIYDGLSEANQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACCASE 2
publication title Crystal Structure of a Laccase from the Fungus Trametes Versicolor at 1.90-A Resolution Containing a Full Complement of Coppers.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 142
structure length 499
sequence length 499
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gycA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gycA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gycA03
3T71A 2QPEB 1AR1B 3SBQA 3S8FB 4DPAX 3FU7B 3T6WA 3OMNB 2DWSA 2TSAA 3FSAA 2XV0A 5I5MA 2CJ3A 3CVCA 3FT0A 4CSZA 2XX1A 4YSSA 5B1KA 5F7BA 4Q89A 2WO2B 4UAHA 4L0PB 2FTAA 2HX9A 3FQ2A 2R7EA 3AG4B 1JXFA 3T6VA 2DV6A 2VM3A 4G70B 1NIEA 1YLBB 2PCYA 2HZHA 3QJUB 1WA2X 3ASNB 4UF7C 3TBBA 3WI9A 1V54B 1I53A 3T6XA 6PAZA 5AFAA 3TBCA 1VLXA 3NP4A 3EF4A 4F2EA 1ET5A 1RZQA 2XXGA 3UABA 4AZUA 4AKOA 1ILSA 3NSYA 3SBPA 4DP7X 1WS8A 2EIKB 2YXVA 1OE1A 1PLCA 1BQ5A 1J9QA 2ZWNA 3X1BA 4KNSA 3JT2A 3PAUA 1NIAA 4UANA 2B3IA 1OCRB 3CVBA 3H56A 3NSDA 5PAZA 3MX0B 4DP0X 4YSAA 3WNIA 5I26A 1PNDA 1AG6A 2DYRB 2DWTA 1KBVA 4BDVB 3QJVB 2AZAA 1W6LA 4W9ZA 1AOZA 3X1FA 1PAZA 1ASQA 5B1JA 4G7QB 1BXVA 5E9NA 4RH4A 1PCSA 4E9YA 2UXFA 3FSWA 3DIVA 1PZBA 2UXGA 1KDIA 3ERXA 4F7KA 1AANA 1SFHA 3FQYA 4HHWA 1KBWA 1JERA 4CSPA 1NPNA 3TA4D 2J56A 1M9WA 2IH8A 1ASPA 4YSTA 1XB8A 2P80A 3NSFA 2IWFA 2VSMB 2PPCA 2VMJA 4G7RB 1W6WA 1BXUA 2IDFA 2XU9A 1X9UA 1V55B 2IDUA 4JHVA 4AKPA 3S8GB 1N68A 1AACA 3AY2A 2FWLB 4HCGA 3C75A 2GBAA 1NTDA 3HEIB 3FPYA 4G7SB 1CURA 2BZCA 4DP9X 2LLNA 1KDJA 3FU7A 5B1JC 3NSCA 4DP4X 1NPJA 3OQRA 5B7EA 4E9SA 3OMIB 5D4IA 3RYMA 4GP8B 3V9CA 1AZRA 1IC0A 2Q5BA 4WKXA 3WIAA 1MG2C 5I5IA 2NRDA 3TU6A 3NT0A 1PF3A 4FAAB 4YSDA 1MG3C 4YSPA 4HCFA 3S3BB 5D4HA 1BYOA 5I6OA 2BP0B 2IDQA 1JXGA 3ZBMA 2QDWA 1L9QA 1GR7A 4BK5C 1QHQA 5LDUA 1JZGA 1HFUA 1AAJA 2AZUA 4YSEA 2AFNA 2VSKB 3S3CB 1JOIA 4A2HA 3NJKA 4YSQA 2XV2A 2YARA 6PCYA 4KNTA 3CZUB 2BHFA 3PCYA 1QLEB 1GSKA 1J9TA 2OJ1A 4HZ1A 4A66A 1DYZA 1F56A 1JZFA 2IH9A 1ADWA 1GY2A 3L45A 3NJIA 4NERA 5I6NA 2BZ7A 4KNUA 1MDAA 1ZIAA 5IY5B 1AZUA 4M3HA 1N70A 4BWWA 4GY4A 5AZUA 1URIA 1OF0A 2QPDB 2XLLA 4HALA 4KO7A 3NP3A 2VW7A 3ABLB 3QJQB 1AZCA 2Y69B 2W88A 3U25A 4GYBA 2HXAA 1UATA 4AX3A 2CALA 4A2FA 4DPBX 4BDVA 2H47C 2N0MA 1BQKA 1OV8A 3WG7B 2OCCB 1OOWA 3ABMB 2AVFA 2QDVA 2DY2A 3WNJA 1ZDQA 3IN2A 5D4JA 1NIDA 4GP5B 3S3DB 1ZV2A 1IKOP 1M57B 1KV7A 3GDCA 5PCYA 1CUOA 3WKQA 3AG2B 3EH4B 1GW0A 2FQDA 1JZHA 1EZLA 4BWTA 3JTBA 2BP8A 1IUZA 4KOBA 3AG1B 1J5DA 2J55A 2FQFA 4HIPA 1KCBA 1BXAA 1E5YA 1PZAA 2YAHA 5A7EA 5I6LA 2UX6A 1BAWA 2IAAC 3FPXA 4QKTA 5EHFA 3ZIYA 4E9VA 1A4BA 2UXVA 2JKWA 3WKPA 3NJGA 1XB6A 2UX7A 4DP2X 5B1AB 2XUWA 3H4HA 1NICA 2ZXWB 1JVOA 2AANA 4GP4B 1SNRA 1ETJA 1CYXA 1EHKB 1L9RA 1TEFA 4ENZA 2OV0A 1AIZA 2I7OA 2BP8B 1ASOA 3ASOB 2VM4A 2YAQA 4A67A 1B3IA 3MBWB 2FJSA 3QJRB 1RCYA 1R1CA 1PY0A 1SDDA 1T5KA 4K9JA 4KO5A 1A8ZA 3NYKA 1WAEA 5FC9A 2I7SA 2EIMB 4JKNA 2PPFA 1OCZB 1A4CA 3EH3B 1PLBA 2YAPA 4P5SA 3X2QB 1AG0A 1L9PA 1HAUA 4MFHA 4NB7A 2BP0A 2MTAA 1PLAA 4DPCX 4FA7B 2GHZA 1JZJA 1OCOB 2H5UA 2HLEB 4E9XA 1AS6A 3AG3B 5B7FA 1SDDB 3FSZA 2FT8A 2FQGA 4W1TA 4BWUA 2PP8A 2YQBA 1TU2A 1BQRA 2JFCA 1ILUA 2VN3A 1JVLA 1SF5A 5I6MA 3FU9A 4NAJA 3OD3A 3PLYA 3HB3B 4PCYA 2PPAA 4YSUA 1L9SA 4A68A 2VW4A 4EF3A 1JXDA 4YSCA 4BXSV 3QQXA 2GI0A 2GSMB 3NJLA 3UACA 4HHGA 3FYEB 3NJFA 3EH5B 1NIFA 2BO0A 3BVDB 5I28A 3PXLA 3FS9A 3V9EA 3ZDWA 3PAVA 4DP5X 5TK2A 7PCYA 2BW5A 1FFTB 5ANHA 2UXTA 2HX8A 4N4YB 3T9WA 4KO6A 1A65A 1PMYA 3CDZA 2PCFA 3FQ1A 3IBOA 3N2JA 3FYIB 3IEAA 1L9OA 3ABKB 3QJTB 5F7AA 5TK4A 3SQRA 1AS8A 1TEGA 1ID2A 2I85A 4TXVB 3QJSB 4X4KA 3FSVA 3X1EA 2JXMA 3H4FA 4BXVA 1SFDA 3NJJA 1OE2A 1SHWA 2IWKA 9PCYA 3AZUA 2CBPA 2ZONA 4KOCA 2WO3B 2CCWA 2IDTA 2XYBA 4WTQA 1PNCA 2ZOOA 4YL4A 4A2EA 3CDZB 1FA4A 1GS8A 1RZPA 3D12B 2RACA 5I6KA 2PPEA 1PZCA 4YSRA 1NWOA 2J57A 4DP6X 1IBZA 2E86A 2PP7A 7PAZA 1IBYA 4HCIA 2YXWA 1NWPA 1WA0X 1A3ZA 2IWEA 3IN0A 4Q8BA 3X1GA 3ZX1A 4YSOA 3SBRA 1TKWA 1XMEB 4E9WA 4E9QA 2H3XC 1FWXA 1J9SA 1X9RA 4DP8X 4YVNA 1KGYE 1ZPUA 3BQVA 4KO9A 1SF3A 3FU8A 2R7EB 1NZRA 1E5ZA 1W8EA 2FT7A 1CC3A 1RKRA 4N8UA 2B08A 4ZK8A 8PAZA 1JZEA 2YAMA 2XWZA 5AKRA 1GS7A 1GYCA 2XVBA 3GXUB 2YAEA 4A2DA 1BYPA 1SHXA 2W8CA 1OE3A 2EINB 4DP1X 1CYWA 2GIMA 2BWDA 5B7MA 4E9TA 1NDTA 1BEXA 1AQ8A 2GC4C 2HRHA 2GB2A 3DTUB 4G71B 4HAKA 4M4RB 3X1NA 1V10A 4G72B 4AKQA 2MRYA 5I5JA 4YVUA 1JZIA 1NINA 4A2GA 2CUAA 2HRGA 2XX0A 4E9RA 2PP9A 2CAKA 2PPDA 2EIJB 2Y1AA 1E65A 3PAZA 2Q9OA 1WS7A 3G5WA 1GS6X 2YAOA 1KCWA 1ZIBA 3KW7A 3IE9A 2BW4A 5B3SB 3NJMA 3OM3B 3CG8A 3QPKA 3PPSA 4PAZA 1J5CA 2EILB 2FQEA 1AZNA 3UGEA 1A4AA 4F2FA 3UAAA 2FT6A 1ET8A 3ABGA 1OCCB 3T6ZA 2TSBA 3OMAB 2A3TA 4P5RA 2HX7A 2XV3A 1NIBA 1DZ0A 4QLWA 2J5WA 3UAEA 2XXFA 3DKHA 1MZZA 1MZYA 3TASA 3AW5A 4JHUA 3KW8A 1J9RA 1XB3A 2GC7C 3CVDA 3NJHA 4GXFA 1HAWA 1QNIA 2IDSA 2VW6A 1WA1X 2WSDA 1SJMA 1AZBA 1E30A 2PLTA 3EHBB 1AS7A 3GYRA 2DYSB 1M56B 3NJNA 2YAFA 2X87A 1E67A 2QT6A 2P80D 2X88A 5B1BB 1ZDSA 2FNWA 4AI7A 1GY1A 5I6PA 1KYAA 1L9TA 3UADA 2BWIA 1ET7A 3N55A
chains in the Genus database with same CATH superfamily
1K4CA 4K3HA 2QPEB 1MFBL 35C8H 1OP3K 2Z7YA 1XF5A 1ZTMA 2LLGA 4X8GA 5D1QC 3K0WA 5KZCD 1UB6A 3MROA 3B83A 3OMNB 2QGBA 2ZJSL 3GSOB 3MLTB 4O4YH 3CFKA 2BJML 3OKNB 5L6YH 1U8PB 1P4IL 5GGTL 3N9GH 2Z65C 4YE0A 2ZX5A 5L2KD 1U6AL 2XACC 5EN3A 2VUYA 3TT3L 1KIQB 3KPOA 4UAHA 4NYLA 4JW3A 5AUMA 3GHEL 4OQTL 3SQBB 4NKOA 4L0PB 2FTAA 4WTZG 1BLNA 4UUJA 3WDJA 3NZHL 2XZQH 3FQWB 4RX4A 5TE7H 1R3KA 2CGRH 4LVOC 2PCYA 4KH2A 2AJUL 1KF9B 1WA2X 3ASNB 3DPBA 3WI9A 1OM9A 4RMUA 5JIDA 1NBZA 1A3QA 2EDYA 1JPEA 2KS0A 3CHXA 1KB5L 5F2FA 4UTAA 4HWUA 4WI6A 4Y4HA 1JJUA 4I3RL 3ZDZF 4PYGA 4UNTA 3V0DA 4WEUD 4GI6A 4FADA 5JQIB 1IC1A 2R8SH 4BINA 3WEBA 4ENEC 2BSTA 3UCRA 2W9EL 2X89A 4GIOA 2A9ML 2VXSH 1OE1A 3U0TB 4FZ8L 2VQ1B 2VOTA 4BCYA 5I8EA 4MCNA 5I1IL 4NCC2 1XD1A 4TMPA 5I17B 2DH3A 4B95C 1YNKL 2ATPA 2EH7L 2IGTA 1MRDL 2B3IA 2UUDH 5T1DL 1G6RB 2ZOWA 2EDKA 3GO1L 3KPRB 3ARQA 4H20H 3W9DA 4F27A 2A74C 3QIUD 5HHXL 4S1QH 3ARED 4XCCL 1DQDL 4XZUB 4HU2A 2Z6FA 3L17A 4BDVB 4JDTL 1OSYA 2AZAA 3PL6C 4OD1H 1N0XL 2DOCA 3O6FA 5D5ME 5DZLA 1D6VH 1ASQA 4JUTA 4HFWB 2NY6C 1F11A 1L5GA 2OTUA 4E9YA 1PCSA 5H35B 2J1XA 5FYKE 1QWHA 4JM4H 2UXGA 2IAMC 5E56A 3EOTH 3MV01 1NGZB 1C12B 1T66D 2IF7A 3X3GL 4HIXL 1KBWA 4LF3B 3TN0D 5TDPB 1IKFH 3SE8L 1IT9L 3ZL2A 3ULVL 3CSTA 1I3GL 2YS4A 4L4JA 4EDWH 2ITCB 4JPKH 4OLWL 3VCLA 3DGDA 4PW3A 3BPLC 3QZBA 4NJAL 3CH1A 2K6YA 4PJFE 3HFFA 4F5CE 1F4XH 5KSBE 3LKQB 1JK8A 3TH2T 1UUNA 3FU6A 1BZQK 1ZHKA 1A7NL 2D0HA 4RAVA 3GC3A 1UWYA 1AKJA 3QUXC 5D1XB 5CCGE 3MRRB 5LG1A 1ZA6B 1N2RA 2B8OT 3MNVA 5F9JB 1NTDA 2W1NA 3IJSA 4UOJA 4Y9EA 4XNMB 3P3SA 2HA1A 3KD4A 4N25A 5JA8B 3QW9A 3VDBA 3QUKA 4PRBB 5IR1B 2CLVB 3ARBB 3IT8D 5TH2A 3VWJB 5SWZE 3FRPG 3JBG7 5D2LA 5GGSA 3UDWA 4AEIH 4LKCB 4LQFL 4DK6A 3KEHA 4Q0XL 3WIAA 2NTFA 3Q8BA 3QUYA 2XKNB 4YSPA 3S3BB 4JHAH 3QUMH 1OTUC 2DYPA 5D8JH 1AO7E 3CPLB 3NIDF 4HUNB 3QZWB 2BRRL 2EEDA 4KQ3H 5IM7A 5CEZE 2E4TA 5J9PB 5TE4L 3ZDYE 1KCRH 3EGSA 3VXSE 3PGDA 5EBLA 3MRQA 3RL1B 4QRPD 2OP4H 4BZ1L 2E9JA 4DGYL 1XH1A 3QORB 3WFEH 4Z78B 1K3IA 3GTVA 4JRXB 3NZ8B 5GS0D 1ETB1 1WJ3A 2DQJL 3MRGB 2AI0L 3BAKA 1OGPA 3PWPA 4OLXH 5F9OL 1GY2A 3P9LB 4QAMB 2QADD 1KYOK 3VQ2C 4OD3H 5L7XL 2QHRH 4X4XB 4PJIA 1F90L 3V0GA 5CM1A 1WH0A 3QNYA 3LN5A 1TEYA 1GJWA 3B5GA 3NIGF 1JNNL 1OLLA 4JFPB 2XLLA 4Z7IA 3H3BC 5IOPB 1YNLH 5C0BD 5E99H 1UACL 4AX3A 1KIUB 2GBVA 4LLMA 1KCUL 4PV9A 4F9PC 3C6LD 1PG7W 2N0MA 3MV7E 4ZS6D 5MEOB 1G43A 3SKOA 2EDTA 3WG7B 2L3BA 1INQB 2DF3A 3DX2A 2G5UA 5LHDA 5CEYB 1E43A 3WNJA 4JDZA 5J11C 4IMLB 4DT2A 1OTTD 3TVMD 1MFCL 1VGKA 1U8OB 2NZ9D 1FC2D 4A7UA 1TQCC 2CRYA 2ICWA 1Q1PA 5JYMA 4GKLA 2CJUH 4NZTL 2FAUA 2UUDK 1G7IB 3HZMB 1WICA 4N2GA 2ZUTA 2B2XL 1S4IA 2YN5A 5D96B 3DGGB 2VDPH 1E5YA 5LGYA 1BZ8A 2Z64C 1QFHA 2EIBA 2UX6A 3RIFF 4UT9H 5J1SC 5E2UL 1UGNA 3U7WH 5KG9A 1FZKB 5K69A 1LE9A 1MJ7H 4YDIL 4RRPA 5C0JA 1T5XA 5CAYB 5B1AB 2MOGA 4AGQA 1N7ML 5DURD 5JHDD 1J0YA 3D85B 1WZKA 2KBGA 1RZGA 2XT1B 4NQVB 1CZ8L 3O11B 4OW6A 2A77H 1O75A 3VG0H 4I4WA 3QPQC 2H8PB 3KVPA 3LZRA 4P59L 3AU0A 5DD0L 4BK5A 1ZSHA 5I8OH 4DKFL 1HIML 1HH9A 4F2MA 3P4MB 2EH8H 3VFOA 5E24E 3NTCL 4G1EB 1SBSL 2Y5TB 3OLGA 4H8HA 4QOKA 4QJ5B 3AU1A 1PCXA 3NEEA 4U1LA 3RX8A 3BW9A 1A8ZA 2I9LA 4JZJB 2VH5H 1A6ZA 1CTNA 1WT5C 1OOAA 1T80A 4XPGH 2MKLC 3QIBA 3X2QB 1S7RA 2Q8AH 3STBA 2DM2A 2HRLA 3RPIA 1WITA 2VDOB 4LARL 2F0CA 4ZO7A 3BOVA 4JKPL 2GY5A 2F53A 1AS6A 7FABH 5IHUH 4UM9B 3Q6GH 2EYSA 4Y2DB 4EZKA 1QBLH 1WUNT 2Z93B 2Z7ZA 1DLFH 1QFUL 1ML0A 2FT8A 3DDFA 4W1TA 5EOCL 5CEXB 5HHVL 4IHOB 3ROOB 3NCEB 1SBBA 1WGVA 3RX5A 3FMGH 1LO5A 2Q2LA 3L6FA 4ZODA 2HFEB 4L29A 4KFMA 1JYXA 3P69A 1A1MA 1FDLH 2PPAA 3W2DH 1NGWB 1R47A 3E6FB 3L3JB 4XP4H 5IMKA 2FLBT 3ZDXE 4PP2B 3L3OB 1YEDA 5B39B 2FX9H 2GSMB 5CJ8A 4HHGA 3DIFB 1HSBA 2ZOKA 1NFDE 3ARVA 3O2VH 4XC1H 2VXVL 5E8NA 5K9JH 1IAOA 5AL8A 3SPIA 4N8CL 1NFAA 2UZXB 4HIIA 4GXVL 4JDEB 3D25A 5I0ZA 1PKOA 3FO1A 4GFXA 2FBJL 2OTPA 5I1HL 4IRJB 3FXIC 4WWKA 2CM5A 1F1AA 4NFBA 4NHCL 4XP5L 5F9AC 1I1AC 3FU0A 5AAWC 3GHBL 5D70L 2ZP9A 4CW1A 2E7LC 4J1UA 4Z7VB 4QHMA 1CICB 2VISB 5DRXB 2ZKMX 2H1PL 3BQUA 1H5BC 2WUCH 3UP6A 1U58B 5DQDH 2DIJA 3OBAA 1GYVA 3C5ZC 5LAXA 3HS0A 3P73A 5BUGA 1JHTB 5FB8A 4UIKH 4ODVL 2CIKA 3D4YA 5LCVL 5EWIL 1MRFH 3LZPA 3WNPA 3Q05A 1CD0A 4QIRA 5DSCA 4LRIC 1I8KB 3MRPA 2Q10A 4YNYA 2VNCA 4HCIA 1ZVYA 5C09B 1S9VB 1KB3A 1J8SA 3IN0A 3DX4A 3ZX1A 5KVDE 3SKNA 5EORL 4DP8X 3SB3A 3LRGA 4NQDE 4IU2B 3T8XB 1ZPUA 4NT6A 4O5LL 1E4XI 3BQVA 3V6ZA 5DCCA 1MCSA 1NZRA 1CC3A 4HG4J 5JLZA 4MAUL 4U1GC 3D0AA 4GMSH 1PSKH 5SWSB 1UVQA 2YAEA 4KZDL 3EYQC 4ODWB 3F6IA 3MRLB 5T5NG 1T4KB 2P8LB 1VHPA 2BWDA 4LAQL 5ADOL 3RL2A 1MELA 3D9AH 3O6KL 5HYFA 1MAKA 1ZANL 4U0QB 2JJSA 3IMUA 4N68A 4G43A 3CZJA 4XGZA 2HWZL 2P5PA 43C9B 4AXWA 1MHCA 2ADYA 1V7NH 5I1EH 3VFUA 2KZWA 1HHJA 3CMOH 5KYXB 1BZ7B 2ZOLA 3QIWA 4DPRA 1YMMA 4X6DB 4MJ6B 5EPMB 1FH5L 2QR0B 2MCPL 5ITBL 4XMVA 1CLOH 2HN7B 3U9WA 3MI6A 1WS7A 1FPTH 2P8PB 2WZPA 1JGIA 1KCWA 3H1ZA 4L4TE 1CFTA 1G7QA 4LLAA 2DB8A 1ZMYA 4YPGB 3QEQA 1JIBA 2ZCLL 4FJZA 4WTWA 4D9QD 4KKZA 5HYQB 5ACMA 1C5DB 4HISA 5IG7B 4QCIB 3CUPB 4XHQA 1G9EA 5ES4B 1A5FL 3O8XC 1TTRA 1C1EL 4JY4B 4Q9CA 1FAKT 4P9HC 5EU6D 1ZHLB 3UAFA 1N8ZA 4JQIA 5JDSA 5IQ9B 1OSPH 3DJZA 1GGCH 2Z8SA 5DZPA 4XT1C 4JZOB 1L0QA 1IBGH 1U30A 5ESVB 3UCQA 2XWJA 5I18L 4XI5C 3KXFD 5DC4B 4HWEH 3GQFA 1Q0XL 3VGFA 7CGTA 1B6DA 2ENPA 3I9IA 1T83C 1Q9OA 2ATKA 1E30A 4NZRL 5DK0B 5L8JB 4RGMB 4HU8A 5D7JC 2YAFA 1UJ3B 4MMZC 5D2NE 3EO0A 1NA8A 3IGAA 5DR5L 1BFVH 4PJXF 3QZNA 2CJSA 3DYOA 4XPBL 2V5RA 2GJ6B 2Q7NA 3MXVL 4XVTH 2F18A 4PS4H 5GGQL 4AK1A 2ENSA 3MUGA 4OM1L 3WJJA 1CDCA 2GJPA 4PJHB 3MRIA 1QBAA 4JPIA 1P4BL 4LHUD 3T0ED 4UIMB 3ZL4L 3S8FB 3LZLA 4LSRL 4DPAX 1AZVA 2AMGA 1IGIL 3Q06A 3MRMB 4OY9A 4ZNEA 4EBQL 3RWGB 1RFDL 1JFQL 4GB9A 5T5FA 1J5IA 2ZAGA 1SJHA 2UWEA 4J3XA 2XX1A 4RRPG 1IAII 2HB0A 4IBTA 4MNGE 4PJ9A 3ZE1F 1MWAL 4GQRA 5IHLB 1R5WB 1URLA 1A25A 4AGPA 1T0PB 1EJ8A 2C34A 4N2CA 2O6FA 3C8KB 4MGXA 2QLYA 4DKEL 4ELKA 1XF2B 1U42A 3F2LA 3E1F1 5I76A 3T6VA 1FNLA 2A7BA 1HXYB 2QLVB 4KI5E 5C0RH 2A1WL 2AITA 3TH3T 5BV7C 4U7KA 4XN5A 3SCMD 4LOEA 3C8HA 6PAZA 5K93A 3G7TA 4XMZA 4ODUB 1BX2B 4Y4FD 2J8UB 4OLYL 3NVQA 4DIXA 4LCCA 3UABA 3LSOB 1CE1L 4JRLA 4PB0L 3UAJC 4R96A 2VDNB 1M7IB 4YHKL 5A6LA 1PQZA 1MJ8L 4O02H 4ZFZA 5DVNA 3X1BA 3MBEB 3WE6B 5DMKB 3VGEA 43CAB 4E0RA 5FECA 2Y5EA 3MZGB 3QR1A 1JHLH 4HOXA 2BY0A 6FABH 1S6NA 2GITA 3OG6B 4U1IA 3KLDA 5LBSH 1FFPB 5D7SL 1EMTH 4HQQL 3VD9A 2YUWA 2D4FA 3QZOA 5DEGA 3WN5B 4UBDD 4Z7OF 4F92B 3CC1A 1GW6A 3L4CA 3C8DA 4V2BA 1A7BA 4WJKB 2BVEA 1X6NA 5ALCL 3F64A 3B6SB 4P9HL 4TNFA 3WXVH 3K3QA 4POUB 5HVFB 3O9WD 5SWQA 2AF2A 3GXMA 5D1ZA 2A83B 3BEVB 4X50A 5B1JA 1FGNL 3TJHD 1C8PA 2XIIA 4G83A 2WOYA 3O3AB 4PP1D 4NBXB 3B8SA 4P2RE 4P3WA 4QD2E 3T3PF 1D5MA 4Y7MA 3SE9H 4GBXD 2NZIA 4TQHA 4NO5A 1DLHA 2HT2D 5HVGB 3ZHLA 3VXRA 3GMMB 2W0FA 3C5JB 5BZDA 4HFUL 5CGTA 2H41A 3TA4D 3W0WB 3O45A 1EHAA 2EKSB 2IO5A 5A43C 2PXYD 1JZ7A 2VJXA 3R8BB 4YLCA 3R7RA 1Y1UA 3UTTD 4OZHB 3D09A 3KG5A 3AB0C 3ATBA 3ES6A 4HUVA 2WXJA 4AJYV 4B9KC 1VERA 3KPTA 3GSVB 4CDGC 2NR6D 3EJQA 1V55B 2MPAL 2DKMA 1BD2E 4KTEL 4UM8A 5KBNC 3N04A 5I8KL 4AJWA 4G42B 5AD0A 5CILL 3PWJB 4UWQB 3Q8FA 3L4VA 5K59E 1NCAL 2IADA 2WGNB 4YHLL 2O6EA 5DVKA 2DJUA 2V9RA 3I9AA 3O6FC 4Y19D 3FU7A 4ZUSB 3I75B 3TXAA 2IQ9L 4KJPC 3L7EA 4P5TD 4MD0A 3OQRA 3QDGD 3U1QA 3TLRA 4E9SA 5J1AB 3NRPA 2ED8A 1X5KA 1AZRA 1NCCH 5ANMA 5L8LB 3IFNH 3LHPL 2VDKH 1EV2E 5BV7L 2ZYRA 3TU6A 4N6RA 4WI5A 3GSQB 3IGFA 4X6CA 2ZG1A 3CLWA 3D6GA 3GSUA 1E42A 4KX8A 1E9QA 2GSGA 5GS1A 3POCA 3FTGA 4LHJB 4LT7A 3BZFA 1OAQL 4ONGH 1N6UA 1YHPA 2BIOA 5AG9A 2FIKA 1AMYA 3HOGA 3QNFA 5JW3L 3MMEB 3H2PA 5C0CA 2HLAB 4K9EH 4P3DA 3WKML 2KLTA 5IQMA 1B2WL 4OZFA 4C58B 2NYZA 2ZG2A 1VSCA 2A9AA 5ESAB 3B9KB 4G8GD 3TH4T 2CKBL 3BZ4A 3B1TA 2OZ4A 1WO2A 1NC2D 2VMCA 1MRCL 3F6LA 2BZ7A 3RWDB 1FNEB 1VEPA 4MNQA 1MI5A 1I7TA 4BM7A 3DMMA 3EO1A 4NKQB 3V52L 2BNQB 1N3NA 2E5EA 4LVNB 3REWA 3CFBA 3S88L 2NUPB 1HESA 5D7KE 3LN9A 4HALA 5IT2L 2FH6A 3NP3A 4RDQF 3UDWC 3C09C 4PJEA 2EIZA 2DQGL 2HLFD 1VA9A 1QSFD 1YEEH 2JKRM 2QADC 4H8WC 4JREC 3GMLB 2YMTA 4GYBA 2P49B 4FHKA 5L9DL 3QUYC 4M6OH 2GSIB 3T2NH 2WXRA 5AB9A 1BQKA 1WG3A 2V3EA 4NC2B 4KK6C 4B7IA 2OCCB 3LPOA 1B4JL 3BWSA 4X6BA 4HIJB 1KYDA 4FP8L 1ZDQA 1TDQA 3IN2A 2EDMA 1ZV2A 3BVNA 3PP4L 3S3DB 1KACB 4M43H 3JSSA 1V7ML 1FV1B 1UT9A 1F4AA 2PYED 4JPSA 3V4PB 4ODHH 3ENEA 3TCXA 2VGLM 1UZGA 2DS4A 2AXJA 3I6GB 4MD4A 1IGYA 3FQTA 4KUCF 3T4AA 5KSVA 4Z8FH 4QYAA 3UJTH 5MHSE 4Z3EA 3C87A 5IHZA 3ZHFA 2XDHA 4JR9H 3D5OF 5GRUL 5ICXA 2O5XL 3VFMA 3L9YA 5HJGA 1EK3A 2M83A 3WKPA 1LO3H 3FN0H 1M2VA 1SVBA 3RGVB 5HI5C 2FL5A 2ZUQB 5HPOA 3UTQB 4S1SH 1CT8B 5GRJH 2V2TB 2J88L 1E9OA 1EHKB 4GKZB 1HQRB 1P4LB 4HK3N 4JFVA 3N1PC 3NZSA 4G6KH 4X6FB 1QFWI 5DUMH 2OX5A 3AXIA 1JWMA 3MLYH 3WKNA 3GFUA 1QX1A 4U33A 2ZX7A 4YX2H 1PY0A 4NCC1 5ALBL 5CJXA 2DQIL 2RR3A 3VE0A 4H44C 3PQYE 5FHBH 3P4NB 1KT2A 4JKNA 3ESNA 5T1KA 5CMAA 5FUZH 5HYJD 4JVWA 3UYPB 2J12B 5HD8D 4Y1TA 3U2SB 2ARWA 4Y16D 3IPBA 1FZOB 5FYLH 3NACH 4KK5C 1Z5YD 2EO7A 4P46D 4ZFGL 1KEGH 3LS4H 2I9TB 1A02N 5DLLA 3K2KA 1XCTA 3V0EA 4JQVA 1EH9A 4OF6A 4ZAKA 3TT1H 5GS0L 3KH3A 4LOUC 3I2CH 4NWUH 4OLZH 3U4BL 3U9UA 5DT1H 4ICXA 2DQDL 3BH9A 3OGCA 4H8WL 3RVXD 1W8OA 3SPJA 3WGUB 3V4VB 4ZYKA 4ZOEA 1KCKA 3HB3D 3O6LH 1R3LA 4IU3A 4XP9L 1V8HA 2XN1A 3DC0A 4MA7L 5E23A 1BMGA 1Z32X 2CR0A 2BO0A 3RY6A 3LNEA 4PRIB 2A6JA 5T1JA 2JCWA 3V0WL 3UTPE 3L9RB 3QIBC 2VLJD 1Q0YH 3WBDA 4IRSB 4JFDD 5JIKA 1H8OA 1DQKA 3L5WA 4WU7B 2IANE 2EYTA 4ZTOL 2YA1A 3CBJB 2O1AA 2GW5A 3EFFA 3K8LA 3N1MC 1ROCA 1U21A 2EDXA 1LD9A 2QBWA 3H3KA 4Y5YB 4HA1A 2X7LB 4KZ0A 4HS3B 1IGMH 1EFXA 3DVNA 5I82A 5IFJA 4E68A 2YD6A 4KK9D 3DOIA 4Q4IA 4XCYB 3QCUL 4GG6A 4LGPB 3AZUA 3O2DH 4OZIE 3MJ7A 4F7PA 4JG9A 4PREB 2OMYA 3VQMA 4C4BA 3JWDC 4KU1A 2VR4A 4M3KB 1F3DJ 1ZT7B 3I6LD 2QFPA 1CXIA 1JPSL 1AD9A 4DVRH 4FX5A 2GAZB 32C2A 1O5PA 4QHNB 1RZIB 1INDH 3JVFC 2PP7A 4PGZA 1DJHA 1QSEB 3IJYB 2K3TA 5DRZA 4ZS7H 1UWGL 2FECI 3VRIB 1A3ZA 1D9KD 3RDTB 4JM2B 3AGWA 2Z92A 3GF8A 5FHAH 3LKNA 4ABUA 3VFSB 3GTNA 4X9IA 4P23A 1OD9A 3FT3A 5DA0B 1MIML 3QJFA 2H0FA 3DBXA 1KB5B 5L0QB 2AK4E 4MDRA 1JGVL 2OMZA 4PGDA 3AGVA 3SDXF 4OB5H 2YMXL 3GXUB 4ZFOA 1BYPA 2YR3A 2EINB 3BQUC 1M05B 1PU0A 1MHHB 2ZUSA 4PGBA 3QHTC 1LEKB 4S10A 1BEXA 2YK1H 1GXEA 1AYOA 1R5IB 4A6YL 5KS9A 3IFPB 3T8VA 3RURA 2PWDA 4XMPH 4M9OA 3NUKA 4PJDA 1FQ9C 3MLSH 5T8IA 1K4DB 1NLBL 3W39B 1DQLH 1WC7A 5J6SA 2WC7A 3G6JF 2WXFA 2RBLA 3M1BB 4HEME 4P2OA 4WSJA 3ZKQD 4GRMA 3OC8A 4E9RA 1BMWA 4MBOA 1MFAH 5E6YA 3VXQB 3NCWA 1U3HA 2WTPA 2AXGA 3G04A 1U8JB 3QAZC 4M7KH 4UV4H 4WI0A 1THAA 1S7SB 4L4VE 2NX5E 4X5WA 5FK9B 4P4KD 5C6TH 3VFRA 1WFOA 2ERJB 4E5XG 1MFNA 1JF5A 1RQ5A 3HZVA 4M02A 1YYLL 2FB4L 1HHHB 4Q6YA 3U6RB 2YGPA 4NN6C 1QATA 5FFLA 1S9YA 3ULUE 3FL7A 2ZTBA 1NCWH 4DW2H 1XDTT 4TVPE 3C6SB 1E4KC 2UY6B 2WZAA 2K70A 4IBWA 1RZKH 3WJMA 3ZLQC 1H3WM 5EOCJ 5FW7A 2JI1A 2R2HB 5E5LA 3M17B 1KIPA 3QUZB 5AW9B 1EXHA 3TA3B 2ZICA 2YEQA 2JJSC 5LGJB 3A6BH 5GXBB 1HAWA 1ND0B 1WA1X 3WL9A 1ZE3C 2YEZA 2HVKB 2K7PA 5D1QB 1AZBA 4P5KA 4NM4H 3QIWC 3DTXA 4J4PD 5LO7A 3LD8C 3JWDL 3DX8A 4N0UB 1I8AA 4TUOA 2Q3XA 3IU4H 5IZ7A 2X4OA 2H26B 1G5GA 2VXQA 4OSUH 4MD5B 3EKCA 4IBQA 1ERNA 4HKXA 2X0WA 5GGRY 2E7DA 4WEEA 2J1ZA 5CJQH 2NCEA 3IDXL 5JZ7C 3NRQA 4LVOB 4S1DC 1BBJB 5CCHE 1GJIA 1MFDL 1X5AA 2E4FA 2R0ZL 2APVA 4HXAL 3FFDB 4MA8L 4AZ8B 4BSWA 1G1CA 5AYUH 1ONQA 2QPUA 2JJVA 5IVZA 4PRDB 3JV4B 4NPJA 2V2WB 2VAAB 2DLHA 3ETSA 2VLME 2G0LA 2ZXEB 3BP4B 4LDCA 2EUVA 1UURA 5D5MF 2D2OA 4H0LC 4L1SA 3EDEA 1RK1B 1EEYA 5DJ0B 1VPOH 5J6GB 2LW3A 3BUYB 2VIRA 2HZHA 4UNIA 3KJ4C 4UT6H 4HKJB 4QRQA 1CLVA 1DVQA 3EBGA 1I7ZB 2FJHB 4LEBA 4H88L 5EF1A 1JRHI 1ZWIA 3FBKA 1JDCA 5DTFA 2Y7LA 1IC4L 5JIMA 1OTSD 1PYWB 1I7UB 1KC5H 3WJJC 1X5GA 2YRZA 4U1KB 3WOVA 3GBNH 3PL6B 3SCMC 1MF2H 4JLRA 1BQ5A 1IARB 1Z0NA 4ZO8A 3WNKA 5ABAA 4X4ZA 1ZVSA 2NY6B 1A3RL 3R06A 1FZJA 2DD8L 4PJFF 5KSBF 1LWRA 2IBZX 1UTDA 5DYFA 3V7AG 3H9HB 3IFLH 3K46A 3G6DL 1JYNA 3UX9B 3FB6B 3HUJF 2RQ8A 2IAMB 1DANT 2NY5C 2EXTA 5EU7E 2XN2A 4PJ9C 1JDAA 3QI9A 2PTTB 5FA4B 3D2UD 1XH0A 4JFZL 4CC4A 1ZLDA 3CFJA 2ZCHH 3TWYA 5FA3A 3VFVB 1KTBA 2NZ1A 1W6LA 5IEHA 3QFJE 2WLNA 2NXYD 4OCRL 1KULA 3BPLB 5FYJE 2F61A 1BXVA 4ZMQA 1LO4L 3VM5A 1CBVH 5FLVA 4Z5RB 2R27A 2WCPA 5DJZA 1AHWA 1D5ZB 2C7FA 3ELQA 4RSYA 5A6MA 3WO4C 5LQBH 4JG1H 5D2LE 4LCCC 2WYZA 1OVZA 3STLB 4C57C 3P4OA 1KZYA 1XF3A 4OVUA 4C56E 4HS8L 3ZDYF 1GGIL 3CQQA 1KCVL 3BUBA 3Q9PA 2ZXAA 5LUMA 2QKIA 3CD4A 1E7UA 3KPSB 4BFRA 1IC7H 1XCQB 3GLDA 4JHVA 4U6YB 3DI3B 1TTFA 1E6JL 5KYWB 2J21A 3RNQA 1A7PH 4DEPC 2BSRA 5BQ7B 1YNTA 3FQUA 2ZAHA 5LNEA 2UZYB 2X6UA 5EO0A 3LH8A 1XF1A 5F89A 1IE4A 4WO4D 5FYLD 3PWPE 4KUZL 1TSRA 5D1ZC 3II1A 2AK1L 3FUIA 5K9KA 5B1JC 1QHPA 5IMLA 1TR7A 5DZVA 3PFUA 4R26L 5E6IA 4WAFA 2AHIA 4GP8B 2I5YH 1WIOA 4BH8A 1O9ZA 1FLTX 1ZSDA 2NRDA 3R19A 2Z1PA 1S2EA 5K9OB 4HC1A 5IUCA 4PLOB 4YJZL 5C0FB 3ZRCC 1QLFB 2OKMA 4JZNB 2QDWA 2VDLH 3OAZH 4B0MM 5C0GA 3MOAL 3VNZA 3PABA 4RETB 4JG0H 3WS3A 5LDUA 2ZXGA 1FN4A 2EUXA 3EHBC 1BPVA 4UQ3B 3FB8A 2F19H 5AZEL 5HHPA 2CM6A 5KUMA 3HAEG 4WGVB 1JOIA 2JIXA 2O5YH 4L0ZA 4A2HA 3K72A 3SYPA 4LP5A 4KNTA 3VXUE 2Q86A 5HJ3B 2V7NB 2GBTA 1Z1WA 3NEXA 2B0SL 3FONA 2I60H 4ZXBD 4XXWC 4HV8B 2XZAL 3F58H 4JRYE 3H6JA 4PRHA 2XXMB 1ADWA 2FD6H 5EZJA 4TUKH 1TJGH 4QXWA 2NY5L 2ZWLT 1EBAA 1ZLSH 4KQ0A 5CKGA 5BZWA 1OQXA 4RGND 1JXKA 2EDNA 4WWPA 3RIKA 2BNRA 5J11B 4JMXA 3KYMB 1BFOA 2KLRA 1TQCB 4ODTL 1KY6A 5FOBA 2G4EA 3DETD 1Q0EA 5SX4H 2VITB 2OQJA 1OQOA 4Y9CA 1I3RB 2MNWA 5GS1C 3F00A 4PD4K 2RMNA 3SSGA 2QVFB 1PJWA 1PVHA 2GFBA 3PNRB 3WMSA 1RUMH 3WEXB 4IOIB 3SDCB 4QOKE 4EIGB 3A4AA 1M57B 4HJSA 3WKQA 3VXTB 1Q94B 3BPNB 4DK3A 1Y0LA 4XCFH 3LRMA 4Y9BA 1UB5B 4WDIA 5TD4A 4AIZA 1AGEB 4EI6A 4QRRA 3I02B 1YN7A 2P5EB 1MCCA 1UT2A 4LCIH 4MXVE 4HPYL 3QG6B 3DMMC 4QXUL 4WNSA 2C1OA 2OMTB 3MLPA 3ZGHA 3EBHA 1ZHBA 1DFBH 1JWSA 2X1PA 3IDJA 5C3TA 4EZJA 3KS0J 4EI5C 4ECNA 5E9DA 2XUWA 1ED3B 5AVZB 4I1PA 4OIIL 4L9DA 4YFLF 1TUPA 3MHZA 5HDWA 3ZDXF 4ZJ9A 3UC0L 4E36A 4OGAC 2RCSL 1YYML 1XAKA 4GUPA 1M6UA 3AS0A 2EKJA 3MLVL 5E70A 1M71B 4XNBA 2KDGA 2EDLA 3IU3A 3WXWH 1I8UA 3RWCB 3TBTB 1WAAF 2NQ3A 2JI2A 5KTEH 2L7EA 3WFDL 5D9SA 1U8MB 5JTWA 4JCLA 1JP5A 2PPFA 1SM3H 2CK2A 3BIAX 5C9JB 2F6AA 4P5SA 2Z9TA 1C5CL 4YHZL 4MX7A 1H9VA 3TBVA 3COOA 4XVUD 3T4AC 3TZVD 1CD1A 3SD2A 3PXHA 4FA7B 5CBAA 4N87A 2WXLA 1ZXKA 4CGTA 1W0VB 4CVXB 2PYFA 4DFHA 2H5UA 2G2NA 5B3NA 3TPUA 2OSLA 4OFVA 5C8JA 1R3HB 3L5JA 1DVFA 2DPKA 3MREB 5TGBA 3VD4A 3VFGH 3FSZA 2AS5M 1MFVA 5E8DL 1B0GB 2ESVB 3ARFD 2DL9A 4JO1H 3N85L 3BRFA 2X6CA 5GGRB 4A7VA 5HI4D 4IJTA 3WE1A 2R2EA 1JVLA 1H19A 4FTVB 1FZMA 4M48H 4OCXH 3LS5L 3PLYA 2OCJA 2B1AH 5KBKA 2XBZA 3OKMA 1I1AB 3MLZL 5HHNB 1L6XA 5DVLA 3SGEI 4EUPB 4N2DA 2R69A 5HDQL 3HS8A 2GI0A 4XC3L 5E95B 4D9LH 3OAZK 4NKMB 3ESMA 5CJXC 3B43A 4G7YH 3RKDD 1WCBA 3F3HA 1H5BB 1OPGH 3R1GH 3TO4D 1WZMA 2FEDD 3MRCB 3FO0H 4CAGA 4L1DA 3C5ZB 3SDDC 1E4WL 1MCPH 3P0YH 1OGAA 4LPXA 1G7MA 5KBDA 4JN2A 4FQHA 3OPZL 4R0LA 3N2JA 5F3BA 1LP9E 4UDTA 5GS3A 3W0WE 5DD6A 5E0QA 1QRNE 3LKPA 1FIGL 1G4MA 1MUJA 2NY0C 3S35H 4Q7DA 2CA3A 4CC0A 1IVLA 1XTMA 4KH9A 2OZ4L 1UGKA 2GK0A 4ZOBA 3X1EA 1QWNA 3H4FA 4IBVA 3FZUD 1KJ2A 2CIIA 2F5BH 2QZQA 1W16A 1LE5B 2OAAA 4JQVC 4OFYD 4ZAKC 1IM3D 1QNZH 4HWBH 5LGHL 4FEMA 1BIIB 5GGVL 3KYNA 2V5SA 3PHQA 1ZVNA 4Z7UB 4DQOH 2XTLA 1CL7H 1Z9OA 5DJYB 4U1GB 2DI8A 4M7JL 1D3CA 3NCFB 4TV3A 5DMGC 3RQ3A 1MWAB 3PV6B 3WHE1 4K3DL 4NHUA 1KGCE 3LQAC 2W81C 2YXWA 5KOVC 3RY6C 1WA0X 3W11D 4RMBA 3GI8H 4N86A 3VFNA 2LOEA 4O2EB 4EVNA 4IRZH 2W59A 3QEUA 4WUUD 5CHNB 1BZ9A 1YY8A 2PWHA 1CFVH 1UASA 4LLQB 3REVA 3EFOA 3HG3A 5EF2A 1NOAA 2VDRH 4OFDA 3I6KB 2R7EB 3ARGA 4AW7A 1RZJC 3G6AB 4XH2B 1IGFL 3QEQE 4L9LB 5FO8B 1QTSA 4PJ7F 4FXGA 5EU3A 1HOCA 5IHWA 2XVBA 1REIA 2X70A 3HMXA 3DHMA 2B16A 3P9MA 1ES0B 1F58H 4UOQA 4X0KA 4JFFB 4QDGA 1IO4C 3US9A 1XZ0B 3UTSA 1W0WA 1SY6H 2YGVA 2X1OA 3HI6L 3Q48A 4PV1C 3A67H 3DRTA 2QVMA 3BT2L 3QVAA 1H15B 1SLVA 1MAMH 4QXGL 3WEOA 4LEOB 4EN3C 4W93A 3ROLB 2C9PA 1MJJA 3LNFA 4PJAB 4V1DD 3O8XB 5FYKU 3DXAD 3FUEA 3E7JA 4KROD 2C3WA 2CXKA 5G55A 2ZX9A 8CGTA 1NDGA 1FNFA 4E42A 2H2SD 4FNRA 1NEZA 1BQUA 5EB9A 3C2AH 1MNUH 4JMNA 1OB0A 4H0HB 5C07D 2Y36L 3G5YA 1H0DB 3LPPA 4P23C 3TBSA 2J43A 5AW5B 2F54D 2R4RH 1WWCA 3LRKA 5GRVK 4R7NA 3WV0A 4QRPA 5GZOA 12E8H 3MRHA 5MP6H 3ZR5A 1EANA 1RAMA 4ZUWB 2WLKA 3UAAA 5D7JB 3IAQA 3ABGA 4LPYA 1KG0A 1P2CA 4MMZB 1TG8A 1TQBC 1L6ZA 4MXQC 3D69A 4ZNEE 1PEWA 1NIBA 1YEFL 1DZ0A 3MYJB 4M6ML 5AOMA 3K4AA 1CR9L 2UWEE 1VZIA 3WAJA 4J3SA 1G1KA 3BUDA 3B9EA 1JE6A 3MRNB 5LGKA 2X2IA 4KI5F 2DQHL 1MFEL 4U1NA 4FKHA 4ZSOA 4P3CH 2J72A 2RTTA 3GSNA 4P2OC 2VDMH 5C0BA 2DYSB 2XQBH 1TVDA 3FW6A 5DDHA 2D3JA 4ONFH 2EXYC 1U3HC 3C6LA 4HGWA 5D72L 3HZYA 2M2DA 1UM5H 3EYFB 4MQXD 4X8XA 3UADA 5KZCB 2W60B 5ISZD 5GJTL 2BP5M 4Z0XA 3LQAL 5E1IA 3QS3A 4OJEH 2EVFA 5T1LA 3V0VB 4P8QA 3LNIA 2P28B 5BV7B 5J13B 2P5WD 1IGJB 3IJ8A 4JRFA 5B8CA 2ZSVA 3PYCA 4PRPB 1B4RA 1RZJL 4F7TA 2Y07H 4KJWD 1PKQB 3BUIA 3M1OA 4PBXA 2HP4A 1WK0A 4PY8J 2BHYA 1RPUA 1X7TA 1K4CB 2Z31D 1VDGA 3DOSA 4WFGE 3F8UB 1B9KA 1YLBB 1B9ZA 1DUYB 3MROB 5FFGA 2ROXA 4ELME 5IBUG 1USZA 3GNML 2CKBB 4S2SA 3NAAL 1FL3A 2OSXA 2Q3ZA 3GRWH 5I2IB 1LVEA 5CU5A 1F8TH 1RZQA 4PWKA 5HGGS 4A39A 4NYLB 5AUMB 1L7IH 3QWQB 5ICUA 5LN4A 1OXYA 4UUJB 1PDKA 2A9BA 5H37G 1NAKL 1T0NA 3CZKA 3O4OC 1R3KB 2VJ0A 2VZVA 2WXOA 4W70A 4L1HA 1AY1H 4U7SA 2QJDA 2VLRE 1P5VA 3DURB 3NFSH 4DUXA 2CO1A 2PW1A 1UEMA 3AREB 1NBZB 3JT2A 3PAUA 3MLRH 5INDA 1S7XA 2F74A 4YUEH 1IFRA 2EE3A 4S0TD 3FTVA 1JZ3A 1TZAA 3FH8A 3VSUA 4ZFOL 1PX4A 4JY6A 1G6RH 4B9GA 5K59F 1U8CA 3RWFB 1YEGH 1DDHB 2QSCL 5FGCE 1WPCA 3SPVB 1YY9C 4QRFA 5C0AD 3RWIA 4YOKA 3ZTJG 1GGUA 1QPPA 3AB0B 1IEBB 2DLTA 2P47B 4RH4A 4HKBB 5GSRA 3SJVA 1T7WA 2IG2H 2MCG1 3V4UL 2DAVA 2HJKA 3X13A 2HKAA 3GS7A 3T2QA 3HJEA 5DI8B 5IGXL 1U41A 1BFSA 3W9DB 1MCHA 3JWNE 2NXYC 4L0YA 3G9AB 5AG8A 2AGJH 4D3CH 4ODXB 4X6CE 4XZ4A 2N7SA 1O9WA 2L0DA 4HUWA 2ADFH 5F1KC 5AW0B 3QQ9D 1GGBL 3CLEL 4P9ML 2OTUB 4KKCC 3ISRA 5I71C 1T03L 5C08A 3BGFB 3ASWA 4UQ2A 4PIBA 3FTUA 3H9SD 5KVMC 2ZCKL 3S3JA 4LSTL 3QI9C 4HLEA 5L4JA 4CC4C 1OF2B 2GBAA 5DJDA 3C5XA 4TUUA 3QUHA 5IW6A 3VCLB 4L3ED 2CU9A 4LVHC 4NAMA 4RBPH 3KYAA 3MQIA 5D7LA 3SPCA 3CH1B 4N9GA 4MNQE 1MI5E 1VCAA 4KX9A 1A6PA 1JK8B 4AVKA 3L1GA 4R7XA 3HPJA 5CLZA 1J1XL 1ZHKB 1HWGB 1RZ8A 1GSMA 1XGPA 3ZYIA 1AKJB 4YSDA 1MG3C 5FDWA 2MQGA 1NMBH 3OAWA 4PMFA 5BO1H 1WGOA 2BP0B 1FNSL 2ADGB 4OZGF 3IJSB 1GR7A 3S2CA 1MXDA 4ZMPA 5EIIA 1EQWA 2X9ZA 3NH7L 5MEND 1HFUA 5EOTA 2EDWA 1DSFL 2OTWA 3OXSA 4NQEA 3QUKB 1K5NA 5TH2B 1HHIB 1Q4NX 25C8L 2QADB 2Z8RA 4KKNA 2WPGA 1JUFA 2WQVA 2YZ1A 4ZPTB 4JKLA 4NLHA 1KZQA 5IM7B 2H9GA 3AWFA 4QHUA 1P7QA 3SBWA 4KZCA 3EGSB 5IVXB 4RCAA 3V5KA 4CRPA 3PGDB 5E6IC 4BWWA 4G6FD 1L6PA 3D3VE 4UILH 2VW7A 2CO7A 2BIQA 2XPYA 4HXBH 4D9RE 3JWOC 2WWMC 4L5FH 4GRLD 3WFHB 4PLKD 1PLGL 1RHHA 4AQEA 3R18A 1BAFH 2YPKB 3ILQD 4DGVL 1K2DA 3W57A 1YQVH 4MS6A 4PJIB 1ZD6A 3QNYB 4X5XA 3U6XS 1KFAL 3LN5B 2YC1A 4XBEL 2Y7QB 3X11A 4HCRH 4XCNA 1NIDA 3S4SB 4EXKA 4TULL 4AIOA 2K6ZA 1IKOP 3H53A 3TWCH 1HWWA 1NCJA 3IF1A 2XPGA 1UXMA 4DO6A 5ADPL 4PV9B 5C92A 1FAIL 4ZMTA 4LNRB 2ZNWA 2C1PB 3DX0A 3QARA 1KCBA 1RJCA 3SKOB 3HE7D 5G5DA 2QFRA 1PZAA 1BBDL 2A6KA 1IIIA 1ZV5A 1TZGH 2CGYA 1FJ1B 5IHBA 4JDZB 2F58L 3QDJE 3V7AE 3MA7A 1MREH 1A6UL 4HX1A 1VGKB 5JOPE 2ICWB 3ZKMD 1ACCA 1T0OA 4I88A 3IXTB 1UFGA 4X80H 1KUMA 3KLSA 1TVHA 2JB5H 3JV5A 3CVIH 5F70A 3OJVC 4ILDA 1BA9A 2AAVA 1NCHA 1I1RA 2NNAB 5E5MB 1IQWH 3U30B 5HDBE 4A6YB 5KG9B 4KO5A 2WBJA 1LE9B 3MGAA 4ALAH 1T5XB 1QBML 3QUMA 2ZE0A 3L1OL 4N9OB 3VD1A 4DFIA 3TCTA 1F4WL 4W9FC 5EZIH 3MUY1 1FF5A 1XSIA 4X4ME 3MA9L 1RZGB 4XXCA 5D4QA 2JWYA 3N43B 4WNQB 4I4WB 5EDSA 1XSOA 1SZNA 1I9EA 3QDMD 3ULAB 5I15H 3MV8E 3FN9A 2VDOH 5TF1L 2FHCA 4LBEB 4U1LB 2NOYA 3BW9B 2I9LB 1ETZA 2J8HA 4N8VB 4RBPK 2EXWC 5KN5B 4G59C 2V7HA 3OSKA 3D8MA 4NQCA 3KYKL 4OZIF 1WBZA 1LJMA 5M7QA 3FTSA 4U3SB 3QIBB 2VN3A 2QL1A 4GG6E 1DTUA 1EJ6A 4I18B 3FSOA 2UYLA 2EC9T 2G2RA 4NUGL 2X4TA 4W9IC 4GQZA 5B38A 4Q2ZA 4IKNA 2WVSA 2F53B 5C0EA 3MJ8A 3JWOL 4H8UA 5F7HA 1QVOA 3F6JA 3DROA 4HC1L 1ZGLM 3QXUA 4G11A 4N0CD 4XNYL 2JI3A 4BGDA 2OM5A 2R23A 5EA0H 5ESQA 4JO8A 3V9EA 2IPKA 4X5LA 3FFCE 4NNXA 1OANA 3WY3A 1LO2L 3L6FB 2KI6A 4BE6A 4YDKL 4ANVA 1OK8A 2EDEA 1A1MB 3BKCL 5HYIA 3PPEA 3F7PC 2CA4A 3IBOA 3VX0A 5IMKB 3B9VA 3IEAA 3ZE2B 1LK3L 4YZWA 4YXHL 1CDHA 3WIFA 1ZHNA 1YEDB 5DZOA 4F24A 2AEIT 3QO1A 2HKFH 5IK3A 1E8ZA 5FYJH 1DVFC 1KLUA 5I1GH 2ZOKB 4WGWB 4UB0L 4LSUL 2H3NA 4NSKA 5JHLL 4HDIA 1NEUA 1SFDA 1IAOB 4E41A 3C08H 3BFWA 4YEEA 1FLRH 3FO1B 5CJBA 1IJNA 1DR9A 3T2OA 4CN1A 4ERSH 2CDEB 2ZPKL 3CIAA 3GXFA 3Q0HA 4NUJA 4J8RB 3WEAA 4IDJH 2IGFL 4KJYA 4PJDE 5EOQH 3CFDA 5J7CC 1NWOA 1T6BX 4J1UB 4MB1A 3ZHKA 4DCQA 3AQXA 2J57A 4OKDA 4WV1A 4QHMB 3TBYA 5CSZA 4OCNC 1Q1JH 3ZR6A 3UZQB 4FJYA 4GMTH 4MCYB 3U0WL 3UP1A 2QZ5A 3BQUB 4K5LA 2IWEA 3LEVH 5DVMA 2BVTA 3L81A 4M4RA 4XVSH 2N3JA 1EZVX 2D73A 1HEZA 1CS6A 2YHGA 5FB8B 4KY1H 4R0LC 2FYYB 2VLKD 4PLNC 4K71C 5CGMA 3VFTA 2DJ4A 1FSKC 1S7TB 5FO9A 2XWZA 4XAKE 2FGWH 5DSCB 4YNYB 1M4KA 2I07B 2W8CA 1G9MC 5FS5A 1SEQH 3L8QA 2ZZUT 3QAZB 3A4EA 4EEEA 2J5LC 3VI3E 4E9TA 1EFQA 2EADA 4NKIH 4HAKA 1ZT1A 4Y19A 5KVFE 1FYTA 5T3XL 5AVXB 3PWNA 2BM3A 4FLHA 2DEWX 4NT6B 3S34H 3X1NA 3TIEA 1TYEB 4CVUA 3Q2VA 4NN6B 1OAJA 4OCWL 1J8HD 1I8MA 5JXEA 1HTYA 4YVUA 1VJSA 3VM7A 5JLZB 5LNGA 4Z7NB 5DJCB 2HRGA 2BVOB 3RHWK 1UVQB 5LXGL 1A4JB 2V3FA 2W9DL 4JFOA 4PJXA 2VXTL 1QD0A 3B7RL 3L95A 1HNYA 5E4EC 3FUMA 4RSVA 4PJ5E 4KJQC 3RL2B 5BW7A 4PN6A 4YAQA 3QPKA 4HP5A 5F6HJ 1FE8L 4G43B 4F7EB 1E27B 1YEJH 1XGUA 3ARGC 5EU6B 1HQ4A 2XG5A 1HHJB 4EIUA 1G6VK 3BPCA 4ZTPH 1KBPA 3LD8B 4FXGC 4JFHD 4TL5A 4PM1A 3P2BA 4QWWC 3ZPDA 5I8CB 3FH5A 1BM7A 4UU9A 3FAXA 2XV3A 4ESKA 1IAIH 5CCKH 2R4SH 3B7TA 3DKHA 1FI8C 3P3UA 4MSWB 1HZHL 3FTWA 4WY7H 1TF4A 2R0KL 3I3BA 4G5ZH 4PU2A 2MCAA 5C2UB 4OR1A 3CVDA 1CGWA 5KW9L 2YXMA 1O0VA 5D1XD 2CCVA 4UYPA 5C7XL 4P99A 2ZKHH 2R9HC 1INEL 1AS7A 5B4MC 5DUJA 4K94H 2Z4QA 4RESB 5FM8A 1JV5A 1DBKH 1KCSL 4F58L 1R19A 2R69L 4LHUB 5CR8A 5JDSB 2BFVH 2WQ8A 3D39E 4TSCH 5CN2A 1KYAA 3VWJD 3M8OH 1KTLB 2HRPH 1NC4D 4U2YA 3N6YA 4HK0B 2CHDA 3ECVA 5D71H 4Y2OB 3SN6N 3V6OA 5H4YA 5GQBA 1LMIA 5E1AA 5GZOC 1JWUA 2ATKB 4RWYH 4QO1A 4OUOA 4M62H 1H9DA 3KJ4B 2IPTH 2OMVA 1F3JA 1R5VB 2KL6A 2DH2A 2IXQB 3EO0B 3IGAB 1CWVA 2C9UA 1BQHA 4JPVH 1AGCA 1JGDB 1LDPL 3HC3L 2CHWA 2LV4A 1AXSA 4PG9A 5JO5A 1M6OB 2BS8A 3MUGB 5BRQA 5TQ2H 4XP1L 1G9ML 3SCMB 4JPIB 4JRXD 4AQAA 2O6PA 3OWRA 5BMFH 3IGLA 1PG7X 2WUBL 1JK9B 4H2AA 4NDMB 1OAXL 3VD0A 3GEFA 3HI5H 1J5HA 1DVYA 5J56B 3QJUB 4ZFFA 5BS0D 2JCCE 2NDFA 4GAYA 4Z7VF 3QQ3A 1HT6A 5T5NF 2VCOA 4M7LT 1VLXA 1VRSA 2Y3NA 4PJ9B 3TIDA 1IM9A 3MGTA 4LHUG 1MCDA 3NIFB 4XCEB 5HGBB 2EIKB 1DP0A 1XGZA 5LWYL 4L8BA 4FS0A 3QC5X 4YQXH 2QGCA 3T4YA 2WVTA 2VDNH 4P5MB 5B8CC 2BVPA 3K6NA 5C7ZA 3KZ8A 3PS6A 4YSAA 4ZX6A 3V6BR 4H25A 1NL0H 5J1TC 1IBBA 4GAAA 2ZYIA 1RIVL 3A3YB 3HMXL 4TTDC 4P46A 4JFXA 3AWEA 2DQCL 4ZFZB 3CX5J 3FNKA 4TN9A 2BOBA 4E0RB 5B38G 5FECB 3FOLA 1MW2A 1S5IH 1CDIA 5CNHA 4TS6A 2HKHL 2JELL 4K5PA 5ENWB 1U8LB 4R8WL 5DEGB 3MLXH 4XBGA 4J3TA 4DEPB 4JFEA 2J56A 2XWBA 2AJSH 5I0VA 4AVJA 2HFTA 3D85D 1GL4B 5D1ZB 2FO4B 2KUTA 2FLMA 2VSMB 1JPST 4BE5A 2VMJA 4X6DF 1P9MA 1S8DB 2YOAA 4TKWA 3VWKA 2HFGH 2AV7B 4NO5B 2IDUA 1NJ9B 5C2BL 4NP4L 2Y2WA 4NWTH 4XE0A 1URZA 3KE0A 3OLIA 1N5AA 3ZO0A 3VXRB 4AH2A 1NBCA 1GMEA 4GH7B 2HAZA 2W0FB 1N4XL 5CP7A 5BZDB 3ZIMA 1IEHA 5DFTA 1XQ4A 3L16A 4P5TB 1KXQE 1GPOH 4GS7C 1KFGA 4JE4B 4YXKL 1RZFH 4PRHE 1AI1H 1UXWA 2VSDA 1PD6A 4MMYA 5KANG 1KLFA 3MRBA 4G9FA 4NNPL 4OF0A 3ES6B 4HUVB 1O7DE 3VRJA 3BVXA 3IB4A 5HXMA 3FCUB 3ABZA 5I1JL 4UM9D 4UM8B 4AMKL 1MG2C 4Y2DD 4OV5A 3GSNL 1PF3A 3QA3A 1YUKB 1FNHA 1MHPL 1V3KA 4P57A 1JNLH 5AD0B 1KTRL 1HXMA 2ZIDA 2J71A 3EF7A 2DTML 1QRKA 3G5XA 4KKRA 3BI9X 3AUVA 4KAQL 4PGEB 3APFA 5H4ZA 5ACLA 4N20A 1B88A 4FFWC 4ZRGA 3TFKD 2EYRA 3PV7A 4UINL 2CO2A 5ANMB 3GI9H 4HEPG 1KPVA 1ZGLP 5DGRA 5EF0A 2VJ8A 2EE2A 4JL1A 4O02A 1CD8A 3B7YA 3PWLA 1QZNA 3GSUB 4HZ1A 4NO2A 5F7DA 1MQKL 2YGOA 1TITA 2GSGB 1T7XA 4NERA 4AEHH 4PJHF 5GS1B 5IJDC 1AR1C 1XXFC 4ICWA 2DLGA 2DQUL 3BZFB 4R2GD 3SY0B 1TO5A 1E3ZA 2IH1A 3CX2A 1QSFB 2FIKB 3N1FC 4UZUA 4P06A 4ZUUB 4FG0A 1ITBB 5DFAA 4W9CC 5C0CB 3DECA 4Z77B 4P3DB 1PG7H 4AYFB 4Z0BL 3U2IA 3DUUA 3WSQL 5DRNA 3DJ9A 3WU1A 1CICD 3UJJH 5F6HI 4YPJA 2HT3C 1EAPA 2VN5A 2Y06H 2EO9A 2EEFA 1GOHA 4GUQA 3TNNB 1CLZL 5FV2A 3NG5A 1PZSA 1Q8MA 1I7TB 2PYEB 3DMMB 3EO1B 4IEFA 4EXPX 3ABMB 2R1WA 5AW6B 5FCSH 3CFBB 1A1OB 3EJYD 4WK4B 3CLFH 3ILPB 4KMQA 1CLCA 4EI5B 3B8YA 5EDXA 1BOGA 2JTDA 2NSXA 4HD5A 2AJXL 4PJEB 5EZOH 2EIZB 1CUOA 2C9SA 2JKJA 3W82A 1UD3A 4MA3A 3QJZA 2J8UF 4K4KA 3WLWD 3AQZA 2AXFA 3EH4B 3HCVB 4PJ8D 5DWUH 2TRHA 4FZEH 4JGJA 4KOBA 3V4PH 4PHXA 2J55A 4RWHA 3C5SA 1JTTA 4QXTA 3DNKA 4FFZL 4HJJL 3UTOA 4N1EA 4POYA 3SKJL 5EHFA 3TURA 4XB7A 3CFCL 2OR9L 4JHWL 3FB7B 3UPRA 2XFXA 4NRXA 15C8H 5L2KE 1HI6B 1JVOA 2PCPB 4Y88A 3ZE0E 3B2VL 5SWSD 3MFFA 3MO1A 1A7OH 3JZYA 3T4AB 1DBAL 2AXWA 2V5TA 5E5RB 5A2BA 4AW4A 5IHZB 1NGQL 3TP4A 2E6JA 4GXUM 3VFMB 1TLMA 3H42L 5HGAA 5TQ0H 1W9XA 3DO4A 2ZNXA 2JF1A 4PBDA 3ZVVA 3MV9A 1GKEA 2A0LD 4LCWA 4XN9A 5T3ZE 5DEJA 5E00B 1OCZB 3OR7B 1SVZA 3RJQB 4JPWH 4FQLH 4J12A 5DC9B 3VU1A 3HMWL 1IFHL 3AT9A 4OKVB 1FGVL 1Z5HA 1LP9F 3EJTA 1QI5A 4KVNH 5IIEB 2BDNL 2LU4A 1OGAE 2OX5B 4K3GA 4FI8A 2NSQA 4K3EH 3QH3A 3VE0B 3V55A 3JYBA 5E2JA 1CGSL 1MKFA 2AEQH 4Q14A 5CBEB 1NUDA 1ECYA 4S1RH 4XPAL 1ILUA 5T1KB 3SDDB 5I6MA 5FX3A 1FRGL 3I50L 3OD3A 4NAJA 3HB3B 5IW3A 1QKZL 3P40A 4KRLB 1T1WA 4NC1E 3KLAA 1T3FA 2XWXA 1CFSA 3ZU8A 4BXSV 2NY0B 4MB3A 1EHLH 3HW7A 4OJFH 3FYEB 2WBJC 5CZVH 1IZJA 1V3LA 5K9QG 2JNZA 5F3FA 2D0FA 4PWHA 3V4VH 4DP5X 5ANHA 1N10A 3GXPA 4IBYA 4HJ0C 2XTJC 3QG7H 4ZAKB 5HBBA 4N4YB 4LIQL 3FUFA 5IBTH 3VNYA 3CDZA 5BOZG 3IWVA 2R8SL 3N42F 5BXFA 2DWXA 2GJ6D 3OGCB 2X4QB 3D30A 5HHOD 4UT7L 1NCBL 2FJFA 3O0RH 3DOHA 4W9DC 3SDXA 4KI1A 5C97A 2R0LH 3WJLC 3QFGA 1M1XB 3QJSB 1SJVA 3U1SH 5AWNL 2R0WL 3NJJA 1OE2A 3UMTA 5ID1A 1G7HB 4OCSL 1AXTL 2JLPA 1LEGA 2C9RA 5F88A 2NYYD 2F8XC 2DIAA 5DHXB 5JIHA 2KZBA 3JWNH 2WINA 1OK0A 3DVIA 1IGCL 2WLLA 2EACA 2EYTB 1RURL 3LKSA 4WW1A 3U4EA 4AMXA 1QI4A 2ZJSH 3LEYL 3EYUL 2BJMH 5JHMA 3VSQA 1FBIL 1ZTXE 1T1YA 1P4IH 3D4GA 5GGTH 2VC2L 4KHXL 1EFXB 3DVNB 5TTRA 5IFJB 3TT3H 4N26A 4P2QA 4CUCA 1TKWA 2NXZD 2X4NA 4E9QA 4FGMA 3MJ7B 3GHEH 4OQTH 4R6UA 4TSAL 5GS2H 2LAGB 4ONHA 3EGDA 2D3LA 4ACPA 2VRKA 5KSUA 2KQNA 3ZKXB 4EN3B 3NZHH 1MPAL 1ORQA 1AD9B 3MBWA 2AJUH 1E50A 3MJ6A 4TSBL 5ETUA 32C2B 1G7LA 4UV7L 3MN8A 3GUTB 2WBKA 2EDJA 4ANXA 4QRPE 2FUQA 4Y1AD 4A2DA 1KB5H 4CU6A 4XHJC 2KLSA 4GW5A 1FP5A 3MBED 4L05A 2XKUA 5JPMA 4I3RH 2Z92B 5GZND 4JVUA 3PDGA 2W9EH 1S78C 4P23B 1JPFB 4MJID 4TUJB 4FZ8H 5I73C 4HMDA 3QJFB 3WENA 1YAIA 4LQ1A 5I1IH 1S5HB 1YNKH 4PGDB 5EU5A 4F8QA 4P4KB 2EH7H 5FUOL 4ZFOB 5T1DH 4X99A 4GSXA 1X5FA 3EOAA 4OFPA 3GO1H 4N5EC 5EULV 5C0BE 4OGYL 3PAZA 3K2UL 2MEJB 1GS6X 3T0AA 4PGBB 5HHXH 4GEJA 4PV8A 1DQDH 1S7WA 2V17L 5KS9B 5DRWB 4JDTH 2IVFC 5EZLA 5AALA 1X5ZA 4UDUA 1N0XH 4ZBJA 1YPZE 3DJSA 3N0AA 2E27L 4FDWA 1OY3B 5D8JL 5C1MB 5DS8A 2Y9RT 5E8OA 4P2OB 3SGJA 5DZ9A 4GRMB 4YS4A 3OAUL 1KN4L 3PHOA 1TSHA 3CBKB 3FUJA 3OR6B 1ZKAA 1VKXA 1U3HB 4WI0B 2AXGB 3G04B 3OKKA 3O0LA 4FRWA 3L4XA 4HIXH 3VFWA 3X3GH 2CNZA 4K73A 4ZX4A 3WFEL 1C9SA 1IT9H 3VFRB 5JNYA 3PY9A 4X83A 1I3GH 5D5MA 3OZ9H 4YR6A 3ZT5A 4M6NL 3L5HA 3CQPA 2YUZA 4OLWH 5ACZA 2Z1KA 2CUMA 4HZLB 3RVTD 3Q6FB 4UQBA 4ELMF 4RIRB 5JXEC 4NJAH 1KBKA 2IDCA 1QLRB 4OD3L 3V0JA 2EUWA 5CIPA 4EZLA 1Z66A 2HJFB 2J44A 2CKNA 2VL4A 3O2DA 2X87A 3A4FA 1U0QA 5JHDE 3WJMB 5IW1A 1QQDB 4K07A 1A7NH 3APMA 3HVDA 4LCUA 4V2CB 1WVZA 1TXKA 5BW7C 4IS6B 3S0PA 5GSVA 4AGLA 2NW3A 3DLQR 1CMOA 4A7TA 4N22A 3GHPA 1UEYA 2DQEH 2WNWA 1WHOA 4PJFA 5AVWB 4F5CA 2G60L 4P5KB 5KSBA 2XBDA 4F9LA 2R39A 1KGXA 2X3AA 3HUJA 3ZQXA 4LQFH 4Q0XH 5KVGE 4MJHA 2RB8A 4QYOA 4OLUL 3EH2A 4IKJA 4HKXB 2BRRH 4R90L 4Y4KC 3SO5A 1OWWA 3AG4B 5I1AA 4KGLA 1SYVA 1U92B 3VXOA 1LL1A 3B9KD 3BP6A 5SWZA 3RB7A 3RI5F 1A14L 3S3SA 3E9UA 4QGTA 5GPRA 3UH8A 5KVEE 4BZ1H 4G82A 2ARJA 3QNZA 2YPVL 4OCMC 4DGYH 1U8KA 4M00A 1ZGLA 5E2TH 4WKZA 3MX0A 1ONQB 2DQJH 5IVZB 2AI0H 4EJ1C 4XVJL 1AO7A 3HBQA 1EEQA 5DHMC 3SBPA 4FNSA 4X6CF 1WS8A 3I9GL 4KKQA 2HUEA 3V6OC 1F90H 4KPHL 3VXSA 1E4HA 3KJ6L 1T2JA 1A66A 2P1YA 2X4RA 4NENA 2Y22A 3BIKA 1N6VA 2VIRB 4GO9A 1JNNH 3QR2A 5J6HA 1E28A 3TNMA 3HG0A 2VRAA 4N0YL 4EIBA 4UANA 2Z8VC 3FT2A 2CG9X 1ZWIB 1UACH 2WN2A 3LMJH 5D7HA 1SXAA 1PNDA 5DTFB 1KCUH 1AP2B 3I3DA 2NXYB 5F7EL 1F3DH 3GINA 5I30L 2X4PA 5IQLA 3QJVB 3QQ4B 3VQ1C 4JLRB 1WUZA 2OA9A 3LXBA 2AKRA 4N2LA 1GJUA 3DPDA 4ZX3A 3DDGA 1FZJB 5CEZD 5LAPA 1MFCH 2YD0A 2W94A 3Q6GL 3PWUA 4PS8A 3BRGC 4FF9A 3ORJA 3BKYL 1FUNA 3FDWA 4NZTH 3HHMA 1U3ZA 2IOOA 3FQYA 3MV7A 2EZ0D 3QI9B 2PWEA 4UTCA 2B2XH 2VQTA 3RTQD 4Z7QE 3CFJB 3RAJL 3RGVD 1A9BB 1H6UA 5FA3B 2G3MA 5LKNA 3D0LA 3GKWL 2WKOF 1XGQA 2P3YA 4XP4L 3W2DL 5IEHB 3IPFA 4LVHB 3LXAA 3TO4A 5IV2A 4FLSA 1SLWA 4MA1C 1QR1A 2EEBA 4G6JH 3U7YL 1N7MH 3VB8A 4U31A 3O2VL 5K9JL 1VCBC 2F7RA 3HZKA 3SOTA 3O4LB 4NRZA 3AADB 3H0TB 4PI2A 4PJBE 1CZ8H 4B9YA 4KC3B 4ZZKA 4AGOA 2F1AA 4WSKA 4P59H 1OM3L 3D18B 5DD0H 1XF3B 1F41A 4DKFH 5IP4A 1HIMH 3IRZA 4JK0D 5DS2A 2YKLL 3NTCH 3JYCA 2X41A 4GKOA 1SBSH 3BKML 3EOBA 2G75A 2IBBA 4QTFA 2Q2EB 3EJRA 1I8IB 4YHNA 4JEGB 3RYMA 1I9RL 1IC0A 1ZAGA 3SGKA 1Z9SA 3BXNA 2H1XA 4WKXA 2HG5A 2EVGA 2VUOA 1BGXL 4F15C 1FFNA 2B39A 4LARH 3DVGA 4YXLL 1DZBA 1HHKA 3FQUB 4JKPH 3K8MA 3TCLB 4UT6A 3C12A 1BEYL 1BJMA 5EO0B 1DQJB 4CVWA 4APXA 3IS1X 4I2XE 4U2ZA 4AQ8A 2DDQL 5DXWA 5HJBA 1QFUH 2AJZA 5EOCH 1U8QA 1P9MC 4LAJH 4WWNA 5HHVH 3VG9B 4LNVA 2MJWA 3VWKC 1TZHA 5C0IA 3X17A 1SEBA 1ZSDB 2BHFA 4JBSA 1YC7A 4URTB 4QJ4B 2RH0A 4JQXA 1KBBA 4IW4C 4D9QE 3N41F 4PRID 4RGNB 4X8JB 3TFKC 3GXTA 4BSVA 4X8CA 4KNUA 1WEJL 4HGKC 3MNZB 3WS3B 4QRTA 1FN4B 4KKAC 1I1YA 3GZOA 4MS8D 2VXVH 4LASL 3KPPA 5G2NA 4YIQA 1O6VA 2VMEA 1OF0A 1KXVA 2JIXB 3BPOC 3K72B 5IFAL 3CZGA 3CFEA 3QJQB 4J3UA 2FBJH 1I9JH 3T08A 3X14A 4I77L 2CZNA 3FONB 3Q8EA 5I1HH 3KXFE 2LTQC 2CALA 3L7FA 4XP5H 1G4RA 4V1DA 2WB7A 4M1CD 2LU5A 1U91A 1NOFA 3GHBH 3HKZA 1DQVA 2C3VB 4NOFA 3ECBB 5D70H 2CLRA 4MZRA 1NGYA 4F57L 1WAAA 5BZWB 5T1MA 2H1PH 3Q8CA 1DE4A 4X9HA 3F7YA 4X7TB 2Q6WA 1T7ZA 1OP5H 4J3WA 2YD8A 3KPLA 5PCYA 1FYHB 4OIBA 3IKCB 2O5NA 3L2NA 1Y7VA 1QSED 2E47A 2APWA 5AZ2L 5GS2D 3T0EE 3T77A 3RDTD 2WZ6A 5LCVH 4JM2D 5EWIH 2YRBA 2OMBA 1AXIB 3EJYC 1UCTA 3ECUA 4G80B 1D2PA 5CINL 3UTZA 4FN0A 2AV1A 4QKTA 2UXVA 4Y2LA 5CD5C 1HEJC 1XB6A 1HILA 3ZY7A 2HTKD 4Z3HA 4OGQC 2MKWA 2BMKA 2AJYH 2J6WA 3HLKA 3NESA 5EORH 1KMGA 1U8HA 4GG6F 3OPUA 1MVUA 4O5LH 2XWDA 1OSPL 1TEFA 1Y0LB 4NQCE 5E2WL 2DQTL 2E9IA 4BJLA 1ZS8B 1ASOA 3QO0A 3OG4B 4QRRB 2JKTM 2YGNA 3ASOB 3IJEA 3HG1A 1P6FA 4MAUH 4XOEA 3SGEH 5IB3A 3LNDA 3B5HA 1KJVA 5CP3H 2BVYA 4KZDH 4IHBA 2C1OB 5KOMC 2HPOA 1CCZA 3FCSB 3ARXA 4J6RL 1ZHBB 1QAWA 4I9WD 4WU5A 4IIZA 5ISZA 3IDJB 2XVLA 4LAQH 2D7TL 4ZO6A 3TZVB 3V0AC 5ADOH 3LKRA 5E9DB 1BFVL 3O6KH 2W92A 1ZANH 2OLDA 1NAMA 1P7HL 2CXGA 2YSSA 2P5WA 2HWZH 5SX5H 1FVDA 4MXWL 4ZQKA 4M03A 4DSYA 4BHUI 2W07B 2DM3A 4MKMA 3NMEA 3NSXA 2NY3C 1FH5H 2OW7A 2MCPH 3LDBC 5ITBH 4IGBA 2YKKA 2RFXA 2FNBA 1PL3A 2FBOJ 4KXBA 3RVUC 5D9SB 2CBQA 1KGIA 1T5WA 5H94B 4PJ6A 1XIWD 3VB9A 2EEAA 3K2IA 2YQBA 3ZQ9A 2Z31A 4LKXA 4RZCB 3ULVD 2ADIA 3CN0A 2ZCLH 3MNDA 3HNSL 1S46A 1CD1B 2BIPA 5CBAB 4HH8A 1AQMA 1TYRA 3QUZD 4MJ5A 5LBVA 1A5FH 1QLEL 3IGUA 3TX4A 3TPUB 1C1EH 4YHIA 3MR9B 3CQFA 2OSLB 5C8JB 3U0PA 1DVFB 1GZPA 3NJFA 3EH5B 4MQSB 4EUPH 1IRAY 1D7BA 5K33A 2ZG3A 5D1QD 3FF7A 1BOYA 4L4TA 3EAKA 4PJGB 5TK2A 3NCYS 4ES9A 5I18H 5HHQA 3QGVA 1FZMB 4YDNA 2KERA 3T9WA 2R2BA 4P05A 3ARYA 3TF4A 3ILDA 3G5ZA 3JZ7A 1SXSA 5EBWA 3OKMB 1MHEB 4NZRH 1I7RB 3UTTE 4ODBD 1UYWL 4PJ7A 5FM5O 2WXKA 1JV2B 1T22B 2JQZA 4K9EC 4O02L 1AS8A 1ZXQA 5TK4A 4EKJA 4Z18A 4DZ8B 3MDJA 1W91A 1IM3B 3VI3F 4XPBH 2B9AA 3MXVH 4YHPA 5GGQH 5IQNA 4OI8A 2WQRA 1T4WA 3EUDA 3RY4A 5DD3L 1P4BH 1XV8A 1S9WB 1G7MB 3ZL4H 2OZNA 4FQHB 4DAGL 3ZHDA 4R0LB 4Y19E 4LSRH 1FYTE 1IAIM 3WCYA 2J20A 5F3BB 1IGIH 1NCOA 1QUNA 4K71B 1CF8L 1FSKB 5D2NA 2PPEA 3M46A 1MUJB 1JFQH 1RFDH 1DEEA 2FEJA 3QDGE 5CXPA 4WUUB 3VDAA 4MJ4A 2E86A 1MCFA 4DETA 2GK0B 3HZ3A 1SLXA 2IQAA 3ISWA 1NWPA 2J5LB 1P7BA 4TVSa 5FUCC 5IROA 3QCTL 1MWAH 4DOHB 5E8PA 1SPDA 2LE9A 2WM0A 4KMTL 3U46A 1GAFH 4LPTA 1OP5K 2ALAA 4DKEH 1G9HA 1EIBA 1MAJA 3S5LB 1MCQA 3BAEL 3F7VA 3KYNB 4HZAA 1WFIA 2A1WH 1NFIA 3MAWA 4YBLC 1BFTA 2X1QA 3WTVA 2X40A 1GS7A 1JF1A 1VACA 3PL6D 2KZ1B 4KHTL 4PGCA 1A1NB 1Q9LA 4MNGA 4NHUB 4XMLL 4L8DB 3IDYB 4X5PA 2MOVA 3OB0H 5E4EB 4OLYH 3S5YA 2Z8WC 2NY6D 4U1JA 2NMSA 5JW4R 3QEUB 3QYCA 4G8GE 3ATDA 1CE1H 3DTUB 4G71B 4LLVA 4PB0H 3ZE1E 1BZ9B 1YY8B 4FCAA 4AQ1A 2B7DT 2BC4A 1B0RA 2IAMD 3EFOB 4YHKH 1MJ8H 1ODAA 4HPOL 3R4DA 4KROB 3ARGB 1G5AA 1NINA 2ZXBA 3CAFA 4ZMVA 2BSEA 3FO2A 3U36B 1FG9C 4FXGB 5EU3B 1HOCB 4JFYB 2KMWA 1RIHL 4JJ5B 2ZKYA 5D7SH 3P9MB 5KYUB 1QSFE 4X0KB 3G5WA 2BH0A 2F54B 3UTSB 1W0WB 5C70A 4R3SA 2I27N 2XN9B 5ALCH 2FJGA 3DRTB 4GG8A 4P9HH 3VJ6B 2LU3A 3GMRB 4LLUB 5MENA 1TJIL 3V5DA 5HPMA 3TM6A 3VYOA 4G9DA 2FQEA 2FWOA 3QUXD 1FGNH 4MAYD 4Y5VA 5SX5K 1KELL 2WY3B 2YBRA 3LCYA 3KS0H 2DMHA 4HOMA 3ME0A 2YN3A 2VM9A 4OF3A 4C4KT 1CBJA 5JPMC 1YUHA 3FT1A 4K9EL 1NEZB 1DCLA 4NQXA 4DERA 2XXFA 4HFUH 1UA6L 4PS7A 1MZYA 4MYPA 4WFED 3GB7A 4DHLA 4CBZA 3QWRA 3KPSD 1ECZA 3QWOA 2LABA 3TBSB 3KHOA 4ENED 1F2QA 2IDSA 5KBLA 1GKOA 4H5SA 4U6TA 2OMXA 2JCCF 1NMAH 2QQLH 1OTUD 4HBCL 3UG3A 3O81A 1ZK5A 1E67A 4KTEH 3D69B 3VTMA 5F3HA 3BH8B 3KNBA 3UGUA 3T3PE 2X88A 2F1BA 5I8KH 4AI7A 2NY2C 4J3OH 4ODSH 4TNVK 5CILH 4WI9A 4I0PD 3WN6A 3E8UL 1M42A 4KNQA 3OJMB 1NCAH 4F7CB 2O5ZL 5F93C 3BAXA 3PWVB 1YEKL 1CLYL 3GMQA 4YL9A 5TDOA 1W15A 4U1NB 4ZSOB 2P48B 3C60A 3WKYA 4H13C 1GYAA 4XO4A 3IDGA 4EZMA 2OR8A 2IQ9H 3GSNB 4LU5L 3DA0A 4TNVF 3AACA 3SGJC 5BOJA 2BVQB 5CGYC 1QP1A 3BVWA 5BO0D 1BD2A 1BZEA 3DX6A 4J27A 5EH1A 3LHPH 2H32A 3GZPA 1CO1A 1F4YL 3ZDZB 4HGWB 4OGZA 5IB4B 3HZYB 5HYJE 2XRAL 3HE7A 5JOEA 4LCYA 4WIQA 3P77B 1UKQA 3PGCA 4OT1L 4QJ3B 1LLAA 2V2XB 4XMUA 1KSRA 1PZUB 3MUZ1 1T7VA 1OAQH 1DVSA 3GT6A 1U8IA 3BGMA 1A9EA 4DVBB 5JW3H 3HIZA 1HZKA 3OWEA 2CO4A 1SY6A 2IH3B 1RH8A 1A7QL 2K4AA 3WKMH 3ELAT 3KDPB 3MXWL 4QF1A 5B8CB 4KKBC 1IFGA 4F7TB 3T65B 2YD1A 1ET5A 1TQTA 2CKBH 3NCCB 3ZKNC 1MRCH 3MU3A 3NFPA 3QFDB 3KYOA 4YH6A 3DOSB 1MCNA 4JFEE 2ZWNA 3V52H 1AQDA 1R75A 3S88H 2ICEB 4LL1A 3OXRB 2WYIA 4PUBL 4F9LC 3BE1L 5IT2H 3UBXA 2ATAA 4S2SB 2DQGH 3NSDA 1FL3B 5IESH 5DD1L 3I3EA 2VLJE 4H1LB 4M5ZH 3OB0K 2P8MA 2ZWYA 4JFDE 5C0AB 5HYSB 4UOW1 4AV4A 3LIZA 3DSNB 3GMOB 3CXDH 2V4LA 2VN7A 3M6DA 1B4JH 4PCKA 1T0NB 3CHSA 5EG6C 4FP8H 2YMOA 3CNKA 3H7BA 3QPQD 3PP4H 4LSDA 1P5VB 1V7MH 1AHMA 2P5ED 2PW1B 2HFFA 5C0DA 4G9FE 3DIVA 1S7XB 1HNGA 2F74B 2R1YA 3FT4B 3GXDA 4BZ2L 3IMTA 4F3FA 2CDFA 4WTZA 2D9QB 1BPLB 1NPNA 2BNUA 1H8LA 1QSVA 5SX4I 4OZGA 1DJIA 4JY6B 5C6WH 3I6LE 1U8CB 1ASPA 4GS7B 5GRUH 2O5XH 3AS1A 2NLJB 3D0VA 3RWIB 2BK8A 2WSKA 3SKUD 3JTSA 1E2VA 1NBYA 3MYZA 2FWSA 3PNWA 1A3LL 3OQ3B 4ZPVA 1DO6A 4PY7A 3VSTA 4G7RB 3X3FL 5AVYB 3SJVB 3RTQC 4HJEA 3RVWC 4XP6L 2VR9A 2EICA 2HJKB 5D7KD 4U0RC 2J88H 3FTZA 2C3HA 1KTDA 3QPXL 2V8LA 4FTDA 3U6XA 1F0LA 1RK7A 2OBGA 3RFRA 3NIDB 3HEIB 1EERB 3O3DA 2G4GA 1RZKC 1PFOA 1D7FA 5ALBH 2HT4C 2DQIH 1KXTB 4TOYL 3VGAB 3W1ZA 1RHFA 3GSOA 3MLTA 3EJZC 3OKNA 1NLDL 3AM8C 3F85A 4TQIA 5FV1L 5C08B 4WHYG 3OMIB 2K78A 1N67A 1ZLUH 5HSFA 1IGML 5FYKL 1RL1A 4FQXA 3BSZL 5D4HA 4WFHE 3Q2CA 3MJGX 2ESVD 3BUPA 1KJMB 4G6ML 4N2NA 5I6OA 1NCDL 2JK5B 1BG9A 5IW6B 5MHSD 3FQWA 1NCIA 4UMSA 1ZV9A 4FTVD 3PQYA 4ZFGH 5D7LB 4Y8DC 4ONOA 2F9BT 2OXGB 4XWOC 5I19L 1JD7A 5GRWA 3BESR 4J3OF 4HOWA 3OJDA 1GZHA 4ATWA 2GIXA 1GZQB 1RZ8B 3K5SA 5GS0H 5KJ7E 5I0WA 3IFOA 2YD2A 3CZFB 5FDWB 3U4BH 4RMQA 5HY9B 1TETL 2DQDH 3NK4A 3U0TA 5JMOC 5EIIB 4IIQB 4H26B 2VQ1A 3C5ZD 3O3BA 4ZD3L 5IY5B 4XP9H 3IE4A