1GYDB

Structure of cellvibrio cellulosa alpha-l-arabinanase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
315
structure length
315
Chain Sequence
b'QVDVHDPVMTREGDTWYLFSTGPGITIYSSKDRVNWRYSDRAFATEPTWAKRVSPSFDGHLWAPDIYQHKGLFYLYYSVSAFGKNTSAIGVTVNKTLNPASPDYRWEDKGIVIESVPQRDLWNAIDPAIIADDHGQVWMSFGSFWGGLKLFKLNDDLTRPAEPQEWHSIAKLERSVLMDDSQAGSAQIEAPFILRKGDYYYLFASWGLCCRKGDSTYHLVVGRSKQVTGPYLDKTGRDMNQGGGSLLIKGNKRWVGLGHNSAYTWDGKDYLVLHAYEAADNYLQKLKILNLHWDGEGWPQVDEKELDSYISQRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARABINAN ENDO-1,5-ALPHA-L-ARABINOSIDASE A
publication title Cellvibrio japonicus alpha-L-arabinanase 43A has a novel five-blade beta-propeller fold.
pubmed doi rcsb
source organism Cellvibrio cellulosa
molecule tags Arabinanase
total genus 79
structure length 315
sequence length 315
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2002-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 1gydB00
3P2NA 3C7FA 1WL7A 3ZXLA 1W18A 2XQRA 2AEYA 5JOWA 4N4BA 4O8NA 2YFRA 3WPUA 3UGHA 3BYJA 1Y9MA 2QQVA 4FFHA 1GYEB 3VT2A 2YFSA 3WMYA 4AK5A 1GYDB 5A8CA 3LDKA 5FKBA 4N1IA 3LF7A 4N2RA 3D61A 3SC7X 1YRZA 4KCAA 4KCBA 3QEEA 5ANNA 5AYCA 1Y7BA 3LEMA 5GLOA 3ZXKA 3R4ZA 4QQSA 2EXIA 2EXHA 3ZXJA 3TAWA 3CU9A 3UGFA 3C7GA 3LIGA 3OM4A 3WPZA 5AYEA 3VT1A 3WN2A 4FFIA 4NOVA 3BYNA 3VSFA 3C2UA 3VSRA 5FIXA 5FKCA 2ADEA 3LDRA 2X8TA 3KSTA 3NQHA 3LFIA 4O8OA 1UYPA 5JOXA 1ST8A 4KMIA 2EXKA 3VT0A 5C0PA 5FMCA 5GLKA 2AC1A 3WATA 1GYHA 2EXJA 1YIFA 2VDTA 5AYDA 4KC8A 4AK7A 4UDGA 4MLGA 5FLWA 2YFTA 4UDIA 3WN0A 4PVAA 3KF3A 4O8PA 3AKIA 1UV4A 3WMZA 5A7VB 3LV4A 4N2ZA 3VSZA 4FFFA 3OM5A 3K1UA 4COTA 2B4WA 3VSSA 5A8DA 4U6DA 5B6TA 3PIJA 2ADDA 3OM7A 2X8SA 3C7HA 2QQWA 5JOYA 3RWKX 5A7VA 3AKFA 5FK8A 3D5ZA 1OYGA 3QEFA 3UGGA 5GLQA 4AK6A 3KF5A 3WAUA 3AKGA 3QC2A 4UDJA 3U14A 3WPVA 3C7EA 2AEZA 5FMBA 1PT2A 3R4YA 4UDKE 3C7OA 1Y9GA 3QEDA 3WN1A 3D5YA 3LIHA 3OM6A 4D47A 5JOZA 4KC7A 3R67A 2OXBA 3PIGA 3U75A 1YI7A 4FFGA 3BYLA 5GLMA 5B6SA 4PVIA 4UDKA 3OM2A 5GLLA 5FMDA 3WPYA 5GLPA 4U6BA 4EQVA 3D60A 1VKDA 3WASA 5FK7A 2X8FA 1W2TA 5GLNA 2QQUA 1Y4WA 5AY9A 3QZ4A 3AKHA 3BYKA 5GLRA 4ONZA
chains in the Genus database with same CATH superfamily
3P2NA 3C7FA 1WL7A 3ZXLA 1W18A 2XQRA 2AEYA 5JOWA 4N4BA 4O8NA 2YFRA 3WPUA 3UGHA 3BYJA 1Y9MA 2QQVA 4FFHA 1GYEB 3VT2A 2YFSA 3WMYA 4AK5A 1GYDB 5A8CA 3LDKA 5FKBA 4N1IA 3LF7A 4N2RA 3D61A 3SC7X 1YRZA 4KCAA 4KCBA 3QEEA 5ANNA 5AYCA 1Y7BA 3LEMA 5GLOA 3ZXKA 3R4ZA 4QQSA 2EXIA 2EXHA 3ZXJA 3TAWA 3CU9A 3UGFA 3C7GA 3LIGA 3OM4A 3WPZA 5AYEA 3VT1A 3WN2A 4FFIA 4NOVA 3BYNA 3VSFA 3C2UA 3VSRA 5FIXA 5FKCA 2ADEA 3LDRA 1TL2A 2X8TA 3KSTA 3NQHA 3LFIA 4O8OA 1UYPA 5JOXA 1ST8A 4KMIA 2EXKA 3VT0A 5C0PA 5FMCA 5GLKA 2AC1A 3WATA 1GYHA 2EXJA 1YIFA 2VDTA 5AYDA 4KC8A 4AK7A 4UDGA 4MLGA 5FLWA 2YFTA 4UDIA 3WN0A 4PVAA 3KF3A 4O8PA 3AKIA 1UV4A 3WMZA 5A7VB 3LV4A 4N2ZA 3VSZA 4FFFA 3OM5A 3K1UA 4COTA 2B4WA 3VSSA 5A8DA 4U6DA 5B6TA 3PIJA 2ADDA 3OM7A 2X8SA 3C7HA 2QQWA 5JOYA 3RWKX 5A7VA 3AKFA 5FK8A 3D5ZA 1OYGA 3QEFA 5C2MA 3UGGA 5GLQA 4AK6A 3KF5A 3WAUA 3AKGA 3QC2A 4UDJA 3U14A 3WPVA 3C7EA 2AEZA 5FMBA 1PT2A 3R4YA 4UDKE 3C7OA 1Y9GA 3QEDA 3WN1A 3D5YA 3LIHA 3OM6A 4D47A 5JOZA 4KC7A 3R67A 2OXBA 3PIGA 3U75A 1YI7A 4FFGA 3BYLA 5GLMA 5B6SA 4PVIA 4UDKA 3OM2A 5GLLA 5FMDA 3WPYA 5GLPA 4U6BA 4EQVA 3D60A 1VKDA 3WASA 5FK7A 2X8FA 1W2TA 5GLNA 2QQUA 1Y4WA 5AY9A 3QZ4A 3AKHA 3BYKA 5GLRA 4ONZA
chains in the Genus database with same CATH topology
3P2NA 3C7FA 1WL7A 3ZXLA 1W18A 2XQRA 2AEYA 5JOWA 4N4BA 4O8NA 2YFRA 3WPUA 3UGHA 3BYJA 1Y9MA 2QQVA 4FFHA 1GYEB 3VT2A 2YFSA 3WMYA 4AK5A 1GYDB 5A8CA 3LDKA 5FKBA 4N1IA 3LF7A 4N2RA 3D61A 3SC7X 1YRZA 4KCAA 4KCBA 3QEEA 5ANNA 5AYCA 1Y7BA 3LEMA 5GLOA 3ZXKA 3R4ZA 4QQSA 2EXIA 2EXHA 3ZXJA 3TAWA 3CU9A 3UGFA 3C7GA 3LIGA 3OM4A 3WPZA 5AYEA 3VT1A 3WN2A 4FFIA 4NOVA 3BYNA 3VSFA 3C2UA 3VSRA 5FIXA 5FKCA 2ADEA 3LDRA 2X8TA 3KSTA 3NQHA 3LFIA 4O8OA 1UYPA 5JOXA 1ST8A 4KMIA 2EXKA 3VT0A 5C0PA 5FMCA 5GLKA 2AC1A 3WATA 1GYHA 2EXJA 1YIFA 2VDTA 5AYDA 4KC8A 4AK7A 4UDGA 4MLGA 5FLWA 2YFTA 4UDIA 3WN0A 4PVAA 3KF3A 4O8PA 3AKIA 1UV4A 3WMZA 5A7VB 3LV4A 4N2ZA 3VSZA 4FFFA 3OM5A 3K1UA 4COTA 2B4WA 3VSSA 5A8DA 4U6DA 5B6TA 3PIJA 2ADDA 3OM7A 2X8SA 3C7HA 2QQWA 5JOYA 3RWKX 5A7VA 3AKFA 5FK8A 3D5ZA 1OYGA 3QEFA 3UGGA 5GLQA 4AK6A 3KF5A 3WAUA 3AKGA 3QC2A 4UDJA 3U14A 3WPVA 3C7EA 2AEZA 5FMBA 1PT2A 3R4YA 4UDKE 3C7OA 1Y9GA 3QEDA 3WN1A 3D5YA 3LIHA 3OM6A 4D47A 5JOZA 4KC7A 3R67A 2OXBA 3PIGA 3U75A 1YI7A 4FFGA 3BYLA 5GLMA 5B6SA 4PVIA 4UDKA 3OM2A 5GLLA 5FMDA 3WPYA 5GLPA 4U6BA 4EQVA 3D60A 1VKDA 3WASA 5FK7A 2X8FA 1W2TA 5GLNA 2QQUA 1Y4WA 5AY9A 3QZ4A 3AKHA 3BYKA 5GLRA 4ONZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P2N A;  3C7F A;  1WL7 A;  3ZXL A;  1W18 A;  2XQR A;  2AEY A;  5JOW A;  4N4B A;  4O8N A;  2YFR A;  3WPU A;  3UGH A;  3BYJ A;  1Y9M A;  2QQV A;  4FFH A;  1GYE B;  3VT2 A;  2YFS A;  3WMY A;  4AK5 A;  1GYD B;  5A8C A;  3LDK A;  5FKB A;  4N1I A;  3LF7 A;  4N2R A;  3D61 A;  3SC7 X;  1YRZ A;  4KCA A;  4KCB A;  3QEE A;  5ANN A;  5AYC A;  1Y7B A;  3LEM A;  5GLO A;  3ZXK A;  3R4Z A;  4QQS A;  2EXI A;  2EXH A;  3ZXJ A;  3TAW A;  3CU9 A;  3UGF A;  3C7G A;  3LIG A;  3OM4 A;  3WPZ A;  5AYE A;  3VT1 A;  3WN2 A;  4FFI A;  4NOV A;  3BYN A;  3VSF A;  3C2U A;  3VSR A;  5FIX A;  5FKC A;  2ADE A;  3LDR A;  2X8T A;  3KST A;  3NQH A;  3LFI A;  4O8O A;  1UYP A;  5JOX A;  1ST8 A;  4KMI A;  2EXK A;  3VT0 A;  5C0P A;  5FMC A;  5GLK A;  2AC1 A;  3WAT A;  1GYH A;  2EXJ A;  1YIF A;  2VDT A;  5AYD A;  4KC8 A;  4AK7 A;  4UDG A;  4MLG A;  5FLW A;  2YFT A;  4UDI A;  3WN0 A;  4PVA A;  3KF3 A;  4O8P A;  3AKI A;  1UV4 A;  3WMZ A;  5A7V B;  3LV4 A;  4N2Z A;  3VSZ A;  4FFF A;  3OM5 A;  3K1U A;  4COT A;  2B4W A;  3VSS A;  5A8D A;  4U6D A;  5B6T A;  3PIJ A;  2ADD A;  3OM7 A;  2X8S A;  3C7H A;  2QQW A;  5JOY A;  3RWK X;  5A7V A;  3AKF A;  5FK8 A;  3D5Z A;  1OYG A;  3QEF A;  3UGG A;  5GLQ A;  4AK6 A;  3KF5 A;  3WAU A;  3AKG A;  3QC2 A;  4UDJ A;  3U14 A;  3WPV A;  3C7E A;  2AEZ A;  5FMB A;  1PT2 A;  3R4Y A;  4UDK E;  3C7O A;  1Y9G A;  3QED A;  3WN1 A;  3D5Y A;  3LIH A;  3OM6 A;  4D47 A;  5JOZ A;  4KC7 A;  3R67 A;  2OXB A;  3PIG A;  3U75 A;  1YI7 A;  4FFG A;  3BYL A;  5GLM A;  5B6S A;  4PVI A;  4UDK A;  3OM2 A;  5GLL A;  5FMD A;  3WPY A;  5GLP A;  4U6B A;  4EQV A;  3D60 A;  1VKD A;  3WAS A;  5FK7 A;  2X8F A;  1W2T A;  5GLN A;  2QQU A;  1Y4W A;  5AY9 A;  3QZ4 A;  3AKH A;  3BYK A;  5GLR A;  4ONZ A; 
#chains in the Genus database with same CATH topology
 3P2N A;  3C7F A;  1WL7 A;  3ZXL A;  1W18 A;  2XQR A;  2AEY A;  5JOW A;  4N4B A;  4O8N A;  2YFR A;  3WPU A;  3UGH A;  3BYJ A;  1Y9M A;  2QQV A;  4FFH A;  1GYE B;  3VT2 A;  2YFS A;  3WMY A;  4AK5 A;  1GYD B;  5A8C A;  3LDK A;  5FKB A;  4N1I A;  3LF7 A;  4N2R A;  3D61 A;  3SC7 X;  1YRZ A;  4KCA A;  4KCB A;  3QEE A;  5ANN A;  5AYC A;  1Y7B A;  3LEM A;  5GLO A;  3ZXK A;  3R4Z A;  4QQS A;  2EXI A;  2EXH A;  3ZXJ A;  3TAW A;  3CU9 A;  3UGF A;  3C7G A;  3LIG A;  3OM4 A;  3WPZ A;  5AYE A;  3VT1 A;  3WN2 A;  4FFI A;  4NOV A;  3BYN A;  3VSF A;  3C2U A;  3VSR A;  5FIX A;  5FKC A;  2ADE A;  3LDR A;  1TL2 A;  2X8T A;  3KST A;  3NQH A;  3LFI A;  4O8O A;  1UYP A;  5JOX A;  1ST8 A;  4KMI A;  2EXK A;  3VT0 A;  5C0P A;  5FMC A;  5GLK A;  2AC1 A;  3WAT A;  1GYH A;  2EXJ A;  1YIF A;  2VDT A;  5AYD A;  4KC8 A;  4AK7 A;  4UDG A;  4MLG A;  5FLW A;  2YFT A;  4UDI A;  3WN0 A;  4PVA A;  3KF3 A;  4O8P A;  3AKI A;  1UV4 A;  3WMZ A;  5A7V B;  3LV4 A;  4N2Z A;  3VSZ A;  4FFF A;  3OM5 A;  3K1U A;  4COT A;  2B4W A;  3VSS A;  5A8D A;  4U6D A;  5B6T A;  3PIJ A;  2ADD A;  3OM7 A;  2X8S A;  3C7H A;  2QQW A;  5JOY A;  3RWK X;  5A7V A;  3AKF A;  5FK8 A;  3D5Z A;  1OYG A;  3QEF A;  5C2M A;  3UGG A;  5GLQ A;  4AK6 A;  3KF5 A;  3WAU A;  3AKG A;  3QC2 A;  4UDJ A;  3U14 A;  3WPV A;  3C7E A;  2AEZ A;  5FMB A;  1PT2 A;  3R4Y A;  4UDK E;  3C7O A;  1Y9G A;  3QED A;  3WN1 A;  3D5Y A;  3LIH A;  3OM6 A;  4D47 A;  5JOZ A;  4KC7 A;  3R67 A;  2OXB A;  3PIG A;  3U75 A;  1YI7 A;  4FFG A;  3BYL A;  5GLM A;  5B6S A;  4PVI A;  4UDK A;  3OM2 A;  5GLL A;  5FMD A;  3WPY A;  5GLP A;  4U6B A;  4EQV A;  3D60 A;  1VKD A;  3WAS A;  5FK7 A;  2X8F A;  1W2T A;  5GLN A;  2QQU A;  1Y4W A;  5AY9 A;  3QZ4 A;  3AKH A;  3BYK A;  5GLR A;  4ONZ A; 
#chains in the Genus database with same CATH homology
 3P2N A;  3C7F A;  1WL7 A;  3ZXL A;  1W18 A;  2XQR A;  2AEY A;  5JOW A;  4N4B A;  4O8N A;  2YFR A;  3WPU A;  3UGH A;  3BYJ A;  1Y9M A;  2QQV A;  4FFH A;  1GYE B;  3VT2 A;  2YFS A;  3WMY A;  4AK5 A;  1GYD B;  5A8C A;  3LDK A;  5FKB A;  4N1I A;  3LF7 A;  4N2R A;  3D61 A;  3SC7 X;  1YRZ A;  4KCA A;  4KCB A;  3QEE A;  5ANN A;  5AYC A;  1Y7B A;  3LEM A;  5GLO A;  3ZXK A;  3R4Z A;  4QQS A;  2EXI A;  2EXH A;  3ZXJ A;  3TAW A;  3CU9 A;  3UGF A;  3C7G A;  3LIG A;  3OM4 A;  3WPZ A;  5AYE A;  3VT1 A;  3WN2 A;  4FFI A;  4NOV A;  3BYN A;  3VSF A;  3C2U A;  3VSR A;  5FIX A;  5FKC A;  2ADE A;  3LDR A;  2X8T A;  3KST A;  3NQH A;  3LFI A;  4O8O A;  1UYP A;  5JOX A;  1ST8 A;  4KMI A;  2EXK A;  3VT0 A;  5C0P A;  5FMC A;  5GLK A;  2AC1 A;  3WAT A;  1GYH A;  2EXJ A;  1YIF A;  2VDT A;  5AYD A;  4KC8 A;  4AK7 A;  4UDG A;  4MLG A;  5FLW A;  2YFT A;  4UDI A;  3WN0 A;  4PVA A;  3KF3 A;  4O8P A;  3AKI A;  1UV4 A;  3WMZ A;  5A7V B;  3LV4 A;  4N2Z A;  3VSZ A;  4FFF A;  3OM5 A;  3K1U A;  4COT A;  2B4W A;  3VSS A;  5A8D A;  4U6D A;  5B6T A;  3PIJ A;  2ADD A;  3OM7 A;  2X8S A;  3C7H A;  2QQW A;  5JOY A;  3RWK X;  5A7V A;  3AKF A;  5FK8 A;  3D5Z A;  1OYG A;  3QEF A;  3UGG A;  5GLQ A;  4AK6 A;  3KF5 A;  3WAU A;  3AKG A;  3QC2 A;  4UDJ A;  3U14 A;  3WPV A;  3C7E A;  2AEZ A;  5FMB A;  1PT2 A;  3R4Y A;  4UDK E;  3C7O A;  1Y9G A;  3QED A;  3WN1 A;  3D5Y A;  3LIH A;  3OM6 A;  4D47 A;  5JOZ A;  4KC7 A;  3R67 A;  2OXB A;  3PIG A;  3U75 A;  1YI7 A;  4FFG A;  3BYL A;  5GLM A;  5B6S A;  4PVI A;  4UDK A;  3OM2 A;  5GLL A;  5FMD A;  3WPY A;  5GLP A;  4U6B A;  4EQV A;  3D60 A;  1VKD A;  3WAS A;  5FK7 A;  2X8F A;  1W2T A;  5GLN A;  2QQU A;  1Y4W A;  5AY9 A;  3QZ4 A;  3AKH A;  3BYK A;  5GLR A;  4ONZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...