1GYLA

Involvement of tyr24 and trp108 in substrate binding and substrate specificity of glycolate oxidase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
359
structure length
352
Chain Sequence
MEITNVNEYEAIAKQKLPKMVYDFYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLTLKNFEGIDLGKGLSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKEISRSHIAADWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Involvement of Tyr24 and Trp108 in substrate binding and substrate specificity of glycolate oxidase.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase (flavoenzyme)
molecule keywords GLYCOLATE OXIDASE
total genus 67
structure length 352
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.1.3.15: (S)-2-hydroxy-acid oxidase.
pdb deposition date 1995-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gylA00
2WSRA 4NJGA 5U7SA 4EF8A 3UY8A 2JGQA 1QMLA 2NWRA 5AB3A 2ZBTA 2QKFA 4DO4A 5CKSA 1KFBA 3UWZA 4P2VA 2C15A 4A2RA 2GJLA 1WAUA 1LP6A 1DV7A 5EYWA 5LNWA 1HUVA 5CPOA 2ISSA 4FNRA 1U83A 1GYNA 3QW3A 2V82A 1AW1A 1SZGA 4MJZA 3CM4A 3HIJA 2HTMA 2WV8A 3NEVA 3NQVA 4A3UA 1ICQA 4NXSA 2CZDA 4Q4KA 3G22A 4RXFA 4WUIA 1X8FA 3TNOA 2YR1A 3PUDA 4QJ1A 3GXNA 2ZZ2A 2EF9A 2NXHA 5HR6A 3PAJA 5K4XA 3DFOA 3KRZA 5D37A 4QNWA 5G5IA 3NOEA 1FCUA 3O07A 2NXIA 5J5DA 4Y8FA 1SR9A 3NM1A 5F1VA 1GVQA 3RLVA 1OABA 2ZRVA 4FEZA 2OT0A 3C2FA 5F2LA 5HULA 2HS8A 4XBKA 1GYLA 1L6WA 2TRSA 3NA8A 4O1DA 4DBDA 1DJQA 3PULA 4Y90A 4LW7A 3PG9A 3UD6A 4I7UA 1FWNA 1S5VA 3W1AA 3A5VA 3FJLA 3O16A 4O57A 3PB2A 1KM4A 3PS7A 1TPC1 2ZQ0A 3NL5A 4P61A 1VCFA 3TUUA 1SQ7A 2P1FA 5FF0A 5KINA 3P84A 5K3VA 1D3GA 2OX1A 2CLIA 3GYEA 1V7YA 4BFAA 5D2XA 1XCFA 2NWSA 4PL2A 4UFJA 1K8YA 5AOUA 1TV7A 2FPYA 5KZDA 3TFCA 1P5BA 1YDVA 1RPXA 1G67A 1H7WA 3TU9A 3L2IA 1HO1A 3LCIA 4GUGA 1QO2A 1VQTA 1NSJA 2X2GA 1EP1A 1S5WA 1TPUA 3C61A 4FXRA 3F03K 1RR2A 1DBTA 1TB3A 5G1YA 4O12A 1Z44A 2Y7FA 3QSRA 4XUGA 3B03A 2R8WA 1H7OA 2XN2A 1YXCA 1ZFJA 3STCA 3LV5A 3MP5A 3EWWA 3UWWA 1FCVA 3QM3A 4R7JA 3FKKA 3UZ5A 2X1SA 3TE9A 3R8RA 2Z0IA 5L9FA 1IF2A 3A9IA 1ZAIA 1JJKA 1H7PA 4IPJA 3TAKA 1D9EA 4FIRA 1ML1A 4UTTC 2RDWA 3TJLA 4UFKA 3LCLA 2NV2A 2W79A 1SZEA 3L9CA 3R5EA 1GT8A 3F4NA 2J9ZA 4JY8A 3W86A 3HPZA 1R2TA 5DCDA 1KTNA 3RLUA 2NZLA 4OQVA 4G1KA 4NUWA 3BGGA 1B3OA 3LXCA 5EY5A 1BKSA 1M5WA 3LHTA 3W87A 4IOTA 2VEMA 3KFTA 4IX0A 3N19B 4N02A 3W88A 1OYAA 2H8ZA 4S2BA 2OJPA 4HIBA 3PB0A 1JRCA 2J6XA 3M16A 3SFKA 1TPWA 4PH6A 3I68A 2A2IA 4XTDA 4DQWA 2P10A 3P61A 4GUJA 1X6UA 4YWIA 5C2XA 3W1TA 1TPDA 5CZ0A 5LHFA 1EX5A 4RZ5A 1GQNA 1TPVA 1FDZA 3LOTA 4LU0A 1ICPA 1W5NA 3IIVA 4Z08A 1RVGA 5FEPA 4UFIA 2CW6A 3NQFA 5EMUA 3SR7A 3VFLA 3W1NA 3GR8A 3C4UA 3G1AA 1F6PA 5AYZA 4GC4A 3FYPA 1W5OA 3O05A 2Z2UA 1BWLA 1DQWA 2PCQA 2DJXA 3UZJA 4JD4A 2ZZ1A 1D3HA 3C6CA 4BF9A 1LM1A 3NZ1A 1SFJA 3KX6A 1FQ0A 5C55A 1SO5A 5AHNA 1HFBA 3EWZA 1SFLA 5G2IA 1W56A 5I3JA 2H3BA 2FPVA 2JK2A 3BV4A 6TIMA 3NAVA 3QW4B 4GE8A 2WNQA 3JS3A 3IGXA 2V0TA 2Y88A 4LOCA 2Y7GA 4TO8A 5AC8A 1EB3A 1YDOA 4UR8A 3E49A 4IMGA 1TRIA 4ML9A 1B4KA 2Z1BA 4JEQA 3VE7A 5LGZA 3DFQA 2VFEA 1QPQA 4AVFA 2VENA 1YXYA 4M7TA 4QSHA 3S9YA 4N6EA 2GPTA 3PUEA 3PBVA 4ZQRA 4LUJA 3OA3A 3QPZA 2TMDA 4HSOA 1LBLA 3W1RA 4MY1A 3VCRA 2FJKA 4AF0A 4LUIA 3I6RA 1NVMA 3NZRA 5J5RA 1HTIA 3DAQA 3QQ1A 1I2OA 1LZOA 1OX6A 2RKXA 2WO5A 3ATYA 4BK9A 1KA9F 5HR7A 4N6FA 2ZTKA 4XKYB 4DBEA 1WBJA 4ZQOA 1KFCA 5D02A 4QITA 3W71A 1PCKA 3FFSA 4MLRA 4AXKA 1A53A 1KTBA 4WXYA 3TSDA 1FWTA 1DVJA 4ORIA 2CLFA 2QUVA 5HWNA 4IXHA 4O10A 3LDVA 4NXKA 4AHOA 5F4SA 4M6PA 1K8ZA 2Y6ZA 5IM51 2ZA3A 2A5HA 3KAOA 3P80A 4JN6A 2CFFA 3HQ1A 3STEA 4JYEA 3NQGA 3EX2A 4HHPA 1VCVA 5D32A 2GUUA 2B7OA 3N3MA 1WXJA 1JQXA 3B4UA 2EKCA 3OBKA 4XBSA 4GUIA 3RMJA 4D2JA 4M5PA 4Z0JA 4UXDA 4FB7A 2ABAA 2BWGA 2R91A 3JRKA 4UTLA 5HQEA 1TPH1 4KKXA 5EPDA 1EWEA 4JTLA 5F4XA 3R89A 1JCJA 4JGDA 4NZFA 2PRLA 1TTQA 2DORA 3W73A 2EHHA 5LSMA 3NQEA 3DI1A 3IV3A 4JYDA 2FTPA 3B04A 1TSIA 4LTSA 3P5YA 1GVOA 2DZPA 1XXXA 3GKAA 2A7PA 1AMKA 1Q6OA 3O1NA 1TPEA 3ABQA 3NL3A 3MP3A 5CGQA 3TC6A 3W1QA 2V2CA 3P74A 3TC7A 1UCWA 3TIMA 3GNNA 1LBMA 4NVTA 1XBZA 1PV8A 5D33A 3PF3A 4TMCA 3NQAA 4PTNA 4K36A 4ORMA 3U6WA 3VI2A 3BGJA 5AC6A 1JUEA 4O53A 3IIOA 3L5MA 3CB8A 3M5ZA 3QF0A 4LT9A 1PS9A 4CQAA 5DCEA 4R33A 4LY8A 5DELA 1SO4A 2W6RA 4RKAA 4IPIA 3Q2DA 1N8FA 3UWQA 4HKPA 1EP2A 5BRBA 1GTHA 4NZJA 1ADOA 3TMLA 1OF8A 3N14A 3LHYA 3G1FA 3STGA 1H5YA 4JTGA 4OE7A 3BG5A 3IVUA 3GR7A 3W7OA 2OT1A 4PA8A 1K7EA 3LI0A 4WQ6A 1I8JA 4MFDA 1XKYA 1XBYA 4UTIA 4N9CA 3LHVA 1H51A 5G4WA 1XI3A 1KV5A 4GJ1A 1JCMP 3A23A 1H62A 4JR5A 3LHZA 2J9XA 1WYIA 1G4PA 3W7JA 4GRSA 3A24A 4O14A 3N9RA 1R30A 3W7RA 4I7WA 2ZZ5A 1YTKA 5C5YA 3OVQA 1ME8A 3LX9A 4FF7A 4EIVA 2Q8LA 3K30A 3E96A 3NQ8A 4A21A 4O0ZA 2A4AA 3PVFA 3G0XA 3OHIA 4GNJA 4Q32A 4JYFA 1G6CA 3L67A 3IGSA 4Z1BA 2WSQA 3M5XA 2ZCGA 1IGSA 1WBHA 2WNNA 4OBTA 1GWJA 3HB9A 4NX5A 5F2GA 3ATZA 4CCDA 2YGYA 1S5TA 1O94A 2QJIA 4NNAA 2VEPA 1HG3A 1JUBA 1FXQA 2RFGA 3IGUA 1XUZA 3DFTA 3M6YA 1XFBA 5I3HA 1YADA 3MHFA 4LRTA 2YDAA 4DO5A 3NQ7A 4O19A 1LDCA 1B57A 3GKFA 3W6YA 3TQVA 3LTSA 2VOMA 3HGSA 1XDMA 3FLUA 1OFOA 2VFDA 3FJ6A 1IIHA 1FCBA 2CLEA 2E5CA 1WOBA 4LWWA 2QUUA 3W85A 3M7WA 1WQ5A 2GVLA 1KLZA 3S1WA 3SGZA 1H7RA 3BLEA 3EKLA 4GUFA 1LOQA 2F84A 3TK7A 5K9DA 5LKYA 5SWUA 2PC4A 3V75A 5HJLA 4KFOA 3NQ6A 3H55A 3EB2A 4DO6A 4XKYA 1SZFA 2QCCA 2YW4A 1YTDA 3GB6A 1DHPA 2Q8ZA 4JXCA 1R2RA 4JTHA 4O13A 2QUTA 2PURA 4IWWA 3L5AA 2TSYA 3CWOX 1I2NA 3QMRA 5DXXA 2E1DA 3PWAA 1LRNA 4IMCA 3CLMA 2BTMA 4O52A 3PBUA 2GQAA 1VLWA 3BLFA 1THFD 3NVTA 2QR6A 3O8AA 4TIMA 1I2RA 2FLIA 3LHUA 2YXGA 1X1ZA 2NX3A 3W2NA 3HGRA 5KTLA 3KRUA 1DORA 2QCGA 3QJAA 5KITA 2V2DA 1GZGA 3QEZA 3CPRA 3GNDA 2A21A 1OFQA 1QOPA 5EA9A 2J9YA 3WJYA 1JCLA 3HPXA 1NF7A 2X1UA 1K8XA 4U4MA 3T7VA 1CW2A 2EPHA 4FNPA 3WJWA 1W5PA 1K02A 2G96A 4ZQCA 1F6KA 4GFSA 5AYYA 1KM3A 2QCLA 1OK4A 3CU2A 3W2JA 3KVKA 3NXFA 1NEYA 4ADSA 3G8EA 4MY8A 1TIMA 2DU2A 1P0NA 5AC7A 3W9ZA 3QQ0A 1QNVA 4Z0SA 2ZA2A 3FOKA 3B8DA 1Q6LA 2OMAA 3EX4A 3ZR4A 4NX0A 3W22A 3DFSA 5G4EA 4RK8A 1GJPA 2IQTA 3CQ0A 1TPB1 1B4EA 4ADUA 2AAMA 4QIUA 3GK0A 3G1VA 5AHMA 3RFAA 3W75A 1W3IA 2VKZG 1G7VA 5G2WA 3RU6A 3CHVA 3PG8A 4N4PA 3B0UX 2BLEA 2GOUA 1H7NA 2PE4A 3GAKA 1A5BA 3ELFA 5AFDA 1RZMA 3DKJA 4HNUA 5FESA 2J88A 1VR6A 3DZ1A 3W7IA 1GG1A 4C1LA 4KWVA 3CIXA 1J4EA 1VJIA 5EKYA 2YX0A 2E77A 3TQ0A 3IEBA 4UTHA 4MFEA 1ZALA 3N73A 2CZEA 3HF3A 1H1YA 3LLFA 1TV8A 4ZVJA 5U4NA 3H53A 3EX1A 3LCGA 4W9TA 4CNOA 4RLIA 2VFIA 2A0NA 2E68A 4RJEA 1AW5A 3EXRA 4FNUA 2QCDB 3EX3A 4UNKA 1ZCOA 3HG5A 5FF4A 2GQ9A 2FFCA 1GEQA 4WY0F 3GDKA 4UR7A 4LC8A 1TCDA 5L6UA 5E1QA 2NV1A 1YTEA 1XM3A 2ZTJA 3LCWA 2WNZA 4HNNA 2Y70A 3ABRA 4FXSA 3B05A 2QCDA 5K9XA 3TAOA 1Q3NA 3TH6A 4MUZA 4QISA 4Y9AA 3M5VA 5H2ZA 3KVJA 3PC0A 1RD5A 1SZNA 4KFNA 1GVFA 3E0IA 4BI5A 4FIQA 1J5TA 4KWWA 3P62A 3UXDA 3W7NA 2CZFA 5CZTA 1YYAA 1W3NA 4TX9A 4AAJA 1J2WA 4K6AA 1OFDA 4PODA 3P7YA 3G8RA 1U5JA 3F4WA 1ZAHA 4MIMA 4Z1DA 1LCOA 2C1HA 3I7SA 1EA0A 1OX4A 1DOSA 3KHJA 4WOZA 4E2BA 3RF9A 4DELA 3HPSA 3W7CA 4UNLA 2JKAA 2YPIA 1DQXA 2EAWA 3IIPA 2QJHA 3NPVA 5C6MA 3B0PA 4XTIA 2C13A 3VKJA 1QCWA 3GLCA 4IMEA 1KBIA 3QSTA 2FDSA 3HMJG 1VC4A 3NGJA 4HSNA 3O6CA 4JTIA 3CIWA 1LRTA 1OX5A 1ICSA 1IIGA 3TFXA 3UQNA 3PUOA 3PR2A 2Q3RA 1ME7A 2Z6IA 4YCPA 1TQJA 1Q6QA 3G1XA 3LRLA 3F1QA 3R13A 3EWXA 4OWGA 3LERA 4UTWC 4JDYA 4K8EA 1KV8A 5ABTA 3S1VA 1V5XA 5F2IA 3BG3A 3QZEA 4MPQA 1IXQA 4NJIA 2XN0A 1F7BA 3S6DA 3TW6A 1H63A 2FQIA 1BEUA 1GPWA 3SW6A 4BI6A 1OFAA 3T44A 4C1KA 5BOOA 3C3NA 1VHCA 3W72A 3KOFA 4IQLA 1X7FA 1FWWA 4PC8A 4L4MA 2WSYA 1TJPA 3SSJA 3S5YA 1EEPA 5DY2A 4LV4A 4O1BA 1SW3A 1RQEA 2ZRYA 3L68A 5DN1A 4UUIA 2P0OA 5AYXA 5FF2A 4NJKA 3W7EA 4JY9A 4DF2A 5I3GA 4WOQA 3C0JA 1Q45A 1KM1A 1OYCA 1TTJA 4RXGA 1FDJA 2I14A 2J24A 2ZA1A 5KZEA 4MYAA 2A6NA 2VELA 4Z1AA 3G0SA 1M7OA 2HS6A 2QJGA 5D2WA 2NX1A 3OVRA 1UB3A 2Y7EA 1Z41A 3W1PA 1OHLA 4YLWA 3NR0A 3W1LA 3T40A 1PVNA 4GUHA 5D30A 3VE9A 2X1RA 5CPLA 3LXBA 2V5BA 3DHDA 5TBOA 3IVSA 2ZZ4A 5CSSA 1R2SA 3HG4A 4L4LA 3TR2A 2YW3A 1R46A 3MI6A 3INPA 3W23A 1JUKA 1UJPA 3BG9A 3E02A 2VFFA 4FX6M 5CSRA 3RNDA 2FIQA 2VFGA 3FKRA 2JKEA 4U28A 4M19A 2C6QA 3NQMA 3SIZA 2VEKA 5F4WA 1LLZA 3NDOA 1FX6A 1SUXA 3NPUA 4ONVA 2E6AA 3SGUA 7TIMA 3G18A 1P4CA 3Q58A 5IBXC 1F73A 4MOZA 3B06A 3WJSA 8TIMA 1OK6A 3HOJA 2Y89A 4O16A 4AF0B 4AEOA 4IX2A 3DHFA 1KLYA 5FEXA 5G1TA 1W37A 4YCOA 3WK1A 4K39A 4DF0A 4GWEA 2QCNA 5H91A 3MJYA 4LVFA 3EWBX 5AHFA 1KM6A 3QMSA 1TJRA 3P5ZA 1RV8A 1I45A 1YLVA 3MI2A 4N9BA 3TKFA 1KW1A 3G1SA 1H60A 2Y61A 1VH7A 3W74A 3W2LA 5BW6A 1A50A 3QC3A 3O6DA 2CU0A 1SU5A 1QO5A 1Z48A 1GTEA 3MWAA 3C56A 5LNUA 4UMCA 3EKZA 4ICNA 3ZWSA 3W83A 3TJXA 2ZZ7A 3E9AA 1VRDA 5CPNA 5HWJA 4A2SA 2AQWA 5BNKA 4FNQA 1HO4A 1EPXA 1TREA 4IJBA 3T78A 2V8ZA 3TSBA 1TV5A 4X22A 1VYPX 1FWRA 4JTTA 4O4VA 4QQ3A 6ALDA 3BW4A 1H61A 4MZ1A 1IXNA 3BARA 1QWGA 4CNNA 3FEMA 2QDHA 2I9EA 5BMWA 1ONRA 1EIXA 2Y62A 4OU1A 3I7RA 2QDGA 4WZHA 2WPBA 1F74A 4TMBA 1LLWA 5D04C 3WJXA 1IXPA 4DPPA 3MI3A 2QCHA 3W7DA 4IXXA 3D0CA 1FDYA 3W7HA 3L0NA 2CLLA 5CG7A 3T55A 4OT7A 3S8HA 1JQVA 4S1FA 3WJZA 1QPOA 4LS0A 4JS3A 4X3ZA 1T8XA 4UTJA 3FS2A 1VS1A 4AWTA 2R94A 1SW7A 3QPYA 1WV2A 4DXVA 1UUOA 1OFPA 1SPQA 1YDNA 2FB3A 3DH7A 2A85A 3QRHA 3I7QA 3EXTA 1W8SA 2JKPA 4R53A 2Q3OA 2GVJA 1W5MA 2Y63A 3RK8A 4CQ9A 2WQPA 5HNRA 4JTUA 5AN7A 4NU7A 4UC5A 4UMBA 3A22A 2RDUA 1KBJA 4I9AA 3ABSA 4MZ8A 4LRSA 5HUPA 4UTTA 1W5QA 4PFMA 2OZ0A 1EUNA 2ZYFA 3E12A 3LCFA 1FY6A 3R2GA 4MZYA 4K37A 3NPXA 3W7PA 5LNVA 1AW2A 3EWUA 3HJZA 3W2MA 4O15A 1H50A 3NQ2A 4OGZA 4E38A 4Z1CA 1VYSX 4TU1A 4HPXA 5F2MA 4LC6A 5DCBA 3N2MA 3LBCA 3L5LA 2DP3A 2YYUA 5DBTA 3LXAA 4LV9A 4MJMA 5K7JA 1OF6A 1MO0A 1B9BA 1PE1A 1GVSA 3YPIA 1G69A 2A7RA 1A5AA 1ZJIA 3L65A 3DI0A 4JTKA 1F2JA 2ZRZA 5KMYA 2YFOA 5FEWA 2ZRUA 1F05A 1QFEA 1MEWA 1R47A 2ALDA 3KXQA 4JX6A 3O06A 2WKJA 3LTYA 2BSLA 3GDTA 2CLHA 4K8HA 4O8RA 1ZHAA 4O50A 4JDBA 2G5WA 2G97A 3GDLA 3KVMA 1TRDA 3P81A 2YFNA 2A1YA 1NFBA 4MLJA 4HNVA 2A7NA 2QAFA 3HO8A 2QAPA 4MVAA 3UWYA 2C0AA 2ISWA 1BTMA 1JRBA 1AK5A 1DKWA 3IVTA 4IGHA 4UIOA 2PRHA 4CCCA 1GOXA 4NJHA 3W2UA 1OX4B 1TMHA 4R34A 2O7QA 4GXMA 4E2DA 3S1UA 2TYSA 1IXOA 4O0KA 2R14A 3PBWA 3OEXA 4WJEA 3EXSA 2B7QA 4XWUA 4A29A 1K03A 3DBPA 2NXGA 3W76A 1VLIA 4DEFA 3S42A 4N9EA 4UTWA 1LOSA 3SZ8A 3IRDA 1Z42A 2QCFA 3CEUA 2CLOA 4DF1A 3L21A 3P8JA 3USBA 3C2RA 2I1OA 3EEGA 1W54A 1AG1O 4BWLC 1MZHA 1JCNA 3G0UA 3SY5A 2V5LA 3BVJA 4ZMGA 3W1XA 1W3TA 1BWKA 4CCEA 1TTPA 4AWSA 3M9YA 2EGZA 2YCEA 1MEIA 4UFHA 3W07A 3NG3A 1K7FA 3N2XA 3ANYA 4HN4A 5EL1A 4AHPA 1W31A 5TIMA 5FI8A 4FO4A 2ABBA 1KTCA 2CZ5A 2ZFAA 1VPXA 1T0OA 3LGEA 1TYGA 3DXIA 5AHIA 3UNDA 1T99A 1YPIA 2QCEA 1AL8A 1QPRA 2YZRA 3C8FA 5LHEA 3QYQA 2XFWA 2ATMA 2DZSA 4O11A 1N7KA 2CLKA 5HWMA 3TXZA 3TV8A 3PSWA 4MY9A 1TTIA 3FA5A 2B7NA 1SO3A 3JR2A 3CT7A 2B4GA 4HNTA 1EUAA 3QFEA 4WD0A 1XC4A 4RZ6A 5C54A 4RR4A 2DZTA 3O15A 1K7XA 3O6YX 4UMAA 1WX0A 2VXNA 3EX6A 4FX8A 3MYPA 4JICA 4NT0A 5HINA 5AHLA 4GBUA 4ZZ9A 2C19A 1VHNA 4EOUA 1ME9A 3P82A 3ZWTA 1E51A 1F76A 3LRKA 1O5XA 3FIGA 3THQA 1W0MA 4PCFA 3L0GA 1I2PA 4O1CA 2RDTA 4LNYA 4BWLA 3C2VA 2WJZA 1QDSA 1C9DA 3W1UA 3UXAA 1VZWA 3CEPA 5TQLA 4N4QA 2WOQA 3P60A 1M7PA 1QPNA 4LVDA 3G3DA 4ADTA 4JX5A 3TQKA 3N34A 1JCXA 3M44A 3MBDA 4FX7A 3KVLA 3N9SA 4MYXA 2AGKA 3NNTA 4JIQA 5FF7A 1G4SA 1WA3A 3C52A 1RQBA 2NLIA 1O4UA 1XBXA 2G95A 4Y6GA 5D38A 1KM2A 3HBLA 4H4IA 4UFLA 4IMDA 4UTKA 2E5DA 2BZNA 3W7QA 3V1PA 2H8XA 4LS2A 1KFLA 4LS1A 1L6SA 1UASA 3DKLA 4X9SA 3A5FA 1PCWA 5IBXA 5A8GA 5E93A 2HSAA 1A5CA 3LLDA 5D03A 2V30A 5E0KA 1ZENA 2GQ8A 4QNEA 1I2QA 4DPQA 3H54A 3OIXA 1LRQA 2ISVA 4CQ8A 4AMAA 2D73A 2RH9A 3GZ3A 1DL3A 2B0MA 1OFRA 3TW7A 1LORA 2XN1A 3LBMA 2QEZA 3NYZA 1EWDA 1C8VA 5LGXA 1KFKA 3SECA 1G4TA 4Q33A 3GXTA 1G4EA 3C2EA 2NUWA 3NM3A 4UTMA 3UWVA 4FNSA 1QOQA 4LVBA 4X2RA 2H6RA 4QM1A 5K4ZA 2BXVA 4NJJA 2E6FA 4K7YA 3CTLA 3BO9A 5LNRA 1OFBA 4EWND 2NUXA 3L0KA 1H7XA 1WDWA 3GDMA 2VFHA 1WOAA 3MW7A 3G3MA 3U8GA 1MSSA 3PY2A 2O7SA 5CZJA 3GAYA 3W7MA 4A22A 2DZUA 3TROA 1HL2A 5HMSA 2DZWA 5FEZA 1JVNA 3GX9A 1S3HA 4NNCA 1SW0A 3HG2A 1PL9A 3Q37A 1O95A 2GVGA 4Y96A 1CX9A 5DBUA 3LHWA 3LTPA 3NL2A 1OVDA 2W0UA 1GVRA 1Y0EA 1T96A 3G24A 4WXZA 1SSDA 1XL9A 1AL7A 1NF0A 3GDRA 1LTDA 1SSGA 4XQ6A 2NUYA 3W3OA 5FF3A 1SO6A 1P1XA 4ZQMA 4AWUA 5K2ZA 4O4WA 3BW2A 1M6JA 3ZS4A 3W7KA 3MMTA 1PHWA 1QR7A 2LLEA 1VYRA 3HGJA 3UY7A 4O54A 1OFEA 4IMFA 4WY0B 1FWSA 3NQDA 5D2TA 4JTSA 1C29A 5LNSA 3W7GA 4OV9A 3Q94A 2RHGA 5AHEA 3S5NA 1LROA 4ALDA 1K3UA 4EVZA 2F7FA 1W1ZA 4HPJA 3TXVA 3BW3A 2PRMA 3CWNA 3U2OA 5D2VA 2HMCA 3W7LA 5DXYA 2QF7A 3OVPA 3MUXA 3SI9A 2BX7A 4WY0A 3THAA 1CI1A 1QAPA 3QMTA 4IUOA 3L66A 4H6KA 4ZQPA 5BMXA 1XDLA 1XBVA 4RV8A 4RZ4A 5KSWA 2FB2A 5D05A 2Z6JA 2H90A 3CC1A 3UPBA 3DFNA 3DGRA 3HG3A 3M43A 3T4CA 1DJNA 4POCA 3W2KA 3G1HA 2C16A 4AH7A 2X30A 3WK3A 1O5KA 1I4NA 3LRMA 1EP3A 1OJXA 3S0CA 2ZZ6A 4CLMA 3P67A 3A21A 3QH2A 1G7UA 3GXPA 5D09A 5I3IA 3I65A 3GIYA 5DY3A 3S5OA 3W1MA 4AHQA 2J27A 1JULA 1Q6RA 2ZRXA 3M41A 3O63A 5G2HA 4TR9A 4QAIA 2H3DA 1UUMA 3C2OA 2YYTA 2V9DA 3TDFA 3LCHA 2ZRWA 1KFEA 4LVGA 4E0CA 4B5NA 3WK2A 2DZVA 1FXPA 3TX9A 2C14A 4YMZA 3HGOA 3NO5A 3M1ZA 4J9JA 1PHQA 4N2YA 4ZQNA 3MBFA 4RX0A 3TMQA 1LBFA 2X16A 3LM7A 3ZFHA 4CNPA 1NAL1 3R12A 4M6QA 3DU0A 1YPFA 4JIPA 3AO0A 4NNBA 1KM0A 1O60A 1LYXA 3UYCA 4XZ9A 5K9CA 4FNTA 3OG3A 4FHAA 1MXSA 4I7VA 4AB4A 2V81A 4JX4A 4JNMA 1FUYA 1ZY9A 1PIIA 5D2YA 3G1YA 4N9DA 3UWUA 4JTEA 4JTFA 1TQXA 2B7PA 5HUOA 4WX2A 3IIZA 3TCEA 2E5BA 2OCZA 1VGAA 3MP4A 3W70A 1JCYA 1KFJA 2X1TA 4H3DA 4PL1A 4BI7A 5T26A 5DLCA 4BR1A 1ZAJA 2YSWA 2V2HA 3IIXA 3FYOA 4M6VA 5LZLA 3TSMA 2UV8G 3VNDA 3MO7A 2JGYA 3W84A 3PM6A 3WK0A 2DJLA 3BPWA 5A5WA 1XUUA 1L6YA 4PEKA 4NQ1A 1UBSA 1N55A 2QCMA 4MKNA 3MHUA 1KM5A 3LCXA 4OV4A 3DFPA 4UFMA 3S5ZA 4S2CA 4JTJA 1TO3A 2VEIA 3NQCA 2ZZ3A 5GVJA 3SJ3A 2VC6A 4O1AA 3BK0A 1OYBA 3MHGA 2CWNA 2A6LA 3KRSA 2E6DA 4YL2A 3PBYA 1ALDA 2E6YA 1FBAA 1TPFA 2JBMA 4RCXA 2ZDRA 5CZSA 3TA6A 3WFAA 1YXDA 4EF9A 3ABOA 3M0ZA 1A5SA 2GJNA 4YXGA 4M7SA 1JR1A 3UPWA 3NPWA 2DZXA 5KZMA 1OG0A 2E09A 2Y85A 4O17A 1F5ZA 1MEHA 2C3ZA 2FPTA 3PSVA 1H1ZA 3EWYA 4ZL1A 3BLIA 3STFA 2CLMA 3DENA 2Y7DA 3MYOA 3AJXA 2KZHA 2TPSA 1P0KA 4LVAA 4UCGA 1GG0A 3LV6A 3B0VC 5EBUA 4KFPA 5I3KA 5I3FA 4UTUA 3M47A 3G1DA 1RQHA 1X1OA 2C18A 2NX9A 1L2UA 4O18A 4OHQA 1FCQA 5CPMA 1L9WA 3LI1A 3P8IA 5F1UA 4K38A 3NL6A 2ATSA 1ZNNA 1VCGA 3LB0A 5MHBA 4K7VA 3M5YA 3GVGA 3S1XA 1LOLA 4O28A 4HT3A
chains in the Genus database with same CATH superfamily
2XSBA 1B31A 3OPSA 2J7DA 3U0HA 1QMLA 1KB3A 5AB3A 4YPJA 2FZDA 2F6KA 3TWBA 5CKSA 4P2VA 2V5CA 2GJLA 4NAFA 1DV7A 5EYWA 5LNWA 1HUVA 4D8LA 4EAMA 4RDVA 5CPOA 1ISZA 1WNOA 3HIJA 2D0HA 3NEVA 3NQVA 4A3UA 3E74A 4NXSA 2CZDA 3G22A 3M0LA 4RXFA 4WUIA 1NFGA 1HQTA 1X8FA 3CASA 3ARWA 1EYWA 3PUDA 4KS0A 3GXFA 2ZZ2A 3G77A 4O1EA 1VFOA 1PBGA 1GQKA 5K4XA 3KRZA 5D37A 3ONBA 4QNWA 3NOEA 1FCUA 4X60A 1KWGA 4Y8FA 4F0LA 4NAEB 1CDGA 3RLVA 2ZRVA 2TAAA 5HULA 2HS8A 5A6LA 1GYLA 3CV2A 3GVWA 3NA8A 2PF8A 3BOXA 3M07A 4O1DA 3WLIA 4W89A 1XIJA 2BY1A 1S5VA 1SFSA 5LIUX 4O57A 4M0XA 1KM4A 3PS7A 3PK7A 2OWXA 1FKWA 1ISXA 1VCFA 1SQ7A 5KINA 3P84A 2OX1A 1GKRA 6REQA 2Z25A 3AYRA 2NWSA 3IANA 4EP8C 1RPXA 3TU9A 1JCTA 3GU9A 3CHDA 4H2CA 2PC8A 2R24A 1TPUA 2DQXA 1RR2A 3GNXA 3EDDA 4NRSA 3AIVA 1PTDA 2IMRA 1H7OA 2R1LA 1ZFJA 3GG8A 1JPKA 3E0FA 9RUBA 3AXIA 3K4WA 3VGEA 3FKKA 3TE9A 1DJWA 3ANUA 3R8RA 3PTQA 1ZAIA 3CK5A 1NP2A 1ML1A 2QJMA 1PWLA 2D0FA 2RDWA 2O92A 4K1GA 1T40A 2J9ZA 4JY8A 4FAMA 5CJ5A 4WKFA 3CUZA 5HJXA 4NUWA 1B3OA 3AS3A 1M5WA 4IOTA 5CG0A 2ZUNA 2H8ZA 3EA3A 1I6NA 2DSZA 2CYGA 4A3YA 3EA1A 3SFKA 4AEEA 1H1NA 5BYWA 2A2IA 2P10A 2PMQA 3THDA 1FWHC 2DVUA 4GUJA 4PCTA 1TPDA 3BSHA 1UKTA 4LANA 3OB8A 3AIUA 3LOTA 4LU0A 1BKHA 2JALA 3QQWA 2QVHA 1VEOA 3PP7A 3ISIX 3WQWA 2ADAA 1F6PA 3JZEA 3A9BA 3RYSA 4KW2A 3O05A 3ZO9A 1DQWA 1HJUA 1HVQA 2DJXA 1XDJA 1C7SA 2ZZ1A 4IQJA 4ACYA 1B2YA 1J79A 4M8UA 1FQ0A 1SO5A 4LBUA 3ZSSA 1AZ2A 3MUZ1 1C7TA 5DX7A 1UR4A 2V5KA 4AD1A 1EA9C 1W56A 4WSKA 3CYVA 3NDYA 4GE8A 2PB1A 2O4MA 3BLLA 5AC8A 1EB3A 1TR1A 2Z1BA 5HMDA 3VE7A 1EX1A 1IZKA 2BGNE 4I6KA 1CGVA 3GW0A 4ZQRA 4HU8A 3OA3A 3QPZA 1ZJBA 3QVQA 4C6QA 3R25A 1TCMA 2BY3A 5TD4A 3L4YA 3WO8A 1I2OA 1LZOA 2EKGA 4I5RA 2RKXA 1DEDA 1KGWA 4BK9A 5JH2A 3ARUA 4ZQOA 5D02A 3W37A 1RP9A 4QITA 3KS5A 3W71A 3FFSA 3U2EA 4PUMA 1QI4A 4RNHA 4GZ7A 1FWTA 2EJAA 2QUVA 4LB3A 4TX6A 4O10A 4V28A 3U2CA 2HVNA 3FA4A 4WDUA 2W63A 4M6PA 2A5HA 3P80A 4JN6A 1E0XA 5E6ZA 3HQ1A 4JYEA 1JG9A 1A5OC 1KKOA 1K70A 1X98A 3H2OA 3W27A 4DM2A 3UCDA 1MRQA 4HHPA 2B7OA 4HYVA 1WXJA 3B9EA 4M1BA 3RMJA 3ZJ6A 5AYIA 3HQNA 3V5CA 1MYRA 4FB7A 4Q8QA 4UTLA 3E5PA 4KKXA 1VJZA 4JTLA 1PJ9A 1JCJA 4H04A 1ZQ5A 4A3RA 2XWDA 2PRLA 5LSMA 2DH2A 3IV3A 4ECLA 2JF7A 2OEKA 3TONA 3K5XA 3ABQA 5CGQA 1RCXB 3TC6A 5GQBA 3W1QA 3TC7A 1RA5A 2BXYA 3E2QA 1UP3A 3TJIA 3GH5A 8XIMA 3OW1A 2PWHA 3WN6A 4PTNA 1F8IA 3EMQA 2BOGX 3IIOA 3CB8A 1PS9A 4E5TA 1F6YA 2VDHA 2A3BA 4QP0A 3BG5A 2OT1A 4OIFA 3ABXA 3LI0A 4AZ7A 3VDAA 2CBUA 2FZBA 4S39A 4C6MA 1XH0A 4BA0A 1H51A 3CQIA 5G4WA 4E8CA 1Q7ZA 1W1YA 4H83A 4EWJA 2PWEA 1RD6A 4QFUA 3A24A 4JHOA 4B5UA 2WB5A 3N9RA 7A3HA 2D20A 3OTRA 3BMVA 3QHOA 3MCMA 5C5YA 4EIVA 2YCKX 1FKXA 4GNJA 3NIYA 2VZOA 4Q32A 4D1IA 3L67A 4FA3A 3IGSA 1U2YA 1WE5A 1YNQA 3M5XA 2ZCGA 2WNNA 1R0MA 3PBMA 1GWJA 3HB9A 4B4HA 2W91A 1D3CA 1MI3A 1IWPA 1WDQA 3ATZA 3TN6A 3VIJA 3DBNA 3Q65A 1S5TA 4J1OA 1CIUA 2VEPA 1HG3A 1JUBA 1Q6GA 4P8XA 4J4KA 1XUZA 3MHFA 5CXPA 1QTWA 5EB8A 2Y0FA 2EO7A 5I78A 3MKKA 3NQ7A 4G1NA 1B57A 4F2TA 3VUSA 3TQVA 2VOMA 2VFDA 1QI2A 3C5QA 1FCBA 4YTTA 3HURA 1ITXA 3S1WA 3TK7A 3RU8X 2PC4A 5HJLA 3NQ6A 4RPPA 4K68A 3ALFA 2IPJA 3KOYA 5T8GA 4GYPA 1WPCA 1PKMA 4IWWA 2FYMA 3CWOX 3QMRA 1XG4A 3R43A 1T8QA 4IMCA 2QPSA 2GQAA 1VLWA 5IHRA 3O8AA 4TIMA 2YDSA 3ITYA 4B5SA 5FJIA 3UG5A 4XAYA 3HGRA 1S1PA 3PPGA 4Y9OA 1JYXA 4L65A 2V2DA 4AZBA 3CPRA 1NOUA 3GNDA 2A21A 1OFQA 2J9YA 1KGUA 1ZCCA 1ADDA 3IUHA 3W82A 2Z7GA 1P0EA 1NF7A 2FGLA 3GS6A 3PJWA 3T7VA 3B4YA 3LYEA 3HV8A 3RX3A 1A4LA 4H9ZA 4CKQA 4MKSA 4ZQCA 5E09A 1KM3A 3N4FA 2QCLA 3I3BA 1QNSA 1YIXA 2DU2A 1UIPA 3PN8A 1X6NA 1K1DA 1QNVA 2ZA2A 4HU3A 5A3HA 1VBGA 3EX4A 3ZR4A 2E28A 4LFYA 3W22A 3B0YA 4XUYA 1U1UA 1B4EA 4GVFA 4ADUA 2AAMA 3D3FA 5AHMA 3G1VA 3W75A 4ZODA 3V36A 1W1VA 5CZKA 3PG8A 4Z1YA 3V0TA 1W9DM 2PE4A 2OLSA 3GAKA 1FTXA 3ELFA 8CGTA 3BL3A 3WUFA 3N1AA 1J6OA 1VJIA 2DIKA 4YNGA 3WMSA 3T2OA 2QHAA 2J66A 2BP1A 3HF3A 1ODUA 2ISFA 4ZVJA 3VKCA 3H53A 3QY7A 3IJLA 4C91A 3ICJA 4RJEA 7CGTA 4DJFC 2FFIA 4I5UA 3EX3A 4UNKA 3QGKC 2Q6ZA 2GQ9A 4KRTA 1U33A 4UR7A 1I75A 1EGVA 3WD3A 2D1ZA 3VIFA 4H9XA 4YHEA 4XZLX 4S3DA 4DY1A 1V6WA 3EDEA 2Y70A 3B05A 3ITCA 1JAEA 3TH6A 4L6OA 4Y9AA 1EYEA 3WQ8A 5H8PA 4HMDA 1E4MM 1RD5A 4Y9NA 1BYAA 1EGZA 4FIQA 3FEQA 3ZYZA 4J2MA 3SN0A 1PZ3A 3K1DA 3BXWA 5C9ZA 3W7NA 1YYAA 4IP4A 4AAJA 3W02A 1J2WA 4PODA 3NUKA 2XH4A 3G8RA 1CBGA 3F4WA 4J28A 4Z1DA 3I7SA 2G37A 4IFRA 4E2BA 3HPSA 2H9AA 4IUGA 5E5CA 3BE7A 1ITCA 4PMZA 4UNLA 1DQXA 1IR2A 2VGBA 2GUYA 7XIMA 4IIBA 5C6MA 3B0PA 4XTIA 3H7RA 1M7XA 1QCWA 4HSNA 4ZCWA 5CSUA 3O0KA 5CH9A 1LRTA 4L5ZA 3CUFA 5BZAA 4YCPA 2R1PA 4H7ZA 1JZ6A 2OSWA 1E4NA 3R13A 4KERA 4OWGA 3EAUA 3S1VA 4YYCA 1IXQA 4NJIA 4DJFA 5DT5A 3TW6A 4EE9A 1H63A 2FQIA 1WAWA 3SW6A 2V6AA 3PZVA 3T44A 1FHVA 4HSHA 2G4FA 3UCQA 1BGGA 3EMCA 3KOFA 1XIMA 3WDPP 2AQOA 3SSJA 4NIRA 1DTUA 1EEPA 4XD4A 1NY1A 4EANA 5RUBA 5AYXA 4Z2GA 4G7EB 5FF2A 4NJKA 2DUXA 3MC5A 1K9DA 2OSYA 4S3KA 3W7EA 4NL1A 3UA3A 2BHUA 4F0KA 2XG9A 2QQ6A 2J24A 2ZA1A 3F4DA 3TN5A 2NX1A 4PRRA 3SUSA 1UB3A 3W29A 3QTPA 4GFIA 3JVAA 4GI4A 5EU9A 2IKHA 3NR0A 1IT0A 5B7ZA 4Q8OA 1KBLA 4EPDC 5A8NA 5C70A 1JGIA 1HJWA 2XM2A 3IJDA 4GMEA 5DMYA 5CSSA 1V3JA 3LUTA 1YW1A 1WKYA 3GU1A 3WF0A 4XK2A 4FX6M 1F9CA 2UY2A 1BHGA 2VFGA 2YCIX 5FIPA 4C6BA 4M19A 3WLTA 3NQMA 1LT8A 3VNZA 4LXFA 2VEKA 1LLZA 2ZVRA 4S3AA 3NPUA 3H7VA 2YBUA 4IP5A 1DJXA 4Z42C 3PFRA 2AMXA 2W4XA 3TJ4A 4HTBA 5IBXC 3BAWA 4JZ5A 1ISVA 1X7IA 3B06A 8TIMA 3N18A 1XWYA 3HOJA 4AF0B 2Y89A 4O16A 4GH1A 4H7VA 1JDAA 3EA2A 3ZLGA 1N82A 5G1TA 3WNOA 4YCOA 1CGWA 2QCNA 3MJYA 4JQ4A 2A3HA 3ZLFA 3TYEA 2CETA 3P5ZA 1I45A 3MI2A 4AUBA 4AD2A 5TAOA 1L6FA 1MNZA 1ESWA 3DG7A 1H60A 4J35A 3GR4A 3W74A 2HRWA 3QC3A 3TYBA 5BW6A 1QO5A 1XFCA 3MWAA 3C56A 2X1IA 3NO3A 2QIWA 2IKJA 3H2CA 2PBGA 4X61A 1HKVA 2VDGA 2WC4A 5CPNA 4A2SA 4C6NA 2AQWA 4IJBA 1J93A 2V8ZA 2BHZA 4QQ3A 4MPKA 3WQOA 1H61A 2DPEA 3H7UA 1NIUA 4AXNA 3WH5A 4CNNA 3FEMA 4MWAD 2QDHA 1AUSL 3WLJA 2I9EA 5BMWA 1HKWA 1EIXA 2VTFA 3HM7A 2PGFA 2WPBA 1F74A 5EMLA 1E15A 1I1WA 2NVCA 4FK9A 5A94A 3L4XA 4F2UA 2YIHA 5CG7A 3T55A 4G5DA 3WLNA 5CPTA 1BFNA 2QMJA 3WJZA 1GW9A 4JS3A 1XF0A 1J10A 3VNKA 4UTJA 1TVNA 1OC6A 1VS1A 1CXIA 4BKNA 3AMDA 3BANA 3QPYA 3ARTA 3MPGA 3K13A 3BLPX 3XISA 4HHLA 5DO8A 3MSYA 3OP2A 3WD0A 4PUEA 4GO8A 1W8SA 4H9VA 4JTAA 1BLIA 3FY1A 3KUMA 2PDWA 1R3VA 2J8FA 5A69A 3AS0A 4NU7A 4UMBA 3QTGA 2RDUA 1KBJA 4I9AA 3ABSA 4UTTA 1S5NA 1EUNA 3E12A 3LCFA 4MDPA 3QY6A 3MV01 3VABA 3WLRA 3VU2A 3HJZA 2X8RA 3W2MA 4O15A 5AZ0A 3VOIA 1E1FA 4IQEA 2BY2A 3WH7A 3AALA 1DPMA 3RPMA 1VYSX 4HPXA 3CS2A 2PBOA 2VEFA 2VCAA 4LYRA 3N2MA 5ABFB 1K9EA 3L5LA 2DP3A 5DBTA 4E6MA 3L23A 4QG6A 2DH3A 3LXAA 4LV9A 4MJMA 5K7JA 2OZ3A 1QHZA 3II1A 4KF1A 1VENA 5J8LA 1ZJIA 3BCDA 4QEEA 3S2MA 1F2JA 2ZRZA 2EBNA 1GPFA 1R47A 3ZSTA 2ALDA 3LK6A 3SY8A 3M0YA 4GJJA 1O12A 1OC7A 3SM0A 3M7SA 1XD0A 3FJNA 3P81A 5JUVA 1UZDA 2A1YA 3PZMA 1NU5A 3HO8A 1MUWA 3UWYA 2C0AA 4I3GA 4GD0A 1BTMA 1Z32X 5AVHA 1KBKA 1XSKA 3LMYA 2BHYA 4CCZA 4UQEA 4IGHA 4PMRA 1OIMA 3A3WA 4GH3A 2OSXA 2ZUWA 4JTDA 3QOMA 5FSEC 1MZRA 2E8ZA 3T8QA 2TYSA 1A0EA 4WJEA 1X8CA 5FJRA 4PCSA 3S42A 4N9EA 2PODA 1UMLA 1W32A 1KR1A 2QV4A 4F0MA 1R9ZA 3L21A 3P8JA 1NDVA 3GFXA 1GEHA 4J3XA 3G0UA 2G3JA 2VVNA 4HOZA 3IK4A 2P8CA 3COTA 3OU8A 3D6NA 5FA5A 4C5YA 2XDFA 3UERA 1EHAA 1GGOA 4F4RA 3H2FA 2P76A 2CZ5A 3OQ8A 4MNJA 2WMFA 1GOIA 2V3FA 5AHIA 2Y5JA 4IGSA 3W4RA 2WJFA 3AICA 4AIOA 5LHEA 3V4BA 4KBXA 2ATMA 5M03A 1N7KA 3TXZA 4DZIA 4MY9A 3SN4A 1SO3A 4OOUA 4GZIA 1W9UA 4WD0A 5XIAA 3VNJA 1RHCA 4ENLA 2DT1A 4XISA 1KQYA 2WSPA 1H49A 3O6YX 2OYLA 4XAZA 3QBUA 2BVYA 2F2HA 4GQRA 3R8HA 3EX6A 2P0IA 1JZ3A 4PMJA 4QJ4B 1Z6KA 4JICA 5AHLA 4GBUA 1XS2A 5HPOA 1VHNA 2AGTA 3IAQA 1W0MA 1BVNP 4UR9A 2RDTA 3AXXA 4LNYA 3S47A 2X40A 4TTUA 3UXAA 3PZIA 3O0FA 4DAIA 1EC9A 3LENA 2CHNA 1M7PA 4LVDA 3WUGA 3T1GA 1M1BA 3CGTA 1Q6CA 3U5UA 8XIAA 3N34A 1JCXA 2F6UA 4ASTA 4FX7A 3KVLA 3N9SA 1V7AA 3EDJA 2VO5A 4JIQA 1RY8A 1G4SA 3UEQA 3ES8A 1VBJA 4YHGA 4Y6GA 3SQLA 1YX1A 5D38A 3HBLA 4IMDA 4GK8A 3UGRA 1MDRA 3E2RA 2H8XA 1BXBA 3PBGA 2QXWA 3NZGA 4LF2A 4US5D 1JZ4A 1OQFA 3M0XA 1T41A 4P5UA 5A8GA 5E93A 4YJ5A 3LLDA 4AD5A 3P2VA 1XYBA 4ZE5A 4QNEA 4H6QA 2GGHA 4DPQA 3OIXA 4B2DA 4B9ZA 2Z1VA 5C9WA 4G7FA 2J79A 1M9HA 2ISVA 3WFZA 4KEZA 2RH9A 3QV6A 2GK1B 3MUCA 3G1RA 3LBMA 1EWDA 4A35A 5LGXA 2O55A 4HCDA 4Q33A 3GXTA 2NUWA 2ZXQA 1QOQA 1GHSA 2PLKA 3KTCA 5K4ZA 3VAVA 2WMJA 4IG2B 1VFSA 1LQ0A 4K7YA 1OCBA 5LNRA 4WDWA 3TTSA 4L9ZA 2NUXA 1R7AA 1WDWA 4Q8TA 1WOAA 3KL0A 1FWFC 5HNNA 5GPRA 3U8GA 5E70A 2G3IA 2BVDA 4A22A 1KWKA 4JFVA 3IUIA 1BXCA 1SW0A 3HG2A 3T05A 4RDZA 2IPFA 3HFTA 4Y96A 5DBUA 4KESA 1S38A 3LTPA 3NL2A 3LA4A 4QE4A 1MFVA 4HMCA 3GDRA 5C0QA 4GCAA 5HATA 5FOOA 4PUNA 2WMGA 4NSBA 3PHAA 3EKGA 4O4WA 3H23A 3N6HA 1M6JA 1PHWA 4KETA 4WDTA 4BQ2A 3URQA 4WY0B 1XYCA 4QJ5B 5HQMA 4LBRA 1PAMA 1GOOA 3WBEA 1M53A 2IPWA 5E9XA 5LNSA 3CZKA 3TN3A 2RHGA 5AHEA 3MCNA 3WD1A 3OYZA 4ALDA 4KWOA 2AAAA 2PWDA 1PTAA 4BF7A 2BDQA 5D2VA 2HMCA 3OVPA 3SI9A 2AMGA 4XO6A 4WY0A 4B4FA 1CI1A 4HA3A 4JKMA 5BMXA 4RV8A 3LNPA 2E0PA 3K4DA 1B0IA 1KRCC 3W24A 1V8EA 2OWCA 2X30A 1O5KA 2C1IA 4JNYA 1BF6A 4W93A 1QUMA 2FZ8A 2IQDA 5A95A 4DJEC 3HMCA 1KRBC 3QH2A 1G7UA 3ERPA 3GXPA 3T0TA 5I3IA 5LYRA 4MB3A 5TNVA 3FYYA 3S5OA 3BAIA 4AHQA 1Q6RA 4IHCA 5JBFA 2WVTA 3M41A 1GK8A 3P93A 2H3DA 1UUMA 3C2OA 4Q6JA 4B90A 1ADSA 2CIPA 3TYZA 1E6RA 5BU6A 1V3MA 4XX6A 4E0CA 1B3WA 1CTNA 2DZVA 3L4VA 4EX4A 5JBEA 4XZHA 4ACZB 3GTIA 3F4VA 4N2YA 2XZ7A 2HROA 4RX0A 2XGZA 3LM7A 2OODA 2PDIA 3RJXA 1IQ8A 4Q4MA 1EDTA 4WSJA 2FHCA 4JIPA 1K6WA 4MDOA 3AO0A 4NNBA 1KM0A 1E1CA 1RLDA 5K9CA 1NDWA 5HMEA 4I7VA 4HGXA 1V6UA 4JX4A 2J25A 2QLYA 2OOFA 2GSEA 4N9DA 1WDRA 5BXRA 1XSJA 2PWVA 4JTFA 3RG6A 3WQ6A 4LCRA 3C0LA 1ECEA 1NDZA 1GZ1A 3LPFA 1J0KA 4BHYA 4IM4A 1JCYA 4PL1A 4H3DA 3EZ4A 3H8AA 5T26A 5DLCA 5IDIA 1TJ0A 2NQ9A 3QGAC 3FYOA 4M6VA 5LZLA 4E2VA 3TSMA 1W2VA 4XVDA 2O9TA 3W84A 3PM6A 3PAOA 4QCFA 3ARVA 1XUUA 1L6YA 4HD5A 4NQ1A 2DQWA 3PZNA 4F9DA 1KCZA 1BYDA 4H1ZA 1EKOA 1RVKA 4OV4A 1D8CA 4JTJA 3IJ6A 4FF5A 2VEIA 2ZZ3A 1MQRA 2VC6A 4O1AA 3BK0A 3BV7A 1POKA 4H41A 4HA0A 3KRSA 4GIAA 4H6RA 3OA5A 1ALDA 3ITGA 4KWUA 2E8YA 4FSAA 4FOJA 1TPFA 1GYMA 3KLLA 3B9AA 3QHNA 4EF9A 1YXDA 4LAMA 1WXZA 4M7SA 3SJNA 5A6TC 3DX5A 1G94A 1VRXA 2NLYA 1OG0A 4LEQA 4HCLA 2XIIA 2E09A 4O17A 3PSVA 2WSKA 4BJHA 1SJBA 3EWYA 4ZL1A 5JXQA 3THUA 3DENA 3UZWA 4HK6A 1LWHA 3GFYA 3RGTA 5HQLA 2KZHA 1Y8BA 1GG0A 3LV6A 3B0VC 5EBUA 5I3KA 4IH3A 1KO0A 4QX4A 3UR2A 1RQHA 2C18A 4OHQA 3OGSA 1HIZA 3NCOA 4A3HA 1L9WA 1YQ2A 3E3HA 3CHEA 5F1UA 8RUCA 3CL7A 1P0BA 1ZNNA 2RDXA 3NSMA 3S1XA 5BXSA 4ML4A 1LOLA 2I16A 2WSRA 4NJGA 4EF8A 3WBWA 3UY8A 2JGQA 7PTDA 1TZZA 2WQDA 5ABHA 4GIRA 1JI1A 4E3TA 2ISSA 3U4FA 1GYNA 4MB5A 1V0LA 3APGA 3L4WA 1DIKA 5C2CA 1Q5MA 4Q8WA 4Q4KA 1B3ZA 2JF6A 3BCJA 2OLAA 4G9PA 4JIIX 5LA2A 5A6JA 1KNWA 4WJXA 4D6IA 4R27A 2P5NA 2OVLA 2NXHA 2WCGA 3B9DA 4A8NA 3LD5A 5J5DA 5FL0A 1SR9A 4AW7A 2E25A 3RUBL 5F1VA 4EPKA 4FEZA 4CUCA 3C2FA 1S2TA 1OB0A 1E56A 3KL3A 3P0WA 1RAKA 3CZLA 2RGLA 1DJQA 5I07A 2CHOA 5GJPA 4XZMX 5FJJA 3PULA 4HYWA 4Y90A 3PG9A 1REQB 4DUOA 3CQJA 3W1AA 1ZSXA 4AY8A 3A5VA 3PB2A 2ZQ0A 1JPIA 5H1WA 4ICMA 1P48A 4LPCA 4P61A 2UBPC 1JDFA 4L61A 4BFAA 4UFJA 5AOUA 1TV7A 2FPYA 3S46A 3TZFA 3VIKA 1DJHA 3ENLA 5CC7A 3L2IA 3JUGA 2X2GA 3OZYA 1EP1A 3C61A 4FXRA 3K2GA 3R0UA 5G1YA 1TB3A 3CMGA 4O12A 1XLFA 1NQ6A 1YXCA 7TAAA 2QMKA 2EG6A 4TTGA 2PGRA 1UD2A 4WJ8A 1W91A 1ZP3A 1HGYA 4QLKA 3GVQA 4WCJA 2X1SA 3BICA 1Q13A 4W7UA 1J2BA 3NZPA 4IPJA 3TAKA 1D9EA 1G0CA 3XIMA 1TV4A 2ANUA 4PMUA 3EYPA 4JHMA 3WL0A 3TJLA 4UFKA 4NF7A 2W79A 3PPHA 2YL5A 3W86A 1KTNA 4IIDA 3RLUA 4TVUA 3RM9A 3BGGA 1AH3A 3LXCA 2WVVB 5DANA 3W87A 2VEMA 3KFTA 4ERIA 1K9FA 3KOWA 5I2UA 1OYAA 4P7QA 3PB0A 1WKDA 4JQAA 1TPWA 4DQWA 1P43A 3P61A 3B0XA 1E3XA 1X6UA 4YWIA 3WBYA 3WDQA 4HVXA 5I77A 5LHFA 1GQNA 1TPVA 1XGZA 1ICPA 4BY3A 4C6IA 1HXJA 3NQFA 3A4AA 3LSCA 3P3BA 3C0QA 3VFLA 3GR8A 1VFHA 4PSRA 3K1GA 5E0FA 5AYZA 3FYPA 3QR0A 2Z2UA 1MW0A 1R7OA 4IFOA 4M24A 4JD4A 2BY0A 2VX6A 4WF7A 1D3HA 4DWSC 1BYBA 3VOFA 4BF9A 1F07A 1LM1A 2NT0A 4DVOA 3QKEA 1HFBA 3S2LA 2WVUA 1UOKA 3E5BA 4NYYA 6TIMA 2FPVA 4W8LA 1GW1A 3NAVA 2OQYA 2V0TA 2W61A 3IGXA 2F6XA 3SCNA 5FKYA 3VZXA 3R94A 1F3XA 1EOKA 3GZAA 4TXEA 4U33A 3E49A 1TRIA 4LAZA 3FAXA 2HE8A 5ECUA 1QPQA 3ITTA 4JOMA 4QSHA 1W1IE 4B15A 2BG5A 1QXLA 3N2TA 3FA3A 1X6LA 1WO2A 3VCRA 2KAUC 4AF0A 4LUIA 2UY4A 2XU2A 2GDQA 1XLEA 1OX6A 4N6FA 4NY2A 1XLDA 1WBJA 1KFCA 1YBQB 4W4QA 3L4TA 1A53A 4HMNA 4WXYA 3TSDA 4ORIA 3MQTA 3V5FA 2WJEA 1W17A 1S1RA 2V38A 4Y9PA 4KRUA 3VKAA 5BXTA 2V69A 3FHAA 3KAOA 4RZBA 4LUTA 1Z8AA 4FOUA 2FHBA 4ZXLA 3VIOA 2PLJA 2CFFA 4PMOA 1UH2A 3EX2A 5D32A 3N3MA 1XX1A 2EKCA 1V6VA 3OBKA 4PUJA 3MS8A 1PX3A 3MANA 4Z0JA 4DWSA 1UWUA 4RDWA 1S5MA 4AZHA 1GKQA 4H19A 5EPDA 1EWEA 5F4XA 1EOMA 4W85A 1S39A 1GZJA 4IIGA 1TTQA 3TTOA 2EHHA 1KXVA 1OD8A 3P5YA 1GVOA 2DZPA 1XXXA 1PKLA 2A7PA 2HPIA 1O7AA 1Q6OA 3O1NA 2QDEA 1E6PA 3NSNA 2FJUB 1LBMA 4NVTA 1XBZA 2VR5A 4B92A 3KW3A 5D33A 2XFYA 3DUGA 3NQAA 1CXLA 2VGIA 4ORMA 1XPYA 4FS9A 1XIBA 1XISA 4L1GA 3BGJA 5AC6A 1JUEA 3ECQA 1UIOA 5DCEA 7REQB 4LY8A 5DELA 3A12A 3LPPA 1TA3A 1AD4A 4IPIA 4NI8A 1EP2A 1U5VA 4C6KA 5HBFA 1GTHA 4L4OA 1ADOA 1NTHA 1LLOA 3N14A 3STGA 1H5YA 4OE7A 4F9JA 3GR7A 3M0MA 4R3UA 4PA8A 1K7EA 1MFUA 1XKYA 4UTIA 4ZGYA 4DJDA 2X0SA 1BVWA 1V02A 3TYUA 2JFEX 3A23A 1H62A 3BZJA 1BYCA 4JR5A 3GHUA 3LHZA 4LAKA 1G4PA 3KOXA 2WLYA 2JEPA 3V1HA 4O14A 3RJYA 2QPUA 3W7RA 3C3UA 1IZCA 3WNPA 3PWIA 3LX9A 4PMYA 3IJQA 2Q8LA 1J0YA 3K30A 3QFWA 2I57A 4DLMA 2F9RA 4BCEA 4O0ZA 2A4AA 4JHZA 4WR3A 3OGRA 4JYFA 1D7KA 1G6CA 1Z3NA 2WSQA 2VRQA 1Z89A 1WZMA 3N2OA 1R3WA 1IGSA 1HKJA 3ARQA 4PTVA 4L1WA 4OBTA 4HZ8A 3E2VA 4GINA 3SCWA 3OQEA 2YGYA 5I6SA 2OX4A 1US2A 1FXQA 2V3EA 2HBVA 3DFTA 4AVNA 5I3HA 4AC7C 2YDAA 1GCYA 1AJ2A 4K3ZA 3ID7A 1K4GA 4DO5A 4RUBA 4GXPA 3B8WA 3GKFA 4WGXA 3QY8A 3N2CA 1NQKA 3HGSA 4GA8A 3CLWA 4OOZA 4EPEC 4LWWA 1WOBA 2IQ0A 2Z1XA 1HKKA 2WK2A 1PKNA 1WQ5A 1KLZA 5SWUA 1UR2A 4KFOA 4Q8NA 2YLAA 3EB2A 3E0WA 4DO6A 1GVEA 1S2CA 2PU1A 2YW4A 3XINA 2P8BA 3GB6A 2Q8ZA 3ZZ1A 1TX2A 1R2RA 1B3VA 4JTHA 2QUTA 4M56A 4HTYA 4D6HA 3AHYA 2XIBA 4Y2WA 2E1DA 3PWAA 3Q45A 5REQA 3CLMA 1MQQA 1VEMA 1ZJHA 2I7GA 3PBUA 3KCJA 3BLFA 1THFD 3MMWA 3NVTA 4D8ZA 2FLIA 1S3TC 1X1ZA 3V0UA 1DWIM 3DEQA 3POCA 1ITUA 3QEZA 1J0JA 2GFTA 1W2PA 3WBAA 3HPXA 2YXOA 3VFCA 3WDHA 1M04A 4LY4A 1E0VA 1F6KA 3CU2A 5GNZA 3W2JA 3NGFA 1P0NA 5AC7A 1ZBKA 3CB3A 3W9ZA 3QQ0A 4J3SA 4Z0SA 3FOKA 2XVGA 4NX0A 1GJPA 1P7TB 3CQ0A 2PDCA 3GSMA 1W3IA 1K8CA 1TIWA 1QVBA 3PPFA 3RU6A 1A5BA 5AFDA 1RZMA 4NZ4A 2VT0A 2QJNA 3DKJA 5FESA 2J88A 1VR6A 2RJHA 1ZU8A 4C1LA 2D2OA 3PTKA 1J4EA 2WBGA 3CAQA 1W9VA 3ZLHA 4MFEA 3N73A 4C6PA 3AHZA 3LLFA 3EOUA 3EX1A 2ZXDA 1VBUA 1OM0A 1A5KC 2E68A 3UF9A 5HPCA 2XM1A 3EXRA 4FNUA 1QOXA 1E40A 1EJTC 1H11A 4LX4A 2FFCA 5DEZA 5KETA 2XFRA 4MJ2A 1TCDA 5L6UA 1R3YA 4JIHA 3CPGA 5E1QA 4MB1A 2IUZA 1XM3A 1U1HA 1WXYA 3PJXA 4JCMA 4YTRA 3LCWA 4HNNA 2WANA 3W28A 4HU4A 1UG6A 1UC4A 1OZMA 2QCDA 5K9XA 4JTRA 4G56A 3CAKA 3SO7A 1DIOA 3S5SA 4LAOA 4M82A 4QISA 5H2ZA 3KVJA 3O6AA 1TJ1A 4BI5A 4IIFA 4QLJA 4LH8A 1J5TA 4QG8A 3VX1A 1TVPA 3SBFA 5JVLA 3UXDA 5CZTA 3F2BA 3VD3A 4TX9A 3GNPA 4K6AA 1OFDA 3P7YA 1U5JA 1FFQA 3SCPA 1DOSA 1QNPA 2IXUA 4PN2A 2X7WA 4HMEA 3RF9A 1E3ZA 1ONWA 3W7CA 1F3WA 2BOFX 2JKAA 1XPGA 3FN9A 3TLLA 2O9RA 5G4HC 3QSTA 3OLDA 1JZ7A 1HKMA 3CIWA 1OX5A 1PB0A 1ICSA 2YCJA 5AY7A 4M81A 3PUOA 2R6OA 3SSZA 1C8XA 2OEMA 3SCUA 3LRLA 4GG9A 4UTWC 3AHTA 4JDYA 4K8EA 5ABTA 5A6KA 1V5XA 5F2IA 5AVNA 3BG3A 3ONCA 3QZEA 4MPQA 3S6DA 4E4UA 2R1MA 1GPWA 5FJOA 3WKZA 3F5JA 1A4MA 2ZUSA 1AJ0A 3EOSA 3GE7A 1XCWA 4IQLA 2BGSA 3WQPA 4D6DA 3NO1A 3VD5A 3AUOA 1SW3A 1RQEA 2RJGA 1XIHA 3GDBA 3SCOA 5C8BB 3A4JA 4ZTXA 1O1ZA 1YNYA 4WOQA 3C0JA 4RXGA 2BBFA 2VRJA 3KRBA 2J77A 2WC3A 2VCCA 4V1YA 1UMYA 1M65A 1M7OA 1E9ZB 2HS6A 3N29A 4PE8A 1E6QM 2Y7EA 3T42A 1EFZA 1J0ZA 4YVVA 2IS7A 4H8NA 3FK4A 3STPA 4FLRA 3LMZA 3VE9A 2V5BA 5TBOA 4MWAC 3IVSA 1Q7QA 4U3CA 1ZPTA 2ICSA 1R2SA 3VDHA 3MI6A 4DBSA 3INPA 2XIJA 3WZ0E 1JUKA 1UJPA 3AISA 3HZ3A 1DXIA 3T2QA 3RNDA 3FKRA 1JPMA 2J74A 2J75A 3VIGA 3N13A 2VJXA 3ITOA 4M6UA 2WVSA 1FX6A 4OTKA 3CUIA 3RIKA 1V77A 1HKIA 2BVTA 1YMYA 5JBDA 1XLLA 1PKYA 1SM9A 4IX2A 4X2PA 3DHFA 3PWGA 1KLYA 1B5TA 5DF0A 4J27A 9CGTA 3WK1A 4K39A 4GWEA 5H91A 4QDMA 3OZPA 4I90A 2DW6A 3QMSA 3B8IA 1RV8A 1YLVA 4N9BA 1KW1A 4G6CA 2Y61A 3PPCA 1A50A 2BNJA 3T2PA 4J3TA 2BODX 5LNUA 1VF8A 4ZTYA 2HCVA 3FJ4A 2OTDA 3EKZA 4ICNA 2SFPA 3L2LA 3R8GA 3TJXA 3A3HA 5HWJA 3RMEA 2AKMA 4FNQA 1HO4A 5M3WA 5CJMA 3TSBA 1TV5A 4X22A 1VYPX 1FWRA 1XH2A 4JTTA 4MZ1A 1FH8A 3V7PA 6XIMA 1QWGA 3EGJA 4OU1A 4WZHA 1QNRA 4KIEA 1UR1A 1LLWA 5D04C 3WJXA 2D2GA 3W0KA 1F4AA 5AYBA 3W7HA 3L0NA 4OT7A 3S8HA 1UHVA 4UQ9A 2ESCA 5LXEA 1W3HA 3FS2A 2R94A 2QJJA 1SW7A 3B8TA 1HX0A 2PF0A 2PCEA 4AIEA 3RHGA 9XIAA 3KEHA 1CB7B 2FB3A 2A85A 3FCPA 3I7QA 1OD0A 2JKPA 1CXFA 1EJRC 3DHPA 2GVJA 4M1RA 3VGDA 5HNRA 3VKKA 2W67A 1UH3A 2QNEA 4MF4A 3B8SA 3A22A 2CERA 3ZJ7A 2OR2A 4MZ8A 2ZYFA 3EDFA 1FVPA 1PZ0A 4DM1A 3W7PA 3ZMRA 2UY3A 3NTYA 1UZ4A 3RITA 2J7CA 2X7VA 3NQ2A 3DYPA 1A5LC 2HXTA 3M0HA 1PZ1A 4NAFB 3UYIA 2XSXA 4LC6A 1QK2A 4IGMA 1LUCA 2O9OA 1CLVA 4GQBA 3W01A 1RBAA 4XBJA 1PE1A 1GJUA 2WMIB 1A5AA 2GSHA 1E71M 4AVOA 3L65A 2QF8A 1EBGA 1QFEA 1IYXA 2GVYA 3QKZA 4KGJA 1H2JA 3LTYA 2PWGA 5TF0A 3AIWA 4O8RA 4K8HA 1ZHAA 3AWNA 1GJWA 3GDLA 4U3AA 1VEPA 1TRDA 2YFNA 3FVMA 4H8UA 4ZO7A 2Y24A 2W5FA 2ISWA 2WYSA 3UT0A 3CZGA 4MSSA 2OFJA 3IVTA 2ZX5A 3UXIA 4NJHA 1OX4B 4R34A 2X09A 4GXMA 3S1UA 1Y5XA 3PBWA 1UD4A 3DBPA 2NXGA 3L12A 4F3HA 2DY3A 4RE2A 4AFYA 3NYDA 3SCSA 4QQUA 4MKVA 4UTWA 4PUKA 4PZVA 2DFAA 3KWSA 1PIGA 2CLOA 4LBSA 4YTQA 3USBA 3C2RA 2ZIDA 4BWLC 1MZHA 2WPGA 1A3WA 4C6OA 3UU0A 1XH1A 4FXFA 4RPQA 1VBHA 1BWKA 4HB7A 2XIMA 1RA0A 1SMDA 1H0IA 4GYKA 3M9YA 1MEIA 4UFHA 3W07A 3NG3A 4HN4A 3ANYA 4AHPA 3RX4A 4DUVA 4GIYA 1KTCA 5F7UA 4L4PA 1T99A 2QCEA 2J7BA 3C8FA 1IEIA 4ATLA 3RO8A 3HPFA 2XFWA 2PAJA 2QVNA 4O11A 3GIPA 1Q8AA 2VZUA 1Q4NX 5FL1A 5I24A 2AL1A 1XIDA 3FA5A 4JFUA 1UWQA 3JR2A 3ZJ8A 2I5IA 3AZSA 3T8LA 2CHRA 1UR9A 1BTCA 2W66A 3MTWA 1VFLA 4RZ6A 2OPJA 1EPVA 3A64A 1JFXA 1K7XA 4UMAA 4XZNX 2VXNA 2ISDA 1W1B1 4FX8A 3DHUA 2WKGA 3RXZA 2QULA 3NWRA 4TOQA 5C9XA 4EOUA 1ME9A 3P82A 1UP0A 3DOPA 3RLGA 3ZWTA 1F76A 4C65A 3EDKA 3UPMA 2QT3A 1DWFM 3AJ7A 3HA1A 3M4HA 3QR1A 3ZOAA 1J01A 3PJUA 2OKOA 1VZWA 3CEPA 1PZ2A 1RSCA 4N4QA 4HJFA 4LYPA 1YE4A 3DFHA 4QR6A 1ZB5A 2YOCA 4ADTA 1NWTA 1L2QA 1ZRQA 1IEWA 3ZVHB 3TQKA 1FH9A 3CV7A 1AMYA 3M44A 3MBDA 3MV11 4RNFA 5FJPA 3OGVA 3MSGA 3NNTA 2HPMA 3AFBA 3AIQA 1WA3A 3C52A 2YA2A 1LL4A 1O4UA 2G95A 1JYVA 4ZB0A 2G3MA 5AZ1A 4UFLA 4UTKA 2E5DA 2BZNA 1EJUC 4LS2A 1A0CA 4GZJA 1L6SA 4IP7A 2DUAA 1CPUA 1D8WA 2HSAA 3IJ7A 1A5CA 2WZHA 4EAYA 2V30A 1XYFA 4GI8A 1GQIA 3IJIA 3E6EA 3H54A 2C0HA 3AMGA 4AMAA 2DT3A 2B0MA 1OFRA 1XLIA 5CBJA 1V0KA 1E72M 3NYZA 1H41A 1C8VA 1OT1A 3CZ8A 2GK1A 1G4TA 4DX3A 1OCNA 3NM3A 3V18A 3QZ6A 1JGMA 4DZAA 2FTYA 4QM1A 4N42A 4REQB 4B9YA 4UQBA 4NZ5A 4DAFA 3NZQA 2E6FA 4I8DA 1HZYA 1OFBA 3WLLA 4B5VA 1TE1A 2GOKA 1ZBVA 4CD7A 3OZMA 4GYPC 2VFHA 1KXQA 4OUIA 5EGRA 3BDKA 3MW7A 3FAWA 1M7JA 1L8NA 3G3MA 3SUUA 3W7MA 2DZUA 1QWKA 4XD6A 3TROA 1HL2A 3WENA 2DZWA 5FEZA 4KEUA 1S3HA 1NFPA 1PL9A 3Q37A 4DJED 2D22A 4IGNA 3LHWA 4DB7A 1E6SM 3IAPA 3CV1A 3T6CA 1U5HA 1T96A 1OBAA 3G24A 3EWCA 3P0XA 4W88A 4AZ5A 5CPQA 3H70A 3CNYA 1XL9A 1NF0A 3P6LA 4LALA 4XQ6A 3HQOA 5XIMA 2YB1A 6TAAA 1P1XA 1JYWA 2VOTA 3MDUA 1Q6EA 4YYFA 2OU4A 3W7KA 3TOPA 4Q4RA 1XGEA 3HGJA 4O54A 1OFEA 1XIFA 3A47A 4JTSA 3RAOA 3MMUA 1EJSC 3AHXA 5JU6A 4OV9A 3UZYA 2DT0A 3M0JA 3BLDA 4EVZA 2F7FA 5LIYX 2PPGA 2PRMA 5DXYA 2UWFA 3MUXA 1BRLB 1TKKA 4AG0A 1QAPA 1XQLA 2YJQA 4H6KA 4ZQPA 5KSWA 3BOLA 2E7FA 3CL8A 3DGRA 3H2EA 3HG3A 3RM4A 2XINA 3V16A 1DJNA 4POCA 2VX5A 3VD4A 3E1F1 2PLMA 4J2PA 1BAGA 1OJXA 2PTYA 4CU6A 3S0CA 3HN3A 2ZZ6A 3KTSA 1C3FA 5D09A 1JDCA 4PMQA 2OELA 5I5RA 3W1MA 1RJRA 1FA2A 1V93A 1DXEA 3FX4A 2WZIA 1KFEA 5BWAA 4G2DA 2VC7A 1FXPA 3TX9A 4FP1A 1HJXA 2XGBA 4XZBA 3WELA 1BQCA 6CGTA 2ZDSA 4JIRA 4J9JA 4Q7IA 5JH1A 1SVDA 1Z9AA 2RGMA 1AQMA 1DJYA 3PZ9A 3KE0A 1LBFA 2VZTA 3FDGA 1DYSA 4CNPA 4M6QA 3R1ZA 1GQJA 1V3HA 4RNIA 4Z2IA 4WVXA 1ZUAX 3H6OA 2WHKA 4AU0A 3DGBA 4GC3A 3UYCA 5M17A 5C9UA 3BCFA 3OG3A 3PTMA 2V81A 3WDIA 5LIXX 1FUYA 2OOGA 5D2YA 1E1EA 1QNOA 3UWUA 2WW5A 1OGBA 4JL1A 2OYKA 2FKPA 1EBHA 5A6AA 5HUOA 3KL5A 3MP4A 3W70A 3E38A 1KFJA 5IFPA 3CBWA 2YSWA 3IIXA 2BMBA 2IKGA 4GI6A 2A3CA 5FJTA 1UKSA 2UV8G 2HDJA 4Q22A 3AI0A 1RJPA 5DT7A 1IGWA 3BPWA 5A5WA 4ERAA 1V6XA 1UBSA 3WBXA 1CZ1A 1N55A 3D3AA 4C7GA 4NRRA 1YKWA 3MHUA 3WH6A 3LCXA 4UFMA 4QS5A 4S2CA 2PDPA 1C9WA 5FJUA 4G7EA 1M3UA 2F61A 1XRFA 3B8UA 3NQCA 5H8MA 5GVJA 2XIQA 1HL8A 1WZLA 1OSEA 3TC3A 1K6AA 1OYBA 3OIHA 4J3WA 3PBYA 2WLZA 5I09A 1XICA 1BWVA 1S2AA 3SCTA 3WLHA 1RALA 2ZDRA 3U48A 3WFAA 2HBXA 2OGJA 2GJNA 1JR1A 4S23A 2DIEA 3GYCA 3UPWA 4L7ZA 1OEPA 3NPWA 4CN1A 1CEOA 3PNZA 2YKKA 1V03A 2Z7KA 2Y85A 3CUJA 4NZCA 4QG9A 4TUFA 4QS6A 2C3ZA 4LNCA 3UG3A 2PDQA 5C9RA 1PWMA 1J9YA 1EDQA 2WCSA 2Y7DA 3VKDA 3S2NA 4P7OA 2TPSA 4FR6A 1TELA 3WYZA 1P0KA 4H8VA 4W5ZA 4KFPA 4ZO8A 4UTUA 5I3FA 3VX0A 3IARA 4A05A 3G1DA 2GWGA 4P7LA 1DWAM 1YDYA 2HK1A 1P7TA 2FHFA 3WCZA 4XAFA 2ACRA 1M68A 3WY1A 2W27A 2ATSA 3LB0A 5MHBA 3VDBA 2L5HA 3APYA 1IT8A 3WLKX 1JD9A 1QK0A 3TWAA 2NWRA 4MADA 3VIMA 1UPPA 3KBSA 1DXFA 2QKFA 2YLLA 2WM1A 4DO4A 1KFBA 5E0CA 4DBUA 3GHRA 2C15A 3TTEA 3VIPA 4A2RA 1WAUA 2HXUA 5C2GA 3ZQ9A 4Y9MA 4FNRA 1U83A 1KKRA 3QW3A 2V82A 1J18A 2MUCA 2VC5A 1PYFA 2WV8A 4XAGA 1ICQA 1HJSA 2CKSA 1OINA 2D69A 4GLEA 2C1GA 4QJ1A 3GXNA 2EF9A 3VCNA 5HR6A 3PAJA 3DFOA 4S3BA 1UD6A 5G5IA 1EXBA 1PXGA 3O07A 2NXIA 3QV7A 3NM1A 1HN1A 3N3TA 3A3XA 4XBKA 3GD6A 1UQZA 1UYQA 3CWHA 4HP5A 1VFFA 2EG7A 5KEZA 1FWNA 1TMLA 3TTQA 3O16A 3CYJA 1Q2SA 1TPC1 2KX9A 3NL5A 3OJGA 1M01A 3UZZA 5FF0A 1V4YA 3WDRA 2CLIA 1V7YA 3R11A 5D2XA 3IWPA 3NSXA 3RPTA 4PL2A 1HJVA 1K8YA 4IT1A 5KZDA 3TFCA 1YDVA 1PYMA 3QN3A 1G67A 2WXDM 1HO1A 4GUGA 1QO2A 1UWSA 2NQHA 2DSVA 1S5WA 3W53A 1Q4WA 1SZRA 3QSRA 3B03A 1UR8A 2HEJA 2XN2A 4HOXA 3STCA 2P88A 3MP5A 4KCUA 5HAOA 3EWWA 1UROA 4L80A 4KT2A 3AIRA 3ARRA 3VMNA 2PU0A 1RUSA 4ZOCA 1X1NA 4GNKB 2OQHA 2CITA 2O9PA 4HA1A 3S9IA 1CLKA 2Z0IA 1IF2A 1V3LA 3MJMA 3A9IA 1JJKA 1H7PA 2E9LA 3GC5A 3H24A 4B5XA 3H21A 4FIRA 4HBKA 4UTTC 2CEQA 3NJ3A 3DN5A 3SADA 1XHGA 3LCLA 4US5A 3LU2A 2NV2A 4JN8A 3ZIZA 1OGGA 2XPKA 1SZEA 3L9CA 3BJSA 4CVWA 4MGGA 3HPZA 1R2TA 5DCDA 3AAMA 2DZAA 2NZLA 4OQVA 2E67A 3T09A 2PUZA 4XZWA 3ARPA 1BKSA 3LHTA 1I0DA 1ZGDA 5MKGB 5HMFA 3N19B 3DECA 3V5OA 4N02A 3W88A 3AWOA 3GHTA 1E9YB 2OJPA 4HIBA 2J62A 2J6XA 3TQPA 2RUSA 4PH6A 3I68A 4XTDA 2XISA 5C2XA 3W1TA 5CZ0A 5CLWA 2Y8VA 4AYGA 3KWXA 4PB3A 1EX5A 5A6SA 1DJGA 1WDSA 5LA0A 4Z08A 1C90A 3REQB 2EQDA 4OECA 4MNLA 1JPDX 2DT2A 3SUVA 3H2AA 2FGBA 1XR2A 4NHVA 3NXLA 4GC4A 2CESA 3H26A 1R85A 1W5OA 1BWLA 3TOYA 3SRDA 2OO0A 3C6CA 4AYSA 1SFJA 4BQ3A 5C55A 5A6BA 3CTTA 3F4CA 5AHNA 3QXBA 1SFLA 1W1PA 1RCQA 1G01A 1EQPA 5I3JA 2JK2A 5M1TA 3QW4B 3OO2A 1DE5A 3JS3A 4LOCA 4AISA 4GY7A 4GABA 2X2YA 1US3A 1YDOA 4UR8A 2EEXA 1NWRA 4IMGA 4ML9A 3UG8A 1B4KA 2V67A 4X0NA 5LGZA 4AVFA 5ABFA 1YXYA 5A6BD 4FZIA 4CD4A 4M7TA 3S9YA 4N6EA 1KD0A 4PMNA 4LUJA 3HV9A 2TMDA 1R8LA 4HSOA 3LZ3A 3W1RA 4MY1A 1PSCA 3GG7A 2XJ7A 1NVMA 2EXOA 5J5RA 1E9IA 4P7NA 2VMFA 4DRSA 4NASA 2WO5A 5A2CA 4DBEA 3FSUA 3I3EA 1PCKA 4MLRA 3B40A 2I5QA 3GTNA 1DVJA 6ENLA 2ZUTA 2CLFA 3GY1A 5HWNA 4IXHA 3CQKA 4L64A 4NXKA 5F4SA 2AL2B 4NYUA 5IM51 2ZA3A 2EPMX 1ZLPA 3SIMA 2V68A 5FAJA 3GW3A 1TG7A 4XAPA 3URNA 3TYCA 4AX6A 5EFDA 1PEZA 2FH6A 1JQXA 5I00A 2I5GA 3B4UA 3LPGA 1UUQA 4IG2A 3VM7A 2EPLX 4KIRA 4M5PA 4JKKA 2ABAA 2R91A 4MJ4A 3JRKA 3S9ZA 5I7GA 3NDZA 1UZHA 3WQGA 1XLBA 3JZUA 4DJEA 2DSWA 3R58A 1BVZA 4ZXOA 3OBAA 4OFCA 4JGDA 3U2ZA 4GI9A 2DORA 3NQEA 4JYDA 2FTPA 1AQFA 3B04A 3LGDA 1OG6A 1WDPA 3DYMA 2P53A 1AMKA 4RE4A 3NL3A 3MP3A 3TIMA 1UCWA 2C91A 3I3DA 3OVGA 3GNNA 5CSYA 1P6WA 4B16A 3AC0A 2Z1WA 1NJJA 3L5MA 4RNJA 4LT9A 1TWIA 4CQAA 1WKEA 4RKAA 3Q2DA 1N8FA 4HKPA 3BQ6A 4AMCA 4KCWA 3V0SA 4CEUC 2O56A 4HNLA 1ONXA 1VD6A 3W7OA 2ZXAA 2OQLA 1EJ7L 1I8JA 4QXIA 1XBYA 3C86A 4N9CA 3D5HA 1XI3A 4GJ1A 3UCCA 2PDUA 4GOAA 2WMHA 4MWAE 1MQPA 3W7JA 2QYGA 1GVIA 1LG1A 1R30A 4I7WA 2CPUA 3CMJA 2ZZ5A 3POHA 1ME8A 4LB4A 4KCTA 3E96A 4C6DA 3G0XA 3VDGA 3NURA 4Z1BA 4F8XA 3SN1A 4X9YA 1PO9A 3O3RA 4TVCA 4R7OA 1RBLA 2UZ9A 3RCNA 5F2GA 1Q7MA 1AA1B 1PPIA 2PP3A 2XUCA 2QJIA 4LJ3A 4NNAA 5AC5A 4R7WA 4C1NA 3B9NA 2E3ZA 4GZEA 2DSKA 2FTWA 4CD5A 1LWJA 3M6YA 1YADA 1NM9A 4LRTA 4S3CA 1OCQA 1SFTA 1OADA 2Z29A 1BGAA 2OEJA 1UZ1A 3OLEA 3CO8A 1LDCA 4L9YA 3DDMA 3WH9A 3W6YA 4UOZA 2DDXA 1US0A 1XDMA 3BGAA 3FLUA 3FJ6A 3TZNA 1IIHA 3IGHX 4PBGA 2CLEA 2E5CA 2QUUA 3C8NA 1W3JA 1B1YA 3M7WA 4AZ6A 3SGZA 2VURA 3BLEA 2F84A 5LKYA 1JAKA 3V75A 2FH8A 3EBVA 1RLCL 3H55A 2J47A 3BUVA 4BEQA 2J7FA 4XKYA 2VRKA 1KCXA 2JEQA 4CN4A 2QCCA 4MNMA 1Q65A 1FP9A 1YTDA 1DHPA 3KHDA 3URAA 3GXIA 1IE7C 4UZSA 2DUZA 2J13A 4O13A 1MXGA 2PURA 5DXXA 3UR5A 3URBA 4DN1A 4UQCA 1JZ2A 1ODZA 2Y2WA 4O52A 4MG4A 2GZXA 2QR6A 3LHUA 2YXGA 2NX3A 3W2NA 5KTLA 2VX4A 4URIA 2QCGA 2F2KA 3QJAA 5KITA 3WJYA 1QI5A 1N2VA 2POZA 3RCMA 4U4MA 4GKLA 2EPHA 4FNPA 2GJXA 3FGCB 1W5PA 2J8TA 2DIJA 2G96A 1IT7A 3S3GA 3G2GA 1QI0A 5CPSA 3ZXWA 3KVKA 3NXFA 1NEYA 4LUYA 2DV0A 5IOBA 4MY8A 5DMNA 1XP3A 3RRXA 2CNCA 3B8DA 3NQBA 1Q6LA 2OMAA 4NG3A 1E70M 3BQ5A 4HNOA 3DFSA 3WNNA 3N2BA 2IQTA 4PTDA 3EB3A 4JEJA 4QIUA 3RFAA 2NQLA 1TUFA 2MANA 2VKZG 1G7VA 5G2WA 3CO4A 3CHVA 4I6VA 4N4PA 3QHMA 4DNMA 2BLEA 2GOUA 3PTDA 4HNUA 2PDJA 1N8IA 4DXXA 4XZIA 1B30A 3W7IA 4H6EA 4Y7EA 5EKYA 1Q6FA 2E77A 4UTHA 1VIZA 4PTWA 4C5ZA 2CZEA 4I9JA 1R3TA 4DYJA 3LCGA 4CNOA 4RLIA 3T0AA 2VD9A 2X42A 3IJ9A 3VCCA 2QCDB 3O9NA 1KXHA 1ZCOA 4PUUA 4C6EA 5FF4A 1GEQA 1O5RA 4WY0F 7ENLA 4LC8A 3R79A 2NV1A 1YTEA 4OJYA 2PLCA 4XSLA 2UY5A 1X38A 3TAOA 1Q3NA 4MUZA 3KLKA 3PC0A 4KFNA 2GDVA 2PZ0A 3AYVA 1JF6A 3ZM8A 4JPGA 1GHRA 4TVDA 2CZFA 3N6QA 1W3NA 2ZC8A 3F5LA 4PCNA 4MIMA 4S3JA 3LPOA 1LCOA 4UQAA 2C1HA 1EA0A 1OX4A 1I1XA 4RE3A 1QBBA 3RLHA 3TR9A 1EF2A 1Y5VA 4U2ZA 4DELA 4WKHA 4DBWA 2FZ9A 3KP1A 1V02E 3UGVA 2YPIA 4H8HA 2EAWA 4PBEA 4D6EA 3IIPA 4E8DA 4MB4A 1QATA 1TZ9A 2C13A 4AY1A 3VKJA 4UOJA 4IMEA 2FDSA 4CQCA 3EMZA 3NGJA 3O6CA 1LL7A 1CCWB 2VP8A 4CQDA 3AYSA 5I23A 1TR9A 2J4GA 1ME7A 2C71A 4G8TA 2Z6IA 4EXQA 3ORWA 1MMFA 1LUCB 3LERA 1YEYA 3PZQA 3APTA 1QT1A 4QLLA 1KV8A 2PZNA 4OBRA 4E4PA 2VR4A 1O1HA 1E5JA 3VMPA 4HK5A 2C8NA 3Q67A 5BOOA 1TA3B 1VHCA 2NV9A 4ERGA 4ZE4A 4GVIA 1BSLA 1DTNA 1AVAA 2XVPA 4HZ7A 2WSYA 1TJPA 2PTWA 3WH8A 5DY2A 4O1BA 3VGGA 1UWTA 2ZADA 1AFSA 2CC0A 2Z28A 2P0OA 4S38A 5DQPA 3WL1A 4INFA 3IRSA 5ABGA 4JY9A 3GRIA 5I3GA 2VQTA 4NKCA 1FDJA 4PBFA 2I14A 5KZEA 4MYAA 2VELA 3S6OA 4Z1AA 3G0SA 2G4JA 4QE5A 3OVRA 1ZBCA 3WQDA 1Z41A 1OHLA 4YLWA 1J6PA 4QRNA 3W1LA 3CAWA 5EMMA 1EZWA 1PVNA 5HA7A 1JL8A 3G6LA 2YDRA 1MW1A 3MVTA 3ZVHA 2X1RA 2REQB 5CPLA