1GYWA

Gamma-adaptin appendage domain from clathrin adaptor ap1 a753d mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
126
structure length
126
Chain Sequence
FNDIAPGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQADVPKTFQLQLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Gamma-adaptin appendage domain: structure and binding site for Eps15 and gamma-synergin.
pubmed rcsb
source organism Mus musculus
molecule tags Endocytosis
molecule keywords ADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA 1 SUBUNIT
total genus 24
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1gywA00
3HS8A 1GYVA 5CN2A 2DWXA 5CN1A 1P4UA 2YMTA 1KYUA 1GYUA 3MNMA 1GYWA 2A7BA 3ZY7A 1QTSA 1B9KA 1OM9A 3ZHFA 4BCXA 1W80A 1IU1A 1KYDA 1KY6A 2DWYA 1QTPA 2VJ0A 1NA8A 1KY7A 1KYFA 2E9GA
chains in the Genus database with same CATH superfamily
1DE4B 3KE0A 4HHAB 2PPAA 1E9PB 3DO7A 2XV3A 4JG1L 1JS4A 3QQ4A 1YNTF 3X3FL 3ZHDA 5EBLA 4EDWL 1WD8A 2NY2D 2JI2A 2EXSA 4OFYD 2FGZA 4L3EE 3DLQR 2IV8A 3QHZL 1AI1H 1M42A 4HC1A 2CIKA 2VLJA 4Q6KA 2ID5A 1U8MA 3QDME 2I24N 2VOTA 1EJ8A 2X9ZA 5IGXL 2F2HA 2FHBA 2DEWX 4YPGA 3JV6B 1KLUA 1PDKB 2D3JA 5I75B 2FX9L 2MOGA 4H88L 4NBZB 4YSDA 3HLAA 1JGEB 2AZAA 1THCA 2XRAH 4CVXA 1MCSA 2L8AA 2XG5A 2XTSA 3KPMA 3L5WA 3ES6B 1FFTB 1N26A 4KHTH 4UDTB 2V9TA 4BM7A 3T6WA 1H9VA 2V5SA 4I77H 3TJPA 2JKSA 1MY5A 5IKCA 2CA3A 4Y4HC 4Z7UF 2BH0A 1ES0A 1USZA 1FC1A 1KN4H 3AQXA 4KXDA 2MCMA 5JIMA 1QI3A 3BDYL 1KACB 4Y5YB 3LKSB 4GYBA 4EVNB 2VUOA 3EYSL 3BGAA 4YX2L 3LPFA 3K3QA 1Q72H 1VB9A 4UMSA 5H2BB 3WKML 1QR1B 4GINA 4HX1B 4UM9B 4N2KA 5C0ND 1R5VA 2P47B 2R1WA 4K7FB 4U4IA 2VC2B 2VJ0A 3GSOA 4AZ8A 1NA8A 4MNGE 1MIMH 4Z7NE 2ZXGA 5EO9B 3VWJD 3VH8B 1J5IA 3F65A 2E27L 3UDWC 1X7QA 3C09C 4OQTL 5K9KB 3MOBL 4U1IB 1TJHL 3ZRCC 2FL5B 4PJDB 3OZ9L 5E8PA 4NKIH 1V10A 4Z7VE 5I1JH 5K1JA 3BISA 3DO4A 2Q87A 1T5WA 3VGAB 1CFMA 1YYLH 4E36A 3OKOB 3QDGE 3BYTA 3HLAB 4FFVD 4JJHA 4LRIA 3BPCB 4MJIA 3KPSB 3CZLA 2F5AH 4HKXB 4LRNH 2QADC 4FKHA 4FYTA 1YUHA 3S3PA 2X3AA 1QOKA 2YWYA 4FI6A 1N6VA 3FSWA 4GO9A 5DHVA 2DQEL 1RIUH 1A1NA 3TBVA 1HKFA 1KEMH 4XC1H 3E2HB 3KWVA 5JTWA 3DPDA 3CH8A 3CFTA 4X5XB 1BZQK 1DYZA 1QHOA 4PBXA 3GPEA 3DIFB 3ZE2F 1NFDB 1IRAY 2DWTA 5CKAA 1E65A 2B8OT 3VQ2C 2YQ3A 3QA3B 1I1AC 3U83A 5ALBL 1HCFX 4FNPA 3UJJL 3LXUX 3W11C 3LDBB 1A2YB 2B1HH 1EMTH 1SQMA 4Z7VF 4Y1AA 4LPCA 4KMLB 4NP4L 4O58H 4RDQF 4GW4A 4X5LA 3E80A 4P3CL 4Q9RH 4K5PA 1Z2KA 3LXBA 4NUGH 4P2QA 1IAIH 3DV4A 5IHWA 5EIIB 2CBTA 4Q74A 4QTIL 2C3WA 2ZUTA 1E50A 3L3JA 1SJHB 4A37A 4PJCB 1RURH 2Y6SD 4QO1B 2VM9A 3TN0D 4XMKL 2NXZD 1FVEA 1HHHA 3L95B 4OD2A 3E8UL 4H8HA 1U8QA 1FN4B 3BIBX 2OZ4A 4IRJA 3UAJD 2IH1B 5AL8A 4ZYKB 4QRPD 2Q3AA 3CFDB 3TVMA 3V4PB 5AVYB 3I50H 4KRMB 3Q8FA 4AMKL 3UAJC 1GGYA 1ZHBB 4MAZA 4HBCH 4F58H 4UZSA 4BHUI 2VDLH 4LCIL 4P5TD 2GJZB 4PRIE 1MRFH 1J9RA 4JFDB 1NIDA 1O7DE 4KGJA 1OE2A 3CIQA 2P8MA 2R2HB 4CILA 1QUNB 3EGXA 3WENA 3QWRD 4PJFA 1I7UA 2XTJD 1WEJL 2X1PA 5I6MA 3OR7B 3GTNA 3QCTL 4F8PA 5IF0B 5GGSY 3DUHA 2YAEA 1MOEA 3QUGA 5DLML 3I9GL 2NDFA 1Q9KB 5A6LA 1FFOB 1ZDSA 4PJEF 5C7XL 1IGCH 2AJSH 5BW7A 1A3ZA 1DCEA 2Q2EB 4FMFA 1BZ7A 4A67A 3D3VA 2HVKB 4G43B 2JIXD 5DFVC 3UG3A 5CMAA 3FQXB 1NCCH 5IEHA 3TBSA 1B4RA 5D2LA 3FO1B 4Z1PA 5GSRB 2ADJB 2UWEF 2BSTB 3NSDA 5DT1L 4TF4A 3OHXB 5GGVY 5DRNA 4MJID 3PDGA 1G5AA 4JDTL 5LBSL 4EBQH 3CXFA 3VD2A 1Y18A 3SDXB 5GRZA 4EKXA 4FTVE 4L4JA 2YD6A 4U1HA 2OW7A 4ANWA 2FB4H 4AC2A 2DM7A 2FSEA 4LLWA 5E2TL 3A67H 3IS1X 4PBDA 1GW6A 3D7PA 3QH3A 4APQA 4HVBA 1FNAA 3MRQB 1EV2E 1AKJA 3MFFA 1QUNA 2EXYD 3EGXB 3UAEA 5I1JL 3MCG1 5DRNB 4OZGA 2YQBA 2F1BA 1RJLB 3ZE2B 2CLVB 2V5MA 3BIAX 1AG0A 4YFEA 5IF0A 2DJMA 4CDHA 1C5DA 2VL4A 4G8EA 4C56A 1QLRB 2CO4A 2E9JA 4UM9D 1LXMA 1QP1A 1F56A 3GYRA 4N8CL 4YGVA 1JCKA 2P8MB 2R2HA 2WTPA 3ECBB 5ADOH 4PI2A 3I3DA 4AYFA 1BVLB 2WUBH 3DXAB 4W9HC 2ZX8A 1WPCA 3SPVA 2KZWA 4M5ZH 4BBWA 2QQLL 2DJ4A 2J5LB 1ITBB 1L5GA 5CEYA 4KITB 1HHKB 2WBJA 2W1NA 4LO9A 4XPFL 1LO0H 4I4WA 4R7DB 4RMUA 4PJFB 2Q8BL 4JNXA 1KIRB 3DV4B 4PMFA 1EGJL 1VEOA 1E7VA 3MZGB 4R4BB 2PTTA 4WAFA 1KG0A 4H0GA 4OJEH 4XR8C 2H3NA 2ZPKH 3BX7C 1R3KB 3K4DA 3CZSA 1FVCA 4JL2A 4QO1A 4YXLL 5KYUB 3QIWB 3OB0H 1NCBH 5J7CC 4AMXA 1KV7A 3FONB 2WCPA 2EXYC 3C9NB 5E1GA 4ZYKA 5HPMA 4F15C 3AGWA 4MJ6A 5FC9A 1SDDA 5MI0C 2CALA 5GJSL 2XKUA 1UB6B 4FNSA 5JXAH 5FA4B 2BC4B 4J3TA 2XWBB 1NAKH 4FA8A 3P2TA 4CU8A 3T65B 2GT9A 1N9PA 2OYMA 5DMGD 4WGWB 1RZGA 1KB5H 2YAQA 2APVA 5I15H 1AO7E 2ZOUA 4TLKA 2K78A 1A0QL 4FQIL 3GSUA 1OTUC 3NH7H 2EYSA 3HS0A 3V5KB 2J21A 4DT2A 4AWJC 5F8QC 3IKCB 1TJXA 5FYKU 4H2AA 4WFFE 2NY6C 3VRIA 4KZCA 4NQCD 3ULAB 3WY2A 2MQ0A 5I16A 1DVFA 2H6PB 1I7TA 3DRTA 4HS3B 4J2XA 5ISZB 3WN5B 1YG9A 1PBYA 1I3GH 5JQHC 2LHAA 3PWJB 1HJBC 1B2WL 2VMJA 5EU3A 5INDA 3AUVA 3S48A 3AT9A 4C54A 4D9RD 4QT5B 3TBWA 4JO2H 4KTEL 1JPSL 4FULA 2HTLC 4EF3A 4MMZA 4F7TA 1MCBA 1S7QA 3EAKA 4TUJA 2D0HA 4MRCA 2FDBP 3FUKA 3ARQA 1T6BX 2DWEB 2B16A 3FT9A 4X99A 4KXBA 1NC4D 4Y9BA 1F3RB 4P0DA 2R9HC 2PPFA 4YHNB 5D5ME 2UY6A 3TFKC 1CVRA 2YJQA 4ODSL 4P5MB 4J28A 1KXVC 1SYSB 3OPZL 2YPVA 2O5ZL 1TQTA 3KXFE 4YL9A 5EN3A 3VSQA 2R1XA 5DRWB 3OMZA 2P8PB 5T3XH 1UOWA 5AVXB 2P4AB 1OP3H 2QSCH 4HJSA 5D6CA 3FK3A 4WO4C 2ZNWA 4FL4C 3P30H 5D6DC 1XH1A 1ZA6B 2BVQA 2YA2A 5FECB 5AZEH 4ODTL 3VM7A 2XWXA 3IJHA 1AZBA 1EXUA 4JM0A 4XI5C 3TONA 2GITA 3IN0A 2R4RH 4YHLL 3FB6A 3OZLA 3MGTB 3FFCE 1TZOA 5E5UB 2CRMA 3ZHLA 4KMTL 1OE1A 4G82A 3TESA 2P8PA 2YA1A 5LN4A 4DVBA 4GRWF 4D8PA 5DUBA 5ITFA 1CGXA 2ZYSA 1RZJC 2FJSA 4NQUA 5AENA 4JY6B 1XF2B 3OKNB 4PJIA 1UYWH 1T83A 2YD4A 2BNQA 4RNRB 5HTSA 3O6FB 3V52L 1EQWA 2D31A 4MNGB 3UCRA 2QR0A 1ZTMA 3V95A 2BCKA 5J8OA 4RFEA 1ZT1A 2DH3A 4PPTA 3D3VE 4I18B 3CTTA 4K71C 3OX8A 4TUJB 3BJ91 2VR7A 2VABB 5JPMB 1XWVA 5KS9F 3CFKA 1HQRB 3BPOB 4FMKA 1GR7A 3PWJA 3S6CA 4PJXB 1E90A 2OJ1A 1GGIH 4HYTB 3IMWA 1JPTL 3QZWB 4NXKA 3TA3C 1NCBL 4YHYC 1FDLL 4QRRD 3TBBA 2MCG1 2YA0A 3WD5L 1N8ZB 1XF3B 5EOCL 1OAJA 1NL0H 2VNCA 1MRFL 1QLEB 2VXVH 3FTZA 4Y5VA 1YPZF 3QHZH 1EDYA 4QRQA 3Q6GH 3RX5A 4UQ2A 4P5RA 1EHLL 2BP0A 5AW6B 5GJTH 4KXZH 4DCQA 1Q4NX 4F1SA 1GZPB 3P3TA 5KSAA 6FABH 4NJ9H 5KUMA 2WWOA 5IV2A 5KVMC 2SEBA 4J3OH 4WTWA 4G71B 4XVUC 2GTQA 1Z9MA 1W0WB 4Q9QH 3FRPG 4HMDA 4HUXA 5IW1B 2WBJB 1JPGA 2CH8A 5K39A 1FG2B 2Y07H 1OB1A 2XICA 5SX5K 4ZMTA 1G6RB 1UC6A 3JWNE 2NY6D 1MLBB 3UPRA 2ZP0T 4LBEB 1K72A 2DKSA 5EC2B 3U2IA 4GS7C 4MNQA 5HY9B 5KOVC 1PQZB 3MU3A 1N59A 2NXYB 4DKDC 3DBXB 1AGDB 3KPPA 1YEEH 8FABB 1CI5A 5EZJB 3MRCA 5I9QC 5DHYB 5I5MA 4FG6C 4H5SA 5K33A 3VWKB 3NYKA 3SOBH 3QULB 1S3KL 1H6FA 3GWJA 2MOVA 2M83A 3IK2A 5HJBA 1S5HA 3NFNB 4JPWL 1IKNC 5JLZB 2I07A 3HE7C 3D05A 3VWKC 5JR1H 1MNUL 3BUYA 3MX0B 2NX5A 2LVEA 2R1YA 3MNMA 2I60L 3X3GL 3BP6A 1P9MA 4Q4EA 4C4KO 1FUNA 4WJKB 4U6VH 3BXNB 3KAAA 1JMZA 1CGSL 3RL2B 2FQEA 4LRNL 1MNNA 4QTIH 2Y7OA 5EF3A 5HYQA 1R33A 3MYZA 4WV1B 4IRZA 1FH5L 3DBXA 5D8JH 5F96L 2JKRM 3DHUA 3ECQA 4PS4H 4ELKB 1LHZA 4P05A 1H3VA 2A73A 3WXWH 4L1TA 4PW3A 4I0PD 3DA0A 4NC1E 3TURA 1AXIB 4X83A 3SGEI 4FABH 2RTTA 2MPAH 4YLCA 4R7NA 3IRZA 1IKFH 1X5AA 4Y1AE 4PBVC 3LNFA 5EEUA 2K1MA 1PG7L 1A6AA 1YY9D 1JK8B 3VSTA 3KPOB 1RJYA 4J1UB 2YGQA 3EG9A 3WIHL 1HWWA 2HP4A 3FU9A 1N64L 5I0WA 4AE1A 1LD9A 4PD4J 3ARZA 3NT0A 1JNHA 3IF1A 5B4MD 3RWEB 1AS8A 1ETZB 5CEZL 2YD1A 3Q3GB 1MVUA 2O72A 3WTUA 3KGUA 1CXFA 3VI3E 3MBWA 1G7IA 2IBZX 4OLUH 3PCYA 3SY6A 4HUCA 2IQAB 1YA5A 3WD5H 4XNZC 2CGRL 2NTFA 4JDVA 2ROYA 4TUKL 4XBEH 3PGDA 4N0CC 3W0WA 3ZQ9A 5CBEB 3BT2H 1BV8A 4HW6A 4AGPA 5BZDB 4J27A 4F1ZA 3SDYL 3T77B 3PFQA 3WIIL 1WS8A 1KFGA 1KJ3H 5FGBC 4BFEA 4QHNA 3UTPD 5A2IH 5IW6A 3QG7L 1DQQA 1KCVL 4N5EC 4HG4J 1CD0A 1MUJA 1NAMH 5F1NB 3GSQA 1QFOA 1N3NA 2WIIA 3V2AR 5T5FH 4OLYH 2CO3A 2CCLA 4BQ6A 1FRGL 4ODXB 5I1DA 1IGJA 4KO6A 4F7KA 2WXLA 4XO9A 4YX2H 4L4TD 4AY0A 2DL9A 2VMFA 1A14H 2W07B 5EH1A 3Q8EA 2A6IA 3RGBA 5ACMA 1YQVL 4JY5H 2X0UA 5DD1H 1A6WH 1TYEB 5FYJD 5DC2A 2ITCB 5E5MB 2CHWA 3SPIA 2VUKA 1IM3A 1AKPA 5C3TA 1L4IA 1KTLB 4A6YL 2ILLA 1RHHA 4PQXA 4JFPA 3C6LC 1SZNA 3OZ9H 2H32H 4L5FH 2YGVA 2CLRB 2WNKA 2NX5E 5BV7C 1DFXA 4LGRB 2V2XB 2EVFA 3SO5A 1DSFL 3IPFA 3BYYA 2AABL 4NSKB 4X9IA 4QYOB 1B0GA 3ZVVA 5BZZA 4NQQA 1OW0C 3WJLA 2FX8H 3X13A 4PB0H 3PHQA 4OIIL 2QV4A 2Z7ZA 5SWSB 3H85A 3L7FB 2AF2A 1MN4A 1DBMH 1KFAL 4DJMA 4IIQA 5BS0E 1KB3A 4WZ9A 4JO3H 5DMIL 4KNQA 4QRAA 3WOVA 2L7UA 2PO6A 3LV3B 3D0AA 5IFJA 3TBYB 1U3YA 2JIXB 5KYNA 4PJHA 4Y2OA 1GKEA 3SDDD 4LKCA 1LDPH 4M8QB 3MA9L 1E9OA 4Z0BH 4NKOB 4X7FC 5F7BA 2WD0A 4ZO9A 1N12A 4GAGH 3VQ1C 3KPMB 3L5WB 4FQJL 1WAAA 1D5IL 5F3FA 4A2MA 3WHXB 4EN3D 3NDYE 4ACPA 5AVQB 5AAMC 1OGAB 5FKPA 1ZSDB 2A0LD 2EH8H 1PX8A 4IBLT 4M56A 4KZEL 1NINA 2W07A 2BVPA 4JRYE 2OCFD 5C0BB 4ZTOH 2DIBA 4Z95H 3MRLB 1CURA 4NT6B 3H9ZA 4OLVL 2QGCA 1X5JA 2X5PA 3DI2B 5DCCA 4F20A 4HZLA 1F00I 2ORBH 1OM3L 4K94L 4PP1D 4ZS7L 4XBPA 3TC9A 1DUZA 1IQDA 3UTTE 4W1TA 3TO4C 1F4YH 1NDMA 2DQUL 4JGMA 4G70B 3MJGX 2LTQC 1YNLH 4EIBA 3GS0A 5DC4B 5CD5D 1PD6A 2ZX5A 3K0WA 1IB5A 4WU5A 1IU1A 4ZXBC 3I2CH 3LRKA 5I0VA 4EOWH 3QQ9C 1AXSA 5DO8A 4AEHL 1J1PL 4NRYB 3FQTB 4P4KD 2BNUA 4GT7A 1G0DA 3MLUL 1A4AA 5LXGL 2AQNA 5DK0B 2X89D 2FECL 4JFYB 4WTZG 3U4AA 4X8XA 4R4FH 2IH3B 3P77A 1QSEA 2RGSA 4APQC 1OOWA 1OSZB 1CE1L 2XWEA 2PTTB 5A16A 2AK4E 1KB9K 2DLTA 2EEXA 4O9HL 3QO1A 1IE4A 5C0AD 1ACYL 1Q0YL 1VADB 4APQB 3FU6A 4QTHA 2GI0A 2CO7A 4BGDA 3NGBC 2I69A 5I6OA 1CT8A 1UG9A 1UH4A 4QGYA 4QPEA 3JTSB 2XZQH 4YBHA 1YEDB 2F61A 3DDFA 4X7SL 5F89B 2CLZA 2HT3D 4PGCA 1BQRA 3SJVB 2VLME 3OHXA 4DN3H 4XNYH 1BECA 1RP8A 1KXHA 2YFOA 4FLRA 3FO0L 1FNFA 3DC0A 4KK9C 4IBWA 1K5NA 4MA1C 2QV2A 3BWUC 3IAQA 2ZCHH 1RJLA 3T2LA 1BVLA 3DXAA 3GJFK 4NQED 3TYGH 4GB9A 1ZPUA 5EO1A 4LCUA 2XG4B 4Y5XB 1RUML 2WO2B 4BZ2A 4PV9B 2XOTA 2AJYL 4C56B 4F7MA 1JRHL 4R7XA 3VDCA 3RVWD 1JYWA 2Q86A 3CBJB 3MJWA 3P4MB 1Q9WB 4X5QA 1HEZB 5DQ9B 3VFGL 1SLUA 3UG5A 3G3LA 4EN3B 1FFOA 5IB2B 1FCGA 3HPJA 2G2NA 5T3ZE 5DO2C 1CIUA 1TJMA 1LEGB 1IJ9A 4JY4A 3ARFC 2AXHA 3EGSA 4CL7A 4LCIH 4GW1B 2X4TA 2R8SH 3U36B 5GGQL 4MZRA 2R29A 1I1YB 5A2FA 4OLUL 2CLZB 2A9NL 2FSDA 2YPKA 4YDIL 2CR6A 2A2QT 2C34A 3ALPA 4JFDA 3ILPA 4UTBH 3PWPE 4HH8A 1Q8MA 2AAAA 3QR2A 4HWNA 4F7MB 3HNSL 3PAUA 2ZZUT 2Q3XA 2HVKA 1NM9A 3L3JB 3FT4B 3VMPA 2NCMA 1H19A 4K7PY 3UC2A 1R46A 1AG6A 2R69H 3WSQL 2EACA 5BVJB 1WHOA 5L9DL 4PH8A 1F4WL 3F12A 1BYOA 3Q8BA 4TVPD 1A9EB 4WU5B 3TNNB 1QSEB 4MA8L 1KBKA 5DK3A 4AG4H 3FQRB 3FQWA 2HT2C 4PJ8B 1J87A 2BY3A 4FAAB 4P59H 3ZDYE 5F1OB 3ELQA 5HYJD 3IJ7A 3M1BB 4Y16C 1QYGH 3V4UH 4M61A 4NNYB 3NP3A 3TEXA 5D2LF 5SWSE 2IPTL 3UZQA 1DUZB 4HXAH 3AT8A 3LKRA 1G7JB 3P77B 4MRBA 3B43A 4OUOA 2EDXA 3CJJA 3QEHA 5KSBF 1OGPA 4R9HA 4RMBA 2X9YA 2HLFD 1KULA 5H37H 2VTFA 5DJYB 3FAWA 3IXTB 2Z7WA 1IZKA 3GSVB 4KFZC 3D8MA 2V7NB 5FGCB 4A66A 1EA9C 3QIUB 3MLUH 4JFVA 5T3ZL 1EEQA 2EDFA 3ZDXF 4A04A 4R4FL 5GISL 1GZHC 3BPCA 3A6BL 4K9EC 4KJYA 4Z7WF 5T8IA 3W2DL 5JPMA 2OK0L 2J25A 3QB7C 4M1DH 1ZVYA 1E5UI 4JPIA 1V54B 1AQMA 5T3ZD 3C8HA 3PWLB 5B7EA 1HNYA 1IM9A 2QLYA 4YWGH 2OMTB 1HJCA 3SE8H 1KIQB 1LO4H 1AHWC 1J8KA 4JHWL 5E56A 5B8CA 2BXZA 3CSTA 1EHAA 2Z31D 1VFOA 4XMUA 2ZF9A 4PJIB 4X4MA 2HKAA 4JPVL 1RVFL 2MRYA 4MYPA 1WS7A 3N85L 3PYCA 3JSSA 3LQZB 5DQDH 4ZXBA 4HPHA 1MI5D 1Y1UA 4PY8J 4RGND 4BH8B 2CHZA 3FAXA 3OHXC 3RVXC 1FYHB 4XC3L 4G8FB 4ZW7A 2IV9A 4I1NB 4J23A 5FECA 2CHDA 1DJSA 1VGEH 4EEEA 2CGZA 3NFPA 4EXKA 4AZUA 4F3FB 2HA1A 1ZHNA 3D4GA 1Y6KR 2P5PA 1URLA 5AOIA 3HG3A 3TO4A 1KZQA 2E0PA 1YEHH 1RIUL 1EO8L 1EUTA 3HAEG 2LLGA 1C12B 1TUPA 3RWHB 1IC4L 1AHWA 3GC3A 1OCCB 2XYCA 3UBXG 2K3TA 4LOFA 3SDAA 1R5IB 2E4FA 3E6FA 2J6EL 2QFPA 1IBHA 3BAEH 1M9SA 4V1DA 2DY2A 3ZGHA 3HMWH 2HMIC 1KJ2A 3V6OE 5IOPA 1S7UA 3Q1EA 3TCTA 3REWB 1A7BA 4JFFB 3LKOB 2WW8A 2CUIA 1IM9B 1GZHA 5CP7A 4P8QA 1JL8A 2R0WL 1PLAA 5I19H 4P4RB 2Z7YA 5CZKA 2D7PA 1Y6MR 4BQCA 3B9KA 2CHXA 3QJHB 1KPUA 3V6FB 1JI1A 3NIDF 3S36L 4CVUA 4MBRA 1J0HA 4AQ1C 1BQHG 5E2UH 1NOAA 2G3ZA 4ZPTA 2QQQA 2ZKXA 7FABL 1LEIA 4LESA 4A7SA 3WKNA 2AP2A 2BK8A 3ZE1B 3TF4A 3BPNC 3JUYA 3QZBA 4YUEL 5BRQA 3RNQA 3UH8A 1F2QA 3H53A 2OMBA 2IFFH 1NWPA 1UA6H 2GABA 5JQ6L 4MJ5A 1EHLH 1A1OA 3DV6B 2WGXA 1K4CB 3OBAA 3BE1L 1SLWA 3I9PA 1WIPA 1FP5A 3QXAB 3LKQA 1GA2A 3BT2L 3ES6A 3RDTA 3RY6C 4XH2A 1CTOA 5I1EH 3MLSL 2BHZA 1OPGL 1KYFA 3MRGA 5DJZA 5D1XC 4JKPH 1GGTA 4DEPB 2FUQA 3H4HA 1L7TH 3DGGA 4M6NL 3A4EA 1NDGA 1PLGH 1BAFL 2YHGA 3MXWH 3LH9A 3OB0K 2YSSB 1D9KB 3U0TB 1EO8H 3UZEC 1E5ZA 2F5BH 4Q2ZB 1DLHA 3S8GB 1MF2L 1T6WA 3BP7A 1JZFA 2JKJA 4KPHL 4B7LA 4OZGF 5KYUA 1NCCL 4ABQA 1QVOB 1IL1B 1PZAA 4FNRA 1PFCA 4IBQA 1IJNA 4YE4H 4RX4D 5DT1H 3Q43A 3LZNA 4DTGH 2VR6A 2NY6B 3MRBA 1B88A 3WGUB 1KBGH 4JRYB 4N20A 5DZNA 1JUFA 4AQAB 3VDAA 3SDDC 4NZDA 3O2VH 1DLFH 1DVFD 3FYIB 1JXFA 4FKKA 4D3CH 4JFDE 4FQQA 1UWGL 3EO0A 4U0QB 3GDCA 4YXHH 4GXUN 1JGIA 4JDVB 4LDOB 5GS1B 3UTSA 2NQCA 2WP3T 2Z34A 4FXGA 4APXA 2HVJB 2HZHA 3LX9A 4RETB 2KH2B 3M45A 3EG9B 3KH4A 4JHWH 1RJYB 4BCXA 3C5SA 3QDMD 5EU7C 3QJOA 3AG3B 5IIEB 5F96H 3WEOA 1LD9B 3EO1A 3ULUF 2Z92A 1RJCA 1DQTA 4JM4H 4JM2C 2IWKA 5IMLB 1Z9SB 1CZ8L 3W0WE 1DBAH 2XVGA 3NZHH 3BUQA 5E03A 5ITBH 3UBFA 4J1UA 3G6AA 5D93B 5G5DB 3E8UH 4OCMC 3M88A 3Q9PA 3OWRA 2JMRA 5EWIL 3Q2NA 4B6ZA 5I15L 2F7RA 3D4CA 4HV8B 3U46A 3LIZH 4C57C 4OKVA 2EDYA 3MRPA 5I73C 1B3JA 3EJYD 4JPWH 2BP8A 2I07B 3GMRB 2NXZC 3ISWA 3BUDA 1NC2A 4IGBD 1A3QA 2H6OA 3AY4A 5GSVB 1AE6H 1JWUA 1MJJA 2WTRA 1T7WA 2F54A 2NY4C 3S8WA 3X1FA 1UM5L 2AEOA 3EZJB 5B7FA 1MREH 1XX9C 2D7TL 2CO1A 3F8UB 4CDGC 3CQPA 3GRWA 4ZQTA 4OKVB 3BKML 5CF3A 1KCUL 5I1HH 2I26N 2B1HL 3KPRD 4HLZH 3RGVC 1U9KA 3O11B 4NRZA 4PVMA 2ESVD 2FNBA 5E1HB 3BP5B 4N5ED 3FDWA 1F4XL 4E42A 3ZW3A 4X7CC 3ULUD 4PS4L 2A73B 2XI9A 2CUMA 1P7HL 1A6TA 1GJUA 1VENA 3O2VL 3KLSA 1B9ZA 1GOHA 1IC1A 4FXGB 4RSYA 1DQIA 2XZZA 4DERA 1UA6L 3RL2A 5JO5A 5HHPA 1TQUA 3O8XB 4MQXC 5LNEA 1CXIA 1QATA 5G5DA 2OFQA 1L0QA 2A83B 2GTZA 2VLMD 5CM1A 3MHZA 3TXAA 1JF1B 1BQHB 4QIRA 2N7AA 5EC1B 1L7TL 1T04A 2XQBL 4FC3E 4F9LC 2OM5A 5KUKA 1AGFA 3FW6A 2BSRA 4H88H 5F7LB 4UQBA 2WOBA 3HMXH 3ARFD 4H26A 2WB7A 5C0IB 5D1XA 4ZSOA 1U8LA 5F9DC 2XCMC 1XSOA 3JWNH 5CZXD 3QQNA 2J1KA 3VG0L 1PG7W 2AJYH 4B9KC 2IOIA 2I27N 5HGHA 3R06A 1SBSH 3HRZA 3RTQB 1HQ4B 2YWZA 4FXKC 2NSMA 1XF5A 3HR5A 5KWYC 3NSCA 1BEXA 2WZ0A 4YDVB 4AUJA 3OKMA 4IKJA 3U6XS 4ISVA 3M17A 4GS7B 4C55A 2IPUG 3OXRA 4ACTA 4YSRA 1TENA 1Z9LA 4KROC 3RA7H 3AS1A 2XZQL 2UYLB 3Q1SH 1G84A 4D8PB 1L0PA 1O5DT 2WAQA 4QRPE 4PG9A 4J3SA 1VFAA 3ESNA 5LG6A 2VABA 2JIXA 1VLXA 3U1QA 5KSAC 2ZTBA 4PS7A 5D7HA 4GSDH 3V8OA 1RUAH 3KD4A 4FG0A 4PRID 3V4VL 5IESL 4WJ5B 1OAYL 3RVTC 1QBAA 1LK3H 3B2VH 4ERSH 3GUTA 4X50A 1THAA 1TO5A 3GI8L 2A74A 4N2OA 5BRZA 3U7WH 5KSVB 2HLAB 1SUJA 3BWAA 1HDMB 3DROB 1OSPH 4P9HC 5HJ3A 3IFLL 2UVFA 3NSFA 5D7LE 3WU1A 4KBPA 3SZKC 2PCFB 4WFHE 3DUUB 4DP9X 2HRGA 3GB7A 4DPAX 5FOBB 1ZTXL 3T0BA 2XY2A 3GHEH 4CN4A 1HSAB 4Y2OB 2F68X 3WMSA 1TXKA 4XCCL 3KYOA 1J0KA 4HXAL 4U2YA 2QQNL 4DUXA 1IEAA 1WBYB 2ZXQA 3CMOL 2WVSA 5E6RB 2IGLA 2RAMA 3DXAD 4NQEA 5ICZB 2MOQA 4Q58C 2J20A 1GZQB 4G9FD 4BDVB 5CD5C 4PTUA 4HCRA 1S5IL 4JO8A 4YSQA 4GIOA 1RV6X 4JFED 4WNQB 3FUHA 2FBOJ 4P3CH 1HTYA 3O2DA 3KLHD 4LQFH 1IFGA 1J48A 2H6UA 4PJ7B 2YMTA 4G80A 3CBKB 4N9OB 4UTAA 43CAB 4KKBD 5GGRA 1N5YH 4JMNA 2Z0UA 3ERXA 4E9LA 1JFQH 5FA3B 4EI5A 5I0DA 1UGKA 1WZ1L 3W1ZA 2EYSB 3HS0B 4N2DA 1G6RL 2XIDA 3W82A 5C2UB 5T1DL 3MLPA 3JV6A 4FFTA 4ZXBB 3VXSE 2OTPA 3IDYC 2YIHA 4NI3A 2XU9A 4FLSA 4GAGL 1IGIH 1RZFH 2F53D 4Y2NA 2Q9OA 4MQTB 5J89A 1P1ZB 3LNEA 2HG0A 1XF5B 3HR5B 3MRFB 1KXVA 5FA4A 1DJYA 4LKXA 2B14A 1X4YA 3QRGH 4HWZA 2Z8WC 2AJXL 1Z1WA 3LQZA 2R2BB 4JVWA 3FH8A 3R06B 4X6DA 2XZCL 1QHQA 3D69B 2OULB 4IEFB 1QLEL 4N68A 1I1FB 4QT5A 3MOAH 2DQDH 3KYKL 1KGWA 3FQ1A 2Y06H 1B0WA 1MRCH 3AVEA 1IC7H 5AYUL 1DBML 5FM5O 2FJUB 3HG1D 3DX9A 2QKIA 3SO3C 2ZCZA 3WUWB 4FQPA 4CSZA 3B7SA 4EI5C 4Z6AT 3IVKA 2WC7A 5ECGA 2YO3A 2VQTA 4K23L 1W72L 4HOZA 4NRXA 4L4TA 1SF5A 4NX0A 1HZKA 5B1JC 3UTSE 1DBJL 4JDZA 4HPYL 1QBBA 4JRWA 4LPWA 3UROR 3T4AB 1DJGA 3OF6A 3EOTL 3LQMA 1MIEL 3OAZH 5D2NA 3BAJA 3QWOA 4QRPB 4CC4A 3V5DB 4H0IA 1FVCB 2R2EA 3T4AC 1E9QB 4EE2A 1KTCA 4Z9KB 1WAAF 2R0ZL 1S9WA 3QZMA 1JERA 1N68A 2PABA 2FLBT 3ARDC 3MV8A 2K8MA 4LL1A 4AVHA 2GG1A 4N6RA 3DTXB 3QFJD 4W6YB 5AYQA 1OCOB 1SMAA 5DR5H 3BVTA 2YMOA 3MUGA 4PGDA 1DN2A 4L8DA 4NM8L 4OU3A 3KBPA 2PR4H 3ZHFA 1ODAA 4CJ1A 1GRWA 1LQSR 2P7TA 2V7HA 4RFOH 5C07D 2QHLA 4PY8I 1A7PL 1XMEB 2OQJB 3ARED 3SGJA 2RBLA 5EMYA 3AU1B 4HIIB 5I0ZA 3ZX1A 2X4TB 1DANT 3ETBF 3OKLB 2KQMA 3EH2A 5A2LH 1L9SA 4AXWA 3FQXA 3QZLA 4B60A 3HI6L 5EUKA 4XCNA 2GC4C 3I2CL 1VGKB 3TH2T 3HJ0A 3MJ8A 2VXTL 1JD9A 2G3NA 2H4EA 4KTYA 1EIBA 5D1ZC 4N0YL 4AL8H 4BV1A 3KH3A 1I8MA 1S8DA 4X8JA 4LMQI 5ABZA 2ZG1A 1T21A 4G3YH 2FSEB 3EDJA 5IEHB 4TUKH 5D1XE 4ZSOE 2CLVA 3W57A 4FOMA 2IG2H 2ED7A 2PWFA 3WJJA 1WP6A 3HE6C 5AWNH 2DJUA 2CGRH 3IMSA 1A65A 4MMYB 5EEYA 5JYLA 4PS8A 3BW9B 3Q48A 1S7WB 5F7AA 2IC2A 2IO5A 2VZSA 4K0OA 2GJZA 3BD5A 4FFWC 5TDOA 2DEXX 3ASOB 3SE6A 1MQKH 5C08E 1FYTD 1K2DA 4M7KH 1WZ1H 1VADA 2WINB 4FFVC 1B4TA 1TITA 2Z93B 1U93A 2H41A 3V4PH 4EOWL 3D30A 5MEOB 2GHZA 3VXTA 1ETB1 4OUUA 4D0DB 3BEVA 1INDH 4ANVA 3E7JA 5IUCA 2LLLA 4GFXA 5C08B 2DQFA 4F7EB 5DLLA 5L4FA 4I9WD 2DKMA 2VJXA 3DX6B 2HKHH 5F97E 3Q6FB 3VO0A 3IDJA 4E41A 4HUXB 4KK6C 3RTLA 4RIRA 1WF5A 4L4TB 5CCHE 4IBYA 4E9VA 2F9BT 4X8CA 4Y19B 3OAYH 2NNXA 5KVDE 4IHBA 3VB8A 3HFMH 4FYRA 1A4CA 1SVZA 4DAGL 5TE7H 1ZGLM 1NM4A 1SNRA 2VXQL 2DM3A 4AYMC 3DJRA 3L95A 5LCVH 4YSTA 3KEHA 4NN5B 4U1MA 3FKUS 4M1GH 2MNWA 2ERJC 4GRWH 1CFQB 4FP8L 3WIHH 2ZXWB 2PYFB 2M8XA 3OF6D 2A9MH 5HHOA 5EZIH 1I7RA 4Y1TA 4EXPX 3DHMA 3S2CA 3PS6A 4F2ME 4JFOB 5IROA 2Y1ZA 3PQYE 4HIIA 1CK0L 2VMEA 1AQDB 3G5YB 2B5IB 3NSJA 4NFBA 4YBLB 1X44A 2F7OA 3IMRA 1NBYA 1TJGL 3KW7A 3P3YA 4K07A 2Q8AH 3TPUA 4H20L 2LV4A 2XVBA 1AQKH 3BGFC 2B77A 2FT6A 1ZT1B 4N0FB 4BUHA 2EUZA 3CVHL 3B3BA 1EXHA 4XN9A 1D5XB 1X9UA 1E4XH 3DMMA 2AEIT 3O6LH 4AG4L 4P4RA 1BIIB 4KAQL 4P2RD 3OKNA 3GMMB 3VH8G 5I8KL 3BGFB 5E8PB 2CKBA 3L4YA 1JZGA 1XAUA 4MJ5B 2Z4QA 3ZTEA 2JKXA 4KI5C 4QHKJ 2BFVH 1DJXA 2DM2A 5SWQA 3AADB 1XCXA 2MFNA 3B1TA 5DHVB 4HJ1A 4FQCL 4OCYL 5E1QA 1EXGA 4WK0B 1Q9LB 3WY4A 5JNYB 1M3JA 1EXUB 5DU7A 3BKJH 4RMRA 4HIEA 2MCAA 4QNPE 3SKOA 3OKYA 4LLQB 5AKVA 1F4XH 4OJAA 3OKKB 4ZD3H 4CUCA 3II3A 4JZJA 4YHPB 3VFWA 4OZ4A 2J5LC 1OT1A 4QRSA 3REVB 3WGVB 4F37F 2B0SH 3RWGA 3FFOA 4Z23A 1AS7A 3GLDA 2PXYA 3BT0A 3RUGB 4JFTA 4OCSL 3TGXA 4IIZA 2GY5A 5C0CE 3TIDA 1SJEB 5AKRA 1FZOB 4MZIA 3IBEA 1F3DJ 1CICC 1AO7A 3LH2L 5EIVA 2VLRB 2YPVH 5B38B 5IVXE 1OTTC 3FUMA 4HIXL 1SFHA 2ZICA 4PJGE 3LIZA 4PRDB 3CAFA 2H0JA 4AYBA 3BH9B 3EJJX 1D5MB 1TTFA 3MNVA 3OJDB 1IARB 2Y7SA 3MV11 3CZGA 1PZCA 1NCAH 3IDMA 1QAWA 2AQQA 3FRPA 3PXLA 5FO9B 5HHQA 4GQZA 3ZE1E 5HHXH 1QABA 5TE6H 1ZMYA 1KENL 4GEJA 2HX7A 3QG7H 2D9QB 4MA3B 1DSWA 3LDBC 3JVGA 2AI0L 3PV6A 3U9UB 1E4KA 1SJMA 4ADGA 5KW9L 1ACZA 2BS71 2ZWKA 3ZIMA 3VFUB 1WITA 3ARXA 4W6XB 3A4FA 3P2DA 1RPQA 3WNLA 2DMGA 3P30L 3GI9L 1CFTB 2QDVA 3EUDA 1BDYA 4TSAL 4FCHA 1JPTH 4AL8C 5BRZE 1EAJA 4KKQA 1C8PA 3E3QC 5H37G 3W5NA 4BXVA 3ARPA 4E9XA 1UH3A 4S1QL 2DEYX 3WE1A 3S7GA 1F18A 4LE8A 4G6JL 4HU2A 4Y4KD 2WBJD 3MRRB 1ZT7B 4XPGL 1MJ8L 1UACH 2APXA 2OMWB 1G7HB 3K8MA 1DDTA 1HYSC 1DE4A 3EFOB 2Z9TA 2XKNB 1AQDA 3QDHA 5F0MB 1T0NA 4R5VA 3VFOB 1I8IA 2CIIA 2DQIL 4JQIA 4TTDD 3MNZA 5JR1L 1R5WA 3NTCH 1N6QL 1U8LB 4DGYH 4UT6L 1PIGA 3G08A 4HH9B 4PVLA 2EIZB 5D1QE 1LE9A 3LN9A 2F7PA 4HG4K 3MRKB 4JFHE 5JXAL 2CPCA 4NIKB 1KIUB 2NY1D 4J8QA 4XWGL 7CGTA 3AY2A 3B5TA 4W9DC 2EUVA 2ADYA 3DARA 3BKCL 4AGNA 3RYMA 1OSPL 2KUTA 2WMPA 4ZBJA 4BSWB 5CEZE 1T1YA 4P9ML 5E1IA 3CSPA 1RSYA 3QCUL 4QRRB 2NUTB 3N41B 4DK3A 3VWJC 5KVDL 4N0RA 3FQWB 4P59L 4S10A 5F6IC 5HHPB 2NR6A 2ORBL 2PP7A 1DZBA 5EULV 1OM3H 3WEXB 2VQ1B 2IQAA 2W91A 3BE1H 1KDIA 1JV5B 2CG9X 32C2B 3EHBB 3CMOH 4JKLA 1UENA 4QI3A 3KG5A 3R4DA 4RFNB 5HI4D 4BKLA 5I17B 4R0LC 3T6QC 4PJHE 1E3XA 3Q3GA 4WY7H 1TCMA 1P7KB 4GBXA 4Z7UB 5I1GL 3RGVB 4R3SB 1HHJA 4KJPD 2X05A 1XR8A 3GBNL 5H4ZA 2OCJA 1UM6H 4RRPM 4WSKA 1MI5A 2VLLB 1S7TA 4QMEA 3SZ6A 4D9LH 2AGJL 3F6IA 4JFSA 2BY0A 2BHYA 2CR0A 4FNQA 1UA7A 2OMYA 1CZ8H 1NGWA 2XWTB 2FYVA 2XN9A 5AYTA 3FSAA 1HH6A 4TULL 4OLEA 5D72L 4TL5A 1YO4A 2JCCE 5KYXB 2PXYD 2CCVA 4Y4FD 3NG5A 5TDOB 1KCRL 2K45A 4HMCA 1F45A 1OP9A 2KDGA 2NNFA 4F2FA 3VQMA 2H5UA 4TVUA 3KM2A 4HV8A 3U46B 2AHIA 1YEEL 3SDAD 3P4OA 1X5YA 3BLPX 3MREB 4L1BA 3WFHB 1AGBB 5DJ2B 1J9TA 5FK9A 4DKEH 1GS6X 4WCYL 2NZIA 4YXHL 2DYPB 2COQA 2ZUQB 1IILE 1R3JB 3EYVA 3M86A 3QRFM 1QTPA 3MUY1 3BFWA 1A4KA 3NH7L 3GSXB 1ET7A 4GY4A 2Z92B 1UZ6E 3D9AH 3H3BC 3N42B 5GIRB 4YDKL 3CFBB 1EEZB 3MR9A 1YEIL 3SY0B 3BP6B 3DJSA 3LPGA 4U7KA 3MLWL 3L1OH 5I6XB 1NAML 1NCWL 4LBEA 5EC2A 2P5WA 1UT9A 3NRPA 4XMLL 1AO7D 2H1PL 1NEZB 3MLVL 1C16B 5FK9B 3R8BB 4CC1A 8FABA 3OAZK 1MF2H 3APNA 4I3GA 2LR4A 1WK0A 3EF7A 3C75A 1ZS2A 3GDBA 3QIWC 3TO4D 4O2CA 4QHUB 4BQ9A 4ANUA 1ONQA 3FCSB 3BRGC 1XB8A 3K6SB 4LPXA 2ZKYA 5CCKH 3GHPA 3GO1L 3SCMD 4AQAA 2FO4B 2E7HA 5DD1L 2P5WB 3TF7C 4MAYD 1YNKH 1KN2L 2VL5A 2XNAB 4GKSB 1U36A 2ED9A 4ORGA 4WHDA 4ZX5A 3W39B 5AVUB 3WKQA 4ZMWA 3CPLA 4X4KA 4ZTEA 3KPQB 4X5PA 4MCZB 4XVSL 2CA4A 2DQTL 3QQDB 4IRJD 1FE8L 1KMGA 5HJDA 4ADIA 1UJ3A 4TRPL 3EOTH 2CDGA 2K3HA 1QTYT 3EBHA 4EQ2A 2C9QA 3OR6A 5DUJA 2EIMB 4FG4A 2QGDA 4TNEA 2X4SB 1ZV2A 1U8IA 1HL4A 3GRGA 1MCWW 3FCTA 3FT3A 3KPLA 2HVBA 3J27A 4GW4B 4KX7A 4PJ8D 5L88H 5LGJB 4NZTH 1FH2A 5DFVD 3NRQA 4UYQA 4PJ6A 3VXOA 5T1KA 1F90L 4ZW8A 1SN5A 2CPUA 4RGNC 1K4CA 3ZOAA 4XTRD 4DO5A 1LTXA 5C71A 3MV9B 1MHPH 2F18A 3WHE1 3FTVA 4MD0B 4XRCA 3ZYOA 1F11B 2E6JA 1REIA 4X5XA 1QD0A 4IHOA 3UADA 4LL9A 1PVHA 5C7ZA 5ID0A 3P9WB 3BKYL 1NIFA 4UV4L 3PGFH 1JGVL 2BNQB 1JK9A 4NDMB 3DYOA 3QI9D 3S5LG 5C0BA 2Y72A 3FF8A 2HX9A 3L54A 4FQ1H 4APXB 1KWKA 4HAFA 3FUDA 4YHZL 3WEXA 1IBDA 2ZX7A 5AVWB 1IAMA 1A02N 3ET9F 4F9PC 5D7IB 4KKPA 5K9OB 2GYSA 3K91A 3LEXA 4MD5A 4RNRA 1P5VB 5ICZA 2WVVB 2RACA 3ARDD 2YRPA 2VDML 4KX8A 5CILL 3KPSE 3V8CA 1E2VA 2RA1A 4GG8A 2EH7L 1FO0L 3QFDB 1EFXB 4GBXD 1BP3B 2X6VA 43C9B 4X5WB 2V2XA 3KWTA 3A0OA 3SHSA 2X1OA 5GGRB 4G7VL 4YLBA 3SE8L 1DQMH 1TO4A 3UOAB 3KPNA 3V6BR 3F7VB 1QSVA 2NX5D 3N43B 3NEXA 3OVUB 2VDRH 4XPBH 5FIEA 4ZUUA 3KMDA 1FH5H 1OPGH 3K81A 5E00A 1ZK9A 5HDOA 4MYWB 3R4RA 5EEWA 3UBXI 1J5DA 3L7FA 4KKAC 4JZNA 3DK0A 4AYDC 2VDLL 3L4UA 4ZOBA 3O0RH 5D55A 4L4VB 3PDOB 2FR4B 2DIJA 6PAZA 3G9AB 3QUXB 3D1MC 5EBMA 5FHBH 4L9LC 2V2WA 1FFNB 1IC0A 2Y7MA 3S37X 5GS2H 3QWQB 3BVWA 4XVJL 2Z91A 5TQ0L 5D7EA 1EAPA 1XH2A 2YJLA 1JZDC 1VFMA 3FB5A 3QG6B 4FS0A 4NJAL 4GRWB 2BDNH 3BAKA 2J1YA 4O4YL 2V37A 3ZQWA 3VGBA 2ZCKH 1EO7A 1KCSL 1MHCB 2LQRA 4BD4A 1SHMA 3KVQA 3MYJA 4UINL 1CU4L 3AREB 3PGDB 1WBZB 2VISB 3EH5B 1GPOL 3BN9C 2XXFA 1AD9A 4F8LA 4EZLA 5C0CA 4PRDA 5CN1A 3SQRA 3UGUA 4ZUSB 5GHWH 1BD2A 3AS2A 5TDPA 3T3PB 4IOIA 1A4JB 5DZLA 3IJEB 2FJFB 2HUEA 1YEFL 3VFMA 1ET5A 3BVNA 4EDWH 1Q72L 2LE9A 2XIBA 4PJ5A 5EZOH 3Q8AA 3FCUB 3TN0B 3J2PA 1IFHH 1LP9A 2FQFA 4JM2F 4PLJD 1EZVY 3JWDC 4RWHA 1H3TA 5DJ0B 1GC1C 3N3EA 1KJ3L 2X4NA 3IETA 3S35H 5ENWA 1RUQH 4BCYA 3FUNA 5B1AB 4ZMNA 3PUCA 1P5VA 1SDDB 5I9QB 3M6DA 3FJTA 4X7DC 4AYFB 4YDNA 4FMVA 2XWZA 4ZFGH 3K7UA 2BSED 3CQFA 35C8H 3IFNH 2VT0A 4ZDHA 1EZSA 2EIJB 2WM0A 5CLZA 2KMWA 5DSCA 1QLRA 2XRAL 3IU3A 1U8KA 4PCYA 5E08L 1JZ6A 2VH5L 2EXWC 2BRRL 3QRGL 1K8IB 3V0HA 1JI2A 5I8EA 3PWUA 3FL7A 5TQ0H 4QUOA 3TA4D 4GMSH 1SMDA 1HK6A 2ZONA 5DRZA 3HG1B 3PAZA 3N50A 4L8BA 5T1LB 2X6UA 4P4KB 1M7IA 3JV0A 4UU9A 2P5WE 4CVZA 2UZXB 3WKMH 4F27A 3RVTD 3V79C 4TVPH 5LWYH 4P2RA 2GUOB 2V6HA 3OG6B 5FW7A 4KZDL 1A6AB 3BQVA 4IKLA 2DN7A 3TH3T 3VSVA 1MXDA 2ZCLL 4M43H 4Y9FA 2G5UA 1NBYB 1A5FH 5K1VA 4FLOA 4X5RA 1UVQA 3ZYIA 3I6SA 2AXWA 4XPBL 1A1MB 1V7MH 1Z5LA 2EILB 5FYLH 1JN6B 5CKGA 1F6LL 2ZWNA 3S4SA 1ZOXA 4U1MB 1RZJL 2EYTA 1ED3B 1MCIA 3FS9A 5MEOA 4NNXB 3K6FA 3G5VA 4Z7NB 2VXTH 1FLTX 3QARA 3DRQB 3S3JA 3W9EA 4ELMA 5GSRA 1NBCA 1SHSA 2XFGB 3WJMB 1UXSB 4P04A 4DW2L 3B6SB 5ANME 2VN5A 1EFXD 4GBXB 4OZFB 4CMHB 2QTVA 3FQRA 4NN6B 3FQNA 4N2AA 4L37A 4ZNCD 3QYMA 5EZLB 2BOBA 4FHJA 4B95C 4B0MM 1IX2A 4NOFA 3D18B 1IVLA 4DF9A 3ILQC 2H7WA 3FZUD 4JQIH 3LVEA 3O4LD 3R0MA 4FZEL 3O3DA 4K2UL 1GH7A 3MO1B 1MCDA 4MQ7A 4URKA 1HNGA 4YVUA 1P5UA 1DVQA 2NNCA 1TQCC 1ZLEA 1FN4A 1N0LA 2VO8A 2WQRA 1KBVA 2Z93A 5CIPB 1UZ6F 4QRUB 1P4LB 2ZWYA 1YC8A 4ES8A 3QEQA 2I9TA 2YD9A 3T2QA 3OR7A 3ZTDC 1JN6A 3MO1A 1OAXH 1TQWA 1XSJA 3NIDE 4PJFF 3F62A 4HLJA 4K94H 3VXUE 4KKRA 3R7RA 4OLXL 4UIKH 5CGBA 4K5NA 3B7RL 1MFCH 3TEUA 4JRFA 2WQ8A 2XPZA 2BOBB 1XF1A 4G6KL 3JWOC 4XB3A 2ZCLH 4M43L 2ARJB 2VZ1A 4GMTH 2WSPA 1DQJA 2HSIA 3B2UC 4KKCD 3V0EA 4BE6A 4GUOA 1BWWA 1ZLWK 5I74B 4NUMA 2O5YH 1N2RA 2IOOA 1CGVA 1O6SB 2EDTA 4JB9L 2A7BA 4WEBH 3VXNA 2AJVL 3MRMB 3EJZC 4FQLL 5GJTL 2PR4L 3D07A 4JKMA 2EINB 2FT7A 2WSKA 4ZMXA 4KTDL 2R23B 4RFOL 4FQ2L 2PF6A 1CICA 4PJGB 1YEKL 3B5HA 1MFBH 3GEWB 2RFXB 3ETBJ 1DQLL 2B4CH 4QF1B 4DGVL 5EEXA 4AKOA 1ZLVH 3H3KA 4XBEL 2IPKA 1WFTA 1DVXA 2AK4D 5IVZB 1J8HA 2Z7UA 3EUUA 4KJWD 4S1DC 3X14A 4AXWB 1M7UA 2XZCH 4GO8A 1M2VB 2F1AA 3WIFA 1WA0X 4Y1SA 4G1EA 4TPRL 5KJ7E 4UQ3A 3JTSA 4I18A 4YSCA 4AX3A 1QASA 3BLBA 1MFVA 4KJQC 1MIML 4XOEA 2D31B 1IKNA 1D5MA 2DIAA 3ARFB 4PJAB 5DJ8B 5C0AA 3ME0A 1GL4B 3L13A 1G1OA 3BDXA 4NWUH 3VXUA 2VKXA 4N2FA 4LP8A 1AO7B 5D96C 2AQSA 5HDBB 4L3EB 2APWA 3OKEB 1FZMB 3IGAB 1LMKA 4QHLA 4Z7WE 3F3HA 4MNQD 2BFVL 4AMWA 2A99A 4I5BB 2DQTH 5AVSB 1RZ7L 5FGRA 1NGYB 4GIAA 4M93B 3NABL 4G42A 1TJIH 2PCYA 3UTTD 1PLGL 1CFSA 5C0FB 1KDJA 5ESAB 5FGSA 3O8XD 5BO1L 2C26A 4Z76B 1E3ZA 15C8H 4LLVB 4M93C 4X6FA 5H94B 2V9UA 4RGMB 1TZGL 1HI6A 4BH8A 4MDIB 4JFFA 5EPMA 5I0YA 4PP2A 4J4PA 2ESVB 3NJKA 4HK3N 4PWHA 1E8ZA 1KGXA 4XOCA 3V0WL 5D71L 5CD3A 1HWGB 1VCAA 2KT6A 2PP8A 1O7DC 1UCBH 2JKTM 2YD0A 2VB5A 3CZJA 5ALCL 4LOUD 1PSKH 2B1OA 1HSBB 3L4CA 1A6ZB 4YPGB 2QVKA 5BZWB 1SY6A 2DTSA 2XFXB 2KC0A 3HS9A 4G5ZH 4JHAL 3SGEH 1BQUA 4M1CD 2PW1A 2HWZL 3AC0A 4G6MH 2JELH 4HS8H 4MAYC 2O6EA 3RHWK 1S7QB 1WAAE 5D1XD 2CIKB 3AREA 2Q7YA 4JG0H 4RBPH 1PYWB 1KLUB 1OE3A 5ERWB 5KVFH 5I76B 5CSBA 2QHRH 3KYMB 1IAIL 1WWBX 1A6ZA 2XWBA 4AKQA 4DESA 4ZJ9A 2LOEA 4ZMZA 1UUSA 3NAAL 5GS0H 1GMIA 1IGFH 3ZKXB 3GIVB 4K3HA 3KPNB 2E7CA 3KHOA 3QPQC 1KXQE 4LPTA 4P3DA 4JG9A 1CK0H 4M7LT 5IJBC 4PJGF 1I85A 1JTPA 3L3GB 2C3GA 5DJYA 4F2EA 3QS2A 3VD5A 2OYKA 3LRHA 4LLVA 3TM6A 4ENEC 2UVEA 2EDJA 3LKRB 3EO9H 4PJDF 1SJEA 4PRNA 3QDMB 4C83A 4ODUA 1R3LA 2R69A 5E5LA 2APTA 4UANA 1TNMA 3QFGA 4NGHL 1BJ8A 1XCTA 2KDYA 4X9BA 2J1XA 4PY7A 3AUWB 1RLBA 1TU2A 4HPOL 4CW1B 4YZFE 5DRXA 2X3BA 4Q6IA 4NB7A 1R17A 2YEQA 1Z66A 5HVHC 1U42A 4NHUA 2TRHA 3GUTB 4PRIA 1M6OB 1MJ8H 1U8NB 1UACL 3SPVB 3NGBB 5FWQA 4RSVA 4BJLA 1KBWA 3WEBA 1ZV5A 3GS4A 3QUYB 1JGVH 4OF6A 2VAAA 5FYJE 3EJSA 5JNYA 1UQSB 1PX3A 1OHZA 3LRGA 5IT2H 3BEVB 2NW2B 3MRHB 5CCGE 1E42A 4QXUL 4FG6D 2Q2LA 2RD0A 4MDJA 3LNDA 3MLZL 2RQEA 2RFXA 5E95B 1WUZA 3FRUA 4UT9H 3D09A 5JXEC 2R7EB 5CHNA 4AKPA 3FT2A 3MCKA 4OSUH 5JW4M 2BVYA 1WJ3A 4P23C 1WCQA 1CLVA 1T1XA 4XX1E 4ONOA 2RJMA 4GXVL 1WT5A 3L3DA 4AV5A 5I1CL 3DX1A 4M7KL 1GVIA 2ICWB 4KUZL 4YE4L 2OSWA 3NIGB 4QOKA 3EIFA 1MAKA 5C09A 3PPEA 3CHQA 4XVUD 3G5YA 2VDPL 2AABH 2BZ7A 5FLVA 5F9WB 3MACH 4MQSB 2ATPA 2A77L 2CXGA 3KR3L 5DS2A 1AJ7L 4UNIA 5IJDC 1I7RB 4AGOA 1OARH 4IU3B 4LARL 5ESQA 2BY2A 5BO1H 3HMXL 1IT9H 1PZ2A 1HZHL 1ZKAA 2QELA 2XQYA 3FFCD 5AALA 1FYTE 4P5TC 2GBUA 3HI5L 3T0DA 1KLFB 4X7TB 3RIAF 3FBQA 3S88H 4LDLB 5IB1A 2AV1A 2EDRA 3UO1L 5ESVA 3Q0HA 1O6TA 3GMNB 4LSQH 4KQ0A 1AXTL 1CLYL 2DLFL 1E8WA 1FSKB 5GS3A 5BS0A 3ECUA 4OAWB 3SN6N 3QXDB 3TO2A 1QFHA 5C8JB 4JAMA 2IH8A 4NHCH 1IM9D 2D9CA 1OGAE 1YYML 1UOLA 1PZSA 4L1SA 2L7QA 1EBAA 3MRCB 4OCYH 2EDQA 4JFQA 4L0ZA 3UABA 1MVUB 2WPGA 3N06B 3KPQA 1ZHBA 1W2KT 4JFFD 5DS1A 3RAJL 3ORJA 4DOHE 2AKRA 4YHKH 5HY9A 4J8RA 2GJ6A 4RDQG 1A4KB 2YQGA 4LFHG 1XCWA 1NGZB 2ITFA 2HN7A 3P0YH 3I3EA 4A2FA 1MREL 5DJ2A 5L2JB 5JMOC 3RFZA 4ZUWA 5D5MB 2XWRA 5JO5B 1G7LA 3L5JA 1UVQB 3LKNA 5K9QG 4ELMB 1KCRH 4WTQA 3STLA 3CVHH 4FQ2H 2EKJA 4JZOA 3GRBA 2F53A 4WWKC 5FDWB 3JQOB 4UQ2B 2HN7B 5E23A 3S4SB 3BJLA 1MJUL 1WICA 4FQIH 4KMQA 2VDKL 5DQJB 4AEIH 1CBVL 4BFOA 4X0NA 4HPOH 4L3ED 2LW3A 2Z31B 4EIZC 4YEEA 4C8XA 3BLKA 3GGWB 2F5BL 3R19A 3SD5A 2VSKB 4WY7L 2XWJB 4ZUVB 2EE6A 4W9JC 3COOA 1HHIA 3NBNA 3V9CA 1MFUA 1TTCA 3VG9C 2WXQA 4AIEA 5JHDE 4GH7B 3H42L 4WO4A 3N44B 4YNYA 3QIUD 4DPRA 5CJQL 4LQFL 2JB5H 2BSCA 1NMCB 3MV7E 4M4RA 3MRFA 1G4MA 3VTMA 3LN5A 1YEWA 2A9BA 2Y2WA 1MW1A 4LCWE 4NCC1 5E8DH 4FTVD 2C7FA 3SIKA 3EJRA 2WJ7A 3KLDA 1A7NH 4U0RB 2E8ZA 4K2UH 1D5RA 5J6HB 3KPPB 2WQAA 1XIWD 5C09E 1M9WA 1T1WA 1N10A 1T4KB 1NIEA 2EE0A 2ZG3A 4BFIA 4M5ZL 2ZWSA 3WLBB 3ZKNC 2D4DA 4X42A 3MRKA 5DMKB 1GGCL 2HT3C 5GGUA 2J4WL 5EN2B 4K7PL 1FE8H 2YLKA 3C8KB 4L29A 3I6GB 3WNMA 2WO3B 2OMXA 4N4YB 2FATH 4XVSH 4ICXA 2H2SC 3LHAA 2A74C 2GQHA 5D6CB 4AT6A 5ID1B 2MCPL 1ZS8A 3G6JB 3QAQA 1XD0A 2IXQA 4KRNA 2E9GA 1G7HA 5ALCH 1GZQA 1JYNA 5GZOC 3WHXA 5SX4I 2XJKA 5KG9A 4F80A 5JDSB 3LHPL 4KXCA 1WVZA 5C07A 2BWQA 2WMPB 1MWAL 5KVGE 1X5HA 4H8WH 2W5PA 3RVXD 4XHJC 3S34L 3QJFA 4PAZA 3WDJA 3GI9H 3JXAA 5IWLA 5EOQH 1WBZA 2VISA 1ADQL 1EANA 1SJXA 2AQPA 3FSVA 3GB7B 4KV5E 5ETUB 3VRJB 1AOZA 1VHPA 5E8OA 3MRIA 4LSVL 3DVGB 4Y19D 5I1LB 5EO9A 2QQLH 2D03H 3UX9B 3LRLA 2VERA 2F7QA 5BUGA 3EXJA 2EYRA 3UTZA 3MRDB 2E8YA 3ULUE 1NDGB 4N2MA 2Z3FA 3D69A 5H2BA 4PYGA 5CWSB 4MX7B 2C9RA 4OGXL 3B8YA 3KJ6H 4MHHI 4FERA 4POUB 5IROC 2VZ3A 1MPAH 1G5GA 3GSWA 3C60A 2AQRA 1KN4L 3KXFB 4YR6A 1OAKH 4HFWA 1PD1A 4JFDD 3DHJA 4ZUUB 4JE4B 3L6FA 3FB5B 5EU6D 3HG5A 3RY6A 3PABB 4YBQD 4C56D 1M05B 5BVPL 2ZUWA 1JYXA 1LO2H 1KGCE 4RISL 4BZYA 5BRPA 3BMVA 1QWHA 1A25A 3KXFA 4HIJB 1KSRA 2X1XR 1OALA 4HK3J 4AJ0A 2B4CL 3RI5F 2BOLA 4HC1H 1O9VA 2O5XL 3A23A 2WCSA 1RZQA 2HT2D 5HBBA 3ZYJA 2J2ZB 4NC1C 4P06A 3MRDA 4ODXA 5I1DB 2CBPA 4GP8B 3EBGA 3L3KB 3H0TB 4B5EA 3GSQB 5J9PA 2HXAA 2LFGA 2LFEA 3F7KA 4JN2B 5BUAA 1H0DA 2J57A 2LU4A 3QJFB 1PEZA 2DLEA 1T66C 3U9WA 2BWIA 4YHLH 2A4ZA 4A6YH 2AXGB 2YBRB 2WGNB 3L45A 4YAQA 2EE3A 2ICEA 2ZQKA 5E6IA 3AY4C 1BVZA 4KHXH 4XCFH 1A6VH 5DMKA 3ZO0A 4J4PC 1OTTD 4LLQA 4PJ9A 4N26A 2ZCKL 5CP3A 2OW6A 3FQUB 2DQ6A 1DEEA 1E43A 3ECBA 1DBBL 4CKVX 12E8H 4M7JL 5DJ6B 5L9DH 3WELA 1CVSC 3QCVH 3BEWB 1IGYB 1KEGL 2FO8A 2AK4A 2YAPA 1JZ8A 1U8IB 2VDNL 1JGLL 2NY0C 2W0LA 5IQMA 5HYSA 3GXMA 3N42F 3R1GH 4PJEA 4YS4A 3TIEB 1BOGB 4N9GB 3DPBA 2WXIA 3HNVL 3LS4H 3UZQB 4N87A 1KELL 4XZUB 3ATDA 3VXMA 2UWEA 2W59A 3VI4F 4XO4A 3DETD 5J06A 3L17A 1ROCA 1QG3A 2WB1A 3QO0B 2VRKA 2O6DA 4M4RB 4XMPH 4G1EB 1OGAD 1QACA 3HHRB 4HA1A 4PVNA 4QXTB 5DD0H 3IFOA 4YXKH 4TSAH 3D39A 5BVJA 4O2EB 1NC4A 2VLJD 2GY7B 1GJWA 3EGDB 2A4EA 3T6XA 3CN1A 4F7PB 1U3HB 3LPWA 3P0YL 4GKNB 4XBGB 5HPOA 1J1OH 3T2OA 4PJGA 5G2NA 4K3EL 4LP5A 3WYRA 4QRUA 2I60H 5JA8B 2X4UB 3CHSA 4JUTA 1RLWA 4R4BA 3K6DA 1F4HA 3B56A 1O0VA 1QRKA 4R26L 5F3BA 3C60D 3WAJA 1QKZH 3IXAA 1HHKA 1T22B 3LY6A 5HGAB 4X9GA 2JVUA 1U91A 3CE1A 2F53B 2W9DL 3IGUA 3B7YA 4GMSL 4L4VD 4XCFL 3BFOA 1OAYH 1S7WA 4TM9A 4HJTA 1ZLUH 3O9WC 1U8HB 4AQ8C 4PJBF 4Q6IC 1Z32X 3RUGE 3VXRE 3ZKND 3CFQA 4U31A 5HDBE 2EKSA 4AK2A 1HXYB 1CXEA 2NY5C 1I8MB 3UP6A 1ANUA 3NJGA 1G9MC 2X4UA 1KLFA 4X7TA 1LDSA 4KK8D 4LSSH 1X6LA 3TO2B 5EIIG 5C0RL 1A21A 5F7DA 3ESOA 5E2TH 3MJ8B 3C2AL 1FRGH 3CV5A 5FDYA 3GMNA 1XIWB 2X6MA 5JZ7D 2Y07L 3ROOB 4XE5B 3TZVA 4UBDD 3ZHNA 1QZNA 1BJMA 4G9FB 1HCVA 5E9NA 4JKKA 1SM3L 4TSCL 1Y18B 3MLWH 2VR9A 4K55A 3BZ5A 5C0NC 2D73A 5LGHL 1FL5B 5TF0A 3ZDYF 3P69A 4G8IA 5E4EC 5B1BB 3GQFA 1IGTB 3U30C 2BNQD 2G9KA 1BMZA 1CLYH 4FFZA 2UZXA 3WFDL 5IR1A 3RFRA 1F97A 4KDVA 1AVAA 4AJVA 1RFDL 2IQ9L 3VG0H 3NCFB 2O6PA 4Z77A 4NENB 4LVEA 3MAWA 3QUMB 3UBGA 3DX8A 1BVNP 4OCXL 3ZT6A 1FPTH 3IDUA 4DQAA 2DF3A 1P7BA 4M02A 2DRUA 2VITB 4DP6X 1QFWM 1HEJC 3MOBH 1QSFA 3BH8A 3FU7B 3HE6D 4UUJA 4WLCA 4AH2A 5ACZA 1UQSA 3ZPDA 1KLGB 2ICEB 4LASL 5E6IB 5IQ7L 4U33A 2V2TB 1LNUA 4U1JB 4CRPA 2V7HB 4YE0A 2CDEB 2CJUH 3ARBA 4RFEB 3UTSB 4F33A 3ZDZF 1OAQH 1A9BA 4LCCB 4R8WH 3PQYD 4M6OL 1WBXA 1U8JA 3U6RB 2CAKA 2OMVA 2RCSH 2OI9B 2VAAB 4F7CA 5GGSA 3I9AA 1E27B 5AAWA 3PWUB 3FBKA 4R4NC 3T6VA 4IRJB 3INUH 3BSZL 4ODUB 1FNSL 4MAYB 1OB0A 1LP9F 1U0QA 4JM2A 3WTTA 1C1EH 5C6TH 5T5NF 4QNPF 4WRLA 4PJAF 4QR7A 1MHPL 3P3UA 4PLKD 4LIQL 3T3ME 2W80C 1A8ZA 4W9LC 1TTUA 1NIBA 3D2UA 2P5WD 4LCVA 2A9DA 3PU7A 1KJMA 1EMTL 1YEKH 1GYUA 2AVFA 2O5ZH 1CGUA 5FYKD 3T9WA 3TO4B 2AQ2A 3GIZL 4I18C 2ZSVA 3UYPB 4K71B 4KZEH 5C9KA 3WKYA 2P8LB 1J5CA 2JKIS 3ZL2A 3ATAA 2J88H 2X41A 3MROA 2DMHA 2H6PA 4GRMB 5DRXB 1P4BH 2DQIH 4GKZA 3QT2A 4CSTA 3RWDA 5KSUA 2QKIB 3B2MA 3RKDC 4L1HA 3AW5A 1EPFA 4P57A 4R96A 5D7KE 4WHTA 3C5JA 3K5SA 3TJEL 5CFHA 3TT3L 3MLYH 5A43C 4JO2L 5JDJA 3SDXE 1UCBL 1SN2A 2XXGA 2X4RA 4PRAA 3FO2A 2FBRA 1CF1A 3CFIC 4PJ5E 4G80B 1NAMB 4HSCX 1OGTA 4ONHA 2WXJA 3VD3A 2ESVA 3S3BB 2B59A 4F92B 5B1KA 3PDDA 2G9HA 5EU3B 1RZ7H 3TCLA 2VLRA 4QWWD 5CGTA 4B9YA 4MQXD 5B38A 5KS9A 3SE9L 1OL0A 3O2WL 1HSBA 1TJIL 3LB6D 3EYOB 5E8OB 2HRLA 4BK4A 2WKOA 3GBDA 4A68A 2Y6TE 2XZAL 3TX4A 4LHUA 1XTLA 4HIEB 4I7ZC 4WW2F 4N0UE 4URTB 4H1LB 3LKOA 1CE6B 1JD7A 3BSGA 1YYCA 4OZ4B 2ZYIA 3O3UN 3SKNB 1YPZA 3TJHC 4DFIA 3ABLB 5TE6L 3AXLB 3P02A 3V5HA 1EFXA 1F41A 4F37K 4G6FD 4Y5YC 4LLUB 3J07A 5LAXB 3HW7A 1LNUB 4PD4K 5AW1B 2WBXA 4G7QB 2FQGA 3RWHA 1KEGH 3WL9B 1HI6B 1OY3B 2JJWA 3I6LD 4MBOA 3EDDA 4JN1H 3LKPB 2IDQA 3QUYD 4ZX4A 1U8JB 3NACH 2R51A 3HC4L 4PR5B 4RAHA 4AQ1A 1D7CA 3MV7A 5CO1A 1TLKA 2R4SL 5J57B 1RZIB 2G30A 3VFRB 1NGQH 1YY9C 4M6NH 5MEQB 4W4OC 3IPBA 3KM1A 3QDJE 3FQ2A 2J8UF 3D39E 2R23A 2Y4SA 1XXDC 3BAXA 1BZEA 3FF7A 4IMKC 4LSUL 2NY1B 3R0NA 1AQHA 1IGML 4WI9A 1QBMH 1R3KA 1MCPL 2IPKB 1DBJH 1XR9B 4OIIH 4R8WL 4Q4IA 1B4JL 2BMKB 3DUSA 5IG7A 1V3JA 4WJG3 4G5AA 2H0EA 5HHME 3E1ZA 2WZAA 4FHKA 1AGEB 4N8CH 4UQCA 2NY3C 4XMLH 1TZIA 1NTDA 2ENYA 1M71A 1JZ7A 1JSYA 1TZAA 3IE4A 1IGTA 2XBDA 1IKFL 5I8KH 1QRND 2X4SA 4L05A 5E2JA 1BFOB 2NY3B 3ASWA 1SXCA 4LSVH 5BW7C 4Y4KB 1P6WA 4FL4B 1G9MH 4QHKI 3DX6A 3MUZ1 2UY7B 3P40A 4IHOB 3VXNB 3THMH 3D50A 4X80L 2QSQA 5D7JC 4A55A 1WAEA 4G6AD 3U7YH 2CD0A 1JNLH 4GSQA 5HP5A 1FBIL 5MEPB 2X0WA 1OP3K 2ARJQ 1TR7A 2GBVA 4LSRL 1T1ZB 1S9XB 4DP8X 4YH6A 4WFGE 3RTQA 4JB9H 5F0LB 4BH7B 2CUHA 8CGTA 2AGJH 1DZ0A 4PJIE 1XVSA 5C0GB 4JG1H 3K72A 4JREB 1TQSA 3BD4A 1G6RH 3CIAA 5EA0H 3ZE2E 2HFFA 4OJDH 4LSSL 5F93C 5KOMC 3MBWB 3O6LL 3W5MA 1NBVL 3GHBH 5AVVB 3QDJD 2X87A 2Z31C 4JX0A 5EF2A 1T2QH 1PCXA 4PWJA 4XNDA 1G6VK 1ET8A 2H32B 3ARSA 1HE8A 5K93A 4BFFA 4YDZA 3FN0H 2XTLA 4OCRH 4KH2A 5DJDA 1BLNA 1J05B 1XCQB 4E5XG 5C8JA 2AW2A 4MXVF 4D0BA 1H3PH 4BK5C 4MKTA 4LT7A 2P26A 5DA4A 4AQEA 3VYNA 2ZKHH 2JF1A 3OV6A 1S9XA 3UPAA 3O8XA 5ILTH 2IAMC 4JQXC 1G1CA 3P4OB 3QIBD 3QXUA 4HGKC 5F6IB 5FUOH 1JVKA 4N1EA 3BUIA 1E7UA 4K15A 4XPTH 4W9GC 4WI8A 2X53A 2OXHB 3VFVB 1PAZA 3RWJB 1CB4A 5FAAA 2IAMB 4I8DA 4XBGA 4XVTH 5C86A 3VD0A 5H4YA 5F7NC 4GQ9H 4DGIH 1NSNL 2HT4C 2WBWB 1ZA3A 4UDUA 4WI0B 3DX7A 4CAGA 4ETQA 4HCFA 1MCLA 4G6JH 5IFAH 3WTWA 2YKKA 3CVIL 2D0FA 4ZMYA 5IMLA 1R3JA 3B83A 4XNMB 5CSGA 1QYGL 4XPGH 3V4UL 5IMOA 1DQML 2G75A 1YJDC 1MJJB 1U33A 2K9UA 3L3OC 2XWCA 3CSYB 4P2RB 4TV3A 2XV6B 1G4RA 4MMXB 4WSGA 3NIGE 5CEZD 1TOXA 3DOIA 1S2EA 2MEJB 1MWAB 4M62H 4NKQB 1EEYB 3B9KC 1X5LA 3CDGB 4JFWA 2CJ3A 2GEEA 4A6YB 1KIPA 1OP5H 2L4OA 4M8UA 1QQDB 3P73A 3A24A 4KXZI 3CSFA 3N43F 2GJPA 3LD8C 3QA3A 5B39G 4PJ5B 5D1ZI 4EZMA 4PLOB 4JHAH 2HT4D 4LLAA 1UWXH 1DBKH 4LVHB 3WSQH 3NRFA 3FOLA 3JT0A 4I2XE 5T3XD 5KVEH 1CF8H 2ZJSL 4MSWB 3PL6D 5DJ0A 4JGUA 4PJDA 1DEEB 1YMMB 4TMPA 1RJZA 3TCXA 2FLRT 2OSXA 4LKCB 4E5XA 5L6YL 4Z0BL 3AQYA 1JGDB 4Z3IA 1ZT4A 1I7ZA 2OLDA 3WBDA 3CK0H 1T6VN 5TK4A 2F8XC 5CR1A 3MGAA 1RK0B 3SGKC 4OF5A 4WFHD 1BD2B 3K6NA 4NYLB 3CU1A 4CW1A 1CU4H 1PY9A 1VPOH 4Y4HA 3EJQA 3UJTH 4KVCH 4YVNA 1F86A 5A2BA 4Z3FA 4ZFOA 1DQLH 4NBXB 3LKSA 3P54A 2X40A 3KL5A 5JMRA 1XH3B 5J13B 1BBJA 3EZ8A 5C08D 3CFCL 3LQAH 5L0QC 4WHYG 4GUCA 5IBTL 1GYAA 4N28A 2IFFL 4JN2A 3SGDH 4IU2B 3BZDA 2VW6A 4M3HA 1FQ9C 1JGEA 5I66A 4IOFD 3V0GA 1GOFA 2A5UA 3TTYA 5GGVL 3L3KA 2Z35A 3JYCA 1R5VB 3OQRA 4PJ8C 1IBFA 2W9LA 3LJ3A 5DR5L 1CTMA 2ZOKB 4K3DH 1T89A 5DJZB 3LN4A 4NBYB 5BNXD 3PV7A 5JIDA 4Y9CA 1CR9H 3CCHA 9CGTA 1NQBA 5ETUA 2QQKL 3SEPA 3OLIA 4PMEA 3S3CB 4PWIA 3ULSA 2X6BA 3VQLA 4JHUA 5JOEA 2Y7LA 2NYKA 3C60B 5F7EH 2ZKWA 3OMAB 5GS1C 1PLCA 3QHFH 4NKOA 1HE7A 4JN1L 4RMWA 1OOAA 3SKUD 3PABA 3E6FB 4I87A 2ZT9C 4MZ2A 3QWRA 1GKOA 3PV6B 2WLZA 5E00B 3U9UA 1U3HD 3F7QA 4CU7A 3KBFA 4UV7H 3P4NA 1FV1B 3US9A 1DVUA 2FEJA 4WVRA 3IDXH 5C07B 3QRBA 1MFAH 1I7ZB 2GJ6E 1WDAA 4L2LA 5I66B 4KUZH 2DWSA 3O6KL 5GS0D 1JGLH 4N8VB 4MX7A 2BP5M 4PTUB 2ZUYA 3OD3A 4XAKE 4YSEA 2EDEA 4MSWA 4MD0A 3V9EA 3QFJB 5I6PA 3NOIA 1IEAB 1WBYA 2B08A 3DSFH 3HZYA 4GI6A 4EUPB 1QLEH 3AXIA 4OZIE 1X3DA 1S5IH 1BW8A 4G59C 1NBZA 1J8HE 3P0VL 4YSAA 4FQXA 2Z4TA 5DEFA 1GY2A 1ZLDA 3RWEA 4DFHA 1BFSA 4WU7B 2QHRL 3BH4A 4OV5A 3QFDA 1BPVA 1U58A 3LNHA 3ME0B 4IS6B 3VGFA 2DQCL 4GFTB 1D6EB 4OVUA 5GS0C 1YN6A 4HGMA 5I19L 3I6KB 5DD6A 3G5XA 4HKJB 1ZLVK 2AANA 4MMXA 1E2ZA 1JGDA 2J5WA 2XBTA 3IT8D 4UQEA 2ZUXA 4M3JA 5A3IC 5T1DH 2A74B 1C5CL 4OFKA 3V0DA 3B9DA 1DFBH 4B9JA 1I8AA 1I8KB 3IWUA 2NNAA 3QUMA 4KH9A 4L1LA 1HQ4A 1ND0B 2ARWA 3QUKA 2OYPA 1YMME 5LCVA 1PNCA 3EYQD 5H37A 3RVUC 4GKSA 3W39A 4AQ8A 3WAKA 4QF1A 1KN2H 5CXPA 5J12C 3O8XC 4FQJH 4ZMLA 4FRWA 1RERA 2J44A 3C6EA 3QDGA 3MV01 4ATWA 4GRLD 2CJSA 2R56L 2YMXH 2ZPKL 3GSNL 5HI4C 2PN5A 4LAQL 1HILB 4HS6B 3X11B 3IEAA 3SE4A 5HHNB 4WGKA 2MNUA 4B27A 1UXWA 5HYJA 3BOVA 2I7OA 1XGRB 1FGNH 2Y36H 5CBEA 4HWBA 1T5KA 4BIKA 3L4VA 3QQDA 4N2IA 4YK4B 2O61B 4YUEH 3N1GC 6CGTA 2ZWLT 3PG2A 4NWTL 2IOMA 1JTTA 3O4OC 5JQ6H 4HGWA 3MJ9A 2CBMA 4AE0A 5FXCH 4ZXBD 1N0LB 5E8NA 1OAZH 3VB9A 1HXYA 5FUCC 2NYYC 2WQVA 2IWFA 4HCIA 2J12B 4OUUB 4Z78A 4NC2B 3RTQC 1I8LC 3L2MA 4W93A 1NAKL 3IBOA 2H3NB 1CLZH 4D0BB 4HC1L 5IHUH 3WIIH 3G5ZA 1AGFB 1PFOA 5PAZA 3A6CL 4KU1A 5EU6B 4W9FC 4DO4A 3BAIA 4OGQC 4X6BA 1BFVH 1M6UA 4NNPH 3VFPB 1QI5A 1GHFH 1ZWIB 2QQKH 2VSDA 5HGAA 4F9LA 2NLJA 4OJFL 1ETA1 4MB1A 4H8WL 4KNSA 4G9DA 1IT9L 3DDGA 5EIQA 4EZKA 1IMHC 4YGVB 3QORA 4GXFA 2HX8A 1SOXA 2IF7A 1PAMA 2BP8B 1N67A 2Z8RA 4HJIA 2Q86B 2YAMA 4XOBA 3HBPA 1OGSA 2E46A 2DTML 1C16A 1TTBA 3FO1A 3PNRB 3ZT7A 5BMFL 1D3CA 4MXQC 4M00A 4L2YA 3PL6C 1XH0A 3BFQG 1BHGA 3RA7L 3RX8A 3SDDB 3UP1A 1O9WA 1JOIA 3DRQA 2QBWA 4F7PA 5I0XA 1CYXA 1NCJA 4MWFA 5KBDA 1E40A 1I1AD 4UNUA 5J3HC 5C0GA 1YYMH 4K7PH 1BXVA 2WLKA 2YUZA 3UACA 2ICEC 5E6IC 3PL6B 2EUWA 2FLMA 1M56B 1YEFH 3DVNA 1XGRA 3LB6C 4D94A 4OQTA 2F54B 2EDLA 3QFJE 5I71C 3G04A 3MLRL 3LTVA 3VXRA 4EN3A 4LB8A 1R0AH 1S4IA 4WFGD 4CVZB 2V17L 4YSPA 1AR1B 4HJGA 3FRUB 2X1QA 3OX8B 2E9IA 2ETWA 3JYBA 2OL3B 3ZTJG 2NQ3A 2NY2B 3JT2A 4MS6A 5I8EB 5T3XL 3O3BB 4BQ8A 5IEKA 3S88L 3OKDB 3HBZA 4HH9A 2X4OA 5F3HA 2Y3NA 1L0XA 5F9OH 2GTWA 4XVJH 5DO2D 4JRYA 4M29A 4WWKA 1J8SA 4FP8H 5EFIB 3F83A 3CXHK 3DOSB 4PSRA 5EEVA 4QRRA 3FFDB 3K74B 2OQJA 3QUZC 2IJ0C 7TAAA 3OGOE 4NZRL 2JFCA 4IJ3B 1CC3A 3H9SB 3RGHA 5TFSH 3BZEA 2VQ1A 4AQ1B 3EFOA 3N85H 1HH9B 3NA4A 3N91A 3O2DH 2J1WA 2E7MA 3QIBB 4DEWA 5I6KA 3TNMA 3WTXA 3UTQB 3MRGB 3IU4H 3VXMD 3MRRA 5FFGA 5I1HL 5EBWB 5JOPD 3BVNB 4OZFH 3BUBA 5D2NE 1D9KA 1LYQA 2FD6H 4NUPA 1UD5A 1NDMB 2HKFL 4Y5VB 3SBWA 4DP2X 3EYOA 2E3VA 3VXQB 4BCZA 3UAJA 3AXLA 1V7ML 5I1KH 3G9VA 4IOIB 5FO9A 1F4WH 2M26A 3G08B 5CJOH 1LE9B 2B59B 4PJEE 3LN4B 1U95B 2Y5TB 3GLZA 3H3PL 1AOHA 2OZ4L 3MOQA 3RB5A 2VDMH 2BNRB 4HXBH 4M1GL 4OM0H 4BA0A 5C0DA 5IJCC 4C47A 1QFWH 2XN9D 1BSIA 2XKNA 2BIOA 5D2NC 2J3SA 5CSZB 1PY0A 4OTXL 4NQSA 3ZDXB 4LKXB 4A63A 6FABL 1RKRA 5K1NA 3BDYH 2XFXA 5JHLL 1D5IH 3GIZH 1PYWA 5FYJU 1INEH 4WHTB 1OPOA 4I1RA 5ILTL 1N0XH 2CO6A 4YSOA 1SFDA 1D9KC 2Q7NA 4LASH 3MZTA 4KRPC 4BWUA 1XGPA 4Y4FB 5I8OL 2BM3A 2R29H 6TAAA 3GIVA 5GZOA 5KSAD 3VMOA 3OXSB 4DWHA 1WV7T 1LK3L 1ZANH 2GPZA 4FFYL 5A3ID 4XPAL 1IO4C 1EDHA 1G9HA 4L4VA 1K8DB 3BSZH 3NIGF 3QE5A 1AZVA 4E0RA 1NANH 3CNKA 1XIWC 3QUXA 1PNDA 2W9EH 3D52A 5C0BE 3QUZA 5IHBA 2W60A 1YUHB 4EPSA 3FB6B 1JGUH 4KK6D 3GMQA 2QSVA 2KZKA 4IGBB 4HKXA 1GAFL 1ILSA 2NY3D 3GF8A 1AKJD 3BVVA 2KPWA 4M6ML 4AENA 5I6NA 3ABZA 3SYQA 3QEGL 4X7EC 5J1AA 3GHEL 4ALAL 5D2LE 3UYPA 1UATA 3QIUC 1YN7B 1B0GB 2JELL 3KEDA 3NPZB 4G42B 1WA2X 3K46A 4WW1B 5FO7B 4X6FB 2FT8A 5IQ7H 1GGUA 4RESB 4DKEL 4Z76A 4MFHA 3CZNA 5DJAB 1KJ2B 4B9IA 5HDRA 3OKKA 1T20A 5AL0A 4PJDE 1CS6A 4N0FA 2J1ZA 4WI4A 5J1AB 5SWQB 3LV3A 4U1GB 3VM5A 5LN8A 4UQ3B 4BINA 4OGAD 1O7VA 3GM8A 4GSUA 5MHSD 1A7OH 1D6VL 1IAKB 3DOHA 4ELME 5D1ZB 4DGVH 5IJKA 4WK4B 1K8DA 1W0YT 1IC4H 4PJBA 5T33L 4JGJA 3C87A 5IMOB 3Q5YA 4P9HH 4QJ4B 3WN5A 3GXDA 2RMNA 1Q9LA 1T5XB 1N0XL 2L3BA 2WUBL 2XWDA 3Q5TA 1RPUA 3W38A 4BSJA 4BELD 4DHLA 3N1MC 2O5XH 3BZFA 3QEHB 2YBGA 1ZIBA 5IQ9A 2QFRA 3EJPA 1SEQL 3QGVA 1EGJA 3RP1A 3RZCB 1K5WA 3S36H 3QJZA 1FORL 2WKOF 1MRCL 5EUOA 3ROOA 3OR6B 2CZNA 5KVDH 2FWOA 1V3MA 1TG8A 1LWRA 1SOSA 4PJ8A 2JLPA 2IPUK 3IJSA 4TNGA 5E1AA 5HGHB 2FX7L 5F72S 4XCYB 4M61B 4NNYA 3GSVA 4OZFG 4MDRA 1OXYA 3CFJB 4NQVB 4UDUB 2WXNA 4TNWK 4WI0A 4MTMA 3TPKA 5E9DD 4H26B 1XGYH 4YDMA 1S7SB 4RZKA 1JP5A 3CG8A 1MEXH 3WFZA 3AITA 3H2QA 3GBNH 1J8HD 1E4XI 1JNHB 1OLLA 2WKLA 2X70A 2XETA 3AROA 3IF1B 4HDIA 3U0WH 4QAWA 3QEUA 3E9TA 4YHOL 1ILUA 2QMJA 4GPVA 4ORGB 5DUPL 5GRXG 3EF4A 1QFWL 1TMQA 2OV0A 1IGCL 4ADJA 2Q10A 4IBTA 4RMTA 1INQA 5DZOA 5FUOL 5A6MA 1KCKA 1PSKL 2I7SA 1H3GA 4M8VA 2JK5A 5IVXB 1WSST 1T1ZA 5JW5B 1GS7A 1E4WL 4N0UB 2EABA 4K3GA 4KTEH 2AV1B 3QCUH 4MCMA 4TQPA 2Q6WB 3GRWH 5D1XB 1TTGA