1GYWA

Gamma-adaptin appendage domain from clathrin adaptor ap1 a753d mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
126
structure length
126
Chain Sequence
b'FNDIAPGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQADVPKTFQLQLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA 1 SUBUNIT
publication title Gamma-adaptin appendage domain: structure and binding site for Eps15 and gamma-synergin.
pubmed rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 24
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1gywA00
1NA8A 4BCXA 1KYUA 1OM9A 1B9KA 1GYVA 2DWYA 2YMTA 5CN2A 3MNMA 1KY6A 1KY7A 1GYWA 1IU1A 3HS8A 1GYUA 1W80A 3ZHFA 1P4UA 1KYFA 3ZY7A 2VJ0A 2E9GA 2DWXA 2A7BA 1QTPA 1KYDA 5CN1A 1QTSA
chains in the Genus database with same CATH superfamily
4NRXA 1JTPA 3S6CA 3WKPA 4Q6KA 2X2HA 4OT1H 3VG0H 4IDJL 3N9GL 2G9KA 3ZHDA 4N1HB 4LKXB 4HCRL 3TYFA 5TDPB 1NDMA 2KDGA 1BV8A 2FD6L 4L1BA 3HC4L 3V7AE 1YYMH 1SXNA 5KYYB 4NQCE 3NYKA 2AI0H 1WGOA 3PHOB 2K6YA 2DWXA 1G1KA 4ZW6A 2R1XA 4FLOA 3APMA 3IJ7A 4JE0A 4TNEA 4ZQKB 4C54A 5ICUA 2F8VA 3DDFA 3F85A 4HC1H 4GG6E 5FF6B 1AYOA 3S8GB 1V5JA 2GHZA 3ZRSA 2DV6A 1IGJA 1PZ3A 3WFZA 4C8XA 3HNSH 3B1UA 1E65A 2XPGA 3WUWG 5EU4A 4YS4A 1AD9A 1RPKA 5KVMC 2VDQB 3BEVA 5HDBF 2YLHA 1D6EB 1S7QA 2ZKHL 1DBKL 3BZFB 4G3YH 4F8TA 4FQXA 4OZIE 1BYPA 3DGCR 3AGVA 4N6RB 5DWPA 1IC5L 2X88A 3QQ4B 1G5AA 3A47A 3MRCB 2VLJD 4FQCH 4NI6A 4XMZA 2WWMC 5EU4B 1AD9B 3P30H 3HRPA 2IH1A 5FW6A 2YBGA 2BNRB 1QR4A 1HI6B 1RZKC 2ERJB 3FONB 4W4NA 5B4MD 3LKNB 2CUHA 1BBDH 5EA0H 3ZGIA 5IJDC 1EA9C 4RISH 1QR1A 1GAFH 2H4EA 2Y6TE 1CTNA 3GMLB 1CPUA 2DBJA 5B39B 4X98A 2VC2B 1PCSA 5EF0A 2ARJB 1RUQH 4I9WE 1NBYB 3RNQB 2AABL 4BZ2L 2YPLE 4YZFE 3FQXB 3JTTA 1V7NH 2VQ1B 2O5YH 2VWEE 4JVPA 5DS2A 2XHNA 3N55A 5GGVH 1PMYA 3CZUB 1NCUA 4MMZA 4ONFH 2PP8A 1KENL 4CUCA 3ULVL 3BUBA 3IDMB 3PWPA 1SMDA 5HI5C 3EBAA 1ZCRA 1NOLA 2Q9OA 5J7CC 4ZFFA 5KVEE 2A83B 5F7NC 2EVIA 4LGSB 1B4RA 4U33A 3HMXA 4TUUA 3LIZL 2CDFB 3MOBH 4ZFOA 3H9SD 3QFJB 4J8RB 3FT4B 3PWPB 5ISZA 5T1MB 4IJ3C 1FZMA 1S9YA 3ARGC 5EZOL 5C3IA 4ZFFB 3IMSA 4E0RB 2NX5A 4I8DA 4O2CB 3L5WB 1L4IA 5C0FB 1MDAA 5I1CL 3IXAA 4ZFOB 3MJ9H 4A39A 1FO0H 4LQFL 3FQWB 4AK2A 4U05A 3X13A 1FZMB 1AAJA 1NBQA 5I1IL 2BNQB 2AZAA 2IQ9L 3I85A 5E1AB 2BC4A 4EI5B 3SGEI 3F12A 1DQMH 2HJKA 3IS0X 3TO4B 3KJ4B 4FKKA 3R8BB 2K7PA 3L9EA 3GHBH 4F24A 5F1IB 4LFHG 1RZIB 2XWDA 2P24A 5FUZH 1E8YA 2J6WA 3WBDA 4MD5B 4BWWA 5EZPA 2HJKB 3RPIA 4JPKH 4BA8A 3SKUD 5DUML 4KH9A 5AENA 3ZKXC 1LO2L 2NSQA 3JWDL 2EE9A 3WMPA 3GD1C 1X7SA 1WHPA 1XR9B 4DVRH 1URZA 3BO8A 4BFNA 4FI6A 2X9WA 5HYQA 1JHLH 1IGFH 2A0LD 3IDIA 1TU2B 3DRQB 2CSPA 4FTDA 2H0FA 2Y07H 3W56A 1DJZA 3N40P 4MRCA 1E0OB 3C60B 5EO1A 5KSUB 1DQTA 1M53A 4M7ZB 1TMQA 3CPUA 3PFQA 2WXKA 4OZHA 5MEOA 1M7IA 3PHQB 5J3HD 4PRHE 1N5AA 4PREB 4NO5B 1XSOA 1J9CT 4ZAKC 5DJCB 5BW7C 4M5SA 3VFNA 2GJZA 5K33A 1UKTA 1GGTA 4FOMA 1BCIA 1YEWA 4KROC 4BE6A 1L7IL 1N5AB 2K1MA 2WWOA 1S7XA 4JFQA 3DBXB 3UTTE 2HTKC 4PJHE 2OMTB 4MMYA 2QPEB 1EZVY 2DLFL 5GPRA 3VFNB 4JKLA 1N0XL 3ZE0E 5HYFA 4PRNA 1NUNB 2Y2TA 5EDSA 1VIWA 1EMTL 4XCFL 5DZAA 2Z93A 2ED6A 2DYRB 4A7SA 2GK0A 4JFQB 3BT2L 4OCRH 3N50A 3U48A 1PF3A 2BMKB 3PWJA 4MMYB 1TR7A 5CGYC 1TKWB 3RAJL 4QLRA 4EOWH 3MACL 1F0LA 3GSVB 4DEWA 6FABH 2EYTA 3D3VB 1SPDA 1U58B 3C12A 1CT8B 3US1A 4JO8A 2GK0B 1DQIA 2LU5A 3QVAA 3EYSH 1FP5A 1SN5A 3FQUA 3LV3B 2DY2A 3PWJB 4HF5L 1O5DT 2E9IA 3DTUB 5KVFE 3NVQA 5LGJB 1DQJB 2FHBA 3S5LG 1KGIA 2EYTB 4Y5YB 4A2FA 3L4WA 4NPKA 5A2AA 4X5RA 2IPUG 2UX7A 3ZE1E 4LHUA 2HAZA 4LRNL 3UZEA 2V2TB 2WWMD 5FXCH 1AZVA 4PLOB 1OXYA 1UH3A 2VR7A 3BH4A 4F57H 2DIBA 1JE6A 3ETBF 3H9YA 1IE4A 2ZOUA 1U93A 2YOAA 2IAMC 1EK3A 4UU9B 1UJ3C 1ZRUA 3NIFB 3GI9L 4EO5A 3ZDXB 2DH2A 4MJ5B 3LRLA 4KV5F 4DGYH 1M42A 1AHMA 2D4FA 2DQHL 3H42L 2GSMB 3VXPA 2NY1B 3CHOA 3T65B 2XQYG 1JV2B 5CD5C 2ZCHH 3PNWA 1A1OA 3AT8A 2EDTA 1KWKA 1MEXL 2YRPA 5ITFA 1CU4H 2QKIB 1LMIA 1QYGL 2ZTBA 3DX6A 3I75A 1PZUB 2H2PC 1JNNL 4LARL 3LKPB 3UADA 4PR5A 5TD4A 4GUOA 2EIKB 5GRZA 3EBGA 1PKQB 5HDBE 5HSFA 2XTLA 3QJHB 3CTTA 1EERB 3PV6B 4UCFA 3REVB 2QV4A 2BSCA 1A1OB 2K7QA 4JKPL 4N3TA 5GJSL 5BXFB 5HI5D 1HSBA 3BW9A 4HUXA 4PCSA 5ITFB 5KUMA 3KR3L 3KLSA 2BVPB 3I75B 1TEFA 1GPOL 4R96B 3ML9A 2OW7A 5AVSB 4O02H 5M95B 4N8CH 1WICA 3CDGB 2X70A 1H6EA 3WFEH 1NAKH 4GW4A 1DBBL 3ARGD 4HUXB 3IF1A 5CD3B 4QTIH 4F8QA 2GEQA 3KVQA 2FJGA 1U33A 1PAZA 3IDNB 2ZYIA 4LCCA 3U1PA 1U8QA 2VLRA 4PS7A 4AYSA 1N59B 3P9WB 3PDOA 5IOKA 3TWCH 1Y18B 5FYJU 2X70B 5F7EL 2ZXBA 3CSTA 3KPRA 1BIHA 3ABGA 4OZGB 4QHNB 1FH2A 2WXOA 2PCYA 3FFCE 3GKWH 3MYJB 4YXKL 3RPBA 3TA3B 5LN8A 4LCCB 3L2NA 3GMQB 1ZEAH 2O93L 2EABA 2QPDB 1G5GA 3C09C 3SDCB 4BDVA 4F9PA 3L3HB 3L3GB 1CD1B 4KI1A 4NOFA 2E75C 3ZHNA 1OE2A 2BSTB 3SGJC 4A7GA 3VD7A 1KWGA 3Q5YA 2BW5A 3DUUA 4PJXA 1W8EA 2X41A 1EEYA 2J1ZA 3EBHA 1EJ8A 4MJ6A 3B9AA 3FHAA 1RD6A 4TL4A 2YMTA 4BDVB 5EOQL 2EQDA 4FQ1L 2O6EA 4NCC2 3RX5A 3VG9B 1VA9A 3CFNA 3DMMA 3G6DL 3V0GA 2B8OT 4P59H 1XR8A 2Y7OA 2ICEA 5L2KA 1CR9H 1UURA 4PJXB 4Z7WF 2XSKA 5F2FA 4KBPA 2WQXA 4MJ6B 3B7UX 3EXLA 1F58H 4WI4A 1TVBA 1Y07A 4NUGH 4X99A 2OJEA 4L1LA 2B2XH 1VEPA 4RMSA 4HJTA 5BVJB 2VNCA 2DD8L 4D8PB 3ECQA 1Q8MA 3EO9H 3VD0A 3HB3B 4XXCA 3S35H 4WHDA 4F2MA 3S37X 3NGBB 1TITA 4G8GD 5EOTA 3CN0A 1RPQA 4QRFA 3FU6A 2FB4H 3H9SE 2WLJA 4FXGB 3S8WA 4JRXA 1A4BA 4ZAKD 5C9JA 1CB4A 4NM4H 1BAFH 5DLMH 2CIIA 4GQPH 3CZFA 1E30A 5I17A 2XFXB 2Z0BA 4OKDA 4F2MB 5JZ7C 4HWEH 3FN3A 3MLSL 5EOTB 4KROD 2P49B 4LLAA 5JORA 4N2MA 2CO6A 1A3RH 2KZKA 5B7EA 4XMLH 2VJXA 1Q1PA 3UO8B 4AEIH 4YFDB 5E99H 5C9JB 5KVGL 2HTKD 1KJMA 4E5XA 1F4XH 2CIIB 5I17B 1IIIA 1SHXA 3NABL 4FX5A 1IGTA 2JCCF 3H55A 5EBMA 4AGNA 3ZZLA 4QCIB 3LQZA 3S34L 5JORB 4LSUL 4R7XA 1C5DA 1RZKL 1H6TA 4JHUA 4GJTB 4U1JB 4IBWA 4FZEL 1KJMB 2NT1A 4YBQC 1KCUH 5CGYD 4P3DA 2W0FB 4BZYA 2G4EA 3SKNB 5I19H 1J0HA 4FFYL 3TO2B 4ZSOA 2GSIA 5K1JA 4Y0GA 1SQ2N 4XVOA 3IDXL 1Q0YL 4FXKA 4H25A 5B1KA 2ZX7A 5FO2A 2AXWA 3W2DH 3VWJC 1C5DB 4FA8A 3H7LA 3U30B 5EZLA 1A9VA 5GGVY 3M07A 2IDFA 3MCKB 2FBJL 4MQSB 4P3DB 5CJQH 5HDLA 5IMOA 2A9DA 1ZVYA 3B5TA 1E5AA 2IDSA 4ZSOB 4N2FA 4AEHH 5IMKA 3IFOB 2GBTA 4FXKB 4F3FB 1KZYA 3ZKQD 4X7TB 1ES0A 1JBJA 5H37G 5HGGS 5EZLB 2CK0H 4CBPA 5GSRB 1U9KA 2VRKA 1MCFA 2Y4SA 4JDTL 3FCBA 2R2BA 5FCUL 3W0WB 5GZNC 5IMOB 3FU3A 2Z8VC 1BSIA 1NBVL 3T3ME 4F8NA 1LEGA 2IAMD 4HPHA 2YN5A 1CI3M 3LZFH 1GZHC 2Y3NA 1VSCA 2VDQH 4FA7B 2R2BB 3W9EB 1R3LA 1AD0A 1ZLUH 4WSKA 4Y9FA 4XHJC 4BSJA 1CFSB 2B1AL 1LEGB 2UXGA 2AEOA 2XN1A 3NCJL 4X7EC 5CD5D 4FFTA 4FZ8H 3FTVA 1NWOA 2Z1KA 1WFJA 4NHUA 2Z31A 2GW5A 2VDRL 4X7CC 5C08A 3AY4A 1FFTB 1D5ZA 2H2PD 1HH9A 5DDHB 2W0KA 1S9VB 4XWGL 1Q1JH 2JTYA 3CXHK 4AJ0A 2IDCA 4MAUL 4N9GB 4Y2NA 3LPFA 5LDSA 4KDTA 2Z4TA 3VFGL 5BJTB 1G7LB 2ATKB 2SODB 2JJVA 2Z31B 1OGPA 5D2LB 2E7MA 5IF0B 2DRUA 5ALCH 3SQBA 3QZLA 1TPXC 5AVUB 1CBJA 2YJLA 4L18A 4BHUA 3ARQA 2B08A 4NP4L 3WGVB 3FCTA 4HIHA 4PB9H 1OW0A 2B4CL 5E5LA 4PD4K 4B7LA 1U3YA 1E9OA 3C08L 2CE6A 5FO9B 5HHPA 4CKVX 5CLYA 2RALA 3EOAA 4G7YL 2EDYA 2FQDA 1F3JB 4MCYA 4P9ML 2NXZC 4QXTB 2YEZA 1HYRC 3O9WC 4LDEB 3STZA 3ZT5A 3QYNA 3SBPA 3DOIA 4MNQE 1ACZA 2A9NL 4S2SA 2YSSA 1HZHL 4L9LA 2HP4A 1TLKA 3QIWC 3LHPL 2A9BA 3V5HB 1S3KH 4ZFQA 3R7QA 1IQWH 1H3WM 4PJ6A 3BGAA 1FG2B 5L2JA 4KNUA 4QKXB 4W9ZA 4XCNB 4ETYA 3ZO0A 1T7VA 1P6WA 2N3JA 2YEZB 3WY3A 3WO4B 3QZWG 3LH8A 1T20A 4OLXL 4E9RA 4F27A 2MIZA 1VLXA 4BEIA 3HAEA 2ZF9A 5TE4H 2QLVB 3KLHC 1I8MA 3IFLH 4JJHA 2CBQA 1NPUA 1Q38A 5DO8A 3SE8H 3A4EA 3HMXH 3VH8B 2Y22A 2K6WA 2OL3A 2K3TA 2CHXA 5MHSE 4B9KC 3AU1A 3DPBB 3EGXA 4PP2A 5EFIB 3MUZ1 5HVWA 2GJ6A 1SJMA 5C70A 3L48A 3VXME 1SLUA 2OL3B 1V10A 5EUOF 3UTSE 1JZ6A 4KJYA 2C1OA 5I6OA 2NY4C 3EGXB 4XN8A 4XN2A 2GUYA 1L9NA 1A7NH 3KYMB 3WFBL 4I0PB 3OR6A 4BFOA 2ENJA 1ML0A 2XA3A 3PP4H 5CGBA 4G11A 4P0DA 2FSDA 3GBML 2BM3A 1PQZA 3IVKA 1NSNL 5GHWL 5LWYL 1ZY9A 2Y9RT 3E8UL 1JSYA 4DKDC 3IMTA 5BRZB 2FO4A 3C5ZA 5JZ7D 3D4YA 3ILEA 4DN4H 3P0VL 2X7LB 4Z3GA 1WF5A 1UM4H 4GXUM 4PJCA 3VX0A 1UT2A 3QYMA 3V0EA 3QJOA 1DEDA 3U0TA 3SSGA 1OTTC 4JZJB 5IB1B 5E08L 1N4XL 3D07A 1E9PA 2EDRA 2AV7A 3FT3A 2HKHH 4YQXH 4AIOA 1UD4A 1BD2A 2WWNA 3TBVA 5EIIG 3J07A 3L7FB 5T3XD 3PDGA 1NAML 3F83A 1XCQB 3RIFF 4FJZA 4UQEA 3K4DA 2B1OA 4YBQD 2H1PH 1E9PB 5C0NC 1ACXA 2DMHA 3QZMA 2P47B 1ND0B 2GAZA 3MFGB 3OJVC 2DWEA 3TV8A 4HH9A 2CHDA 3VWJD 3HS9A 3Q01A 2F58L 4Q2ZB 2R2EB 2ZCLH 5C0CB 1P0SE 2B59A 2YPKB 3ETSA 3D9AH 2BIHA 2N7BA 3F3HA 3OKLA 2DWEB 2IVFC 4CNIA 4K23H 4QI3A 1SYVA 2C34A 5KBDA 2CCLA 4ESKA 4F92B 4IOIB 4KGJA 1FVCA 2N4IA 3V9EA 4QOKB 3HMWL 5GZND 2V6HA 2QVMA 4O51B 3PJLA 3RJOA 3ZE2E 3W11C 2R4SL 2VDOL 5B8CA 1W91A 1XF4A 3DI2B 3JV6A 4YDIL 2GTZA 1FVCB 2DLHA 3GZQA 3QG7H 3EJTA 4K5NA 3RL2B 4HK0A 4YHZL 4YJZL 1T7XA 4XHJD 2XVKA 3ARVA 2P5EB 3ZYJA 1JZEA 1Z9NA 2R23A 4YWGH 1LP9B 2AJ3A 3CLEH 4HG4K 5DEGB 2VN3A 4P07A 3JV6B 3P2TA 2I32A 5DFAA 4W6YB 4PLKC 5IBUG 3ABKB 3ZDYF 1ZTXL 1RLWA 4OBSA 1J8HA 3QHFL 4WV1C 3NCYS 1SDYA 1U4EA 2J8UA 2AJ3B 1NC2D 2DZEA 1DVFA 4X8JA 4B9JA 2MCG1 5J5EA 1NLBH 2NDFA 4KTYA 2SEBB 5IROC 4MQTB 2GTWB 1FZKB 1KBGL 3GF8A 5KYXA 1J8HB 1YPZB 2G0KA 4HOZA 1JYVA 4FAAB 4PLNC 3VI3B 1DJHA 1YQ2A 5I8OL 1DVFB 2PWGA 4HUCA 4IRZH 4IGBB 4Z3TA 2ICWI 4H8WC 3FBQA 4YE4H 4RFOH 1KPVA 1M9SA 5EUKA 2WZ5A 3PL6A 4LAJH 1XIWA 3O2WL 5FW7A 2NXZD 1R24B 2QQNL 1OIOA 3K72A 3O9WD 4FQ2L 1T2JA 4XMKH 3FB8B 1J48A 5D7IF 2DQCL 2R0LL 3QJQB 1QABA 2DBLH 1RZFL 3FRUB 4PWIA 5C9KA 3QIWD 4NQEB 2FWUA 4MZRA 2PPEA 1T83A 4PGEB 1KPVB 1MUJA 2G3ZA 5E8DL 3WN5A 3P9LB 4GRWF 1MRCL 2MTAA 1CL7L 1AR1C 2RQ8A 3B2XA 2WZPD 4M7LH 3FT0A 1FVDA 1MHHB 1Q9WB 4Q0XL 4KX7A 2R69H 3QXUA 4XH2A 3U9PH 4DUWA 4M62L 1IKNA 1BJ8A 5F9WC 5IM7B 1CLYH 5MERB 3ZTNH 3KLHD 3WN5B 3D0LB 2A74A 4TNVK 4I1RA 3V52H 1EVUA 3L4XA 1S2EA 1L3WA 3HBZA 1NICA 4WUUD 3ZDWA 3IGUA 4B0MB 4XH2B 4JM0A 4QRQA 2ZUVA 4L8SC 3MRDB 3SE3A 2DAVA 2X4UB 2ZYHA 3LS5L 1T6BX 2R9HC 4M9OA 5D4JA 3RBSA 3SO3C 1CE6B 1YYLL 1I9JH 4X5QA 3GSWA 1TJHL 4Y5XC 5D1QA 4NQVB 4HPOH 2TSAA 5E2TH 4RFEA 4BSVA 1QEXA 1C7TA 1NUFA 4AV5A 2VN7A 4QDGA 4PWGA 3S5YA 2NY4D 2EXYC 1G4MA 4G43B 2RH0A 4B9FA 3TPUA 1IEBA 1JPSH 3A67L 4L1DA 5IGXH 5T3XL 2JKIS 3BOVA 3BQUB 2IGFH 3U4EA 2AFNA 4LNRA 4UT9L 2NLJA 3VGAB 4F7CA 3TPUB 1CCZA 2H1XA 1IEBB 2ZOWA 2TAAA 3KGTA 3NEOA 3VUAA 4CSTA 4KMTH 3CMOL 2CQVA 1CXKA 4YBLC 3SGDI 1SUJA 2DIAA 5F7DA 4A04A 2C3WA 3U4EB 2A5UA 3QJZA 2QGDA 3UBXG 3EO0A 2OYKA 2NLJB 1AGFA 1EXUA 2E7CA 1FNAA 2X2YA 3ZDZB 1DE4A 1X5AA 4A2HA 3MRPB 1OTTD 1IGCH 3GDCA 3X2QB 4MYPA 1F97A 3ARBB 3RHWF 2YEQA 4ZOAA 4DGIL 3FQYA 1IGIL 2QR0A 1LE5A 3EO0B 2VLKD 1IKFL 4ZYKB 4KKCC 5EUOE 2JWYA 3UYPB 3KL3A 2HH0H 3X3GL 5JW4Q 3BVUA 3RX8A 5I8EB 3QP3A 4JM2B 3I6GB 5C0ND 1JZHA 5DS8A 1YN7A 3O2VH 3IU3A 2CO1A 4FTVD 1SXCA 1A5FH 2V33A 1GS8A 1FH5L 1OHZA 3DJ9A 1AO7B 4BJLA 3UCRA 1CVSC 2H2SC 4J5VA 2FWOB 1OF0A 1OSYA 1CGWA 1YEKL 3EHBC 1YJDH 3CFMA 3FRPG 3B2UC 5DS8B 2OMWA 2OA9A 4XNAA 1YN7B 1LDSA 2H9GA 3IU3B 4AMWA 3L1OH 2OX5B 4RMUA 3U79A 1UB5A 1XSJA 3S5ZA 3HS0C 4B50A 4HUKB 2VR6A 4LSDA 1AS8A 1FYTD 4NQDB 3OAZH 2CDEA 2Y7SA 4EI6A 2OMWB 3K71A 1KNOB 2G60H 2KBGA 3QXVA 1GIGL 3GSNL 3MJ6A 4YHYC 3N41B 1MKFA 4UZUA 5DFTA 2G5BA 3W11D 1FAIL 3FOLA 1GYAA 1F90H 1MF2H 3UTOA 4R6UA 4EI6B 3L4UA 1MJ7H 1J9SA 1UD3A 2NR6A 4AY0A 3K71B 2HFEB 3C8KB 1GC1C 2XX0A 3D7PA 1G43A 2BOCB 3EUDA 2R15A 3QE5A 2F2HA 4YDNA 3H3KA 5JPMA 4U0RB 5B38G 4P48A 2QADB 3DTDA 4PLKD 2RQEA 3FDWA 3QAQA 4XR8C 3LCYA 5EN3A 2VL4A 3VI4B 3DI3B 4J4PC 3UBGA 3VCLB 3M86A 4ONHB 4Q56A 5IROD 3RVXC 1VGEH 4K7PX 4F91B 3HE6B 2V5MA 1PAMA 1SJEA 4N5UA 1IBGH 3L5XL 5KSAA 2XWCA 5MENB 2ATAA 3JQOB 3H8NA 4MAYC 1SDDA 3IS1X 4W70A 1PG7X 2W0PA 3GTVA 4GPVA 1NEZA 2VXQA 1M2VB 4PWEA 1SJEB 1DTUA 5AUMA 3TBYB 3WNNA 1JTOA 3S3DB 3QDAA 1MFEL 3KE0A 1XGPB 5C09D 3T2LA 3KYNA 1C8QA 2IFGA 1BZ7B 2FGZA 1G7PA 3M1BB 4XPTL 2I60H 2Q86B 4R90H 3T3PE 3TASA 4GIOA 1AR1D 4JRFA 4J6RH 2XYCA 4OD3H 5FYLH 3KYNB 5CBAB 4YVUA 4YAQB 2MFNA 1CDHA 1HOCA 5CSZB 1F45A 4Y4KA 3HCVA 2VXSL 3DJZA 1XZ0A 3UGUA 4HXBL 1OD9A 5ICYA 2XI9A 1R3HA 2QHRL 1NL0L 4NBZB 4R0LC 2IWFA 1JZ3A 2R9HD 1HHIA 1E4WL 3T6ZA 3PAZA 2ZYRA 1SBSL 4CVUA 3UMNA 2B15A 1ITBB 4OCYL 3W38A 4N2HA 2EO9A 2NY3D 1RCYA 2FWSA 1O9ZA 3B5GA 3VD1A 2WXGA 2FIKB 5LJYH 2EXYD 5D7IE 1NA8A 4YC2C 4S1RL 5DT1H 2BP8A 5IWLA 4GBXA 4NLAA 3ELQA 3E2HC 4N2EA 5B1BB 5MEQB 4YDLB 5D72L 4CJ1A 4NHCH 4XMTA 1I1YA 3GHEL 2HLAA 1CF8H 3D39D 1C5BH 4EZJA 4HIQA 4Z23A 4P2QD 2DS4A 3MV9E 5AZEL 3QDMA 2VOTA 1PIGA 3HAEH 4JGJA 4BV1A 3K7UA 4HSQA 5E9DA 5FUOH 2FT7A 1BQLL 4F7EA 2OMUB 4GSRA 4ODHH 4DP7X 2VUKA 1ECZA 4RQQA 2OL3H 2IH3B 4KZEH 1E8WA 3DROB 5EBLA 4J1UA 4AH2B 3QDMB 3GSUA 1TQBB 1YHPA 4ALAH 5F8RC 3WS6A 3P40A 1TQWA 4F7EB 2D03L 4MZ3A 1OV8A 1CQKA 4RQQB 1Z3GH 2OZ4A 2PXYC 1AMXA 4PHZA 5CXPA 3EO1B 2OCFD 4KKCD 1FNLA 2O6FA 3DO4A 3VACA 3R1GH 4ZZKA 3Q06A 5BZDA 5KSBF 4Q4EA 5A2IH 2ITCA 3NSCA 3WNPA 4FC3E 4DIXA 5I1HH 1NBZB 4POZC 2FJSA 4XNBA 2AV1B 3TT1H 3DC0A 2J56A 2WQRA 3ML8A 2BZCA 3EH1A 4QRTB 2R29L 4WUUE 5BZDB 3ULUH 1FIGH 2ITCB 1NCWL 1WD9A 4JG9A 3OVUB 2H2SD 4UYPA 3FT2B 2A2QT 2QTEA 3EHBD 5IB4B 3B2UD 4JO5A 4DP6X 5IVXB 5JIIA 3IB4A 2AXGA 4I2XA 1YY9C 4YIQA 5SWSE 4LIQH 1C1EH 2WO2B 2VZ3A 1KIRA 2BFVL 5K5YA 3V6ZB 1FLRL 4RZKA 2PYEA 4M4RA 5G4NA 3N04A 4F58L 1TTBA 4PRBA 1DQDH 3KCPA 4TVUA 5F9JA 2AQ2A 3I3BA 5GGRB 5K9OA 4QXWA 4HW6A 4XTRC 1HQRB 3QK0A 3HFMH 4YIQB 3LNFA 1VFBB 1JDAA 2BLFA 1NOAA 2PYEB 1F4HA 4M4RB 1O6TA 2AJUH 5INCA 4HVBA 4U1MA 1I7RA 4G59C 1UT1A 5E6IC 3CVIH 5K9OB 4ZD3H 1MW2A 4J3BA 3DARA 5H2BA 4QYOA 1QX1A 2IPUK 1W80A 3EYUL 3QUYB 1HVXA 5IBLC 2W38A 1P84J 2H3KA 5LB1A 5AOIA 4AEEA 2V9QA 2KDYA 4PV1C 3ZRCC 2CMRH 4C47A 3CZSA 1GOFA 4N8UA 3QJUB 4MWFA 1KUMA 2A77L 3WFHB 4OIAA 4J4PD 4QWWC 4IM8A 1BG1A 2BP0A 4GG8B 4OGXL 4KKRA 2ZXCA 5F7YC 4MDJA 3RVXD 1BLNB 3EOBB 4KTGA 5D4QA 3U9UA 3VFUA 5C3LD 3BKYH 4QO1A 3IGFA 3LRGA 4JMXA 1KB3A 1VRSA 1IGMH 2XQYK 2Y6SC 3M46A 4K7PH 2KL6A 5JPNC 5EEVA 4TQEL 4Z77A 4LSSL 4CADB 2COVD 1WBXA 2FEDC 2WQUA 3T8VA 3A6BH 4ATWA 4N3UA 1RZGA 3L3IA 3CDZA 3MLZL 4WEBL 4X5WB 2ADGA 3VFUB 5JHLA 3RG1C 4OQTA 3GUTB 2ED8A 5LAXA 5GRJL 3TPKA 3F04A 4JFFD 4WHYH 4Z77B 1B9ZA 1WBXB 1ULVA 2DYPB 4PP1D 1RZGB 1WUZA 2X10A 3AC0A 5C07B 3SDYL 1L9QA 1DSFL 4DVBB 3CFJA 4LVOB 4LSVL 4FQLH 5D93B 2BDNH 1RVFH 1E42A 1KXVA 1MJ8L 2OSXA 3FU8A 3SCMC 4MJJA 2OYPA 1MOEA 3PE9A 4JZNA 1T1ZB 3QYCA 1K6QL 4P5SA 1QFWI 3QNXB 4Y16A 5GZOA 3ARDA 1YEFL 3EFOB 2RA1A 4HS3A 3IPBA 4HZLB 3U6XA 5I8CA 3DO7A 4R5XA 3IFNH 4ZDHA 4LU5H 4F7MA 4DGVL 1SYSB 2HX8A 4HJIA 3NACL 4JZNB 4CN4A 3ZBMA 3MA9H 1TQVA 5A2FA 3QRGL 2CO4A 2EXWC 3ARDB 2QVKA 5FKAB 2Q20A 2HVBA 3O2DA 3ZVVA 2I7OA 4E41D 3C6EA 5ADOL 5I8CB 3DO7B 4FN0A 1FFPA 1FZOA 5D7SH 3BFQG 1KDJA 1TOXA 4GKSA 1YEDB 1R33A 3UG5A 3BGMA 2ZG1A 4S11A 2CRMA 2OFQA 1TF4A 3AAZA 4PGCA 5ILTL 5JHBA 2WAHA 3KBPA 4U1NA 1XDTT 4PJDB 4IBUA 4M4PA 3VNZA 4NAMA 1KCRH 1FL6B 2A99A 1XAUA 1BX2A 4GKSB 3TP4A 5DGQA 2KYIA 5EO0A 1MI5A 1KEMH 3SPGA 3WIIH 5J57B 3AAZB 1FGVH 2X4RA 3L6FA 4U1NB 1R1CA 2OZNA 3GZPA 3ESMA 5D2NC 1E9QA 1OTUC 5MI0B 1PD0A 3VQ2C 4NKOB 1HXKA 2NCEA 3GSXB 1CE1L 2NY2C 4N8VA 3S7GA 1BVNT 2EH7H 2VYRE 4LASL 5EU5A 3RIFK 3UTPE 5T1LB 5C09E 1NC4D 4CMHC 2GITA 1E4KA 1OT4A 2PXYD 2WC7A 4JG1L 5IJVA 1YUHB 3LHAA 1OE1A 4J3WA 5JQIB 4N8VB 2CKBA 3JVGC 3KLLA 3VA2C 3NJGA 3FU5A 3I74A 3SQOL 4DESA 1XCTA 5EU5B 2DWDA 3DX9B 4P46A 4Z7OF 3S98A 4POZD 5BUGA 4XP4L 4M61A 2DQJL 2V8MA 2NRDA 3QUMA 2YZ1A 2GYSA 1FYHB 4GAGH 3UAJC 3UX9B 3BFWA 3NJJA 1RUAH 1WZLA 4Y4FB 4E9LA 2DDQH 2G3XA 3I50L 2ZKYA 1QTPA 2DWDB 3ILQC 2VDPB 2DQGL 2YAPA 4HKZA 4PY8I 3PGCA 4GMSH 1QACA 1BW8A 32C2B 3CCHB 1YY9D 1DN2A 1SFHA 3D4GA 5DZVA 1DUZA 2DWSA 1HS6A 4IMLA 4LOEA 1EFXA 4A1RA 1OP3H 5I5RA 3MLYH 3JT0A 4HGWA 1I85A 4PCTA 2BCKB 4XTRD 3V0FA 4IS6B 4JW3A 3TNMA 1DUZB 4AQ8A 4WSJA 3MV7D 3B5HA 4G6AC 3HI1B 4OV5A 3GIZH 4V1DB 1MCSA 4I3RH 4ODSL 3UTQB 3NK4A 4FXLA 4LCWD 1RZJC 2FLRT 5E6ID 5D1XA 1HE7A 1JZJA 4OIFA 1WZKA 4A6YA 1U8LB 3KXFB 4X2UA 1KN2H 2OSLA 4QAMB 5BUAA 2O72A 4CGTA 3C6LA 3FFDB 4PJEA 1OSPL 4RAVB 4DW2H 1CC3A 2W65A 5IBLD 5I0VA 4OV5B 3SZKC 1INDH 3VRJA 4PJ5A 1PJWA 3EOYG 3RFZA 1ZGLB 2DTSA 2FZ3B 3T0EA 1UA6L 5D1XB 3QEQB 4NXSA 5D7LA 4BUQA 3FL7A 1I3VA 1NCBH 3ZQXA 4AZ8B 1AKJB 2J55A 2NY5H 4YE0A 1KTDB 2OSYA 3LRSB 2WLHA 4QF1B 3T2QA 4CU6A 2WYHA 4ZFGL 1HHKB 4FMKA 3CFKB 3H3PL 3KM2A 5ISZE 4PJ5B 1NDTA 5T1JA 5D7LB 2OV0A 3FH7A 3V4VL 4JPVL 4JPWL 2NX5E 4XP6H 2Y6SD 4LCVA 2AJYL 3US0A 5IR1A 5HYJA 3FT9A 1FG9C 4MB1A 1X5LA 4KTDH 5AVTB 4L8CA 2FEDD 3RI5F 1K85A 5I76A 1RK7A 4G5ZL 1B0RB 1BXXA 4PAZA 3X3FL 1A6WL 4XBEL 4ZFZA 4UTBA 2VR4A 5TQ0H 1HL8A 1ZT7B 2QPFA 4XPBH 5EBWB 5C6TH 4ELMA 4Z7QF 3UP1A 1D5XA 1MCPL 2Z7ZA 5DMIH 5HYJB 3L3OC 2BRRH 3FF8A 4HS6A 4NRZA 2VB5A 2ZCKH 3MLPA 2I26N 1A7RL 5L8LB 4ZFZB 1CLCA 2IGTA 2NDGA 1AXIB 3X17A 3U83A 4BFEA 4EUPA 5HD8C 4Y2OB 5IMLA 3LXAA 4R26H 1D5XB 2FSEA 5DQDL 3SCMD 4FERA 5CWSA 2GBVA 4QXUH 1I8KB 4GIAA 2WQSA 4HCIA 4IQHA 4KVNL 3GI8L 4L0ZA 4JDEB 2I85A 2PWDA 2UY7A 4P5MA 1MHPH 4EUPB 1L5GB 2ESVA 2FSEB 3CXDH 3SDDA 3VXRB 2VE6B 2YUXA 1MFVA 5TK4A 4U1IB 1YEIL 4A55A 2XWTB 5J06A 2P48B 2VXQH 4JG0H 5CJXC 2EXWD 4LPYA 1CN4A 1RSFA 1TXKA 4KJPC 4NKMB 3TN0C 4A7VA 4PJFA 4M6NL 2UY7B 4DP2X 2CDGA 4O5LL 3SDDB 3O6LH 1I8UA 3E9UA 3RUGA 4OZHE 3LVTA 3WDIA 4G42B 5LGKA 4NCC1 1EAJA 2LVCA 4YSDA 3GUFA 5DHVA 2DIEA 4IOSD 4PQXA 4PJFB 1X44A 2D4DA 5I1JH 4LKCB 1KG0A 5ECJE 3DVGA 1CXLA 1U6AL 1YY8A 4ZS7H 1G9HA 1AH1A 1OPOA 2D0HA 1E40A 3S36L 5J6GB 3WEOA 4N0FA 4M7KL 2NSXA 2Q8AH 2NW3B 2X1OA 3CZKA 4FLSA 5FDYA 2CUMA 5D55A 4HIXL 3RHWK 1L0PA 4N2GA 5T1KD 1OTUD 2WVVA 1QI3A 1VADB 3PGDA 4YSRA 4BD4A 2KQNA 3NSDA 5KBLA 2NY2D 5AYTA 4DF9A 5I9QB 1A6VH 3WDJA 4DO5A 1GGCL 4F9LC 1WFNA 4TRPH 4JFFE 3MXVL 1ROCA 2WTRA 4PH8A 4YDJA 1J05A 5HTSA 2DKMA 3U7YL 5DRXA 1BOGB 3OTTA 1AXSB 4M8VA 1ZJBA 3BPNC 4NIYE 4GP5B 2XV6B 5G4OA 4AE0A 2UY6B 3JWOH 2WTRB 5D70H 4KI5C 1ZVSA 1QQDA 1GYWA 4WW2B 1G7HA 1LO5A 1UZ8B 4JO2H 4XMPL 3UAJD 4WJKB 5DRXB 4K9JA 1V7ML 4PJ7F 3OQ3B 2VISB 2NY0B 3FPYA 4LCUA 3ILQD 3N85L 2Z0UA 3NIGF 4UUJB 1CDCA 4UI2A 2W9DL 5KS9B 5G5DA 3OKEA 1GA2A 3IWUA 2V9TA 3PWLB 4LCUB 3MKKA 2K45A 5C0AB 4CC4C 1A66A 1UHVA 2OZ4H 3TBTA 4K7PY 5FUCC 1UZ6F 3ESUF 1S5IL 4GEIA 4N0RA 5SX4H 4PGZA 3TT3H 3WXWL 2HUEA 1C08A 3GS7A 4G6AD 2D73A 4YEEA 4ZUTA 5T33H 2ODHA 4QY8A 4MCNA 3U25A 4OFYA 3FYEB 2KERA 3DJRA 2IOMA 4QGTA 4WKZA 1JZ7A 1J1XL 5FHAH 3TBTB 3QJSB 2EJ1A 2GEEA 4JREC 4AEFA 2G75A 1X9LA 5JOPD 4POUB 1F11B 1ZSDB 1PU0A 3OF6D 1I7TA 4WNQA 3LTVA 3RWGA 4MSWB 4U1LA 1KGYE 1G1CA 1TJMA 4QY8B 1K3ZA 1ITCA 2NY6B 4NPJA 1I82A 3EJRA 4WKZB 2IPKA 3UG4A 4P9HH 4XNQA 1N68A 5TF1L 3TL5A 3WSQL 4P4KB 3ULSA 1I7TB 1YA5A 1NJ9A 3FB5A 4KRPB 1AFVH 1I7UA 4NC0B 2V3FA 2NYKA 5HI3C 5T3ZH 2IPKB 3RJQB 4C57C 1S7UA 1WYJA 4OJFL 4TOYH 1RIUL 1XF3B 2MMXA 1IM3D 1NJ9B 2VLRE 3EYVB 3CN3A 4C56A 1FNSH 2X3BA 3QWQB 1RIHH 3VWKC 3IU4L 1XGQB 3KPRE 5I74B 5J9PB 3MZGB 1T6WA 3O3AB 3UAFA 4Z0XA 1S7UB 4PG2A 5I1LA 4OF8A 3M6DA 4WHTA 3F58H 2DL9A 5B22A 4PRPA 4UDUA 4C56B 1QSFA 1WA2X 3FUMA 4H1LG 3II1A 4FNUA 2BY0A 3MNWB 4RVBA 5HPMA 4PJIF 3CGTA 1XF5A 1AHKA 1UM5L 2DQFA 3OSVA 3MBWA 1KDIA 1PX3A 4NZTL 4OF7A 5HD8D 4EN3B 2EACA 3ZTCC 1YECH 2R0WL 2Y72A 5BMFL 4Y5VB 2DWYA 5BZWA 5CLZA 4XNZB 1OGAB 1H6FA 2Y06L 1HQ4A 4GKLA 5AW2B 3VRIA 4L4TA 3OBAA 4GUCA 4MHHG 4PJBA 1T0NA 2OBGA 5L2KE 1FGNH 2Z6FA 3V4PA 4LCWE 1IX2A 1Y7VA 2EO7A 1CICC 1U42A 1RJYB 1XBDA 4JFED 2AGJL 3O4LB 3TESA 2W5PA 2ADFH 4I0KA 5DR5H 3FSVA 1GGUA 2UUDH 1CGTA 4KJPD 5JHLH 3TN0D 1I8IB 3GXIA 3LH2L 3OKOB 4X7FC 5ANMA 1OQOA 3V4PB 3D18A 2QQQA 2NYZA 3MRGB 1KYUA 3KYOA 3QUHA 3E80A 5GQBA 2HG5A 3IJHA 2VXTH 1G9MH 3ME0A 2XN9D 2OMZB 4JRXE 3S97C 3ZW3A 1P4LA 3VD4A 4IBQA 4NUJB 5ANMB 3X1GA 2MCAA 3D18B 2OTUA 2GHWB 1P9MC 4X6CA 4ZOEA 3HPJB 4LDLB 1BVLB 4XN5A 5EORL 1NCGA 5DRNA 3G5XA 3V8CA 4ZX3A 1NIEA 5L0QC 2NTFA 3ESOA 3ME0B 4IIQA 3BDBA 5LUMA 4LLQB 5F88B 1GW0A 4JAMA 3GBNH 1BVZA 5ALBH 5AQ0A 3RGVC 1BHGA 5EOCL 3IPEA 3UZVA 1T4KA 1AE6H 3V0IA 2WINA 3K6SB 1PFCA 3ROOB 3WL9B 2NTFB 1QLEL 2OMNA 1RP9A 1DJGA 1TCRB 4IIQB 5C92A 2G5RA 1IGYA 3WY2A 3NCMA 2MHAB 1V55B 3UPRA 3O2DH 4DKEH 1U91A 3OLDA 5AW6B 5K1VA 2I24N 3QDJD 2ZX5A 4JN1H 4U7KA 3RZCA 3DA0A 1WPCA 2F18A 2IANA 2C26A 2WLNA 2WQ8A 1Y6NR 2BSDA 3GGWA 1ACYH 2J71A 4G9FA 5DJZA 4FL4B 3WXVH 1TENA 2GBUA 3Q0HA 4KI5D 3ZZSA 2ETWA 1HEJC 3OM3B 2AKRA 2WKOA 1U91B 3RZCB 1BM7A 3PUCA 1HXMA 5D9SA 2Z35B 2NY7L 1WAPA 2ZSWB 3NZUA 2ICES 4L4VD 4G9FB 1A21A 1QW8A 3RWHA 1UACH 1YEEL 2J4WH 3HNVH 4GQZA 4LVNC 5DC4B 2CCVA 4H0HB 3QI9A 4NYLA 4GKZA 4I18B 4K2UL 1KFAH 2R8SL 1P4UA 5C3TA 2GFBB 4WWID 1WQVT 3MRRA 3DTXA 3OPZL 3T0XA 4NYLB 3K4ZA 5IJCC 5HPOA 3P73B 3NJXA 1EHLL 2O5XL 5TFSL 2CKBH 1G7IA 1U8HA 2FATL 2GTQA 1WC7B 4F5CE 3FSOA 4UIMA 2VR5A 3MGAA 3ZYIA 4OB5H 2ZOLA 2XQBH 5C0BB 1MREH 2VDPH 2Y1VA 3DTXB 5JO5A 4ELDA 1OB0A 3QUMH 5C08E 2KC0A 3JV0A 1U8HB 5I6NA 5GZOC 4X9YA 1B0GB 5IV2A 3NFPA 1KGJA 5FYLE 3U4KA 3WJLC 4FEMA 1UUNA 4NNPL 4Y19A 3QXDB 4XWOC 5JO5B 2ZUWA 1VESA 3AS2A 3PHSA 4YR6B 3NIGE 4NM8H 3WJMB 3O0RL 1VZHA 1LEKA 3CFUA 2OS7A 3CQFA 1H8NA 5IV2B 4XMWA 3WMQA 4OTXH 4Y19B 5HI3D 3QIBC 1FORL 5JHDA 4G7VH 3Q8BA 1S8DA 3WNLA 4X4YA 3LKSB 5H35A 2WLLB 3L4CA 1NLDH 3ARWA 1WLHA 2WZ0A 5IHLB 3VWKD 4Z7UA 3VFSB 5FK9B 5EC2A 3FTWA 5JHDB 3N1QC 3T4AA 1S8DB 4A6YH 1JZ5A 1P53A 1MFAL 2O30A 4ODVL 4YSQA 5LQBH 1YVLA 4KQ3H 1RJZB 5EC1A 4F7KA 5B7FA 5LCVA 3KWUA 4BM7A 1TJGH 4X4ZA 4ZNCD 3IBEA 1FE8L 5D6DC 2YWZA 4HX1B 3VXSD 3T4AB 3PIQA 4HAFA 4OGQC 2HKFH 3IRCA 5F9DC 4OFKA 2APVA 4L37A 1A3LL 4EBQL 4EDWL 3B6SA 1M71B 1D3CA 2R0ZH 4DQAA 2ZXDA 4JR9L 5CP3A 5DUBA 5F97E 1J10A 2DI9A 2J73A 3PIQB 2CJUH 2GJ6E 4RGNB 4ZMLA 4OIIL 3UJJH 4AMXA 4DETA 1YMMB 4Z0BH 2UZYA 2YK1L 5DEFB 5A16B 1CICD 1K8IA 3UGEA 2YAFA 2Y7LA 2CAKA 3QZBA 4OJDH 3UIZA 2FWLB 4UTBH 2DMGA 4JFDD 4Q9CA 4G8IB 1B4JH 1JCKA 5EG6C 2UZYB 2A7BA 3EOTH 1M05B 3O3BA 4Z78B 2EO1A 2YIHA 1JHTA 1KPRA 4NI3A 3QNZB 1OP5H 1RY7B 3HRZC 5DQJB 2VW4A 4EUPH 4D3CL 2HWZH 5CIPB 4A37A 4NRYB 3DX1A 2MQ3A 3HFFA 5IHBA 1ZV5A 2Q6WB 2BVYA 1MCCA 1C12A 1MQ8A 3OKNA 1DP0A 2D9CA 3O8XC 4NWUH 4PJCE 3VYPA 3LEXB 4GXFA 3GRGA 3ASNB 4KK6C 1ZMYA 1MIMH 1XGRB 4G80A 1IBZA 4RRPM 1F56A 5BRPA 4DZ8A 4KPHH 4R2GC 2V5YA 3GNML 4EKXA 3RGVD 1BD2E 1IC4L 3RX7A 3R19A 3OX8A 4CSZA 1R19A 2B39A 1D7DA 1PZAA 2WUBL 4K7FB 1JWSA 4XVSH 5EO9A 1YNTF 4RAUB 5AVZB 1BGXH 2BVOB 2XZAL 5JIQA 5E1GA 4ZMQA 1MCWM 1W15A 5C7XL 4WU7A 1P5UB 4R3SA 3OX8B 4X4XA 2X1QA 3FSAA 3RWIA 2EDXA 1DBAH 4LEOB 5AOJA 4RDBA 1CZ8L 2E46A 4ZMWA 4JO1H 5E1HB 3SDXF 3G5VB 4XBPA 1BBJB 3B4NA 5A6IA 4G7SB 3CLFL 4NX0A 4PJ9C 2C9VA 5DD0H 4ZUWA 2Z1PA 1F4WL 4V2BA 4R3SB 4QRPB 3IMRA 3MLUL 3IDGB 3PQYA 4MA1B 2LVEA 4LNVA 5FYKE 4RZCA 4CN6A 2N1TE 4XP1L 5L4JA 1ZHKA 2V5SA 4JFEE 1A9BA 1DEEA 4HH8A 5DWUL 2VO5A 2R4RL 2H6PA 4BFIA 4TSBL 5GRVK 3SKOA 1ZDSA 4NEHB 4K9EC 5GJTH 2WCGA 3B9KC 2OXGA 3WKMH 1SOXA 4WK0B 4QHLA 3MBEA 1H5BC 1ZHKB 5D1ZC 1DEEB 1XMWA 1SOKA 2DM4A 4WU5A 1LO3H 2N0MA 1TIUA 5E8OB 5IHZA 2H6PB 4MMXA 1QBMH 3Q6GL 3QQ9C 3V4UL 4BFGA 3BZDA 5FDWA 3QDGA 3WLWC 3KWWA 2MQ0A 5IVZB 1QFPA 5DHEA 4LLDA 3MBEB 4OT1L 2X4SB 3MRKB 3VG0L 1FAKT 5CMAA 3GLAA 3QG6A 5L4MA 3OZKA 4WU5B 5BOZG 5IHZB 1M3IA 3F64A 2ZP9A 3CSGA 3TBSB 2YRLA 3OXSB 2WUCH 2UVEA 3MNZA 4H26A 3QDGB 4KOBA 2J8UE 3SGEH 4QEGA 2Y5TA 1I1AC 3BE1H 4XWOD 4AG4H 3DURA 1YYML 3NG5A 5CMAB 2XXMB 3BPCA 3BUYB 4PRDA 1OAKH 2W9EH 3B3IA 5EBGA 4TUJB 5SWZD 4APQA 2CH8A 2VJ8A 2IG2H 3MNZB 4NZUL 4N68A 1P6AB 4UM9D 1SVZA 2QPUA 3VXQB 3QDJE 1IJNA 4HC1L 2WWKO 3F65A 4KITB 6CGTA 1TSHA 3QIBD 4QHKJ 3B3IB 1SEQH 4BRVA 4OJEH 2F5BL 1W0WA 2XWJB 3B9EA 3OWEA 4H0LC 3GSQB 1Z9PA 4G70B 5C8JA 1P5VB 1CI5A 1IM9D 5JIDA 1B4LA 3J27A 4G3YL 1IAKA 5CAYB 1KXTA 4YFLF 3K2MC 3MRFB 1ET5A 2ZAHA 2F53D 3G6JF 3IYLW 1T1XA 1W0WB 3CN1A 4H8HA 3WKYA 1T21A 4FQCL 5C8JB 4PHXA 2GT9B 2K78A 3LOWA 1GYVA 1T6VN 3P30L 4UIKH 5IBUB 5J89A 4ZO6A 5E9AA 1U8KB 3ECVA 4MCZA 5ACZB 3FQNB 1KXTB 2NTSP 2JQZA 5FGBA 2MQGA 1MFNA 1GGBH 2UYLB 1BBDL 2P5WD 5EA0L 4RISL 4H4NA 3VFVA 2YKLH 5B3NA 4X8GA 3MMEB 4NO0A 5FUCE 3OG4B 4JN2B 2ISDA 1BMGA 4JCMA 3FOMB 2AC0A 5F93C 2YO3A 1I3GH 3D2UD 3PWUA 1EGJA 5CEZE 4JKMA 1RUQL 2X6CA 1UXWA 5D1QE 5BS0A 1XFPA 2O5YL 1N2RA 2XJKA 4DJMA 3N40F 4NO0B 5I28A 4F1ZA 4RNRB 5CN2A 4WWPA 5AW4B 2VR8A 4ZUUB 5GGVL 3WU1A 2KMWA 4X6DF 3IK2A 2X4QA 1JUFB 4ONFL 1I3UA 1P2CA 3LXUX 1RFDH 3L1GA 5IW1A 5E00A 4NQSB 5D6CA 2KH2B 3P4NA 3QC5X 1KIPA 1ONQB 3UGXA 1MNUH 3EFDH 2Y7QB 4M6AA 1B2WL 4MB3A 3OAYH 3MOBL 3PWNA 2ITDB 4WIQA 3EH4B 3I9PA 4PWJA 1HFUA 1JZIA 4EI0A 4BCXA 1DO5A 1V3LA 1WT5A 1BEYL 3P4NB 3HKZA 1BFSA 1T2QL 3JZ7A 4P23A 2LTQB 3O8XD 3MJ9L 4JFVA 1FO0L 1QO3A 3GEWB 4KK6D 1KBVA 3Q2VA 4R2GD 3V4PH 5K9JH 2I69A 3GTNA 1X5YA 3H85A 4RWYH 3T5WA 1KV3A 1R9FA 5B39G 3NFSH 2PPFA 4LOVA 2C7UA 5DYOB 4O9HH 5I1EH 5IFJA 1A4KB 4TVPH 2W88A 3L3KA 4Y89A 1TYJA 3AQDA 5EEWA 3CNKA 3GHBL 4NENB 4ZX4A 3TVMA 1JGDB 4NQCB 1OT2A 4BKLA 5FUZL 1AVAA 3PP3H 1HK6A 1GKOA 2C7UB 4JPKL 3L3KB 2O5NA 2ICWB 2QT6A 4YK4B 5TGBA 2RBLA 5KW9H 4F33A 4PJ9D 4GG6B 5GGUA 4LSPH 2JJTA 4DVRL 2OTWB 4YHKH 3GLZA 2XETA 4JDVA 1JD9A 4R4BA 1MY7A 3DV4A 3HI5H 5HHNA 2K3HA 4UT6A 1JHLL 4AQ1B 4TNWF 3T6WA 4P57B 2IQAB 3Q6FB 1UA3A 5TGBB 4OZIB 1T0MB 2YFOA 5GISH 4JFTA 5I15H 2Y07L 4HDIA 2X0UA 5CF3A 3R4DA 1REIA 3B9KD 4JS7A 4AYID 35C8H 4KXCA 1BXUA 1DYZA 2KLSA 4P2RE 3WNMA 3PJSB 4M7JH 5D1ZD 5IMMB 1KLFB 1XB8A 4WZ9A 2WNXA 4R5VA 1P7QA 4E68A 4ANUA 3QQ9D 1XEUA 3HKFA 2ALWA 1OAZH 3WLWD 2YPLA 1F18A 3HLAA 3DX7B 4PRID 3ZIMA 1IVTA 3SE4C 2PN5A 2EVHA 5TE6H 1K4CB 2ZE0A 4N2OA 5LGHH 3TO4C 4EI5C 2WXRA 1P7QB 3KJ4C 4G6FB 1VFAB 1INQA 5TJWK 4YGVB 2IBZX 4JRYA 12E8H 2IGLA 1G9NH 5CKGA 1BP3B 3L7EA 4X4ME 1MFCH 2YUZA 4OCRL 4HFUH 5D96B 1S46A 2WB1A 4YHMH 5IG7A 3DGDA 5DMKA 1ZAGA 4EOWL 2RAMA 1W72A 2XU9A 3TGXA 3A24A 5JOFA 4KKBC 3WTWA 4PEEA 1TTCA 5L8KB 3L7EB 1UA7A 4KVCH 3ZKSD 3M1CA 4ZW8A 4OQ1A 3OJDB 3EYSL 3I9GH 2WTPA 2C9SA 2DQTH 1H0DA 1PS3A 5CILH 4YFEA 5IKCA 4NBXB 1EEZB 1A8ZA 1C16B 2E0PA 1KPUA 1TJIH 1NGXA 5C2UB 3C60C 5DMKB 1KCWA 1EFQA 4L5FE 2BWDA 5DJ0A 3QQDA 4J3OC 3JYBA 1FBIL 4PG9A 2YA0A 4M7ZC 4MJID 2UZXB 3WHXA 4PYGA 4CU7A 2C4XA 1IBDA 1MLBA 5AVRB 4XOEA 5B38B 1FNEA 1WFMA 1H0DB 4DGWC 2APSA 4WWKA 4F57L 1KPUB 1NGXB 1T5WA 3CDFA 1RHFA 3F7RA 3QQDB 4S1DC 3OR7A 1RU9H 5BV7B 4DFHA 1I1RA 2VXUL 3WHXB 5A1AA 2VZSA 3KBEA 1MLBB 1FNEB 3GC3A 4WWKB 5KJRH 3SJVA 3GMPA 4DGYL 2AK4A 3DRTA 3OB0H 3OR7B 1GOGA 1IBBA 2XUWA 3N42F 4TQIA 1QUPA 2GIXA 4NCDA 4ZW3A 3DIVA 4TLSA 1MFUA 3ETBJ 4Z5RB 2H3NA 3BCFA 4RDQF 1CU4L 1KIQA 5ID1B 4PJGF 3SYQA 3P77A 1VKXA 3GMMB 4ZUSA 1XO8A 1RL1A 4NC2B 4ANXA 2MTPA 2PW2B 1A22B 3G6JE 3QRBA 2H3NB 2G3MA 2X4TB 1BECA 1KTCA 5D71L 5LCVH 3TJHC 4B6ZA 4PRHA 5PAZA 3V4VB 5DRWA 5BCAA 1VKXB 4H20H 1JGUH 5LNDA 2DM7A 4HLJA 1RK0A 4O02L 1Z9LA 4PPTA 4ZUSB 5C0JB 5H4YA 2DQIL 4N8CL 5E9DE 2ZICA 5I71B 1YEGH 3WFEL 4QGYA 1K72A 1XXDC 4IRSA 4B0MM 1EX0A 2E76C 4X6BB 4I1NB 4TF4A 4Y5YC 4PRHB 4NZRH 1ZV2A 5FYJH 1NIFA 2BSSB 3TFKC 3A21A 1RK0B 3UTTA 2G2PA 3KNBB 4MA8H 5J6HB 5F1NA 1IB5A 3TWCL 1X7QA 3JWNE 3VJ6A 2BNRD 2ZXGA 2B16A 2BCMA 3GKWL 1X4ZA 4OGZA 4LLWB 4BH7A 2V0AA 2WXMA 3O6FB 4JFHD 1UXSA 3UTTB 5DD3H 4PJHB 4X6FA 2ADJA 3VJ6B 3LIZA 1BF8A 3VXNA 3ZE0B 3MODH 1QRNA 1TTGA 2WXNA 3PPEA 3QJVB 5KJ4A 1S7TA 2NY1C 4TL5A 3QRLA 1F2QA 4H0IA 5BOPA 3I6KB 5IVOA 1WWAX 3EYFA 4BCYA 4NERA 3STLA 1JHKH 2V5RA 2QKIC 3OJMB 1SFDA 4S0TD 3QCVH 4AENA 1Y6KR 4L0YA 1MJJA 2IH9A 4HKBA 1UEYA 4P59L 4ERSH 4I2XE 2P80D 1CF1A 2L7QA 4HKJB 4BCZA 5LLIC 2JKRM 4HJJH 4M5TA 5KOMC 4WJ5A 2P45B 3STLB 4XNUL 4AUUA 1SJHA 3JTSB 3MXWH 2FRGP 4AENB 3FCSB 3G5YB 3QUXA 2BIIA 4NUGL 5T3ZE 4HKBB 1A0QH 3QFJD 2B2XL 4P4RA 3PWPD 1BVKB 2JCWA 5FOBB 3RL1B 3ZE1B 3EO9L 3S35L 3MU3A 3HHSA 3E38A 4MD0A 4OLWH 3OZ9H 4EEEA 4KKZA 1TTUA 5CU9A 1ET7A 2GUOA 3RY6C 2FB4L 4QAWA 2OAAA 3ATAA 4NM4L 1BAFL 1YMHB 5DLML 1OQXA 1QATA 2BNQD 2F08A 4XRCA 4GSXA 4DK3A 1LE9A 2A3TA 4HWEL 4MD0B 3SZ6A 3UG3A 3GXFA 3NSFA 3TA3C 4EI5D 2I27N 3TO4D 5DVPA 1KF9B 1GKEA 2GUOB 1A3RL 4FDWA 2DQDH 4NKIH 3SDCC 4FMFA 2D7PA 3MTRA 4UAOB 5E99L 4AEIL 1BA9A 3DUSB 1F4XL 3DYOA 2IDUA 1DQKA 4KZCA 4XRCB 2RFXB 3O3DB 5L7XL 3LKQA 1J0KA 3U0WH 2J25A 3BZ4B 1JZFA 1IVLA 1G6RB 1WFTA 2WMPA 5HDBB 3GM0A 2IV8A 3DOSA 4G2AA 1A3ZA 3PU7A 1NMAH 2WCPA 2GG1A 3IGAB 1KCUL 1IT9H 2IADA 4N2LA 1I4FA 2VH5H 4PM1A 2LAAA 5T5FL 1MW3A 3LKQB 2FUQA 5I19L 3HG4A 1NPNA 3DETC 3CBRA 4KKBD 4PWKA 4U49A 1FJ1B 4FP8L 1XH0A 2C7FA 2CBMA 2DB8A 4U6VH 1T5KA 1J11A 1MW1A 4O2FA 5JW4M 3TA4D 1TQCB 1RZQA 5FFGA 3VYNA 1E67A 4Q8BA 2OR8A 5CJQL 2YC1A 4JL2A 1IZKA 3C60D 4CC0A 4YDKH 5DMYA 2F8IA 4J3OD 4AEHL 3X11B 2VLJA 3WE6A 2ZNWA 2MCPH 3HB3C 3MO1B 2L8AA 3OKKA 5AW5B 3VTTA 3SQRA 2CK0L 3NGBC 1Y6MR 5KYUA 3ZXAC 4OY9A 1X5IA 3GWJA 4ODWA 1VEMA 1OARH 3RIAF 3QR2A 1EAPA 1UD6A 3BVXA 4FXGC 4AUYA 3FFCB 3BZ5A 2PETA 4OV6F 4S1DD 4HWBH 4TSCH 1CFNB 1KCLA 1DJWA 3H9HB 1BQRA 5T5NF 4YHNB 1A2YA 1UADC 43CAB 4M5YH 3N5AA 5HHOD 2VDQL 4P2AA 1VACA 5E23A 1WCQA 1BXVA 3AM8C 4LEBA 4WDIB 2CBTA 4PRIE 5GRUH 4J3OF 4FZ8L 3BLBA 4F7PA 1A2YB 4E5XG 3VD9A 2LGNA 1SY6L 1MG3C 1JL8A 4IEFB 2O6DA 2PR4H 1Q1JL 3POCA 2VQ4A 5J1TC 2GK2A 5HHMD 3HBGA 3LKRA 5IQNA 1FL3A 3D3VD 1HDMA 4RMBA 3CBJB 3TJHD 3DGGA 4NQTA 5ALCL 4OGYH 4MXWH 4Z18A 3H9SA 3L17A 4ORGA 3U30C 3T77A 1FFNA 2VC2L 2XRAH 4BHUI 1MI5E 4KO7A 3QO0A 5E9NA 2AK1H 4PB9L 5F7BA 4N90D 3GM8A 3DGGB 4P5KA 2ENSA 2WGNB 3AVEA 3UERA 3KHQA 3H9SB 1F1DA 3CH1B 3EYQC 3TFKD 1EGJH 1QA9B 3OMZA 2VZTA 4E2OA 1EO8H 1LK2B 1M6OB 1T1YA 3LN5A 3PGFL 2AEIT 5ES4B 3KVPA 4LESA 1RURH 1S3KL 4I0CC 4MKMA 1IQWL 5FYKU 2DKSA 1Y0LA 5LGYA 3IFPB 2ZT9C 3O81A 4OZFA 4PJGE 1NCAH 3WY4A 5EN2A 1AZBA 4O58H 1BYNA 1SLWA 1WAAF 2OQJA 2H5UA 2E9WA 3QSKB 2XXCB 4G1EB 4X5XA 5TE4L 3NJVA 2NY1D 2PP9A 3IFLL 3SE8L 4IBSA 3N1MC 4ZFOL 4IU2B 5CZVH 3CMGA 2YUVA 3G08A 4W9IC 3IJYB 2EVGA 3AS0A 3OLEA 2V2XA 1HXYA 4BA0A 2F74A 5AVVB 3DECA 3HZMA 4TPRH 4JRWA 4GAJH 4PTTA 2X05A 1RZ8B 4LGRB 3GB7A 2Z31C 4AJWA 4I77H 4F1SA 4NN7B 1T0PB 2J2ZA 3JVFC 1SXAA 5DF0A 1BJMA 2CBOA 2LR4A 3VXUE 2OK0H 4BQ6A 2WB7A 1U36A 4PTTB 3H4FA 4GNKB 3B43A 1MWAB 2ZAIA 2EDEA 3BP7B 1KMGA 4YPGA 3PP4L 2J2ZB 2XTJE 2VAJA 5B3JE 2WAQA 1II4E 5JPNA 3T3MB 4WO4A 3OL2A 3ARXA 3MV8E 1QSED 4PJEE 4ANWA 3ZMRA 4YPGB 4DN4L 2EYRA 1SN2A 3T0EE 3TA3D 1DL7H 1KCSL 1UM4L 5JPNB 4LSRH 4WO4B 3ABZA 3WO4C 1UTDA 3SDCD 3LMJH 2I7SA 3VH8G 3KPMA 5F1KC 3Q05A 5IESH 4UT6H 3HIZA 2HKHL 3RWJB 3EUUA 4YQXL 4WFEE 2OR9H 1Z7JA 4LBEA 3HAEG 3I02B 4YDVA 5CLXA 2WWKT 2G2NA 1AG6A 4GEJA 3C9NA 1EXGA 2H1PL 3KPMB 1BIIB 1FFOB 4RESB 1KJ2A 4OZGF 3DETD 4UAHA 2IWGA 1A9EB 1DQQA 2BZ7A 4G6JH 4H8UA 4EQ3A 5ABZA 4DUXA 2VCOA 3B83A 1QHQA 1QKZH 1TO4A 4QTFA 2ZCLL 1ZHBA 4ELME 3MRHB 3ECBB 1DLHB 3D9AL 1MHEA 2C3HA 1WA0X 4K23L 4KFZC 5I6PA 4I0PC 5ECGA 3CHXA 3HB3D 4MNQB 2ZOKB 2ZOTA 4LDCA 1ECYA 1ZHBB 2V8LA 4R4FH 1SF3A 4MNHA 4N4YB 4HUUA 3GMNA 4OFQA 2CA4A 1DJXA 3E1ZA 3RX9A 3HLKA 2B3RA 3B2MA 4JFXB 4GAYA 4JY4A 3VXOB 3CBKB 5CCJA 2A6KA 4FFWC 2ESVE 1ZLSH 1LL1A 2AJVH 2IMNA 3D0VA 3F2LA 3U1SH 4DNLA 4HUUB 4QJ5B 3GMNB 3ULUC 1W72H 1YDPA 4JZJC 3WG7B 3T8MA 4K5PA 4YWGL 2WJ7A 2A6JA 3N9GH 2BNQE 3LRMA 5E56A 5A7EA 3UTSA 1MCDA 4DGUA 1U41A 3ZOAA 2A6KB 3LN4B 2WQVA 3CSPA 3RUGE 1E2WA 2FD6H 5DURB 2ICCA 3EGDB 3FO2A 2HVJB 5AFAA 5BV7H 4NO2B 3E0GA 3VXMB 2AQRA 3H2QA 3UTSB 1NLBL 3KPPB 3DV6A 1RAMA 1AC6A 3MRLB 1T03H 3GJFA 3WIHH 1I8LC 2P8LA 4YDMA 4M02A 2ED7A 3T6VA 3FO2B 4RGMB 3VB9A 3MJ8A 4XBGB 3FFOA 2HFFA 1G7JA 3ARGA 3D4ZA 5FV2A 5IBTH 4OCSH 4IRZL 3CFBB 4YE4L 2FQGA 5ESAB 4RFOL 5AZUA 2P8LB 3AQXA 3CFEB 3AG2B 5LXGH 3JUYA 4L3CB 3EYQD 4FQPA 2CCWA 3MJ8B 3AMKA 3HZKA 4U1HA 1DFBL 4IJ3B 1N64H 1RP8A 1AI1H 1RH8A 2AXJA 3W0WD 3ZZ1A 4EN2A 1T1WA 4Z7WA 3EJJX 4WI0B 3R7RA 2BZDA 3TU6A 4D0CB 2H26B 1OCWL 3FF7A 3QJRB 4M7LL 5LNEA 4UMSA 4P49A 1ZOXA 5K9QG 2PMZA 2R69L 4JKKA 3U9PL 2DQMA 5KN5A 3CX2A 3ZTNL 3G5ZA 4J39A 3D33A 4WTXA 3SPVA 3GZKA 5FO7A 1YAZA 2VRQA 3QWRD 1SJXA 3K46A 5PCYA 2HT2C 2P7TA 2FL5B 3H1ZA 4JO3H 1M7DA 5HHOE 5AB0A 1XF2B 4WHYG 4ODBD 3ZY7A 4GSQA 3B2DC 4XMUA 5BUPA 5GIRB 2AABH 4PGJA 3UOAB 4K0OA 1K5NB 4OCNC 2EEAA 3MV11 1E4XH 2WKLA 3APCA 4HPOL 4NNYA 4HP5A 2X4NB 2Z31D 4JPSA 4XXWC 1M7DB 5E2TL 4LCYB 2ZWKA 4Z9KB 3VRLF 1OOWA 2IBZY 3NH7H 1KENH 2C1PB 4BUHA 2ZX9A 2O61B 2ZXWB 2RR3A 2WBJB 4P99A 3COOA 3T4YA 3SGKC 4C4KO 2WYIA 2JCCA 1A6UH 3FO9B 3M17B 4HWZA 5IGXL 1DVFC 4K4KA 5HHME 4NNYB 3BHBA 4CMMB 4IGBC 1JYXA 3HG3A 3MRQB 4LK4A 3ZT6A 3NQKA 4G8GA 5J1AA 2IGFL 4GRMB 4CAGA 3LIZH 4R7DA 4W9KC 4J2QA 3K5RA 3WFCH 3T4YB 3ZE2B 3U2SA 4AQEA 1WAAE 1A1NB 4KMTL 5D7KE 4OJCA 3L9YA 2ITEA 4N90E 4MA7H 3RVWD 3TIEB 5KVFH 3LH9A 1VGKB 4YLQT 1JK9A 5D2LF 4P8QA 4L1TA 1XGUB 1VHPA 4AQEB 2CLVB 1DUYA 2EYSA 3LB6C 1X5MA 2OCJA 5IB5A 3BUQA 3RTLA 3WN5C 4HUVA 4HIJB 1VB9A 1J18A 4N1EA 4XVTH 3FAWA 4PYHA 3Q8FA 1DUYB 4MA3B 2HCZX 3CV5A 2D31B 3WEBA 1CG9B 5DJ8A 5GS2H 5DUMH 3ZTJG 4B5EA 4OD2B 5E6UB 1LEIB 3JWDH 2K9UA 2XY1A 1A5FL 1KYOJ 4GT0A 4NS0A 2VABA 2NUPA 1K8DA 1YZZA 4GW1A 4PRPE 1A47A 1QSFE 2P28B 2DW5A 3THMH 1QMUA 4J2XA 5DJ8B 1HHHB 1ZGLM 4P2YA 3BAKA 3LZPA 3A4DA 2R1YA 3H0TA 4N6QA 2J6EA 1G6RH 4I0PD 1ORSA 3BQUC 3NUKA 2Y24A 1VZIA 4HAKA 4ZXBC 1U8PA 4JFYB 4NT6B 5DQ9A 1UOKA 2CPCA 2ZKXA 3VGAC 3BDYH 2G60L 2F1EA 5FKPA 2IAMA 1SJVA 1WCBA 2R1YB 3IDYC 1MIEH 1UJ3A 4P06A 2Z4QB 3P4OA 1T7YA 4L4TE 4U6XA 4M8QA 1OSZB 5BRZD 3FTZA 1SRDA 4PJBE 5DVMA 1U8PB 4POYA 4JGNA 1MF2L 3ABLB 3QA3A 3TZVA 3MCLH 4FFWD 5CHNA 3HC0A 4FQHA 5FKPB 3ULUD 3VFWB 5ABAA 5FO8B 3SEPA 1QSEE 3ARBC 3P4OB 3QIUB 4G1MA 4G8FB 3WJJC 3BJ91 4TVPE 4D9QE 2AMGA 3OHMB 2FIRT 3NIDE 5DD6A 2XQYA 1I1FB 3QA3B 1NMBH 3TZVB 4IHOA 4FQHB 1QBAA 2IMMA 5IB2B 5E7BA 3VGEA 1N0XH 4JM2C 2YLKA 4NFDA 3V5KA 4KGLA 1FNGA 2ED9A 4XCFH 3F5WA 2OSWA 1VGEL 2GSGB 1HH6B 4IHOB 4X6CE 3HR5B 5HY9A 4FNRA 1E7UA 3ZLQC 1XSIA 5EPMB 1IBGL 3EF7A 3MRMA 5E5RB 3ULUF 3V5KB 5C0CD 2VZUA 4A66A 4QMEA 4KRMB 2BSED 3QRFM 3EG9B 2XYBA 2EH8H 3ES6B 3HUJF 3K91A 5EHFA 2BSRA 5TDNB 5IQ7H 1LNUA 3MRMB 5DK2A 4DOHE 5J0BA 3AW5A 1AP2A 1DQLH 2A6IA 3ATFA 3X12A 4QOKD 2C9QA 2H6UA 4EE2A 5FPIA 2K6ZA 4HJ0C 3P11H 5A6LA 5AZ2H 2NY5C 3BJLA 1ZLUK 4IBZA 2I60L 4B95C 4R90L 2ZZUT 4J3TA 4E42B 5C0GB 2IANE 5DK2B 4Z3HA 4PUBH 3QUZA 4HMCA 1IJ9A 4LPVA 1AQDA 1TZAA 4J6RL 4OD3L 5FYLL 4JBSA 3HZYA 1E3XA 3SGJA 3UAAA 1KULA 4HLEA 1L6PA 1ZLWH 5AYUH 1CLVA 2P5ED 5H94B 5EUOB 1JF1A 3N91A 1ASOA 4XO3A 3OGCB 2ENYA 2HT2D 4U0RC 2QGBA 3B7TA 3QUZB 4P3CH 2QADC 5A2BA 3H42H 5EZJA 4X80H 3CDYA 4JHAH 2VW7A 4XNXL 2KKQA 5E5UB 1X3DA 3ALWA 3HG1D 4XN4A 1JF1B 3U82B 4NSKA 5KVDE 2XIIA 4UOW0 1JNNH 4HIEA 5AWNH 3P2BA 3ARRA 3HE6C 1GH7A 5C0DA 1ERNA 2X9YA 1J8HD 4NWTH 2IIJA 4Z7NE 1JNHA 1VEOA 4JKPH 4LQ1A 4P2OB 1NGYB 1DVFD 4NHCL 5ESQA 4KNSA 4MFHA 5E5MB 1CF8L 5CR8A 3HE7B 4IGBD 1LP9F 1C5BL 2X4OB 1CLOH 5KYNA 3MZTA 5D7JA 5CSBA 4AIZA 3B7YA 3C8DA 3VO0A 2LE9A 1MY5A 1OF2A 1NEZG 2XV0A 1IC7H 4LP5A 4UDTB 3MRNA 5FUOL 1FO0B 2HRLA 4NZDA 3UMTA 4ODHL 5F7AA 4KZEL 2OL3L 4NQED 1FN4B 43C9A 5D7JB 3EDJA 1CDJA 2R7EA 4FKEA 1NGZA 3QGVA 5HYSA 2Y5QA 1OF2B 4ALAL 3BKJH 5ID0B 1YPZF 2A4CA 3LSOA 3KPNB 4XPHH 3FN0H 3LB6D 1AGEB 3ROLB 2CRYA 3EGSB 1ZHNB 3VI3F 2EKJA 2HN7B 1Z3GL 3G9AB 1YNKH 5KAQG 1KB9K 4AVJA 2R7EB 3LX9A 4Z1PA 5HYSB 1QFWH 5SX4I 3R1GL 4I88A 2YRBA 1D5IH 3BP6B 4AWJC 4IKNA 3J7HA 3VM5A 2YQGA 5I1HL 3LZNA 3UDWA 4RETB 1C5CH 1QRKA 3F00A 4HPYH 4X9FA 4Z7UE 3CVHA 6PAZA 4YSCA 3NRFA 3K4AA 3VWJA 4HJGA 5HVGB 1HZLA 1QD0A 2XZCH 4KKPA 1PDKA 3QCUH 1FIGL 3CC5B 3IPFA 4MJ2A 3ULUL 3BZEA 1IAII 4XMXA 4QRUA 4PVLA 3TCTA 3KPQA 4HUWB 2F5AH 3CVHB 4YDLC 4Z8FH 3VWJB 4HJGB 4LIQL 1E8ZA 1WWBX 3BQUD 3AT0A 1XH3A 2KLTA 2AMUA 1B3IA 1Z1WA 5GZNA 2Z92A 3LKOA 1DQDL 1BM3H 4QRUB 4KAQH 4M8RA 4UT7H 3QJFB 3QFDB 4RA0C 3HFML 1LD9B 1TVDA 4PI2A 1DVQA 3T3PB 4B5ZA 5I8KH 3F7VA 1GZHA 3ZHLA 3K8LA 4HHAA 3LZRA 1NEUA 4JGUA 3LKOB 2AJUL 2PCFA 3UIYA 1TQBC 2ATPA 3SDAB 3DSNB 4ZD3L 1KJ2H 3LRHA 3ARBD 3F7VB 1Q94A 2PLTA 3G6AB 4HHAB 4Z7IA 3TV3L 1BAWA 3V79C 1ETA1 2C5DC 3TEZA 5D7IA 2CMRL 4CVZB 1CFQA 4C83A 3Q1SL 1NC2A 3QS3A 3Q48A 2CWRA 1Q94B 4JM2D 1DN0B 4WW1B 3L5HA 1FLTX 4ELKA 2E59A 3KLKA 4LSUH 3SPCA 1J88A 5J11C 3F6IA 1JOIA 2E4FA 1AO7D 4W1TA 1ZIBA 3BEWA 3GJEB 3ZHFA 1IGML 1FRGH 1E5YA 1U95A 3KYKH 4FQQB 3LPWA 4K7PL 2XKUA 3VFRA 4UQAA 4HUMB 3D48R 3QB7C 3IDXH 1DDHB 3MBXH 4ELKB 3KS0J 1TPXB 1EO7A 3MV9B 3A6BL 4MYWB 1VFOA 3BXNB 3NP3A 3O9WA 1UWXH 3BEWB 1W8OA 2AJZA 3DJSA 4NQDD 1ZXQA 2IJ0C 3IE9A 3F6LA 4Y2DB 4HJ0D 4ZO9A 1JCVA 3AGWA 4JM2F 1WO2A 1AJ7L 5DD1L 5IEHA 3FH8A 4L3FA 3LDBC 2WZPA 5DJXB 3M88A 2QBWA 3LEVH 1A6ZA 1UYWH 4ODXB 4FQLL 4JDTH 4D0BB 3EFFA 1IBHA 1KB5A 2H8PA 2BDNL 5JLZB 1RVFL 3H9ZA 4RA3A 2OM5A 1NBVH 2KQMA 1RULH 4MD4A 5DHYA 1NKOA 3E7JA 4D0DA 4KKLC 1QWNA 2Q7YB 1U3HB 5JQ6H 3GJFH 1X5ZA 3BKMH 3I3DA 4P5TB 4B60A 5I1DA 4WUUA 3JBG7 3QUYC 1A6ZB 4OFPA 1T4WA 1HWHB 2CZNA 1PYWA 2H1LM 2PTUA 4NO3B 4Q6IB 4WFHE 3TIDA 2QADD 1H19A 4MDIA 3UEQA 1PD6A 3IFNL 3PQYE 1D5RA 2FECL 4IBTA 3O11B 1L3NA 5K59F 1N8ZA 1W0VA 2B1AH 2UXTA 2FYYB 3ET9F 1RHHA 1E3ZA 3PG2A 3MA9L 2IALB 3Q7JA 5LAPA 1YC7A 3N41F 2VDRH 4WUUB 3HUJE 4GQ9H 1PYWB 4L1HA 4TUKH 3O6MH 3WS3A 3ARUA 3HE6D 4XWGH 5CN3A 5D7SL 4IU3B 5EEZA 1DZ0A 4X4KA 1RHHB 4K71B 1BLIA 1ZA3B 4YHPB 3LZLA 5E0FA 5SWSB 5A2KH 1B90A 2BOBA 5MEND 4FEIA 1SNRA 5A6MA 3DX4A 5IUSA 3SY0B 2JKTM 3P69A 2AITA 1KCRL 5ICZB 3MNVA 2CJ3A 2OPCA 2YFNA 1ANUA 3SODB 1KEML 3WIIL 3C08H 3VI4F 1G0XA 3ILPB 4PWFA 7PAZA 3UZQB 1FGVL 4XOBA 1XAKA 3S2AA 2J5WA 4J3XA 3S3CB 4L8BB 1AC0A 2F7OA 3OB8A 5JIKA 1N67A 4LVOC 1VPOL 4WFFE 1VCBC 5D93C 2EH7L 3P54A 2FX7H 2L0DA 3QEHA 2Q3AA 4LLVA 1D2OA 3CPLB 3H4HA 2VLKA 3NSYA 4WGWB 3QQXA 5IHUH 3H2PA 3C75A 5DJ2A 4QRRD 5DK0A 5EU3B 2VDNB 1BFOA 1S7VA 4XE0A 1QNZH 2PW1A 3TNNA 5EIIA 2CNZA 2OP4H 3QEHB 4LLVB 4IKLA 1XCWA 3P2DA 3LQAH 4FTVA 1QG3A 4MQ7B 4G83A 2GI7A 1BFOB 1S7VB 4DKFH 3O3UN 5FA4B 3GPSA 1R75A 2VSMB 3CQPA 4YUEH 2FR4B 5E2VH 5JDSB 1Q4NX 6TAAA 3RPKA 5IIEA 2WM0A 4GMSL 3MREB 3HG1E 4B53A 2WXHA 3D25A 3F05A 5F0LB 2IDQA 2VDLB 2RD0A 3RVTC 1FYTA 2ORBH 4BWUA 2OLDA 5BQ7A 1B6UA 3MLYL 5A40E 1E4JA 3K74B 1RMFL 1XGTA 9CGTA 3ZSSA 1MRFH 2J1KA 1GJWA 1SXBA 3CC1A 4KJQC 5MI0C 3GIZL 5BS0E 2R29A 4I3RL 3QNYA 3T2OA 2DQUL 3QDMD 3BIBX 5DHXB 1XGYH 5LWYH 2IXQB 1OWWA 1XGTB 1KN2L 3K0WA 4OAWA 4AW4A 5G4MA 5FA3B 4N8VG 4BYHA 3PDDA 4DW2L 2JXMB 1K2DA 1JGVH 3BVNA 5IVNA 2EUWA 1INDL 2AQTA 1N0LB 2Q5BA 1M4KA 1PIFA 1R3JA 4FLRA 5J4MA 4TTDC 5ICXA 3PYCA 4WV1A 5E8PA 3WLBB 5E08H 1N4XH 2VDMB 2ALAA 4Q9RL 1NCBL 5HHQA 3ECUA 2NY5L 3V6OC 5JHAA 3IMUA 4YSAA 2J6EH 1O7DE 3BIKA 5JUEL 4HV8B 5IROA 1PZ5A 1Q9LB 1USQA 3RZWA 3ARFB 5AAWC 3AUVA 4LO9A 4UQ2A 2R2HB 4Y4FC 3OXRA 4GO6B 4WV1B 5F21B 3RB5A 3QR0A 4XP6L 5HHVH 1ZT1A 2WKGA 3U7WH 1WEJL 1PZ5B 4NRXB 2PUQT 3OAZK 4JQIL 4DP1X 2D3JA 3OXRB 4Y1AE 3MUGA 1UOWA 3AWGA 5TQ0L 3TYFB 4UMGA 1I75A 5E4EB 5C6TL 5C09A 2BVQA 2ARJQ 1E5ZA 1NDMB 2APTA 5DMIL 1RUMH 2M83A 5HGBA 1EAQA 4KKNA 4U3SA 3UJIH 1R4XA 3MUGB 3ZTDC 2CBPA 2VLLA 3L1FA 2W59A 3FB6A 2XA8L 1UATA 2F54E 2OYMA 2BVQB 2R1XB 3F7YA 5EIQA 5C09B 1QBBA 4R26L 1NM4A 4Q14A 5HGBB 1EPFA 4KKLD 4YMPA 2PYFA 1ZPUA 3QUYD 1IGJB 2VLLB 4L8SA 2FJFA 3DVNA 3KZ8A 2XPGB 3CXDL 5D1XC 3X14A 5GGSA 4APXA 2XKNA 3AXIA 1R5VA 3BEVB 1S7QB 3D34A 4Y5XA 4AJYV 1E7VA 4FQXB 2PYFB 5DJYA 2VXQL 1JFQH 4JG0L 5BO1H 3GMRA 4YBHA 4C4KT 3SIKA 5CCKH 4WFGE 4HMDA 2FJFB 5JNYA 4XAKE 3MUJA 3X14B 3O6LL 1MZZA 1QFOA 2YJQA 4APXB 2XKNB 2IH1B 4NKDA 5DJYB 3D39A 1NGPH 2I07A 1UUSA 3PWVA 1V3MA 4P2QA 1QR1B 1U8MA 4AT6A 2PTTA 5KSBA 5B1AB 2M26A 1AO7E 2BP5M 3O41A 3T0DA 3PFUA 1HCZA 2UZIH 1L9RA 4X98B 2E7HA 2Q8AL 2I07B 3SYOA 4OSUH 3PWVB 1PLGH 2VSDA 3VSUA 3MAWA 3O2WH 4AT6B 2PTTB 4ZG1A 2DYPD 3JTTB 1JZDC 2CLRA 2Z65C 5C07D 4JRYE 3MKGA 3W82A 4E9VA 4QD2E 1A6VL 5J13B 2D3LA 4JPIA 4U6YA 1IE5A 4TRPL 4MMZB 3BGFB 3OG6B 4IK7A 3S3BB 4AVKA 1WS7A 4LPWA 1QPPA 1XTMA 4EUPG 1MRCH 1NTDA 3NDYE 2J44A 2CLRB 3AXLA 5E8EA 4BZ1A 1B0IA 4PGDA 5KG9A 3IRZA 4HLZH 4HWUA 3A6CH 3TCXA 3D8MA 3JWOL 3N1GC 5D70L 5ISZB 2A9AA 3MN8A 3AXLB 1S9YB 4N0UE 2VQTA 2NX5B 5E8EB 1YRKA 3IXAB 2H32A 3LS5H 4F9LA 2X9XA 3TOPA 5EU7E 2VMFA 3EH3B 3X13B 3ZIYA 3FU0A 3HS0A 2WYTA 2CLZA 1B9KA 3NAAH 3RVTD 2BC4B 1OK8A 3TH4T 2B4CC 3F12B 4JFOA 3ZHKA 1CXFA 3CVDA 3IETA 4AIXA 3KWVA 4HD9A 3A67H 4XCYA 5T3XH 3SJVE 2P24B 3CHPA 1XGZA 4Q52A 3X1EA 1H15A 2AK4E 2DLTA 3IMVA 4TNVF 3TT3L 4KQ0A 2PO6C 4KJQD 4JFOB 4FNQA 3RPIB 3RRQA 1JAEA 3WTUA 2YQBA 5E24E 5CZKA 3BAIA 1KGCD 2YPVA 1YN6A 4YHYB 5I9QC 5FHAL 2J8HA 3BAXA 5EB9A 3CVHH 5F89A 5T1LD 1NUDA 4K5OA 1JXJA 1EEQA 2XNAA 3BO8B 1MELA 1OE3A 4CDGC 5HYQB 4PJDF 4TTDD 3IDIB 3ENEA 3V4LA 3W57A 3IGLA 1YN6B 2JQAA 4J4PA 4P9HL 2DLGA 5EO1B 1JG9A 2BVTA 2CM6A 1IEHA 2J5LB 2XNAB 3V55A 1IKFH 5EOCJ 4WW2C 4ZMZA 1AFVL 4QRRE 3UEZA 3O4OB 4OZHB 4Y4FD 4JB9L 5MEOB 1M7IB 4XNMA 2NY0C 3MPCA 1ZLDA 4TOYL 4MAYA 4PSPA 4O4YH 2YAHA 3HZ3A 4Z7VA 1FNSL 3GBDA 3PV7A 2GJZB 2NQCA 4B3EA 1YG9A 3ULVE 3HG2A 4F8OA 2B14A 3P3UA 5K93A 4XNMB 1S7XB 4MAYB 3VXTA 1ZTMA 2AQNA 2HPOA 4JFFA 4JJOA 3FU7A 5F3FA 1WV7T 1UH2A 1HHGA 3POHA 4PRNB 3WEAA 1QRNE 1OGSA 1J86A 2BP3A 2Z93B 3BKCH 4V1DD 3VXTB 2PP7A 4JFFB 3ZK0A 1YECL 1GIGH 7FABH 4GRWH 5F3HA 2E7BA 4YSSA 3KXFD 2VQUA 3RILA 2AW2A 2NSMA 3N44B 1SHSA 5JIPA 4FNLH 1FGNL 2JJSC 2NY6C 4R0LA 3VQMA 5DYFA 3KDPB 3FQUB 5D1XD 3QEQD 4FFZA 1WZAA 4NFCA 2WZ6A 1AKJD 1OAJA 4YNYA 1NKRA 2ADFL 1T89C 4P4KC 5DR5L 1N5YH 1QFHA 1OD7A 4WY7H 4E41A 1D9KC 4Q74A 2J1WA 4KRPC 3FQTA 3T0BA 4LHUB 4A2DA 1DVXA 2Z7WA 3ISWA 5K1NA 4J3SA 1LO0L 3EXJA 1A4JA 2D8KA 1XZWA 4GS7B 2GIYA 1N70A 1YEJH 2V2WA 2VXTL 4RAHA 1G9ML 1S7WA 2J21A 3GFUA 1U93B 4OIBA 5ACLA 3BLKA 1AKPA 3NA9H 1KB5H 1X5XA 5FHBH 5I74C 4FHBD 3ZR5A