1GYWA

Gamma-adaptin appendage domain from clathrin adaptor ap1 a753d mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
126
structure length
126
Chain Sequence
b'FNDIAPGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQADVPKTFQLQLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA 1 SUBUNIT
publication title Gamma-adaptin appendage domain: structure and binding site for Eps15 and gamma-synergin.
pubmed rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 24
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1gywA00
1W80A 1QTSA 1QTPA 2YMTA 1P4UA 1B9KA 1GYVA 2E9GA 1OM9A 2DWXA 1KYDA 1KYFA 1NA8A 3ZHFA 5CN2A 2VJ0A 3ZY7A 1GYUA 3HS8A 2A7BA 5CN1A 1IU1A 3MNMA 1KY7A 1GYWA 4BCXA 2DWYA 1KY6A 1KYUA
chains in the Genus database with same CATH superfamily
1L6PA 1MRFL 1R24A 3IXAA 1B90A 3BFWA 4GW5A 1NBYB 2FBJH 4QHKI 1ZA6B 2XNAB 4AENB 4F5CA 3ARDA 3O6FB 3DSNB 4H20L 2YA2A 2JKRM 5HYSG 4RAUB 5HJ3A 3ZKMD 5C08A 5F9WC 4G3YH 4Z3FA 2YRPA 4BM7A 4OD1H 4QRRE 2RCSH 4O00A 2BVPA 1V05A 2MKLC 3QIUB 1OGSA 2W9LA 1PD1A 3O6FD 4XCFH 3DETD 1T7ZA 4IRZL 1ONQA 3DIVA 4O02A 4IBTA 4Z7UF 2Z92A 5DHEA 5F0MB 2CA4A 3ZDYF 2Z6FA 3FTVA 1ZPUA 2HFTA 2AHIA 2VDOB 2R29L 3K80A 2XA3A 4OF8A 3SCMC 3WHXB 1MHPL 3QIUD 1YPZA 2HFFB 4JS7A 4AYID 4K3HA 1XD1A 5HHQB 2IPUK 1E30A 1K72A 4LL9A 1NCWH 3OX8B 5FYLL 1RKRA 3RA7H 1B3IA 4UOW0 3D4YA 3TNMA 3GZOA 4OI9A 3VTAA 1ZGLP 3DBXA 1CYWA 5A2IH 3KYOA 4L8CA 3KPPB 3S5LB 5LGHL 2MFNA 1KDJA 4P2CG 2Q2EB 1U95B 4G42A 4NPJA 4HIIB 5E94A 1F90L 1WBZA 4G7YL 4FG6C 2R2HA 2A73B 3FTYA 1AQKH 2RALA 3AG1B 2VOTA 1RULL 3QEUB 5EZIH 4WUKL 4UT6L 1DVZA 2VLKB 4R4FH 3B3IB 4MX7B 1QSEB 4ZPVA 4JFQB 4ONFH 3X17A 1SXCA 1JPGA 4XAKD 2ADJB 1MQKL 3EW3B 4ERSH 1JGDA 1DZBA 4GBXC 3WFHB 2J1XA 1AFVH 5J6SA 2GBUA 2R0KL 4NBXB 4XPTH 2VLKD 3QORA 5DRWB 2AEPL 4RDBA 4JB9H 1QSED 4U3CA 4CU6A 2G30A 3DJSA 5MERA 2WSKA 3GLAA 4R84A 3UTQA 3L5HA 4DUXA 4XBEH 2APFA 4O2CA 1M42A 3Q1EA 4L1HA 1AGFB 1GH7A 4KJPC 3KPRE 3MO1B 4JK0D 5FUCC 1FV1B 3SKMB 3D48R 1ORQA 5K9OA 3PWNB 2N3JA 3QQXA 2ED8A 3TN0C 2D7NA 5DHYB 5AVYB 4XCYA 5C7XL 1KB5H 1ZHKA 3ARFA 4Y16C 1XF5A 5CEXB 5AZEH 5E95B 1IC7H 3GQFA 1CD9B 3DX2A 4Y4FB 4MBOA 4S11A 1IKNA 1CLOL 1YEJH 2ZYSA 3FO9B 5H37H 2WQRA 2LAAA 3RY6C 1E5YA 3HFML 3P73B 3VG9B 5CJOL 2JK5B 5KSAB 1AG6A 2ARWA 4A37A 1SMAA 2H6PB 4WKZA 5G5DA 4U1KA 2FX9L 2W0FA 3RFZB 4UINL 5GRJH 35C8L 4Y4FD 1ZHNB 1D5BA 3B43A 2V2XB 3ZZSA 2EE2A 4Z7UA 2ZX5A 4WV1A 5KSAD 2WLHA 3QJXA 1JPSL 4MZIA 5EZOL 5AWNH 1EERB 4GAGL 1U58A 4HS6B 3BQUC 2JXMB 1BMZA 1QX1A 5CUSH 1QFWL 1O6SA 3L5XL 3CFEA 3AY2A 1NCAL 2LAGB 3PJLA 1Q72L 5ENWB 2F7OA 4WFEE 3UJJH 3HS0A 3IJEB 2J73A 4Y19D 3VI4B 4G59C 3UCRA 3TCXA 1KNOA 2ADFL 2ZTBA 4NQEA 4XE5B 5JA9A 3OMIB 1KELL 4F2MA 2AJXH 4GG8A 4YXLH 3WKNA 4CN4A 3LRLA 2FEDD 5F7AA 3L9EA 2OMVB 1JNHB 2K6WA 2WCGA 4TUJA 5FKPA 4ALAH 12E8L 4B9JA 2AJ3B 4ZMTA 4Q2ZB 3GD1C 4U0RC 3C60B 1F41A 3W39B 1MCSA 1KTKE 4WY7H 4K3JH 2Q20A 3B6SB 3BPOC 3KZ8A 5FYJL 2L8AA 5LXGL 4Q9RL 1DBAL 2Q76A 1HEHC 4X80H 4NDMB 4OCSH 3MLTB 2B5IB 4P4KC 4QXUH 1JDDA 3HCVA 5E9AA 3C60D 4HJ0D 4WU5B 5K1NA 4BHUI 2WZ6A 5C0BD 2OMUB 4KK8D 4LLWA 2PCFA 3C08L 4TLKA 3TH2T 1UD3A 1UH4A 1KENH 2I7OA 3IFOA 4RX4D 4UILL 4XNXH 3UTPE 1ED3B 2YJQA 5CR8A 2A9DA 4X5XA 5AL8A 2YRZA 4YMPA 3CVDA 4LSPH 3CZGA 2F0CA 3QFJE 1ETZB 1G7PA 3ARPA 1DQKA 5EC1B 3ZE2B 4KXCA 4P04A 5CEZL 4MB4A 1BXAA 1EQWA 4FQ2L 3TJHC 1LO2H 3N44F 5BOJA 4Q6KA 5DK2A 2Q7AA 5C0JA 4KRPB 2Z1PA 1F3JB 1SJEA 2FWUA 1J1OH 2QTEA 5DXWA 3S0PA 1VB9A 3ZKQD 5DJDA 4ZS7L 2R8SH 1FFOB 4BSWB 2K3HA 1JWUB 5CF3A 1FRGH 1HI6A 4U1LA 1U8HB 1AGDB 4QLRA 4PJIF 2E76C 5AKRA 3RNKA 4KRPD 1S3RA 4P57B 1LEGA 5CILH 3WUZA 1J86A 1P7QB 1SMOA 2AV7A 4BZ2L 3KLLA 3EHBC 2XT1B 4UTBA 1Q1PA 1V10A 4K3DH 1B9KA 2F9BT 3N41F 4UCFA 4EI0A 3DYPA 4JUSA 3OQ3B 4IOIB 1G6RH 3VRLE 4K9JA 4Y5YC 2DQTL 1TZ8A 3LS4L 4OLYH 3ZTJH 5ILTL 3EH1A 1P7QD 2E4FA 1VACA 3UTZA 1O9ZA 5FYKH 3VXQB 4EPSA 2QKIB 5I66B 1CFBA 5HHVL 5JXAH 1QSVA 3PAZA 3NEOA 4OIAA 4Q89A 3ZHLA 4JPQA 2CO7A 1GGUA 3HZVB 3HRZB 3D3VB 5FM8A 4KXZI 3JWDL 1MIML 2X4UA 4CC0A 2AEOA 3IAQA 3X1EA 3AXHA 1YG9A 3C5ZB 2G3ZA 1G43A 2IPKB 5KUMA 3BCDA 3W2DH 5I6XC 2NNAB 2W65A 3G9VA 3TIDB 3ZY7A 4CILA 7CGTA 1XBRA 2G5UA 1TJMA 3UC2A 1A8ZA 3D3VD 3M45A 4F15C 5ESAA 5EBLA 3VMOA 1NKRA 3V6OC 3WNOA 4A39A 4E9SA 3MRJA 4KRNA 3MREA 2YXFA 4G5ZL 4AL8C 3C5ZD 3SGEH 5I9QC 2NY3B 1XCWA 3HG3A 4L5FH 4PJXE 3Q48A 2MHAA 4N5EC 5B1JA 4HETA 3OKLA 2ZYRA 3ZU8A 2VT0A 1AQMA 1EDYA 2XPZA 4X8CA 3SYQA 4KH9A 5AEAA 3BT2H 3DOIA 4H7VA 2NY3D 4FI6A 3BP4B 3CCHB 3T0EC 5I16A 1KBKA 5DJZA 1PZ2A 1P2CB 2O1AA 4N1HB 2ZXBA 3UP6A 43C9B 1N3NB 1MW0A 1NEUA 1A4KA 3D39B 4PCTA 3RU8H 3UCQA 2R69A 3V7AE 4G72B 4KQ4L 1ZVSB 1MFCL 4ZTOL 4OZHF 1C8PA 4HWBA 5HDQH 3N0PB 4EVNB 3VH8G 5HHNB 3SDYL 5EOCL 1QFOA 3LVEA 2YEVB 2YAPA 1U92A 1OO2A 1WF5A 3VB8A 3QO1B 4QRFA 1CS6A 3HNVL 3B34A 3D39D 3EFFB 1PZBA 5C97A 3DYMA 3V5HB 4ABWA 3HHSB 4P9HC 3RWDB 3IGLA 1E9QB 1QBLL 5J89A 3P1VA 4OM0L 1JV5B 3MOQA 3WFBH 4Y2DA 5F7NC 1LLAA 3ZIMA 4HU8A 5E0FA 5I71C 1OALA 4HULB 1H0DA 3U1PA 4LDOB 1SDAB 3VDAA 4BFKA 4XC1H 4YBQC 4F24A 1TUPA 1N2RA 5F8QC 1VHPA 2PWGA 2E0PA 3BAXA 1H6FA 4Q8BA 4U1MA 4Z77A 4JKNA 1HX0A 3WSQL 3UPRA 2GJ6A 4AX3A 4DVRH 4HF5L 2R56L 3GK8L 2YGPA 2VW4A 3IXTA 4MXQD 5CINL 3BH9B 4LIQH 5F7UA 2J55A 3ALXA 2JJVA 3EZJB 4JMNA 4P5RA 5G4OA 1V3LA 3AFLA 2BP0B 3RVXD 5F71A 3PL6A 4ODTL 5FDWA 5HVFB 3K8KA 4EAEA 1ZDSA 4TSCH 1T1YB 2Q8BL 3UO1H 5DCCA 4FCHA 4Z7QF 4J3OH 2YD8A 5JXEC 4ZUUB 2F19L 3PRZA 3DKHA 4Z7VB 5KOVC 4KZEH 3KAAA 4HYTB 3BSHA 4AITA 1QFUL 1SN0A 3TT3H 1Z3GL 2A9NH 2C4XA 3DRQB 2BNQE 4P9MH 1Z9NA 3ESUF 3HBPA 5FYLD 1J5HA 1JZ3A 1NGZA 1PFOA 4ZSOE 1IM9A 5TH2A 2ZCHH 3QIBB 4DQAA 1LK3L 4JFDB 5E70A 1A25A 1E65A 4ZO8A 2J88H 4MAYC 2IVFC 1F4WH 3B9KA 4GG6E 5IW6A 5C2BH 3Q3GA 3QR2A 1LE5B 2ATKA 2LV4A 3FUEA 5AYUH 2WXKA 4RAVA 4QJ3B 2AQ2A 2XY2A 4NZRH 3HI5L 2V17H 2V7HB 3X14B 3SOBH 1OGAA 4Q14A 1IC0A 3QIBD 5HBBA 5BO1H 5KEZA 2HJLA 3AG3B 4JFDD 4D7PA 3OV6A 3QJZA 4HKBB 4K4KA 4K8RL 3L3IA 1JZ6A 4EOWL 5IROA 1CDYA 2BC4A 3V4PH 4W68A 3BFQG 1T6VN 1IBGH 5CMAA 5TDPB 5IT2L 3JVFC 2AJZA 2WCSA 4Y4KC 4OZGB 2WQWA 3OKOB 4Z5RA 4R0LB 4OZHA 5FOBB 4PJAE 3MLXL 3PJSB 4EDWL 1BVLB 1TJGL 3P69A 4OQTH 4X4YA 4ZMLA 5E2TL 1YQVH 3SDAC 3N2JA 2NXZD 2WO2B 1XCQB 4KK9C 5EUOF 2YKKA 1NAMH 1N5YL 3II1A 5HGBB 4A2GA 5JYMA 4X4ME 4W6XB 3O6KH 1DQLL 4KFMA 2Z31A 4EI6B 3ZSTA 3MJ8B 3WE1A 4LSTL 1TETL 3FUNA 3QWRD 5DD3L 5ISZE 2VAAA 2J6EH 4GMTH 4OUOA 4CW1A 3AREB 4HK3N 1EGJL 3CDGA 5D55A 1MFAH 1G1CA 4A66A 3T65B 5ADOL 1GCFA 4PGBB 4E9XA 4OI7A 3BGFC 2R4RL 4KKBC 1RPUA 2DDQL 1YVLA 4XC3H 5EDSA 4AGNA 3GLZA 3LHPH 3GZQA 5IMKA 3ZGHA 3MLYH 2X12A 1D5ZA 5C07B 3ARED 4TNEA 1KBVA 4BH8B 4WUUE 1F02I 4P23B 3QUMH 2VXUL 3BPNB 4KUZL 4R8WH 5SX4I 3HBZA 3OWRA 3MUGA 4MQXC 2EDFA 4FQCH 2ZOWA 4MA7H 4PH8A 2QPDB 5G4MA 3QNXA 4I9XA 4U3XA 5C07D 1IBHA 1WV7T 2CKBA 5E6YA 1BP3B 3TCTA 1CU4L 2XKSA 4Z7WF 5MEPA 3BDYL 3D85A 4P23D 5DHMC 1P7HL 4JFSA 5LJYH 2X42A 4NSKB 1JNNL 3BP7A 3FU3A 1R0AL 5EU5A 5IBTL 5FHAH 1NMAL 1I8IA 3F12B 4YNYA 4H2AA 6PCYA 4OCLC 4N2DA 3ARZA 5DHVB 2BK8A 2ICWJ 5KSBE 3DDGA 2ZF9A 4WTXA 3GSNL 3CHOA 1K8DA 3T08A 3X3GH 3H0TA 4QTIH 3IDIB 1FL6B 3ULVL 1NUFA 2NY6C 4HDIA 5FO8B 1X9RA 1HSBA 1JZFA 4FNQA 4JM2F 5FYJD 1RUAH 5FM4A 4ZXBA 2EVIA 1ZV9A 4HPYL 5L9DH 2COVD 2EYRA 4QNPE 3E8VA 1YJDL 4B5ZA 4B7IA 1PG7H 5AW4B 1MOEA 1QR4A 3STZB 1I9RL 3O9WC 2N01B 5IEKB 1ES0B 4JDZA 5BW7A 1D7CA 2IANA 5MI0B 2B1AL 4HH9A 4GNKB 5F0LB 3LQAC 5GRVK 4PLJD 5CHNA 4AYBA 1OAXH 1BOGB 3DBSA 3IBEA 3EYOB 4M6NH 2P5WB 1GHFH 5F2FA 1MRDH 3FFCB 3VQMA 3EYUH 5E9DE 2I07A 5LWYL 5FXCH 2F6AA 5EUOA 1C5CL 3L3HA 4LOEA 4M7KH 5LAXB 3WIHA 1D6EA 4OFKA 4OIBA 1VFOA 1HILB 5CEZD 4QUOA 3BVUA 3A6OA 4ELMA 4MZRA 1XBDA 5ABAA 3B7TA 3SKOA 2P5WD 4H8WH 4PJ8C 4XB3A 3FFCD 1DQTA 4NQCE 3MRRB 4W9LC 1R5VB 3QZOA 3UYOD 2APBA 2VNCA 2UYLB 3K6SB 2H1LM 5AFAA 1UWYA 1ZIAA 2R1YA 3HEIB 4NS0A 4TNVK 2VIRB 1KIUB 3DX8A 4NQVB 2QZ5A 3O3DA 2MCPL 5CJQL 1IO4C 3FSZA 2AQQA 5DJ6B 2Q7YA 2I9LA 3T1FA 1MJ7L 1PZSA 1OK8A 2P5ED 4G8GE 1PFCA 1IAOA 4GRWH 1H8LA 2PCPB 3WFDL 2BJMH 4OLUH 2DWEB 1HYSC 5TJWK 2XKNB 4PGCA 4MXWL 2CK2A 2GTZA 4FNRA 5E5LA 1HDMB 3IFLL 3BLPX 4PVMA 2WWKO 3GXMA 5HI4C 4LVOB 4NFCA 3ARBA 1IEBB 4YHIB 4NJAL 1PNCA 4Z7WA 4C55A 4ZD3H 3L4XA 4ANXA 4QYOA 1FGVH 3OZ9L 4J3BA 5CP7B 4GRMB 4PJDB 1AS7A 1N9PA 4LSDA 3U0WL 5GJSH 5LDSA 4HS8L 1TQCC 3BSZL 4MMZB 4HKJB 5IOPB 2P8MB 1JTOA 4RIRB 5CBAA 2VLJB 1GZQB 2EE3A 4WSGA 5BRPA 3LKRB 3S5ZA 4GQZA 5GS0C 3UZEC 5EH1A 3LKQB 1DP0A 5ACZB 1QLFA 5F0JB 2OFQA 5E6IA 4UAOB 4JM2A 1QRNA 5AVQB 2EKSA 3BD5A 4ANKA 4BZ1H 4NWTL 2VLJD 2BZCA 3CXDL 2IBGA 1ZKAA 3ZYZA 5GZOD 4WFGD 1BJMA 3VD9A 5EBWB 1X5ZA 1K4DA 5KN5B 3RX7A 1KZYA 2IWEA 2WJ7A 3OKKB 3P9LB 1P9MA 3PWPB 4J8RB 4KGJA 1T21A 3DYOA 3K1KC 5DK0A 5MEOB 1XHHA 1ORSB 2AP2A 1N0XL 3KEHA 3MRHB 3WAJA 1DBMH 1DFXA 5DS1A 2WXJA 1BZDA 2HN7B 1E7VA 3P30L 3PWPD 1E4WL 4O2FB 4QRRB 4UQIM 4YDNA 3LKNB 2Y1YA 4KITB 4JZOA 4GYBA 4WZ9A 3SHSA 1DJHA 3GSXB 1NTDA 2DKMA 1EAPA 1ZVYA 3LZQA 1SF3A 3CC5B 5ERWA 3VXRE 3BE1L 4AYMC 3DSFH 3AC0A 3U83A 1U8OB 1XCTB 3WN5B 4QRRD 4NNYA 2VM9A 2NSQA 3OR6B 3OXSB 1ZHLB 2DM3A 3FTWA 3UBGA 5JZ7C 1XAUA 4N2NA 2GAZB 3C5SB 4I2XA 1K85A 4R90L 3UJTL 2IFGA 1ZS2A 4M43L 4N2IA 1QLEL 2RR3A 5J0BA 2YQBA 3V55A 3FZUD 2A9MH 3VFSB 3TOPA 1VENA 4XNYH 3P77B 5FUOL 1MCNA 4YDLB 2TRHA 2GBAA 1NBYA 1ZA6A 2XNAA 4AENA 3FT4B 1RJLB 4M48L 3O6FA 3V0EA 3DSNA 3MLVH 5CM1A 5L4IA 5HP5A 3Q8EA 5FLVA 3HN5A 4RAUA 2CRMA 3NSDA 1FYHB 2YFNA 4R5VA 2GW5A 2XN9E 2VXQH 1CDUA 2GJZB 1IFHL 3A47A 3IRPX 1EHNA 3QJSB 2NY5H 3DTDA 3QO0B 3QIUA 3BZ5A 2A6DB 2HVBA 2MIZA 2OKMA 3A6BH 3N1MC 3O8XC 4DUVA 4U49A 1OCWH 4BFEA 1GYVA 5A2FA 2NY2C 1KEGH 1SY6H 3UGUA 4K2UL 1E3FA 2PMZA 3WHXA 2DLEA 1MVUB 2EDNA 3B2UC 2D7TH 5E5MB 2HFFA 1KGJA 4XP1L 1P4BL 2HZHA 3N1QC 2Z4QB 3X3FL 3KPRB 3OX8A 3VI4F 1SN2A 5B7MA 3G08B 3JWOL 1OQXA 4GO8A 1G9NL 2H3KA 3ARXA 3KPPA 1U33A 5EU6E 3S5LA 5JQHC 1WWWX 1D6VH 3G5VB 3PXJA 3DX0A 3VGAC 1U95A 4FNSA 5JIQA 5HGDB 4HIIA 1ZGLB 1IBYA 1A64A 4K8RD 2A73A 3DUSB 1F42A 3E9TA 3T77B 5EPMB 3W11D 2JQAA 1FFQA 3F3HA 4GAJH 4BFRA 2HYMA 3QEUA 3Q1SL 3QHFH 2EH8H 2EO7A 1CTMA 2VLKA 1WT5A 3B3IA 2K1MA 1QSEA 4MX7A 4R26L 4CVZB 4JFQA 4FEIA 4KJYB 1JPEA 3ULUH 2ADJA 2JJSA 2O6PA 3FL7A 2MTPA 1MLCB 1CXFA 1CXIA 3WFHA 3ILQC 1Q0XH 3QAZB 4HAGA 5DMGC 5DRWA 3MLSH 4LXFA 1CFSB 1B0GB 3NIGE 1ZEAL 1XZWA 3RX5A 3VXUE 4APXB 5IHWA 4OJFL 3ILDA 2VZOA 4O4YL 2XN1A 4DH2A 1AGFA 1O6TA 1FLRH 4LQ1A 1XMWA 1I3GH 3FN0H 5I2IB 3MO1A 1JMZA 5E7BA 2XXGA 2DMGA 1FV1A 3SKMA 3ZE2F 3EH3B 2C9SA 4KHTH 5TDNB 1TR7A 3PWNA 1DUZB 2P48B 3R1GL 5DHYA 2ODIA 3FT0A 1EH9A 5BO0D 4WFED 1IT9L 1IIIA 5CEXA 3IDXH 4Y4FA 1MCQA 1BMWA 2HFGH 4LF3B 5LLIC 2BWDA 3FO9A 1TJIL 5D6DC 4L8BB 4BSJA 1CZ8H 1J1PH 2NTSP 3SDXE 3P73A 3LIZH 5HXMA 1CI3M 4KH2A 3NJVA 5DLML 5KSAA 1WQVT 5E1HB 1VCBC 2K3TA 3KCPB 4G8FB 3V8CA 2FH8A 4AC2A 5IGXH 1OHZA 3QXAB 2YPVH 3RFZA 1ZHNA 2EC9T 3DECA 4G8EB 1TQVA 4AYSA 4Y7MA 5JNYB 5JHBA 2V2XA 4P8QA 4ODWB 2OL3B 4Y19A 4LLAA 5AW5B 5D1QE 4UT9L 1HJBC 4G6MH 1U4FA 2C5DC 4HS6A 2DQIH 2JXMA 2OX5B 2X2HA 4D0CB 1JXFA 5FYKE 1AGCB 4EUPH 2VXTH 1TITA 1BCIA 3NPZB 5ENWA 2EIJB 1QUPA 4L4TE 5FDYA 3DUUB 3CXHJ 1ZE3C 3VI4A 3L4TA 4WRLA 3QFJB 2QQLH 2NCEA 1I9IH 3UTPD 3F2LA 3HI6H 4XP5L 4AMKH 4N8PA 4F7PB 2GT9B 1VFBB 3WO3B 2OMVA 2H45A 3KYKH 1TVBB 1JNHA 4Z76B 1L7TL 3ULVD 4HUXB 4JG9A 4G9FB 1GMEA 1AIZA 1YEIH 2AJ3A 1NGPH 4Q4IA 1UG9A 2MQGA 3QFJD 5AW9B 5C6WH 4JNXA 2KS0A 1SXZA 2G60L 4Q2ZA 3C60A 2OA9A 3CVHL 3VWJB 4P2OC 3W39A 2ENQA 5C0BA 1T89C 5CZRA 3B6SA 2RB8A 1E4HA 4L5FE 4B95C 5CBEB 2B1HL 4X6DE 3EDFA 1AXTH 4G9FD 4FMFA 1MHEB 4NDMA 2AMGA 4H26B 3L4WA 3FTXA 5DMIH 4G7SB 4WU5A 3VWJD 2QHRL 2OMUA 3K2KA 3AB0C 8PAZA 4N0YH 1E6OL 1U42A 2HA1A 5D72H 1ED3A 1M6UA 4YHKH 2OV0A 3SKUD 3PPSA 1ECZA 4LK4A 1KACB 2D3NA 2OPCA 3FRPB 1OAKH 1G1KA 3HB3D 2JCCB 1ETZA 5AALA 1E5CA 1ERNA 3FOLB 5EC1A 5HDWA 2X1XR 3DARA 4G3YL 4HFUH 4B27A 4JHWH 1DVTA 1JNLL 1RZQA 3TBCA 5E4IA 2RCSL 2W07B 1F3JA 3MOAH 2YD4A 5F7MC 2QV4A 5FWRA 1QKZL 2BSRB 1NLDL 1RIUH 2F7IA 5LG6A 4N8UA 3MGOB 1YC7A 1U4EA 5LCVL 5HYJE 2F8OA 1FFOA 4TS6A 4ZOBA 4BSWA 1JWUA 4UTAA 2RMNA 2WW8A 3WJMB 1U8HA 1AGDA 1UOVA 2IOOA 3GGWA 2EDTA 3QIWB 2ID5A 2RTTA 4HK0B 4NC2B 4DEPB 4DP8X 1A3LL 4URKA 4KJWC 1NM4A 4P57A 1JFQH 1P7QA 4I7ZC 4PD4J 1XT5A 3HNSL 3Q8BA 4PJXB 5BVPL 2FJGB 5K1JA 3VWKB 2Q5BA 1NCWL 3VD1A 4H25B 4IOIA 4FG4A 4LL1A 2HLFC 3CN3A 1HHKB 4LIQE 4BKLB 1G7MB 1MDTA 4OGAC 1XF4B 3H55A 3NVQA 1OAZH 2CAKA 1GGYA 1P4LB 2V9TA 3VWKD 3VXQA 2ZWYA 2QKIA 5I66A 1RIHL 3NK4A 5LBSH 3NFNB 3FQUA 5CNHA 1AIFB 4PJBE 1XVSA 3HZVA 3HRZA 3D3VA 1NGXB 5I28A 2WLLB 4YC2B 4Z7VF 3EH2A 4ONFL 3NJKA 1EZLA 5IJVB 3PLYA 5EBGA 1FC2D 1BM7A 3BUDA 2FL5B 3C5ZA 2IPKA 3WD5H 3GHEH 2NNAA 1IL1B 2Y1AA 3TIDA 5AVXB 1YYLL 1UA7A 4XTRC 4K71C 3QA3B 4RH4A 3F84A 4XP9H 1IC1A 1PS3A 2A2QT 3KJ6H 5GISH 3MRGB 3UZQA 3U4AA 4XBEL 5F9AC 4PGZA 1GAFH 2NY1B 2YK1L 2VSKB 1FWXA 5FK9B 2ORBH 4WK0B 5CSBA 2V5SA 2DM2A 1C5DB 3EUUA 2R51A 3CLFH 4GB9A 4RA0C 4YEEA 1KB5L 3BP4A 1O5PA 3CCHA 5AZEL 2NY1D 43C9A 1P2CA 1QLEB 1N3NA 3D39A 1T2QH 5ADPH 4MJJA 1JF1B 5FFOA 5I1JH 4OZGF 3TO4B 1ZVSA 3Q8CA 2YSTA 2Y5TB 4EVNA 1HINH 3D69B 5HHNA 1WSST 2J5WA 1QO3A 4DIXA 4PRPE 3BW9B 3GBNH 5GRJL 1IC4L 2BNQB 3QO1A 3FU8A 2DZEA 1UWEL 4FHBD 1ZDQA 3D34A 3EFFA 4XP4H 3VCLA 3QCUH 4ZSOB 1OP9A 1ASOA 1U8NB 3TO4D 3V5HA 3HHSA 3RWDA 3HG5A 1E9QA 5AWNL 3WTUA 4FFTA 2AEQH 1OOAA 2ZCKH 4GG6B 4B9CA 1IGJB 3HS8A 1IC5L 1JV5A 5GQBA 5HPMB 2BNQD 1JCKA 3NAAH 3UJJL 1UCBH 4JRYE 2NDGA 3EXLA 4URTB 4FI8A 3MUJA 4AL8L 5B38B 2AJXL 2QVTA 2R29A 5EIIB 5FW6A 1LTXA 1XGZA 5DA4A 3BH9A 4ALAL 3RVTC 4QCIB 3CV5A 4LRNH 4KI1A 5K33A 4ADGA 1T1YA 3BWSA 2WGXA 3QEGH 3L9YA 4K3JL 4PJAB 4QHMB 4ZUUA 4L29B 1J5DA 4Z7VA 4NLHA 1RZKC 1FAKT 1SDDB 1N6QH 5GHWH 5E6ZA 3NZHH 3WI9A 4X80L 1Z3RA 2EEXA 1EVUA 2H0JA 3DRQA 4OZIE 4OCSL 1E42A 4QXUL 2CG9X 5IJBC 5J6HB 4UT6A 4ANWA 3QIBA 2RGSA 2J21A 1WFIA 4I1RA 4JFDA 3WS3B 3U9WA 1KENL 4XNXL 3EOYG 3QQ9C 2F5BH 3DX7A 2QMKA 2ZAIA 3MBXH 4ZW8A 4P49A 3RKPA 2BSSB 1I8MB 5KS9B 1E0OB 4P9HL 5ISZB 3ML8A 1YEDB 2UVFA 1IGYB 2V7HA 3X14A 4EZKA 2OI9B 1WDAA 1MW3A 4RNRB 4HKBA 5E2UH 5LQBH 1PTZA 1IQDA 1JFHA 5BOPA 5KG9B 1F0LA 1NIFA 5FCUL 5ISZD 5TDPA 3CU1A 3Q9QA 4M9PA 2CO6B 3TBTB 1HK6A 4OZGA 3OKOA 1AXSB 4R0LA 3AGVA 2E74C 2ZKHL 3ZKND 4BGDA 5FOBA 5C0EB 1FRGL 5EF2A 3PJSA 1KTDB 3A4FA 1BVLA 5DJ0B 4N0RA 4JG5A 1JYWA 3N50A 2WP3O 4NNPL 1ACYH 3QWRA 1EJ6A 4K3DL 3FHQA 1XCQA 4JQXC 4WWPA 4ZUVB 3SCMD 3DXAB 5HGBA 2Y1ZA 5EO0B 4XNUH 2FJUB 1GY2A 4LCWE 3MUY1 3T8VA 1TIUA 2G5BB 4WCYL 5INCB 4EI6A 4HUVB 2CO3A 2JB5H 4OLYL 4XN8A 3MJ8A 3TWCH 5KSBB 5FEBA 2X40A 5D1ZI 1YNLH 3NJJA 4GP8B 3DXAD 2DF3A 1ET5A 2BVEA 2WXGA 4G6AD 5DJ8B 3AREA 5JXAL 3VFGH 3T65A 2KLRA 4PGBA 3MU3A 1MLBB 4IMKC 3ARQA 1E3ZA 2X38A 1BLNB 3MLZH 4GRWE 2P26A 4X98B 1KGXA 5FGSA 2PPAA 4AGOA 3TYGH 3BGMB 3GXDA 4JFYB 5GRWA 1A3ZA 3PP4L 4X8GA 5C07A 5PAZA 5DR5H 2Z93B 3H2PA 4DSYA 2DJUA 2EC9U 3H3KA 3IAPA 4BH8A 4P23A 1SLWA 4C59B 3VYNA 1RIVL 4HJJL 3ELAT 2H5UA 3B9DA 3MKKA 5E9DB 5LAPA 4OCRH 3CVHB 3NA9H 4ZZKA 2E7LC 3IGUA 3LMJH 4PJDF 3OHXC 5IG7B 4RFNB 4NSKA 1RZGB 3WDIA 1LO0H 1TCRB 3C5XA 4KJPD 5E00B 1E6JH 3F12A 4NQCB 1JD9A 3PDGA 4HEMA 1T1XB 5DHVA 4HUUB 1MZZA 2W59A 2YBRB 1AZZC 3RU8L 2UXGA 3CDFA 4M62H 3IDIA 5IJKA 2QR0B 5FO8A 4ZO9A 4I0PC 1DLFL 2GJPA 1CGYA 2Y4SA 3KWTA 4NQCD 2R0WL 2OJEB 3STZA 2CXKA 4G8GB 1U0QA 3V4UL 4J3XA 3BQUB 5IEKA 1ES0A 5DMYA 2EEBA 4OCMC 2L0DA 2YN3A 1DN2A 1FYTE 2GK2A 4MDRA 1M6OB 1XIWC 1BOGA 1N67A 5C0CE 3EYOA 1NDGB 1QSFB 2P5WA 3U46B 1T03L 5ACLA 5F88B 3FFCA 1KYFA 4G8GD 4LEBA 4NRXB 2Z7YA 2H3XC 3WFBL 1BIIB 3BQUD 3QUGA 5LAXA 4L1TA 1HILA 1PIFA 5KYUB 2AJUL 1QWUA 3QUZC 3ZR6A 1QSFD 1QASA 1KG0B 4LHQB 4BZ2A 2ATPB 4U0RB 3DPDA 2K8QA 5E2WL 3MRRA 1Z2KA 1R5VA 2ESVB 4GW4B 5K1VA 4BXSV 2UYLA 3MNDA 2IPUG 4NZJA 3K6SA 1AG0A 3OJVC 4B9FA 2VIRA 1KIUA 5KVEH 4NQVA 2WWMD 5EIQA 4FXTA 1F1GA 4AG4H 1CO1A 4PWJA 2VDKH 1H3PH 1X9UA 4P4KB 4ONHB 4OU3A 1IEHA 1XFPA 2QPEB 5DJ6A 2ESVD 4ISVB 4W9JC 4YIQB 4L3EB 5B39G 5IESH 3TT3L 5AOJA 3T1WA 3ZOAA 4I77H 3X12B 1S5IL 2VDQH 2B4CC 3KYNB 2PCPA 4WI2A 1H3VA 2ZCHL 1NDMB 1KXQA 2I32A 1BZ9B 1FL3B 2DWEA 2J88L 2XKNA 4P4KD 4X5PA 5E4EC 4LNRB 3EO9H 1HDMA 4LCVA 1KTBA 4L3ED 3DO4A 4AUJA 4MVBC 5AYUL 1M2VB 4YHIA 4HIJB 1IEBA 1LQBC 1OAUH 2V17L 5CP7A 1BZ7B 2C9RA 3INUH 2ZF8A 4GRMA 4JR9H 4PJDA 5KZCB 3II3A 1FZJB 5BO1L 3V5KB 1CE1H 4MMZA 4HKJA 2NXYB 1JRHI 1F4HA 4HOZA 5E56A 5IOPA 2ADIB 2VQTA 2P8MA 3JTSB 1KJ3L 4RIRA 1QMUA 2VLJA 4X7FC 1GZQA 3WNNA 4A7SA 4CC4A 5GZOA 3LKRA 1NM9A 4X9GA 4YSOA 5DC4B 3QUKB 5KYYB 5F7EL 1ZPLA 3LKQA 1WWCA 1YEFH 5ACZA 5JQ6L 3QUHA 3GIZH 3KMDA 2HG5B 2NXYD 3EHBB 3G5WA 2BRRH 2CO4A 1XR8B 1KB5B 3X1FA 4MKTA 1NCDH 3HG1E 3FBKA 4MKMA 4M29A 5EBWA 1BF8A 4Y5YB 1HFUA 5KN5A 4F8LA 2RJMA 2YAQA 3PWPA 3P9LA 1FLTX 1NAML 3MOBH 4J8RA 4LCYB 2VDMH 2FB4L 4ZQTA 3EHBD 5MEOA 3P54A 2GTQA 5EN2B 1TMQA 1ORSA 3UG3A 1PQZB 3ULUE 1VGEL 3MRHA 4JG0L 5GGTA 5E1IA 4H0IA 3MUUA 2CIIB 1FO0H 1CR9H 1S7QB 3NZSA 1IMHC 1IAMA 3VRJB 3TPUB 2HN7A 3N3EA 4O2FA 2YMTA 2X88A 4QRRA 2HVKB 4WI8A 3LKNA 3GIVB 4AE0A 4P5MB 4XWOC 3GSXA 1GKOA 2HRGA 5KBMA 3N04A 3CC5A 2OTWB 3HMWL 1KWKA 3O6LH 4PVLA 1U8OA 1BQ5A 3AWEA 1XCTA 3B9EA 4RGOH 3PQYE 1WC7B 3RY4A 3OR6A 3OXSA 1ZHLA 1E50A 2OTUB 3HAEB 3LXUX 4DKTA 2R4SH 5AUMB 2XIIA 2GAZA 3C5SA 2ZP9A 3V0WL 4JM4L 1SVBA 4CKQA 3QUML 4NHUB 1P6WA 4H40A 4R7DB 1W6WA 3E3QE 3R8QA 5IFHL 1P6FA 3KCWA 5GS0L 3VFSA 5EU6B 3O6MH 3CX5J 4GQ9H 3WG7B 1J5OL 3P77A 2APVA 3NTCL 5HD8D 4LPYA 4ZFQA 5AW3B 4Z7IA 1GTFA 3FT4A 1DJXA 1RJLA 3D8MA 5I5MA 1JGUH 4M3HA 3TFKC 4X42A 4CBZA 4N5ED 2DD8H 5EU6D 4IHBA 4DKEL 3QWOA 4KQ3L 4FERA 4DF9A 4I3RH 1MCEA 2IH3B 4RMBA 3X3GL 1PDKB 2GJZA 1TMCB 4D9LH 3I9AA 3BWUC 3QO0A 2WUBH 3QUYB 2A6DA 4DGUA 4MDIB 4OKDA 5FFGA 3QDGE 4S1RH 1RUAL 3A4AA 3MCLL 3VFOB 1FVEB 3T8XB 4XN9A 1URLA 3PG2A 1PG7L 1R6VA 2GYSA 3GNMH 4KMTH 5AAPA 1MVUA 3LH8A 4R3SB 5E5MA 3QUYD 1JZHA 3ULVF 4Z6AT 3AJ7A 4C58B 4UNTA 2X4SB 2Z4QA 1OAXL 1OT1A 4RDQG 4DUWA 4BA0A 2G2PA 4Y1AE 1GHFL 3G08A 1EHXA 1RV6X 3ZRCC 2A77H 3G5VA 3MLPA 1KGYE 2WLKA 3KJ4C 5HGDA 2MQCA 1ZGLA 4M7KL 3GKWL 1EXHA 2WTPA 3S36H 1E9OB 3ESOA 1HH6B 2HAZA 3E6HB 3DUSA 3T77A 5DZLA 5EPMA 1EXGA 3SDXB 4EIBA 4H8WL 4YBQD 3OPZH 1CK0L 3QDMD 3KS0H 1FI8C 4E2OA 1J1XH 3KLDA 4DP0X 1Q1JH 4CVZA 3CSPA 4KJYA 3NABL 3FHEA 1Q0YH 1KT2B 3UTTE 1UASA 1Z5LB 4I9WE 3K74B 4RWYL 2X4TA 2X2JA 5JHAA 3WKQA 1MLCA 1TJHL 1L6XA 1BZOA 4PSRA 4CJ1A 4PJFE 3HR6A 1CFQB 5D1QB 4MNGE 2X2IA 1NIAA 1J18A 2Y7MA 4U1NB 3ECUA 1CFSA 4N2AA 4ZMAT 1B0GA 5CCKH 3BD4A 2IFFH 4APXA 2HRPH 4DK3A 3D25B 4MAYB 3D09A 2JKNA 3EXJA 1ZK9A 4W70A 2ZWLT 4PCKA 4DGWC 1PX4A 3ATBA 5GS1B 3V0GA 1NSNH 2JJTA 1HZKA 1D5IL 5D1QD 5I2IA 2BJML 3WTVA 3K0WA 3FUFA 2JCCF 4QHKJ 2QVMA 2O5ZL 3K6NA 4KZCA 3ZE0E 4OIFA 2W60B 4U4IA 3WFEH 4AYEC 1LEIB 1A3QA 5TDNA 4IBLT 1DUZA 4MAYD 4KY1H 4MSWB 5HJBA 4YSRA 2D7QA 1BG1A 4P5TC 4LF3A 5GJSL 1OQOA 4ONGL 4L8BA 1BVNP 4LLQB 4BCZA 1AMXA 2QL1A 4NAJA 1MJUL 4MJID 2YMXH 1U8IB 5K93A 4G8FA 3KCPA 5L2KE 4X6DB 1NOLA 3QXAA 1KLGB 2GBVA 5IVNA 1F6LL 1URZA 3SYOA 4G8EA 5GGQH 3ERXA 5LBVA 1U21A 1ZCRA 2JKIS 3LN9A 5JNYA 3EYQC 4PJXF 1TSRA 4ODWA 1YNKH 2OL3A 3CN4A 4HOXA 1Y0LB 4C57C 1N7ML 2KQNA 4JFPB 2IALB 4AZ8B 1G9MC 2OX5A 4D0CA 2YIHA 5I1DB 4OZFH 3IDYC 1AGCA 2GK0A 4QRPB 3DGGB 4ZFGH 2WO3B 3VJ6B 3S37L 1CB4A 2ZUXA 5GZNC 1INQA 3DUUA 4HAFA 3SDAD 1WS8A 2P3YA 3QFJA 3WLWC 5K59E 4WIQA 1DBML 5F1IB 4QRPD 4F7PA 1WAEA 2HRLA 1VFBA 2J1YA 3KWUA 1TVBA 3GI8L 4WNSA 3BGFB 4Z76A 4HUXA 4G9FA 3IE9A 4LEOA 2Y23A 4XCNB 4ZOCA 4ZFZB 1T83A 4TVPH 1FCCA 3P40A 4WWKC 4GKNB 4O5LH 1VF5C 4BDVB 2DICA 2CHXA 1UJTA 2M26A 4F27A 4YBLB 2XX0A 3VWJA 4ES8A 1ZK5A 3M86A 1EHLL 4NO2B 1BDYA 2QSTA 2OR9L 5IR1B 4Y8AA 1UJ3C 1ETB1 2YRBA 1GTNA 2C9XA 1J48A 2H7WA 3DV6B 3FTZA 1MHEA 2OBGA 4H88L 4PCSA 4P5KB 5E6SB 2EUXA 3CZFB 1SMDA 4H26A 5HDLA 4UIMB 2BNUB 3E8UH 4XVJL 3FRUB 1IGFL 4TMPA 4LFHG 4XN2A 5T8IA 2A9ML 3H56A 4XVSL 4XNYL 1TCMA 3IDNB 1HCFX 3ARSA 5CJ5A 2DTML 3O3AB 1JGEB 2JI2A 2VO5A 4MQXD 4XPGL 3RB5A 1UM6L 3FRPA 1HHGB 2Z7WA 2NSMA 4E42B 2Z35B 3CFKB 3MLVL 2JCCA 4XAWL 3G7TA 2QEJA 1NIEA 1FBIL 3FOLA 3CFUA 1PZ5B 3FCTB 3PGFL 2IXQB 3MGTB 4ZYKB 4OTXH 2JIXB 2CGRL 1U3YA 4K0OA 4N6RB 25C8H 2BDNH 2W07A 4GO6B 2EE0A 2BSRA 3JUYA 3MGOA 5AOKA 1NC2B 3A6BL 1JHLH 1PKQE 4RMRA 3S5YA 1SYVA 2KBGA 3UAAA 1NBVL 2NY6D 4Y88A 3WJMA 2BY1A 1KEGL 2JIXD 2R69H 3QIWA 4HK0A 3VU2A 3S34H 4GG6F 3BZEB 3SY0B 2K7PA 2Z7ZA 1WCQA 2D7TL 1KXVC 3BSZA 3P3UA 4FQPA 4PJXA 3M07A 1OCCB 2FJGA 3VWKA 1JUFB 1KBGH 1NC2D 1WZKA 4NO5B 2PPDA 4N2LA 4H25A 1EA9C 4HJTA 1IBBA 3FFOA 2W94A 1HHKA 4BKLA 1YEGL 1G7MA 5DQ9B 3MPCA 5LUMA 5AVTB 1XF4A 4FMKA 1D6VL 1OTTD 1UM4H 2K45A 4XMPH 3VD3A 2NDFA 1P4LA 3WNIA 4JFFE 1GOGA 3IMBA 1C12B 2DQUL 5IB1B 1BWMA 4S0HA 3NCWA 2H8PB 4GAJL 4DQOH 4ODUB 3NFNA 1PMYA 1AIFA 2F1AA 3H4HA 1CT8A 4L0YA 5C6PB 1NGXA 2FQGA 2WLLA 5I15L 4PJAF 4E9YA 2R0ZH 4PRPB 3ULUL 4UAHA 1WH0A 5IJVA 1NAMB 5FUZL 3PWVB 4HUWB 2FL5A 3MNWA 1KGCE 1MFBH 4LHJB 1AGEB 1FGNL 3L3OC 1IL1A 2QSCL 4YHOH 3KNBB 3U30C 1JERA 3QA3A 1XGQB 5PCYA 3LPPA 4UIKH 4NERA 4W4OC 3FSOA 4HG4J 3MRGA 4JW3A 3PUCA 1SGKA 3V0AC 2RAMA 2Q0ZX 4YSAA 3QC5X 5KS9F 1CICC 1V3KA 1OTUC 1VZGA 1YN6B 2XQYA 3BLBA 1FLRL 5FK9A 2IGFH 3M46A 4U1GC 1ITBB 3S3PA 3FN0L 1KCSL 2BIIA 2ITCB 1H8SA 2YN5A 3W9DB 4M1CC 2FO1A 1C5DA 1UQSB 3B56A 2EIEA 3UL4A 2LE9A 3MRBB 3IDXL 3QUMB 1HWGB 2FT8A 1MNUH 4A2LA 2E8YA 5J7CC 1JF1A 2F53E 3MLRL 3LIZL 4P3CH 1SHWA 3BAEL 3CFJB 3M6DA 3TO4A 2CJ3A 1BQHG 2Y5TA 3D69A 3TEZA 3L4ZA 4WEBH 1F3DJ 4TKWA 2O61B 2AGJL 1ZXKA 4FOMA 3BW9A 3U48A 1UACH 4NPYB 2BNQA 3RB7A 2YWYA 1RUML 5T33L 3EJQA 4ZSOA 1GJWA 1K6QL 5GS0D 2HXAA 1U8NA 4PG2A 4G6ML 2J43A 5D8JL 4GG6A 3NCMA 1IGJA 1ULVA 2VXTL 4BGLA 4FA7B 5HPMA 4FHJA 4HXAH 3D05A 2X4OB 5KSBF 1IRAY 2YPKB 3CLWA 3W38A 1FNSH 1BZQK 3H42L 3PE9A 2QQLL 3MRQB 1I9IL 2EH7H 1PG7X 5EIIA 1PKOA 2NY0B 2P47B 4QNPF 2NT0A 4JBSA 1ZMYA 2CK0L 3APNA 3IEAA 5D7KE 1JCVA 1CF8L 3DX6B 4QCIA 4NRZB 4KAQH 1NGPL 1X4XA 3GRWH 1K4CB 1RLBA 2PR4H 3OJDA 5I1CL 1D9KC 3VSTA 1WUZA 3T4YB 3BRFA 4QHMA 4PJAA 3UDWA 4L29A 2NY0D 1RERA 3SE4C 4JM0A 4A6YH 4NZUH 3CVIH 4ZW5A 1KEML 3JWNG 2CLZA 2QADC 2ZAHA 1YEKL 2K4AA 2Q87A 5DMIL 4NC1C 3K5SA 5J6HA 5JZ7D 3H9SE 2RFXB 1V7NL 3WS3A 4LCWB 4B50A 4N0YL 3TGXA 3VXTB 4Y9EA 5BJTB 2CUHA 3HPJB 5DZAA 4Q6YA 4E36A 1I8MA 2BSSA 4DFHA 5E24E 5DJCB 5KS9A 5ISZA 2QQKH 2V9UA 4FXGC 1YEDA 2UZIL 3OKMB 1IGYA 3N9GL 2DQEH 4R96B 2ENSA 4BFIB 1GPOL 3O2WL 2BXZA 4LCWD 4RNRA 1EFQA 1NBZB 3QRFM 2NZ9C 1A7BA 1G0XA 5KG9A 3EG9B 3C2AL 4JKPH 1U3HB 5D2NC 5HHPB 4JY5L 4NQUA 2IMNA 3F7QA 1HKLH 1CLZH 1INEH 1NMCB 1XB3A 2CO6A 4YZFE 5B7EA 3TBTA 4F8QA 4JFHD 3PDOB 2JQMA 3SCMA 2N56A 4Z0BL 5E8DH 5C0EA 2FQDA 2VM4A 3D2UD 4Z8FH 5DJ0A 1KTDA 4I13B 1J88A 1EXUB 4DPCX 1OIOA 2FQEA 2BIMA 2V3EA 1U3HD 3BN9C 3U6XA 2NY2D 5HI3C 2BSBA 3CZKA 4ZUVA 2QQQA 3DXAA 5KBKA 5HTSA 1JGLL 5EO0A 1NEZB 2FYVA 3MNVB 4P2QB 3OZKA 1A6UH 2EEDA 2G5BA 5INCA 1WFMA 4HUVA 3OR7B 4PJ5B 3L3KB 5KVEE 2I9TB 5KSBA 4PB9H 4JCMA 3VH8B 1NCNA 4X7EC 3E38A 4TVUA 4Z23A 1KIRB 2A38A 4UT9A 2YUVA 3L2MA 5DJ8A 4NZ8A 2C1OB 1AZCA 2A7BA 4P2QD 2WHVA 4XMXA 2GIMA 1MLBA 4QPEA 1QTYT 4XX5A 4PJ5D 1P0SE 2BHZA 1BLNA 1P1VA 2X2YA 4X98A 4AQEB 2A4CA 1MCKA 4FAAB 3TIEA 3S37X 3BGMA 3WD5L 4JFYA 5EG6C 4FP8L 2Z93A 1FYTB 1T5KA 3BPCB 4WFHE 4YGVB 3MYJB 5E4AA 4N85A 2BFVH 5TTRA 3VXNB 3GEFA 4GLRI 5C0CB 3DOHA 4WTZG 1PY4A 3KJ6L 2Y3AA 3UAFA 5DMGD 2X3AA 3WS6A 3TLRA 4KRMB 3NQIA 5E9DA 3CFMA 4J39A 1FYTD 3CVHA 3MZGB 5GGRY 4BJLA 2OW6A 5EA0L 3WJLC 3CJJA 4KMQA 4FNPA 5B3SB 1HE8A 4OGYL 5C0CD 3US9A 4MA1C 1RZGA 1J9RA 1ZTXL 1E2WA 1TCRA 5E00A 3F62A 4OFIA 4PY8I 4NQCA 4GQQA 3RY6A 2OMZB 1T1XA 3EJTA 2EKJA 1ZLDA 2YBRA 3GUTB 1DSYA 4FXLA 3LNFA 4NM4H 5ADPL 2QR0A 4RMVA 2M83A 1DQJB 3VFUA 1GW0A 3QPKA 3RLSA 3TBVA 2OJEA 4G8GA 3TEUA 2AQ1A 3BQUA 4HEPG 1LO5B 3QCUL 5FYJU 3FO0H 3QCTH 1M6OA 5EFIB 2D3LA 3PFUA 3D0VA 3RG1C 3L7FB 1NFIB 1NDGA 1QSFA 3OTTA 3U46A 1M4KA 4R7VA 5F88A 4NRXA 1OAYH 1NL0H 1C5BL 1BIIA 3NAAL 5I8EB 2EABA 5TF0A 3BXNB 2AZUA 1LQSR 5LCVA 4FZEL 4DN3L 3QCVH 3PXLA 5KYUA 2GI0A 1MJ8H 4XXWC 2WLZA 3TPKA 3WDJA 4Y7OC 1KG0A 4PHZA 2ATPA 4DKFL 4KX8A 3VGDA 3RGVC 2ESVA 3PGCB 3QG7H 4GW4A 4JCLA 3D0AA 1QRKA 4YE4H 4NOBA 5CKGA 4N28A 1HXYB 1OARH 3MGAA 2JB6B 3WMSA 4AEIH 2HT3C 1P5VB 2ZCZA 4P48A 1UH3A 4LASL 4P4KA 4ONHA 3AT8A 1ZTMA 2X0UA 4HIEB 1D5RA 4ISVA 1N6QL 4YIQA 2XUWA 3NZHL 4L3EA 4WEUD 4E9LA 2XQ0A 1VZIA 1C7TA 3HN8A 3DHJA 4WUUB 1NFDE 3X12A 4XBGB 3NIDE 4JY4B 1UWXK 3KYNA 3OVUB 2Q1EA 2WOYA 1NDMA 4B9ZA 4A04A 1T0NB 1BZ9A 1FL3A 3ZTDC 4JGJA 4LNRA 2XRAL 1BEXA 3LJ3A 2F5BL 2DM4A 1M2VA 3GBDA 1KCUH 4HIJA 4F8PA 1J0IA 3NPSB 4AEFA 4WUUD 5CSGA 4FYQA 1TTBA 4J12A 4NO3B 3CMGA 1BZ7A 3P3TA 5AAWA 4UM8B 4KO5A 1FZJA 3V5KA 2GTWB 3FONB 3DI2B 4G5AA 2YD9A 2ZNXA 3ULUD 2NZIA 3GMNB 5LQBL 2ADIA 1WBXB 3JTSA 3W0WB 1G87A 1ZS8B 1JPFB 4KVNH 1MFEL 3PQYB 4RESB 1R9FA 5IFAH 2VSDA 2PPEA 3QUKA 5KYYA 3P4LA 4G6KH 3PUUA 5ICYB 1DJWA 1IUZA 1AKPA 1M05B 2FNWA 4OLWH 2HG5A 3PAYA 5EEXA 2HSIA 5C0RL 2APTA 4Z7UE 3MAWA 2ZAGA 4XPFL 3W0WD 2Q86B 3WXVL 4EQ3A 3ZHFA 1XR8A 1KB5A 3NH7L 5CLYA 2Z0UA 3PYCA 4Z3GA 3IKCB 3HE6C 4M6AA 5A3IC 2D31B 3BZ4B 4DGYH 4Y5YA 2A9CA 1ACYL 2LR4A 5BMFL 2VDOH 3L81A 1BFSA 5ICUA 4XNUL 4GXFA 4DZ8B 2B59B 3A67H 1KMGA 5EN2A 4DGIH 2EDLA 3SDXF 1PQZA 3BSGA 1XX9C 4F2ME 4GXVL 1MJJB 2WKGA 4A7GF 4G8IB 2Y1VA 2CIIA 1TTCA 1S7QA 1XXDC 1M7XA 4OGAD 1HOCB 1GGCL 3VRJA 3TPUA 1YNLL 2HVKA 2H3NB 5DC9B 4P5MA 1HNYA 4HSAC 4ZW7A 4HVBA 3QDGB 2P46B 4Z95L 2ZKYA 2E7BA 3Q0HA 2PABA 4QRSB 4EUPB 5LXVA 2OTWA 1BEYH 3TURA 2XCMC 4K71B 4IM8A 4DKDC 3TYGL 1WC7A 4QXGL 1XGUB 2XTJC 4JJHA 3BCFA 4PS4H 4F7TB 3V6OA 2OTUA 3HAEA 1OANA 2ITDB 5DR5L 5AUMA 5A2CA 1VGKB 4LPTA 2AKRB 2DIBA 4NHUA 4R7DA 4YHNB 1HESA 2WBWB 4XCCL 5DD6B 1L0QA 5M7QA 2CGZA 2H6OA 4JHAL 2E9IA 5EU6A 4B7LA 1QWHA 3TFBA 4WLCA 5HGAB 1ROCA 4FADA 1JL8A 3NA9L 3QZWG 3Q05A 3LMJL 3NGBB 1CQYA 5SWZE 1LO0L 3LVTA 4PWIA 1E6JL 1OD7A 1HL4A 3PF2A 3TTSA 3ZYOA 4YDMA 1E8XA 3AS0A 3VXOB 1VPOH 1L9TA 1RZPA 2AXHA 2IH3A 3QUXC 3MXVL 1PDKA 3KGUA 4X6DF 4XMKH 3UTTB 2IQ9H 3QWNA 4FQXC 4ZUTB 4U1HB 3QUYA 3EH5B 1TYRA 4MDIA 4PJFB 4U3SB 1GGBH 4AQ1B 1ZIBA 3FB7B 4MNGB 4X5WB 3VFOA 1FVEA 3T8XA 1OLZA 1DCLA 4TTDC 3STLB 2ENYA 4AGLA 4K94H 2DL2A 3NCJL 1RUQH 4I9WD 3P02A 4R3SA 3VTMA 1WFTA 4M7JH 3SPCA 2X4SA 1A6VL 2YA0A 3LKPB 1KFGA 5DVKA 1E4XL 4JO8A 3QRGH 2QLVB 3ZE0B 3V0HA 4F8NA 3QDMA 2PF6A 2K9UA 1QYGL 1RPQA 4TVPE 1WLHA 1T1WB 4GAAA 4HK3J 4EXKA 1E9OA 1HH6A 3E6HA 3KLHC 4JJ5B 4P07A 5IBUG 4HBCL 4G7QB 2DB8A 3AQYA 3U1SH 3SDXA 1A47A 4YK4C 4A7GA 4WHCA 3RIAK 1O5DT 5DT1L 4KVCH 4M5ZL 3D2TA 5L2KB 2HB0A 1AKJD 3MRFB 4LQFH 5B21A 5D71L 1KT2A 3W81A 4C4KO 1Z5LA 4HSQA 2DN7A 3RWHB 1CCZA 5L6YL 1FCGA 2EDYA 3LS5H 3T0WA 3RVTD 2N7SA 3KPMB 2CLRB 2Z0BA 1GRWA 2G3XA 2VDKL 1CFQA 5D1QA 4B0MM 4U1NA 5L2KD 5DZ9A 1HJCA 2UZPA 5IESL 4OFPA 5I1EH 1DFBH 1MCPH 1AE6L 3D25A 4MAYA 3DTXB 1HWWA 3PIQB 3TWYA 2VDQL 4RZKA 3O81A 5GS1A 1A2YB 1OGTA 2W0KA 1LDSA 3BN3B 3VACA 5AL0A 4AI7A 4PMFA 3I02B 4M7LT 1CE6B 1BGXL 3CX2A 3EO9L 2W60A 1LEIA 5DEGB 3D5OF 3AQDA 4YEFA 2WYTA 1K2DB 4ODHH 2YHGA 1B2YA 4MSWA 3QQ9D 3BUYB 3INUL 3RDTB 3HNTL 4FN0A 1RJYB 1A7QL 1GS6X 1X5FA 2A4ZA 3BKMH 4AUYA 4K15A 4LLQA 1JPTL 2APXA 1U8IA 4WO4C 2D2OA 1AS8A 4JPKH 1LNUB 4X6DA 3ZBMA 3JWNC 4MA3B 1U30A 4V1DE 1KLGA 4S1DD 1D7DA 4KI5C 1YEFL 1A14H 4J8QA 1M53A 1DEEA 4PQXA 1Z5YD 4NIYE 4PP1D 2HTLC 2WVVB 3SDAA 2PWEA 1Y0LA 3QHZH 4CUCA 1KYUA 1VCAA 4JFPA 2IALA 4AZ8A 3SE9H 4PJIE 2CZNA 4FJ6A 4BUHA 5IVXE 3DVFA 4KNUA 1IVLA 3Q01A 3DGGA 2YGVA 3E2HC 4NO0B 4QRPA 5I8KL 3VJ6A 4UTAH 1W16A 3ET9F 4H2CA 2A5UA 3MOBL 2C3WA 1IZJA 2VDML 3ZYJA 3L6FB 1UWXH 1I3RB 2Y5QA 4LB8A 1U6AH 1JZ5A 2QGCA 2R0LL 4NZTL 2FIRT 5DO2C 3H53A 5F1IA 4DJMA 2GJ6E 4NO0D 5DQJB 4YE0A 3IETB 2D3VA 1A21A 3MNMA 4LSVH 1WZMA 3KH3A 2TRYA 1NCCH 2OSLB 4XCNA 4ZFZA 4P5SA 4BDVA 3LXBA 1PKQB 5HY9B 4QOKB 5JLZB 1NUNB 4W4NA 4AIEA 3KBPA 5IR1A 2BIQA 5ITFB 2AZAA 3G5YB 3D12B 3DV6A 3D1MC 3QQDB 4P5KA 2XXCB 3QYNA 4NUMA 1RFDL 5IFJB 3CZFA 4W9FC 4UIMA 2BNUA 4QOKD 3T5WA 3SD2A 3FRUA 4L1DA 3CFIC 3D4ZA 1COBA 3OHXB 3IDNA 1G7JB 2VL5B 3O3AA 1JGEA 4JFFB 1W0YT 2VW6A 3ML9A 3SDCB 5JOPE 4J3TA 1HHGA 4P46C 1G9ML 4FC3E 2Z35A 3CFKA 4E42A 2WAQA 5FGBC 4KRLB 3GSOB 3BWAB 4IW4C 5GGRB 2V3DA 1PZ5A 3FCTA 4ZYKA 2IXQA 3MGTA 4I0PB 2VDRL 3ARRA 4I3RL 1B6DA 2JIXA 4MXVF 1G5AA 3GS4A 4U6TA 5E99L 3BWZA 5J12B 4N6RA 3SDCD 2VB5A 3CGTA 3MA7B 3WTXA 2D4DA 1QI3A 1BYNA 3V9CA 4JE0A 3BT0A 4L3CB 4UTCA 3JXAA 4BZYA 1NC2A 1OZTG 3JQOB 4D3CH 4OZHE 1KY6A 2F5AH 3TASA 4I0PD 5C0IB 2N7BA 3AXLB 2NR6A 4LAJH 4JO1L 4HLJA 1M3JA 3SY0A 3BZEA 3SEPA 1RHHB 1KGCD 2DQHL 1MRFH 3ZJAA 1E2VA 1WEJL 1ECYA 3GBML 2LOEA 4YO0B 1NANH 3K7UA 1JUFA 4NCC2 4CMMB 3ZL4L 3RWFB 4WI5A 4NO5A 3UYPB 2CKNA 4H20H 4ABUA 2LFGA 5DQ9A 2K8MA 3HUJF 2SODB 3SGJC 3QUZB 2H32B 1R34A 2K6YA 4JDTL 1H8NA 2EYTA 4HMDA 4A68A 1SBBA 1KIQB 2A0LD 1C12A 3AWFA 1TQSA 4HJ1A 1DDTA 4X7CC 1B4LA 5IB1A 3WIIL 2H8PA 4RGNE 2QSVA 4ODUA 3OPZL 4IRZH 4Y9BA 5DZJA 3P11H 3PDDA 1IKFH 3OSKA 1J9CT 4HCIA 1Q1JL 3QUZD 3MSPA 1NAMA 3PWVA 4HUWA 2KZBA 1MHPH 1AGEA 1R3KB 3KNBA 1UXLA 2YFOA 2DQGL 5FYLH 1XGQA 4AMWA 1JZ4A 3HMXL 3WELA 1PCXA 1THAA 5CCKL 2IFFL 1B3JA 3RWGB 2J6EA 4LGRB 4YDIL 5E2VH 1RXLA 4XBPB 1E4JA 1KJ2L 1YN6A 4OJCA 1F90H 4G7YH 4BV1A 4UOJA 2Y7QB 2ITCA 4YWGL 1PY0A 1RULH 1NUDA 3L4CA 1UB6B 4WUKH 1UQSA 3ECQA 4UT6H 2WUCL 5AW2B 4B9YA 1Q9KB 3V2AR 2W0PA 3MRBA 4YSUA 1HXKA 1MQKH 3QUMA 3DX1A 4H1LH 3CZEA 3R06B 3KGSA 3NDZE 2DQJL 2DEWX 3UZEA 3CFJA 4TVSa 2R0KH 3ATAA 2AEPH 3TV3L 2HTKC 2O61A 3G9AB 3FAWA 4EN2A 3BDXA 4NPYA 1N64L 4RBPK 1MELA 1H6TA 4HGKC 3WKYA 1S7WB 4ZX6A 2IANE 2RD0A 2EIDA 5DWUH 1YNKL 3CZUB 3DNKA 4FL4B 3H9SB 1HQRA 5I75C 3SYPA 1DLHB 5TQ2H 1CDGA 1M1SA 3H85A 4QMEA 3NOIA 2X4OA 1SBSH 5I1GH 2FNBA 5LGYA 2CMRH 1YAZA 2P8LB 5FO2A 5BV7C 5I1HH 3A6CL 4HBQA 4QTFA 3H9SD 3OGCB 4CVUA 1CLOH 3MRQA 4CSSA 1B88A 4KO6A 3WNPA 4WHYH 4IBZA 3W1ZA 4JN1L 1UD6A 5CJOH 1GS8A 1IV8A 4IRSC 1JYNA 1YY9C 3HA0A 2OYMA 1A9VA 4ECNA 1RU9H 2EIKB 3DRTB 3TV8A 2FX9H 3DX6A 4IKIA 4YDJB 1L9MA 3PU7A 4UINH 5DRXA 1OW0C 2CJSA 3RFRA 2PYFB 4TVPL 1K4CA 1AO7B 2EXWC 3MJWA 1B9ZA 3S97C 2QVFB 4WW2C 3T4YA 4QWWC 5CLWA 2F68X 4XWOD 1JPSH 1ODUA 5EZOH 2IG2H 4N5UA 4GAGH 3KXFE 3W9EB 2XU9A 4L8SB 5IM7B 2MTAA 4JPVH 4LHUB 1QFWH 6TAAA 3L5XH 3VXME 2DMKA 1EK3A 1NCAH 4JMXA 2KMWA 3K6FA 1AO7D 3E8UL 5EEWA 3CZNA 3C12A 3DVGB 1Z1WA 2RFXA 3OL2A 4LCWA 4UT7L 1YSOA 2FWOB 3D51A 3VXTA 4FKHA 1KELH 3L9RB 1AC6A 5BJTA 2PXYC 3HPJA 4LHUD 4AGPA 4MMXC 1KBBA 4JQVC 3OHMB 4D7BA 5DJCA 3OKMA 2VDKB 1OD9A 12E8H 3Q2NA 4R96A 5TE6L 4BFIA 4M3KB 1GJUA 2VABB 4IIZA 1NBZA 4X6EB 4BUGA 4TOYL 3IVKB 1I9EA 4UWQB 3HC0B 3OG6B 3EG9A 2VDQB 4YHML 1RK1A 2ZD0A 1U3HA 2BDNL 5FYJH 5HHPA 3QULB 3GRBA 5LXGH 4Q9RH 1DBAH 3LZOA 2Y24A 3WENA 4A2FA 3U2IA 2LTQC 4ORGB 3PDOA 1CL7L 3S3DB 2J3SA 2XTJE 3FNKA 2IADB 1YZZA 1QRNE 5AD0B 1DVUA 4LGSB 4HXBL 2I5YH 3C08H 1EXUA 3WUWG 2E6PA 4ETQB 2Y06L 1U8PB 1QD0A 1SDYA 4OB5H 5IOKA 1MCWM 4BQ6A 3ZQWA 1NMBL 1NFAA 1WD9A 1X5AA 1KBGL 3KJ4B 1ZVHA 2WQUA 3TYFB 2HUHA 1NEZA 3MNVA 4P2QA 4M00A 2AJVL 5A6LA 4NN6B 3JBG7 2WLIB 5SWSE 5CEZH 1M3IA 4BUQA 3OR7A 4PJ5A 3VGHA 4BCYA 5C92A 5F7BA 3L3KA 1UM4L 4FQ2H 4XMPL 5BRQA 3RWCB 2I9TA 1WWBX 2L7JA 3VH8A 3ZX1A 4P2RE 2VRAA 1KIRA 2HJKB 1P69B 2VXSL 2GKIA 3VW3H 2C1OA 4X0KA 4JRXE 2J5LC 4ZS7H 5T3XL 4UOZA 5EEVA 3RL2B 5DLLA 4AQEA 2FX7H 2VDMB 4IJ3C 4XOEA 2JFCA 1FNGB 3NG5A 2XOTA 4BQBA 4BZ2H 1FYTA 1MY5A 3BPCA 1WD8A 4I2XE 3MYJA 4YGVA 5KBLA 4PSPA 2BNRE 3VXNA 1N6UA 4WWOA 2ZOOA 1FO0B 2JELL 5C0CA 4JX0A 2BY0A 1YCSA 2V9QA 3ULUF 3NEXA 2DQTH 3N42B 2X28A 2FCBA 2ICWB 3LS4H 2J1KA 2VCOA 3S98A 1LEKB 4G7VL 2A9AA 3LPOA 3CDZB 5BUAA 1CGWA 4ZMOA 2D2CC 5EU4B 4X5RA 4RMQA 1LJMA 5HHVH 4P5TB 4DPBX 1F97A 2AQTA 1HAUA 2EE9A 4U0QB 3SJVB 4FI7A 5D6DA 2OMZA 1AI1L 1NCGA 1MCJA 2J8UF 3KDMA 4JFOB 4ZPVB 1MIMH 1T04B 2E7DA 2VJ0A 3GUTA 4N2EA 7PCYA 3ABKB 3FQWA 3UEQA 3FOMB 4LARL 4LU5L 3J7HA 4AZUA 1HHIB 1QEWB 1RZ8B 4P5TD 2XYCA 4KXZH 2WQ8A 3GB7B 4MGXA 3SJVD 4WEBL 3BC9A 3C2SA 2RBLA 4DO5A 1IZKA 3ATEA 1SYSB 1UACL 3KBEA 5DD5L 1S7TB 2N59A 1NFDB 1UB5B 2D7OA 1LO5A 3NIDB 4EXPX 4C47A 5DSCA 1CN4A 2KZWA 2BP3A 5EFIA 2VDRB 3L7FA 4LAQL 2VXQA 4XR8C 2CHWA 1NFIA 3SGDH 1JOIA 2WQXA 1MNNA 2YGNA 5I1IH 1UADC 4Y5XB 4TNVF 5I8EA 2BMKA 1XF5B 1FNSL 2HWZL 3BXNA 4I3SH 1KC5L 3MCG1 4TULH 3QS3A 2Q10A 2BWQA 3UH8A 2FX8H 4KQ4H 1A6AA 3B7SA 1TU2B 3WLWD 5K39B 4JFTA 2VLKE 3OLGA 2R23B 3O2DL 5DWPA 3SDYH 3T0XA 1U2YA 3ESNA 3PGCA 4YHYC 1PEWA 2FEEI 3TESA 32C2B 1AQDB 3GRWL 1HXYA 2WXLA 1UJ3B 2PR4L 3HNVH 2JB6A 1BD2E 3RGBA 1P5VA 43CAB 4MJ2A 2PYEE 5I73B 1IARB 4HIEA 1YO4A 2MNWA 4WK4B 2CBPA 3CDCA 1XMEB 5FV2A 4OM0H 4MJ5B 4EN3C 3S36X 5F0PB 4RBPH 1MREL 4WUUA 4XBGA 2GIYA 4P06A 1I1YB 2B7DT 3PNRB 1T0NA 2YSSB 4PTTA 4Q9BA 4AQZA 2CHNA 2KZ1B 3WSQH 4CA4A 3FUJA 5E0QA 4JGNA 2BY2A 4E9QA 5AZ2L 2R56H 3GK8H 2OR8A 5FKPB 3FCUB 1FNHA 4NO3A 3KVQA 3O0RH 2P80D 4LEXL 2EE6A 4YFLI 2XFGB 2DM7A 1GZHA 2GTWA 1BLIA 4PJFF 3B2DC 3GMNA 4AKPA 1HOEA 5IW3A 3W0WA 1ZS8A 2F19H 3TVMC 1KJ2B 4ZTEA 1AR1C 3PQYA 1N10A 3LNEA 4JKPL 4K55A 3ZDZB 1QFUH 1CLZL 1RH8A 3CD4A 1Y18B 2C34A 4LSQL 4XBMA 5ICYA 2N4IA 1M05A 4RRPM 3ZVVA 3ARDC 4ZOEA 2GCYB 4Y19E 2ZE0A 3U9PL 2V0AA 2Q86A 1LK3H 1F56A 2YKLH 2WYIA 3WJJC 4BIKA 2PKDA 1HL8A 4TNWK 3ZE0F 4AXWB 3IKCA 5DF0A 3FS9A 1TEGA 2D31A 3BZ4A 4MAUL 4H0HB 4MBRA 3U0TB 4C4KT 3ASWA 3LIZA 3FTGB 4NIKB 4BWWA 3T4AB 5JHLL 1EIBA 4DOHE 4DZ8A 1LL1A 1HU8A 2B59A 5SWZB 5IREA 4MWFB 2XQYK 1A6UL 4N8VB 3SBQA 1TOXA 4X6CE 2YPVA 1MVFA 3PGDB 4J4PC 4K8RH 1MJJA 3TBBA 4BINA 1U3NA 4G8IA 5JW4M 5IVZA 1FH5L 4EOWH 2VLME 5I19L 5K9JL 1HOCA 2QBWA 3WEMA 2ZOKB 2H3NA 2VZ1A 5FR3A 1MKFA 4TTGA 5SWZD 3QDGA 4OZFB 4AE1A 4QRSA 4EUPA 4NUJB 3I2CL 5C0BE 3QJRB 2C4FT 3MLXH 1TJGH 5AB9A 2IH9A 1XGUA 1P5UC 4OAWB 4F7TA 1SOQA 3UBFA 1QOKA 3HBGA 4FFWC 2AKRA 1N5YH 2O5YL 4YHNA 2DWSA 1L4IA 3T0AA 3QI9B 5DD6A 1WWAX 1DQLH 2VH5L 2OM5A 2WQAA 1JZDC 3QYCA 5HHMB 5HGAA 1TETH 4R6UA 3H6AA 3AY4C 4Y2OB 1AAJA 1DJYA 1OTUD 2KDGA 1G5GA 1EGJH 4NQDB 3QI9D 2D73A 2CO7B 5ADOH 3GXIA 3EJZC 3VXOA 1TQBC 4M1CD 3MNZB 4TVPD 5HHMD 5CZXC 4NP4L 4NM4L 4U1HA 1OSEA 2UWEB 2L7UA 3S2AA 5H4YA 4PJFA 4U3SA 2ZQKA 4NQDD 4AQ1A 3FB7A 4FTDA 4MNGA 4N0UB 2LFEA 3VSUA 2VXUH 4M6OL 3VGFA 3STLA 1AD9B 3L8QA 5ESAB 3VG0H 4I8DA 3LZLA 1IGCL 1TVDA 5GJTL 1BJ8A 3VSQA 3V6ZB 3BUQA 3ARFC 4JFVA 5HVWA 1RZJC 4BQCA 3K5RA 2UX7A 1N5AB 3LKPA 3MV9E 1ZA3B 2E46A 5EF3A 2EDJA 4L3FA 1JNNH 5AKTA 2MEJB 1CDCA 2VR7A 4LRIC 2CBQA 1R0AH 1NL0L 1NMAH 4HCRH 1V3MA 1X7TA 1T6BX 5L0QC 3F83A 5IBLC 1T1WA 1L3WA 3K91A 4HLZH 3GSNH 4ZI8A 3CH1B 1CMOA 4JJ5A 3UPAA 4U6VL 3L3DB 1M7IB 3ULVH 4K3EL 3MXWL 4WV1C 3ILEA 3X11B 2HUEA 4HPYH 2NY7L 4FABH 5L2KA 1YJDH 2AV1B 3MRFA 3IB4A 4V1DB 1I9RH 4UBDD 4PVBA 3RWHA 2G9KA 3WYRA 2WWNA 5CD5C 1Y7VA 3HS0C 5IQMA 3MROB 3KPMA 1UTDA 2CLRA 2EO1A 3NJIA 3WFZA 4AEIL 1I8LC 1A0QL 3WU1A 4GAFB 2X2UA 3CSTA 5E51A 4PJIB 5IVXB 4A7TA 4V1DD 2P9RA 2EDXA 3DTXA 4GP4B 4PJHE 5LBSA 1MF2L 3PIQA 1A2YA 3N41B 5ALCH 4A2MA 3IDGB 5BXFB 2DLHA 1E7UA 1QHOA 2VC2H 4JCWA 3I02A 2IQAB 3M1CA 4L18A 4XP6L 2CXGA 1T20B 2WD0A 5I74B 5T1KB 3S3BB 5AQ0A 3PHAA 5DEGA 2VMFA 3J07A 4JO2L 1K2DA 1L7IH 1C08B 1GGTA 1XGTB 4F93B 3BUYA 4NCC1 3RDTA 4F9LC 5DC2A 5FDWB 1SM3L 1RJYA 4WQOA 3EOTH 4I88A 5TK2A 4PWGA 1OEZW 3UX9B 4HIXL 2X1QA 2MCPH 2X5PA 5CJQH 2H4EA 5T1KD 1X3DA 2I7SA 4OGXH 2WN3A 2WXQA 3HW7A 3Q5TA 1SXBA 1D5XB 2EXYD 1LNUA 1MJ7H 5IFAL 4I18C 2NZ9D 4MA3A 4G6KL 4OLWL 4G82A 5EZLA 2WVVA 2BHFA 3NSCA 4IIQB 5GGUB 4JQXA 4R4NC 4FQ1L 2CGYA 3WFDH 4LEEA 1BF2A 3IFLH 1CBVH 4DGYL 4NO0A 5EWIL 2O6EA 3VFMB 1VERA 1SRDA 4NJAH 3BN9D 2A6KB 4JL2A 5HI3D 1UOKA 3L6FA 5ITBH 1I3RA 3CTTA 3A67L 3U0WH 4DGIL 3BSZH 3OKEB 2H2PC 1BFOB 2GUOB 2X7LB 4LCCB 3RNKB 2CLVB 3CE1A 3QNFA 1YUHB 3OLDA 5DUBB 5DQJA 4EIZC 2NSXA 4GW1B 1JYXA 3IETA 1Q4NX 4IMKA 1PJ9A 4D9RD 2EO9A 5JOPD 1CF1A 3QARA 5C0AD 3ETBF 3DROB 4TQHA 3QZLA 5FYLE 2OSLA 3EOBB 4HUCA 1KN2H 1PKQA 1FPTL 2ZOUA 2CD0A 4GSXA 1OTSC 4QOKA 5HY9A 3X1BA 1N26A 1BEYL 5JLZA 5KUKA 1Y07A 1VFUA 15C8H 2PN5A 2WKOF 4CBPA 3AUWB 3CXDH 4XN4A 5ITFA 4XXCC 2MQ0A 5HVGB 4C4UA 3QQDA 3WO4B 1ZSDB 2VZ3A 1X7SA 1G9EA 2VDNL 2J44A 3ZHDA 5I8CB 2R7EB 4PREB 1OE3A 5F70A 4RRPA 2XWRA 2E7LA 1N0XH 3OHXA 2J56A 4MA1B 1LO4H 1E5AA 1G7JA 2VL5A 1RL1A 5BVJA 2UZYB 2J8HA 1S9VB 4NQQA 4JFFA 5EB9A 1QACA 3K8MA 2XVBA 2MCG1 3SDCA 1A3RL 1F8TH 3P30H 2GI7A 1E4WH 2ZOLA 4A55A 2X9ZA 5D7SH 3VM7A 3MKGA 4A6YB 3GSOA 2CCWA 2P44B 3BWAA 5EF0A 5GGRA 4Y5VB 3M88A 5LGJB 3BE1H 4I0PA 1ZAGA 3WIAA 1XB8A 1DQML 1F1DA 1MXGA 2J4WL 5HI5C 1W72L 3VNYA 4BKSC 2HX9A 4HQQH 3D9AH 4L3CA 5B1JC 4OZGE 3UJTH 2ZWKA 4ZNEE 5L8LB 4E9RA 4L05A 4M43H 1MWAH 1JHTB 3LCYA 4OCNC 5C0IA 3S5LG 1ET8A 3AXLA 4MYPA 5E8NB 4ATWA 4L9LC 4EE2A 1H3UA 4YO0A 1I4FB 5MEPB 3BKJL 4CMMA 2KQMA 4K7FB 3RWFA 1I7ZB 4M48H 2VWEC 4MAZA 2HT4C 5BS0E 2VR6A 3NCYS 3U7YH 4ZFFB 1U41A 1T4KB 3QUZA 2H32A 1A7PH 2DPKA 5HYEA 3LRGA 1KIQA 4HUMB 4HW6A 1IFHH 2APWA 2PTUA 4X50A 4YZFF 5H8DA 3RX9A 1INDL 3C75A 5B1KA 3ZR5A 1BA9A 1OGPA 4GP5B 5JW4N 3V8OA 4KVCL 2D7MA 4KV5E 4LQFL 3THMH 4BE5A 3S8GB 4Y2DC 2DI7A 4QKTA 4UNVA 3F7YA 1MFMA 1HZLA 1R3KA 2KZKA 5F6IB 1P4BH 4FXKC 5B1CA 3ZE1E 3X3FH 3B2PA 2JKWA 2WKOA 4M8RA 3JWOH 5I1EL 3RWGA 1G9NH 1MCPL 2HFEA 1Z9LA 4UQ9A 3VFWB 4JKLA 4XBPA 3TH3T 2R83A 2WC7A 2HKFL 3PL6C 3ABGA 3SDDC 3TZVC 4DKAA 3ISYA 3BWUF 1DVFB 5FYJE 1UB6A 3Q1SH 4ODHL 5F1NA 1Q9KA 4HEME 1FNLA 4M61B 4R97B 1S9YB 1XGPB 2ZUTA 4NN7B 2KYIA 5CD3B 3ARUA 2DEYX 1DDHB 3TC9A 3R06A 4JN2B 1PAZA 4JVPA 3HLKA 4OLEA 1DVFD 4KY2A 3RPKA 2C7FA 1HWHB 3B9KC 3KXFB 5LHDA 4JPKL 4NJ9H 4MJ6B 1JZ2A 4PWFA 2C4FU 4OGZA 1ZEAH 3CH8A 3VXMB 4DWHA 4OJFH 3ZUNC 1A14L 1MI5B 2NNCA 1S7WA 3HE6B 4I4WB 4OV6F 3UBXB 1SLXA 2B9BA 3BRGC 2BOCB 1EO8H 3CVCA 3CXFA 1A1MA 1Z0NA 3H9SA 3GJFB 4GOSA 3B5TA 5C70A 4G11A 5CEZE 5B4MC 4ZRGA 1DLHA 4HPOH 2IEPA 3KXFD 4X6BB 2P5WE 4UMSA 4LLYB 4LFHD 5IROC 3VXMD 3R1GH 1BQRA 4IJTA 1MI5D 3VAEA 3HE6D 4N3TA 2C9PA 5SWQB 1YEHL 1YECH 2P8LA 3ULAB 3ORJA 4DTGH 4XPHL 1U6AL 4TRPL 3OGCA 4PJ6A 5I6KA 3DVNA 3CBKB 1MEXL 1GOHA 1UZGA 1NGWB 5DLMH 1MW2A 3EBIA 4LSVL 4LE8A 3DRTA 1PW3A 2P5EE 3MVSA 4YDJA 1NCCL 1U2HA 1KCRL 5F7HA 2AVGA 2M2DA 1KLFB 1KJVB 2PYFA 2HT2D 4LVNC 2XTJB 5JO5B 5E6IB 1AO7A 3I84A 1AC0A 5E8OB 1X6LA 1U2CA 2CWRA 1B4RA 3UYRL 1MAML 4UT9H 5GRYA 3W9EA 1U8QB 2IWFA 2FLBT 2FT6A 1XWVA 3GSVB 3RDJA 4F1SA 3OXRB 4L8SA 3O45B 4PS7A 5IM7A 3MRIB 4LHUA 5J6GB 3N42F 3FK3A 1EUTA 2XTJD 1Q9WB 1JK9B 1W8NA 2NUTB 1N0LB 3DVGA 2W9DL 4N20A 1P4IH 2F7QA 1KB9K 2FWOA 3L3JB 3MBWB 5SWSB 2TAAA 2EIMB 4XP5H 4XO3A 1H3GA 1R19A 3NRQA 1WFJA 3IU3B 2OTPA 4UQ2A 4P2RB 2YC1B 4TSAL 3V95A 2EJ1A 1R3IL 2VABA 4QXVA 4UDUB 5A6IA 2G60H 4JRXB 3CVHH 4HT1L 4X6EA 5SWSD 5EEZA 1IAIL 3IVKA 3QXWA 3AZUA 3HC0A 5BV7L 4Z3IA 2WGNB 2VN4A 1FC1A 2VERA 5GRZA 2B1HH 3QDJD 3PS6A 2IO5A 3GINA 3QULA 4P2RD 4FFYL 4TNFA 4ORGA 4FQXD 1QNZL 2BNRB 2GITB 2IADA 3BUIA 3KPSE 3GM8A 4JRXD 3O3EB 5AD0A 1J5CA 6PAZA 2E47A 3ASNB 2QHRH 2FT7A 4OH2A 2WLNA 4JO4H 4TTDD 4ETQA 1U8PA 4ENZA 1DJGA 3PWPE 2BNRD 2XIDA 2ZXDA 3TYFA 4F20A 1T1ZB 2Z8SA 3PWUA 4JHBA 4N2HA 4ZXBC 1GKEA 2FHBA 4JHZA 3HC3L 2WLIA 3F7LA 4ZMVA 3R0NA 4F8OA 3BVWA 3RWCA 4YK4B 2YRLA 3ZL2A 1JNLH 5BW7C 1TJXA 1ACZA 2HJKA 3T04D 4JFUA 1QKZH 1NLDH 4L1SA 2C8NA 1RURL 3CSBA 3VFRB 4LOUC 3KLHD 3IPFA 5LCVH 3P11L 4MFHA 1IKFL 2NYYD 3SPIA 4DP1X 3RL2A 4UUJB 2WBJB 2H0FA 4XOBA 1MN4A 1FORL 2QFPA 4N0CC 5D7LB 1A3LH 1OF2B 5KVGL 1EJOL 1FNGA 1AACA 4GO9A 3HNSH 5BVPH 4PW4A 3CHRA 3QS2A 2CRYA 1DL7H 1FO0A 2YUWA 3M8OH 4B9GA 5AG9A 3LB6C 2J6WA 2WZAA 2WBJD 4NI3A 4CNIB 5D7LD 1H9DA 3MACH 5E2VL 1WS7A 1JNJA 2ICWA 2NQ3A 3MFGB 1PD6A 4PRAB 3W82A 2KH2B 5DEZA 1LEKA 3RHWK 4FTVE 3CDZA 3RVUC 5B3JF 3L7EB 3CFQA 3F04A 5EU4A 2P8PB 3QK0A 1BVNT 1RIHH 2HPTA 2G2NA 3U2JA 4P5TA 3VXPB 4EDXB 2PR9A 4N1EA 4D94A 3SJVA 3L1FA 1USQA 2EDHA 4JFOA 5C0NC 4ZX5A 1T04A 2VDNB 3ZDZF 3FSVA 4GXUM 2K9FB 2WPGA 1NQBA 3FN3A 3DC0A 3FOMA 5EO9B 1BD2B 1HHIA 1QEWA 3DLQR 1RZ8A 4MQ7B 4ODSH 3UAJC 1YYLH 4JHUA 3GB7A 4KKCD 1I8AA 2PYEB 2ADYA 2VDLL 2EUVA 1EDQA 4QY8B 1SYSA 4Q4EA 2XVGA 1HH9B 1S7TA 1ZOXA 4JREB 1NFDA 1UB5A 3GHBH 3FQXB 5DWUL 5C9JB 4ZMPA 1BD2D 3E2HB 4E5XB 2YK1H 4KI5D 3ZKXC 5I24A 4NX0A 2KLTA 2B16A 4H8PA 2L7EA 2PYED 3OC5A 1M9SA 5ICXB 5TQ2L 3RI5F 3SZ6A 2W92A 4NN5C 4CU7A 2M1KA 3S96B 4A67A 3PABB 1W72B 4Y5XA 1SBSL 3MBEC 2JJUA 4QRAA 5I1GL 2VW7A 2CMRL 3V0FA 1MW1A 1KPVB 5I1HL 3H2WA 2XZAL 2EDEA 2L7QA 2MPAL 2VMCA 5JW3L 5FB8B 3WTSA 1TU2A 2XJLA 2OSWA 5K39A 2R23A 1CXKA 4F9PC 1BFTA 4XPAL 1RU9L 4FA6A 3TT1L 32C2A 1IC4H 1AQDA 1J7VR 4MCZB 1UJ3A 1UWEH 4WENB 3DJZA 1FNEB 1GA2A 3F65A 4Y19B 3D4CA 4Z3TA 43CAA 2IG2L 5CP3H 1KGWA 1S78C 3RZCC 4JPVL 4XCEB 5EIVA 4YHLL 4MJ5A 1IC5H 5J56B 3VDCA 2KUTA 1ZWIB 1I1YA 3QISA 3SO5A 1EZUA 2CJUH 2P80A 3UROR 4K3GA 4WW1A 4DOHB 2MWCA 4IGBB 2VR3A 3HAEH 1D3CA 2YSSA 5GGSB 4P46B 4X6CB 3L2LA 4AL8H 1U3JA 4LMQE 1TTFA 3ZZ1A 2J8OA 3MRPB 1WJ3A 4F7CB 4R7LA 4GUCA 1XL4A 6CGTA 5BZXA 3POCA 4PY8J 4HU2A 1LILA 2UWEF 4IGBD 4IOSD 3HMXA 1N4XL 1J8HB 3B83A 4P46D 5C0BB 3GRGA 1GR7A 4KK6D 4NQXB 2VLMD 3I3EA 1KJ2A 4P2AA 3AU1B 2AABL 5KANG 1Y18A 1NICA 1UCTA 4TLSA 4PBXA 1YN7B 3O6FC 1XZ0B 2XWTB 1J8HD 1OXYA 2GCYA 3K46A 4XNZC 4AM0B 2BWIA 2I5YL 5AYQA 4Z7AA 4AXWA 2WXMA 2BVTA 2L4OA 2VUKA 4OB5L 3V4VL 3U0TA 4ELKA 4KXAA 2JMRA 4Q9CA 4P9HH 3ULVE 3FTGA 3CFDB 3QIUC 3T4AA 5C0GB 3IM1A 2CCVA 5SWZA 4MWFA 4IU3B 1K5WA 4N8VA 1R1CA 2YZ8A 3IJSB 3H1ZA 3P0YL 1ZV2A 3PGDA 5ECGA 4JE4B 4K07A 4CSTA