1GZ6A

(3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
301
structure length
301
Chain Sequence
SPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGSRMTETVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17 BETA-DEHYDROGENASE 4
publication title Binary Structure of the Two-Domain (3R)-Hydroxyacyl-Coa Dehydrogenase from Rat Peroxisomal Multifunctional Enzyme Type 2 at 2.38 A Resolution
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dehydrogenase
total genus 101
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1gz6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gz6A01
1ENPA 2H9IA 3WQSB 3D3WA 3EAGA 2X9VA 3ICPA 4CLRB 1UZMA 1YE3A 4TKMA 5ER6A 4ZA2A 3WLEA 2YQ4A 3K73O 4PLGA 4U6QA 5KNLA 4DMLA 3TRIA 4YAJA 4CR7A 4JCOA 3I52A 1K89A 4OJNA 1PJ2A 3RCBA 5TS3A 4FCCA 2G17A 1ZZEA 4E21A 2HO5A 5C5IA 4LCEA 1HSOA 2Q1SA 1UJMA 2RH4A 2HUNA 4DL9A 1X7HA 3KLMX 1GQQA 3TZ6A 1J0XO 3GNTA 4RZIA 9LDBA 3OFSA 3WBBA 1PGPA 2GERA 4FDAA 3BMQB 5A1TA 4YJDA 3INGA 3QVWA 1ZK1A 3EGOA 2H6EA 4BO8A 3ZHBA 3GK3A 3Q2IA 3LQFA 4CM3A 5IXYA 3I9JA 1XCBA 2PV7A 2Z1NA 5JAIA 3TFQA 2YY7A 1FDVA 1TLTA 4G65A 3WIDA 1NVGA 2W2KB 1DXYA 4ZN6A 1KS9A 3FTNA 1ENZA 1HYEA 2OHXA 1ORRA 4L4RA 4E12A 4PLYA 1F14A 4TZTA 1ONPA 3BHJA 3O9ZA 1GYPA 2CZCA 1U3UA 1UDAA 2ZB7A 1G1AA 4FS3A 3S2IA 1OOEA 3WWZA 3KV3O 3UGKA 3ZU2A 1QV6A 2B83A 3OICA 3AY6A 1F0YA 3LT1A 4XQCA 4ND2A 1I5RA 1SB9A 4KQWA 1PZEA 2VOJA 3V2GA 4UEJA 4WLEA 5KJ6A 4CM6A 1EK5A 4M1QA 2I9PA 3GRPA 5HA5A 4EUFA 2G1UA 3PWSA 3ZI0A 4W9NA 1JDJA 3RAJA 4BNVA 4BNTA 3K6JA 1UH5A 3ZV6A 4EI2A 5EJ2A 1A7KA 3Q9NA 2X0NA 5JSFA 4LVUA 2HLPA 2NWQA 1R16A 4MP6A 1P1RA 2SCUA 2B4RO 5DCYA 4J91A 2IODA 1N7HA 1W73A 1EE9A 4K6CA 1DB3A 5JYDA 4K9DA 4B3IA 3C8MA 3KVOA 4MP3A 5ES3A 2HK7A 4II3A 4L73A 4XYLA 1I2CA 1GAEO 5L53A 3HB5X 2Y05A 2YHIA 4XZ3A 1RYEA 3ZU4A 1MP0A 1WW8A 2DAPA 4B79A 1LLCA 4ESOA 4HUJA 3VZQA 1MXHA 1ZKMA 4FIZA 2J6IA 2O4CA 1ZEMA 2W2LA 5CDSA 1A72A 2ZQYA 1HTBA 4E3ZA 2EJVA 2HMUA 1RM5A 3ZDFA 3OMLA 2VUTA 3U09A 1G0NA 4MPDA 3RUAA 1GCUA 4J49A 3I3OA 4TKLA 1PJ4A 2C54A 1U5CA 1T4DA 2VZ0A 4ITUA 3PPIA 2HRBA 3CIFA 4IDDA 3TJRA 4ALLA 4FOOA 4OL9A 4Q3NA 3CXRA 2XF8A 2ZTUA 5C7OO 4XGKA 2UUOA 3C7DB 3FNEA 4IDAA 5L51A 2JD0A 3AUUA 1HE4A 4OIMA 4W99A 1EBUA 4E2XA 3LSYA 3KUXA 2D2IA 1VPDA 1NQOA 5ADHA 1HXHA 4Z0HO 2V65A 2IEBA 5LC1A 1PU2A 1ZJZA 3DZGA 4QO7A 4CM8A 2J5KA 3VC7A 5EN4A 3IUPA 4LSMA 3OIGA 2DTDA 1P74A 3IL2A 1JWBB 4YB8A 4HFMA 4PZEA 1MX3A 2CF6A 2FSSA 4CPDA 3KO8A 1SC6A 3A28A 1T2CA 4MVJP 2X23A 4JBHA 1K2WA 3ZU3A 1P0FA 5L95A 1YB5A 4BIIA 5TGDA 1B7GO 4WLFA 4Y6PA 3QY9A 3KYCB 5I8WA 2ZCVA 3E9NA 1ISGA 3K8ZA 3EVTA 3KYDA 3RC2A 4OAQA 1GUYA 3JQBC 3UF0A 4LRSB 4WNIA 1LSOA 1GZ3A 2YFQA 3PRJA 4OM8A 1BG6A 2JCVA 4EBFA 4CMKA 1KVQA 4HV4A 5CDGA 1HETA 3CTMA 4KOAA 4E5YA 2RHRA 1SMKA 3PQEA 1BRMA 1GADO 4Y6SA 3WIEA 4MVJH 2D0IA 3K9QO 1LXCA 4ND5A 5KJCA 5MDHA 2YV1A 1A5ZA 1PSDA 4ZQEA 5G0SA 1U2GA 4AJJA 4OYRA 2O7SA 4JBGA 3LC2O 5JYEA 3DMTA 1GUZA 1I01A 1GD1O 4RO0A 4W4TA 3I5MA 4PLHA 3S1LA 4PRKA 3DTYA 4J4HA 4NU6A 1YGYA 2VRCA 3D4NA 1HE3A 4IGEA 5TJHA 4Q3BA 3KLPX 4AJ1A 5T5QA 2NTNA 1MB4A 1YBMA 4RVHA 1N8KA 1GFSA 5LCXA 1YOVA 3Q9UA 3UICA 4MVJI 1HSZA 2BGLA 3H7AA 2ZTLA 4CQLA 1BTOA 1ZMTA 3EUWA 3MJSA 2X9GA 2OBYA 2PNFA 4QTZA 4D0RA 5IJZA 3E03A 3GDOA 1U3VA 4XGIA 1YONA 2X7HA 5IDYA 2VTEA 1NNUA 5DBIA 4PG5A 1XDWA 4IDCA 1XQ6A 1A71A 4DIOA 3E82A 3MTJA 2GO1A 5L4LA 1NX6A 4YJHA 3WOHA 4QT0A 1VJ0A 4CM4B 4IS3A 2O2YA 5TSDA 5ITVA 2ZTVA 3T4XA 2B36A 4HXYA 4ZGWA 4OQYA 3JQAA 1O89A 4JP3A 1EUCA 4MVJF 4U6SA 4A0SA 3LVFO 3FPLA 3NEPX 4TROA 4IJWA 3S2FA 2ZIZA 2FY8A 3HDHA 1EVYA 1KVSA 5GMOA 3LLVA 5JAMA 1T2DA 4KQXA 1RPNA 5KWEA 1HL3A 5T67A 1YVEI 3JD2A 1BVRA 1KEUA 3GHYA 3RBXA 3GGOA 3C85A 5JMPA 1XLTA 1E7YA 1GPJA 3KTDA 3U0BA 3DBVO 3WGZA 1UP7A 2V7PA 2P5UA 3GT0A 1YB1A 3AFMA 2IE0A 1Y5RA 2A4KA 2I6TA 3WJ7A 1ONNA 1E7RA 2VYVD 3CPSA 4Z3DA 3L4BC 4QXMA 4YT8A 3NT5A 4RPHA 4CQMA 2DPGA 1T1SA 2NNLD 1WMAA 3O38A 2O23A 2OL4A 2DVMA 4CMBA 2O2SA 3RKRA 4J4TA 1C0LA 5GY7A 4OOEA 3SX2A 2HMVA 3D3EA 3L9WA 3WX0A 1QYCA 3DEYX 1GPDG 4FJ2A 4WLOA 4H7PA 5L7WA 3E18A 3UAGA 2I67A 4QECA 4ZRNA 3KOUA 4HNGA 2JD2A 4TQGA 1LC0A 2V6GA 2GN4A 1JKIA 2O4UX 4C7JA 3LDHA 2XPCA 4WUVA 2O3SA 3I9LA 2AQIA 2AE1A 2C59A 2EXXA 3FBGA 3OIFA 3H65A 5JLAA 3DBRA 1LTHR 1ISFA 2RHCA 1NPYA 5JDIC 1V3UA 5LDHA 1T26A 3F1LA 2IZZA 1H0KA 3IP1A 4DQUA 1BSVA 1QMGA 3FTPA 3BXXA 2OP1A 4R3WA 1HDOA 5TLSA 4QEDA 2E82A 2GSDA 2WEKA 1SCUA 3N74A 4YAEA 4IIVA 2HU2A 4TRMA 1U2DA 2IZ1A 4CMCA 2GCGA 4L74A 4BMSA 1A9YA 4JBIA 4FFNA 3OEWA 2HQ1A 4FC6A 3NJ4A 1E92A 3ST7A 1TT7A 4Q39A 3LU1A 1E5QA 4J9UE 3BMCB 5EMHA 3DBLA 3MJTA 4E6PA 1P3DA 1LDYA 4R3NA 1I2BA 1SBYA 4XKJA 3FNHA 4KDFA 1XSEA 2AE2A 8LDHA 3OA2A 1ZSVA 4EJ6A 2W8ZA 3BMNB 3GAZA 3P2YA 3UH1A 1DIAA 3ZV4A 3VKVA 4BNLA 2YZ7A 4D7AA 1H94A 4JGBA 5TJ9A 4BNGA 4Y6RA 1IUKA 1EVJA 1QLHA 4R54A 4GI2A 2VWPA 4M55A 4XEHA 5HWSA 1R4MA 3P5SA 3EZLA 2GLXA 4D79A 3I83A 4PZDA 4MKRA 1Z75A 3GF4A 1MGOA 1SEPA 4J9VA 4ROSA 3HE3A 2J3KA 1R4NA 3NV9A 1HF3A 3DAPA 3QJ5A 2Y1FA 3AK4A 1P44A 2Q1UA 2Q2QA 3JQGA 1GCOA 3PK0A 4O59O 1DEHA 4WCFB 1YKFA 4W6ZA 3ICCA 4QUKA 4BKOA 1D1TA 3JQ8A 3PJGA 1AHIA 4GWGA 3ZWNA 1B8PA 3F1KA 2ZYDA 1Q2XA 1X1TA 2QRLA 2O50A 2DUUA 3GRKA 3WWYA 4NR0A 5FFFA 1NVMB 3T7EA 5KJFA 5F3RA 3CKYA 4DREA 4F3YA 4CUZA 4UUMA 3I4FA 4PN3A 3KSUA 2YDYA 1T4BA 4RPGA 1RWBA 3H2ZA 4OSPA 3V8BA 1N1EA 3OP4A 2JHGA 4OXKA 4IDFA 2QRKA 3TL3A 4RORA 3RBZA 4BNNA 4LN1A 4DXHA 2FHSA 3BYZA 1PL8A 4L8VA 3D1LA 3NKLA 3SXPA 1VKOA 4BNZA 2JAHA 4BB6A 4EW6A 3VTFA 2GYYA 1VSUA 2EERA 2NM0A 3BHIA 4JN6B 2GUGA 5KCZA 2Y67A 2HDHA 2W90A 4XB1A 1K6JA 2CMDA 4KTTE 4CV2A 2RAFA 3UOGA 3JD3A 3RU7A 4BO2A 3K5PA 3PLNA 4EYEA 3OHSX 1K3TA 2NV6A 4NBVA 4PG4A 4O0LA 1LSJA 4CLDA 2NACA 3GEMA 4J2HA 1Z82A 3OM9A 2GN9A 1BHSA 5I7SA 3VH1A 2ZQZA 1KVRA 5BR7A 4I5EA 5U4QA 1UXHA 3TF5A 3R1IA 4FGSA 1ISHA 4LMRA 3QWFA 5ENVA 2J3HA 3OETA 1KBZA 2VWGA 3ABIA 3GZNB 3ONDA 2PGDA 2XXBA 3VPXA 4FQ8A 1E3LA 1J49A 1ZFNA 1ZIDA 3SC6A 4CMHA 1E3JA 4KUGA 1UXKA 3QVOA 3DC2A 4GX0A 5AOVA 5DBGA 4IJKA 2X6TA 2CVQA 1OBFO 4BO7A 4J43A 4D41A 1Y8QB 5EQFA 5L3ZA 4GBJA 5TQVA 3TDKA 2D3TA 4PLFA 1AN9A 2NU7A 4MIEA 4M8SA 4B4UA 4RF5A 1LSUA 4R51A 4ZD6A 1B8VA 2DUWA 3TZHA 1V3VA 2PKQP 3GAFA 2X8LA 1NFFA 2VWHA 3ONFA 4NHEA 2GDZA 4E30A 1WWKA 3AI1A 3IP3A 3BA1A 2C2YA 1MG0A 3NGXA 4CMJA 2BELA 3C1AA 4R69A 3A4VA 1VJ1A 4QQRA 1WDKA 4NJMB 1PGQA 1PZFA 4WLNA 4OKNA 4OXYA 2CNBA 1TT5A 1B3BA 3JYPA 3NTOA 2PZJA 4PCVA 5KTKA 4BNJA 4M49A 3RUCA 4AJHA 4HADA 2PA3A 4Z9YA 2I66A 4NFSA 2PWZA 2XAAA 1DJQA 1ZJYA 1HDRA 2Y0EA 4B7XA 1KY5A 4ILKA 4BV8A 3M6IA 3Q2KA 1MC5A 1BW9A 4I5GA 1A27A 1H6DA 5L7YA 1DFHA 3R0IA 2I76A 4YPOA 5F21A 2FWMX 1A4UA 5THQA 3QP9A 1LI4A 5L4NA 3WB9A 2YW9A 3AM3A 3CZMA 4CMIA 1N7GA 4PG8A 4I1IA 2EJWA 3GG9A 4CM4A 3GEDA 3JV7A 1VI2A 4IMPA 4CL8A 3RIHA 4TRNA 3OQ6A 1T25A 3PWZA 4BL5A 1NR7A 4CMGA 3B1FA 4XX0A 3C3XA 4D3FA 2BFPA 3GVCA 3HZZA 2CUKA 3F5SA 3RROA 5K6AC 3E9MA 1J4AA 3AU9A 5CDYA 4XDYA 2X58A 3D7LA 5DCUA 2NLOA 4MKXA 4Y9DA 2ILTA 4XIYA 5HS6A 2BGMA 2Q1TA 2X5OA 4Q9NA 4XIJA 4WPGA 1N2SA 4YAIA 2FZEA 3FR8A 4IBOA 5DT9A 3VPSA 4I5DA 4D44A 2VYVA 4CODB 3BTVA 4UREA 1YQGA 2C20A 5CFZA 2AG8A 4P22A 3CMMA 3JCZA 4NIMA 5JO0A 2VT3A 3A9WA 4MINA 1CDOA 1I30A 3RD5A 2F1KA 1YDWA 1IHYA 1YL7A 3DB2A 3T7CA 2C5AA 4DPLA 1KEWA 2D4AA 2C7GA 4YT2A 4N18A 4L75A 3NRCA 2X86A 3S2EA 5JY1A 1YRLA 1ENYA 4RQTA 2VTDA 3UN1A 4TMFA 4XYMA 1MFPA 3ANLA 2Q3EA 4CM1A 1QYDA 2QYTA 1PJSA 4LVCA 3AOEA 3AM4A 2Y93A 1E3WA 1ZUD1 2TMDA 2WYWA 2UYYA 4RF3A 3GA0A 2Y68A 4N5NA 5TRTA 3DOJA 2BFOA 4O6VA 4NK5A 1I2ZA 1GU7A 2AEJA 1GEGA 4FC7A 2X22A 3WSWA 1X13A 3ORFA 4DQXA 4YQZA 3TL2A 5ENDA 2X5JO 4TWRA 1I24A 4Z0TA 1XGKA 1XWFA 1IZ9A 4IDEA 1DLJA 2DBZA 3GVXA 4CMEA 4DBVO 3GFBA 1O5IA 3K2EA 4PG6A 1DHTA 4Q3CA 1IL0A 3GVPA 3M1AA 4WJZA 2AXQA 1N5DA 3PZRA 2VCYA 2B5WA 2X0JA 1W6UA 4NDNE 1MA0A 1FK8A 2YQ5A 4OMUA 2CDAA 3I6QA 4EUHA 1JKFA 1XHLA 2WWRA 4U5QA 2GPTA 3OECA 1RM4A 5EINA 3HSKA 2Q4BA 1E3SA 2VUSA 3CEAA 3SLKA 2J8ZA 1HRDA 3BMCA 1FDWA 1HZZA 3D5TA 3I9KA 3P2OA 4U7WA 5DF1A 4W9NC 4WOKA 5EERA 3W4KA 3OEYA 3VOSA 5G2OA 3RJ9A 2EKPA 4TSKA 5U1PA 3JD1A 1ULSA 3L77A 4E13A 1P45A 2GRAA 1DAPA 3QWBA 4XCVA 2PR2A 1X15A 3NTRA 3WMWA 1TA4A 3BTOA 4IM7A 4L4SA 1CYDA 4GSLA 3ETGA 3KEQA 4N5LA 3KB6A 1NASA 1VE9A 4OH1A 5A3VA 5C3MA 1EFLA 1E6EA 1P31A 5JBIA 1C1DA 3HADA 2Y1CA 1GQYA 3WFJA 2Y66A 3UVEA 3GHHA 1FDTA 2R2GA 2G5CA 3LC1O 2NVUB 5KIAA 1Q7CA 3L4SO 2I5PO 1AXEA 1P1IA 4PLWA 1C1XB 5AQ1A 3AUSA 4ZU3A 1G0OA 3ROKA 1GV1A 2HMWA 1R15A 4WCFA 3H3JA 5BNTA 5G0WA 4XB2A 1D8AA 4BVAA 3ZWBA 4OOFA 5TF4A 2IZ0A 4CMAA 4PLZA 3ZWAA 1EDZA 2TMGA 2V6FA 4MVJE 4EEXA 4BNYA 4UVGA 1ENOA 3E5MA 1T2EA 2DTXA 4TRRA 3OJ0A 1GV0A 3JQ9A 4KWHA 3W8DA 5ICSA 1QXSA 1BXGA 4IGFA 1WZEA 5IAAA 4B7CA 1JWAB 2PKQO 3AM5A 2CVOA 3P7MA 4K26A 1VLLA 2VRBA 2NTJA 4I08A 3RWBA 4YDRA 2H5LA 2FR8A 1FJHA 4B4WA 1ADGA 3UUWA 1XG5A 4YXFA 2QX7A 1K6IA 4OGWA 4CLOB 3OBBA 2FPIA 3FBTA 5IN5A 1PZGA 1MFZA 3SJUA 1N92A 3R3SA 4J7XA 3ZNPA 4R9SA 2Q49A 3O4RA 4RPLA 1AGNA 4J1QA 1PJTA 1EE2A 3GOHA 4BMVA 1XKQA 3DHEA 3V5NA 2WD7B 1GYRA 4H15A 3VVBA 4D3SA 4KZPA 4CM9D 4MOWA 3RC7A 2GF2A 4URFA 1VL6A 4NBWA 4TVOA 3DR3A 1E7MA 3MJ4A 1H93A 3HN7A 3DOOA 4YJGA 2WYUA 3ROMA 3RI3A 2RIRA 3PVZA 2BMAA 3VZPA 1XEAA 1QYXA 5B1YA 4CM7A 1S6YA 3IJRA 4XR9A 3TFOA 4FFPA 5TT1A 3CMCO 2J5RA 4UAGA 1R0SA 1H6CA 2LDXA 1C3VA 3PDUA 1HEUA 1X7GA 1ZH8A 2YUTA 2ZJ1A 4TZKA 2PGLA 3HDJA 1FXSA 1NQ5A 2I65A 4ZQHA 5A4DA 2QHXA 3JYLA 3QWIA 1VC2A 3LYLA 2Y0CA 4E31A 4EUEA 2WD8A 5B4VA 5BT9A 3DQPA 3DMTC 2VHXA 3RFXA 3ULKA 2R00A 1MV8A 4RV9A 3IAHA 3GC6A 4CLHA 5TT0A 1NFRA 2A94A 2Z1MA 2EP7A 4DRYA 5KVVA 5J23A 1NXQA 2EWMA 2DLDA 2PGJA 4GGPA 2J5QA 2X5KO 4JLWA 4FN4A 5A9SA 5JC8A 1IOLA 3JQ7B 4G2NA 4OSOA 5G4KB 1J5PA 4JP2A 2DU8A 1T1RA 1QYVA 4ZHSA 1DO8A 4BGIA 2V6MA 3HB4X 1R0LA 4ID9A 3O8QB 4QFCA 1XR3A 4BB5A 3NDJA 1BMDA 1N9GB 1U1IA 4J0FA 5BNFA 4IDGA 2EP5A 3FRJA 4R1NA 1DFIA 3GDGA 2DTEA 3GGPA 4KUEA 1Y8RA 4GAEA 4UVDA 2P91A 2IYOA 4ZRMA 3U49A 4B7UA 3ZNQA 3LT0A 4IQGA 3HFSA 3NDRA 1ZO8A 5JCJD 4BV9A 4R16A 2JHFA 4KUHA 1WNTA 1ZK0A 2OGUA 4FSHA 4GVXA 4BNWA 6ADHA 1PQWA 3RC1A 1HDZA 1EQ2A 2HCTA 3WMXA 3MCVA 2Q2WA 4J3FA 5G0UA 3CSDA 1C14A 1P1JA 3ZHXA 3IC5A 3RUFA 5CAEA 2NTVA 4TVBA 5CPFA 2ZB8A 3IOYA 2JKVA 3ON5A 1DAOA 1RJWA 4X54A 2FP4A 5JAQA 3C1TA 4G81A 2NQTA 3NT2A 4QFDA 2JD1A 1JN0A 2C2XA 4RDHA 3ZHYA 1DIRA 3NX4A 3ZWVA 1E0DA 3WFIA 8ADHA 2YV3A 2HK8A 2ZK7A 3L0DA 1DPGA 4IXWA 4Z9FA 4RVSA 3GR6A 3PJEA 5F5NA 2PK3A 1ZW1A 1E77A 3G3EA 2Y99A 2VHWA 4BNKA 3ZWXA 4M89A 3FHLA 3KHUA 5K9ZA 5F1KA 2YFHA 4PVDA 3EDMA 4LISA 3I23A 5L7TA 1DC5A 3PYLA 5AXDA 2OBNA 1PL6A 5G0VA 4BS9A 2AQHA 1IULA 5DDIP 4DC0A 3W4IA 3IJPA 3AOGA 1CERA 5CP8A 4PGFA 2GASA 1D7OA 5DULA 5BSFA 3IQDB 3NYWA 2JCYA 3ZCXA 2Z95A 1I10A 2ZYAA 1SZJG 3HFGA 3LF1A 4C4OA 4OQZA 1ZXLA 1PX0A 2B4TO 3BMOB 2D5CA 4E2WA 2DM6A 2HRZA 2NVWA 1YJ8A 2PH3A 3E5RA 3NUGA 1L7DA 4M87A 5FI3A 4DYDA 9LDTA 4DQVA 1T2AA 4BO9A 4J7CA 2JFGA 3TNLA 1P1KA 4MVJG 5JXWA 4AJNA 1XELA 1F12A 2CF5A 1LRJA 3UXYA 2O48X 1LJ8A 1PJBA 2PTGA 1W4ZA 1Y1PA 4I9UA 2J3IA 4CLRA 3GQVA 1V3TA 1I3LA 4BO0A 3E8XA 4D45A 4IXTA 4PLVA 1LEHA 1Z74A 3RJ5A 4R41A 3TZKA 4AJIA 3CE6A 3U4IA 1M75A 1U3TA 4RL6A 1EDOA 3TZQA 4S3MA 3Q6IA 4MJLA 4LGVA 3H3FA 4LSWA 1Q0LA 1DDOA 2FRDA 3D3WB 1B16A 1YJQA 3GPIA 3GVIA 3GY0A 4P4GA 4R01A 3RUDA 3FNGA 3I9NA 4FBGA 3DZKA 3MEQA 4J1SA 4YRBA 1D4FA 3VHRA 2NU8A 4AJOA 2EF1A 3IUSA 2VYND 3BMQA 3JYOA 3D4PA 3FPCA 2W4QA 2O3UA 5CG2A 3WNQA 3KETA 4XYBA 4CV1A 1M67A 5HTOA 3ETDA 3ZNNA 2OP0A 4BGEA 1UZNA 2G82A 1SEVA 1Z73A 2ZKLA 1ZK3A 1VKNA 4RLHA 2C82A 2DC1A 4BNUA 4GKBA 2AG5A 2W2KA 4XA8A 4XQEA 2FR1A 4INAA 4MKZA 3ZH2A 2D5AA 5AXCA 1GL3A 1O6ZA 4GKVA 3EK2A 3GFGA 3WYEA 1I33A 3IKTA 1PWXA 4II2A 4BGVA 2NUAA 2DKNA 4BO4A 1QSGA 4BKUA 4J4BA 4MVJD 4NU5A 2A92A 3F47A 4HFNA 1Y9EA 3LC7O 2PFGA 1C0PA 3I6IA 3M1LA 1NTOA 1PJCA 1SNYA 1YH3A 3H5AA 3N58A 5L45A 3PEFA 4EITA 1U7HA 1D1SA 3GEGA 3EC7A 2ZB4A 3ZN2A 4NPCA 1ARZA 2B37A 3ETEA 3WDSA 5IG2A 2VT2A 4EDFA 4HFRA 3WGHA 1LDNA 4LW8A 3OSUA 3V2UA 4A7PA 4P8RA 1WZIA 2VQ3A 3ZHZA 1AUPA 1SOWA 1KVTA 3JQ6A 4N5MA 4GMGA 3WGTA 3E9QA 1PS9A 4DIFA 3OJEA 4A10A 1EUZA 5IDXA 3RU9A 4AJ2A 3EZYA 2P4QA 4J6FA 3RUEA 1WPQA 3QWHA 5HS4A 2JL1A 3KXDA 5EIOA 1QLJA 3VZRA 1BGVA 3F46A 5JS6A 4CR6A 4O1MA 4ZQFA 2NQ8A 3L6OO 1NPTO 4J0EA 4NH4A 2QRJA 4CLXA 5T64A 1GDHA 1ISJA 4XWYA 1LDEA 3H9UA 3VVCA 4PG7A 4YJFB 4ZJUA 4PRLA 4RVUA 2DPHA 2ET6A 4D42A 1R12A 1UAGA 2YHIB 3PHLA 4XYGA 4AJKA 1L7EA 3AJRA 4GMFA 2CY0A 3PGJA 4J16A 1SPXA 2WYVA 2PLAA 4JIGA 4CLOA 1GUFA 3B6ZA 2ZATA 2AQKA 1S7CA 5CG1A 5COAA 2EW2A 3ZWWA 3OA0A 1AHHA 2UVDA 2WTBA 1JU9A 3WTBA 4FOSA 3IMFA 2FPPA 1FDUA 3ZWMA 1FMCA 4UVHA 5T8KA 4DTIA 4WK6A 3AI3A 4CM9A 4J2OA 3PTZA 4FJ0A 1PZHA 1V9LA 2G76A 3ITDA 5KVSA 4YT4A 4A2CA 1DC3A 3U3XA 4FPXA 4IQ0A 2B5VA 3K92A 3R3JA 3E1KA 4BQPA 1PTJA 4PIVA 4RZHA 4YBZA 1OMOA 2EG9A 3H9JA 3WR5A 5DP2A 1N1GA 3C24A 3WLFA 4CM8B 1PQUA 3QVSA 4BO6A 1E7QA 2CFCA 3QQPA 1NWCA 2FZWA 4L4XA 3GUCA 3HJAA 3KYCA 5I7VA 4Z6KA 5IZ4A 5HRUA 2FMUA 2H63A 3TPCA 1J6UA 2UV8A 4XR4A 1NPDA 4CV3A 5C7LO 3DZIA 1JQBA 1OAAA 1ZNQO 1UDBA 1Y7TA 1K0UA 3AWDA 3NTQA 1DFGA 3KYDB 3VPGA 1YS4A 3TZCA 3DZHA 3P19A 2H1SA 3KEOA 1JVSA 2DBRA 5B4TA 3CZRA 1PGOA 3ROPA 1ZMOA 5K0ZA 5B37A 3Q1LA 3GLQA 4CL3A 3O26A 4DC1A 5A3JA 5B12A 3QVXA 4IDBA 1FF9A 1M2WA 1N9GA 3W1VA 3PJFA 1E3EA 3X2EA 5BSEA 3DO5A 3DZFA 5JDCC 1NFQA 1Y81A 3AY3A 2EV9A 1V0JA 5CHEA 2NU6A 3H2SA 3DXFA 2DBVO 3B1JA 4WASA 4RVDA 4DMMA 3BHMA 1O95A 3SVTA 3TN7A 1YO6A 3F3SA 4BNHA 1RM0A 4UVIA 4XGNA 2VRCD 1SAYA 1ID1A 4U8GA 3AUTA 3UFXA 1I32A 2EW8A 1BWSA 3S55A 1UXJA 5JDCA 1ZSNA 3GZ4A 3NGLA 1C0IA 1CQIA 4OO3A 4YRDA 1B26A 4LK3A 4CQLB 5JCXA 2HK9A 4AL4A 3HQ4O 4MO2A 1VM6A 3WQRA 4E2ZA 1Q0HA 3V2HA 1YQXA 4NQZA 3SC4A 1HE5A 5AXAA 1DRUA 4JK3A 1B2LA 2PZLA 3ZW8A 2HJSA 2YJZA 1HLDA 4YJHB 3QW2A 4JROA 1XYGA 2OORA 2BLLA 2E48A 1O0SA 3JQAB 3JQAD 3VPFA 4R68A 1LLDA 4A26A 1JW9B 2EGHA 2RCYA 3ANMA 3PFFA 2BI8A 2R6JA 4CJXA 3JTMA 4QSMA 1PJ3A 4B4VA 3I9MA 3ADOA 1M6WA 2ZYGA 4B3JA 1KC1A 2O3RA 1Z6ZA 1KYQA 3IS3A 5I7FA 1VL8A 3UCFA 4FW8A 2C7VA 1H9BA 3MTGA 3JD4A 4OKIA 4BHTA 3AOEC 4K28A 4Z9XA 4E2YA 3DMYA 3DZBA 1VRWA 3TQHA 5JC1A 3CUKA 5TNXA 3MWDB 1EZ4A 2OUIA 5DBFA 4BMNA 4DYVA 2ZB3A 2I99A 3OJLA 3W4JA 3FSRA 4Z3KA 3OIDA 1KEVA 3BMOA 2B35A 3K30A 5CDTA 3DHNA 3RASA 4K1LA 1UP6A 1HDYA 3O03A 4PZCA 3S8MA 4DGSA 5COQA 4CMEC 4CQMB 4CQMD 4B8WA 4RQUA 1I3KA 1YB4A 3PIDA 3WBFA 3GUYA 3VPHA 1BDMA 3HG7A 4Y8VA 1ULUA 3KM0A 4JJGA 1LNQA 1ZXBA 1PGNA 1U8FO 1Z45A 4GWKA 3OF2A 1QR6A 3MWEB 4CUJA 4HKTA 3PQFA 1OC4A 3JSAA 1A7AA 3OH8A 1E3IA 3MZ0A 3Q11A 4AICA 3VTZA 3VAZA 4KDEA 5IF3A 3U5TA 1UXIA 1MUUA 2CDBA 4IQ8A 4WCDA 1AXGA 4RCVA 1EEHA 3RSHA 5KKCA 4RJTA 4KMSA 3CH6A 4WECA 3PZBA 4RVGA 3DBRB 4DWVA 5A05A 1P33A 3JYQA 1HE2A 1UUFA 1IHXA 5KJ1A 2VYNA 2Q4EA 2ZJ0A 5F5LA 4XQGA 1CWUA 1E7SA 1I3MA 2Q99A 4AJ4A 1E1MA 4R5HA 4ALIA 1F06A 2OZPA 1YBVA 3WXBA 4NBUA 2Q45A 1BXZA 3JQFA 3ANNA 5I9LA 3H4VA 3WQQA 1U8XX 4B4OA 3AI2A 4BNFA 4GX1A 1LUAA 1IYZA 3PHHA 3HWRA 3INTA 1LU9A 2E6UX 2VZ8A 1NP3A 3GDFA 3QSGA 2C5EA 4E5NA 1RKXA 2X0IA 1QRRA 3PP8A 1TVEA 4UULA 1O8CA 4IS2A 5I9NA 7MDHA 2AW5A 2C29D 3E6AA 4XJSA 5G4LA 2IEDA 3DL2A 3FF4A 1ADBA 3BMNA 1Q0QA 2GNAA 1UDCA 1KVUA 4MP8A 4YT5A 1XIVA 5DP1A 3ZNOA 4FB5A 4J1TA 3JYNA 3OJOA 1F8FA 4WCFC 3DBLB 2IYPA 1E1KA 4MVJA 4L76A 3W6UA 1PEDA 2Y1OA 3LT2A 1D3AA 1FDSA 2AHRA 5THKA 1SOVA 5FI5A 3ZV5A 1E7WA 1P77A 1YWGO 5LDGA 3WGYA 3LZ6A 2Y1DA 4BO3A 4ALMA 1OC2A 2EHDA 3JQ9C 2JFFA 4PLCA 3VZSA 1R4MB 1L1FA 2Y1GA 3ZWYA 3WGGA 2VUUA 1HYHA 5H82A 1P9LA 4NG5A 4ZICA 1EVIA 3QV1A 3KYBA 1GTMA 1ADFA 4R4JA 4NFHA 4EGFA 1HWYA 3MJVA 7ADHA 1R4NB 2OOSA 3PDJA 4U0JA 4O5OA 2E4AA 3U4HA 2IDZA 2VNAA 1ADCA 3WJAA 1A4IA 4IZIA 3JQEA 3PHIA 2O3JA 3G49A 4IPTA 2C0CA 3JQGB 3PXXA 1NWHA 3CINA 4NFYA 1KETA 5BSHA 4Q3AA 4BKPA 2QZ9A 3UCEA 3L6EA 5H83A 1ONOA 1XU7A 1NHGA 1HDXA 4GSKA 4RPKA 2WSBA 3D5QA 3JQ8B 1LA2A 2VHVA 4BO1A 3QRWA 2X1HA 3QVTA 1TI7A 1U5AA 2GN6A 3NAQA 1ZBQA 2JFHA 5EESA 3FN4A 3H9EO 4YJFA 5IN4A 3GN1A 5IXSA 4IMRA 1HDCA 3HUDA 2O7QA 4JXKA 4M86A 3L6DA 4RGBA 2QQ5A 3TOXA 3B1KA 1NYTA 2ZTMA 4UUNA 4FJ1A 2B0JA 1WP4A 4I9HA 3SLGA 1IPEA 3C7AA 5CEEA 3R6DA 1U4SA 2WDZA 3PHGA 1Q7BA 2HKIA 3D0OA 3QA9A 1YXMA 2D8AA 4IZHA 5I7EA 4QX6A 3AU8A 1R66A 1XA0A 4S1VA 5DN9A 5DZSA 1H2BA 1OZAA 3G1TA 1ISMA 4XRGA 4UEKA 3HDYA 4EEZA 1HDGO 1DIHA 2R00C 3LF2A 3WGQA 3L9XA 2VN8A 5AXBA 5C7IO 2G0TA 3M2PA 2JCXA 1XU9A 1GEEA 4P4NA 1E5LA 1HZJA 1DLIA 1ZK4A 4GLLA 4UEOA 4XRRA 2P68A 5FF9A 5HBRA 1WDMA 2PD6A 1TXGA 3DHYA 3U9LA 4EJMA 4DLAA 2D1YA 3GZNA 3RUHA 4Z0PA 1NAHA 4A03A 1LDMA 3H9QA 3OJFA 1Y9AA 1HYGA 5T57A 3H5NA 4E5MA 2Q50A 1U9JA 3L07A 3LLSA 2GD1O 5TIIA 1QYWA 1IB6A 1Y8QA 2LDBA 1X0XA 4HBGA 3HDQA 1E1NA 3G1UA 2FPGA 1E1LA 5KVQA 4CR8A 5JW6A 3V1UA 4R1SA 2HMSA 5DOVA 3ZU5A 4DUPA 4BQRA 3MOIA 4UUPA 3ROQA 2F00A 4ALJA 3V1YA 4NMHA 1BVUA 4FFRA 4JNKA 2IXBA 3D4OA 2J3JA 4W7IA 1DBVO 4WGGA 1Y5MA 5KVCA 1IZ0A 4AJLA 4DPMA 2I3AA 3K31A 4N7RA 4NJMA 2FOIA 5A04A 4CM5A 3KRTA 3DBHB 4R5MA 3A06A 2Y0DA 3EY4A 3BTUA 4BNIA 1O94A 3QHAA 4AFNA 1PJQA 1R0KA 3JQBA 4JJIA 5A9TA 1G6KA 4E33A 2IXAA 1LDBA 4GX5A 1H5QA 2DBQA 5H81A 5L4SA 3H6KA 1PS0A 5F1OA 4NBTA 3BAZA 1KEPA 4WNCA 1BXKA 4TRJA 4YVFA 4D0SA 1KY4A 2DFDA 3HN2A 4ONEA 1TT5B 3ZWPA 4OXNA 2WM3A 1ZVMA 3RFVA 4O63O 2RH8A 4BKRA 5IDQA 4OHUA 4YAGA 4RF4A 4HY3A 3X2FA 4DIBA 1CQJA 4ZQGA 1PJLA 1H6BA 1K6XA 5L9AA 1DIGA 2BI7A 5CEFA 3PIIA 3DONA 5FWNA 3JQCA 4NNJA 2JAPA 3PLRA 2VHZA 4AG3A 1BW9B 4KWIA 3WYCA 1PQPA 2GZ3A 2XXJA 4BNXA 4Q3DA 1A9ZA 4CV0A 2GGSA 1YDEA 3FR7A 4YACA 1EBFA 4CMIB 5A9RA 1MC4A 4PVCA 1OFGA 1U7TA 5C37A 5T6BA 1KOLA 4A73A 4UUOA 4YTEA 3S2GA 2W98A 3U4CA 1UZLA 3SEFA 2EGGA 3KBOA 3SBOA 3ITKA 4MVJM 3GH3A 4JJFA 4B3HA 1JLLA 3NDIA 1I8TA 3PFWO 4GX2A 4DA9A 4E4YA 2IRWA 3K96A 2NSDA 2NVBA 1WVGA 1CETA 3NT4A 2GZ1A 1QV7A 3DDNA 3FD8A 4YR9A 1TB4A 3W8EA 1XQ1A 1W8DA 1UAYA 1B8UA 3KSZO 3HNPA 2EKLA 4FFOA 4C7KA 4F46A 2I3GA 4ZQBA 3UW3A 4XJTA 3IIEA 1AE1A 3Q3CA 2DT5A 3C7CB 3QLJA 4KTVE 3UHAA 1R37A 4BUCA 2AEMA 1T24A 1V8BA 3ZZNA 1JKJA 2UUPA 3GNQA 3K2BA 1JA9A 1QP8A 4ALKA 5COBA 1EK6A 4CLEA 4BOYA 4PFJA 4YQYA 1EUDA 4E0BA 1B0AA 1B3RA 1X14A 2Q46A 3DWFA 3ZGYA 3G0OA 4NZ9A 3BZUA 1E6UA 1K5HA 3GVHA 5I9MA 5JPIA 2GN8A 3I1JA 1GR0A 1Q1NA 3PYMA 3WSVA 2EKQA 1GQ2A 3L4BA 3RUIA 1YQDA 1RM3A 1U4OA 1WDLA 1E3WB 1YBAA 5GZ6A 4NI5A 3V1TC 4BO5A 5TC4A 1RYDA 4LRTB 1MXFA 3C1OA 3IKVA 4ND3A 4BNMA 4KP7A 1GZ6A 1U28A 2BF7A 3RC9A 1PS8A 3RQSA 3DFZA 5FEUA 1MG5A 1WXDA 1CJCA 3D64A 1VSVA 3GN2A 2BH9A 5JNLA 1WAMA 3I4CA 5KKAA 1JAXA 3F6YA 1CF2O 1PWZA 1I36A 5MGBA 2FN7A 2JJYA 2AMFA 1R6DA 4E32A 4EJ0A 3PGXA 4XD2A 1HT0A 2WE7A 3EHEA 3A14A 4F45A 4YYZA 4GPD1 3GMSA 4M54A 3NJ8A 1W0CA 5JDIA 3JQDA 3DZJA 4YEDA 2GR9A 3ENKA 4PLPA 4ZVVA 3WTCA 4AJEA 3Q0EA 2B4QA 2VZ9A 2WE8A 1P1HA 2QG4A 4E5PA 1DRVA 5JAZA 1GYQA 1KIFA 3EW7A 4DBZA 5JMWA 4HP8A 3VDQA 4IJVA 3EMKA 4WEOA 1BDBA 4JQCA 1LC3A 2CD9A 3LT4A 1LQUA 2PZMA 1NQTA 5A5FA 1M76A 3ZW9A 2NVUA 3A1NA 1EMDA 5JO9A 4W82A 3H9GA 3ZV3A 5ILOA 2C07A 2CVZA 4ND1A 3PJDA 1C1XA 2PZKA 3GMDA 1Y6JA 2AA3A 4HX5A 4WLVA 5B4UA 1PR9A 4I5FA 4Q3EA 1F17A 3OQBA 1CRWG 1DC4A 3ADPA 1C1DB 1SB8A 2HAEA 1F8GA 2VOEA 4H3VA 1LQTA 4IIUA 1DRWA 2YDXA 4EZBA 3COSA 1I0ZA 4FFMA 3WGOA 3WYBA 4A27A 1JTVA 2OXIA 3AUAA 2VNSA 5KJEA 3VH4A 5A03A 2EEZA 3ONEA 5DNAA 1PGJA 4WE3A 2VWQA 2OO5A 2P2SA 1X0VA 3WS7A 2PY6A 1YL6A 1NR1A 5ILGA 1ZK2A 3DOCA 3F4LA 4Y98A 4G5HA 2YYYA 3E48A 5KOIA 1M66A 1PR3A 1I3NA 3PWKA 4HNHA 5T8KC 4ND4A 1LLQA 1NAIA 3QE3A 4E5KA 2P9EA 2RBEA 5JE8A 4DVJA 3FWNA 4PLTA 3UKOA 1V35A 4FGWA 4AJPA 2OMEA 4MDHA 4QO8A 1JVBA 1EFKA 2W2LD 2E37A 3U4DA 2QIOA 1BXGB 4XDZA 4GL4A 1M6HA 3EYWA 4XYEA 5DCWA 4YAKA 1PIWA 2O3QA 3ASVA 3FI9A 2WD7A 1T2FA 2P4HX 2DQ4A 2YHUA 4IJUA 3RBVA 2X9NA 1YL5A 1P0CA 1LDGA 2WMDA 2P9GA 1VL0A 4YRAA 4ALNA 2DFVA 1NQAO 4IUYA 2OFPA 4UVEA 4RPJA 2QYSA 3W8FA 6LDHA 2CDCA 3F9IA 1QORA 5A06A 3KSDO 2PD4A 2QW8A 5CPBA 1HKUA 5AYVA 5A5EA 4IY1A 4LCJA 2BD0A 4FD3A 4FFLA 1DIBA 1H9AA 4DPKA 4IINA 1UR5A 3GPDG 4YJGB 4B8ZA 3I9OA 2CSUA 3TWOA 1QKIA 2P5YA 1IPFA 2XOXA 3WGIA 3LK7A 4R1UA 3WICA 1LLUA 3H8VA 4NJOA 2YV2A 4HFJA 3FCOA 4RVFA 1NHWA 3W6ZA 1LSSA 1GZ4A 1DOHA 1Q7GA 2BFAA 5CDUA 1B14A 3AY7A 1O9BA 2NU9A 4BGUA 3QWAA 1QG6A 2UAGA 1WLYA 4D3DA 1H2HA 4DLLA 2X4GA 4K6FA 3TOZA 1ML3A 1ZCJA 3JQ7A 4WKGA 5G4KA 2E49A 1WMBA 4U0KA 5AVOA 3ZWOA 2Q1WA 1OI7A 5JY6A 1NVTA 2HMTA 1B15A 3F5QA 1V6AA 3HHPA 4CUKA 1TEHA 2HSDA 4I9NA 3VH3A 3O8QA 3RVDA 5BSGA 1IY8A 2Y1EA 2BFMA 2PD3A 4MIOA 5A9SB 4GGOA 5GZ1A 1NBOA 4YCAA 1EQUA 3AW9A 3PI7A 5BQFA 3DBHA 5GZ3A 3WNVA 1X1EA 3B20A 4RF2A 5FYDA 2BKAA 4YA6A 2D59A 2PKRA 3SJ7A 3DFUA 3PYXA 5HM8A 1H6AA 1DHRA 2FSVA 1LRKA 2WJPA 5JCJA 4FR5A 4D43A 2POQX 1DSSG 4WLUA 5L40A 2NADA 5F1PA 1LX6A 2AEFA 2PH5A 5ITWA 2UDPA 5ICMA 1Y8RB 1NM5A 5JFOA 2ZCUA 3VH2A 3STHA 4YWJA 4F6LA 2VHYA 4R9RA 1KERA 4NBRA 1YOVB 4J7UA 5IZCC 1IE3A 3DAGA 2A9FA 1EVZA 4XQ9A 5DOZA 3UCXA 1GY8A 2X0RA 3FNFA 4J1NA 4WOJA 4H16A 3F4BA 4Y67A 3GG2A 5I8ZA 4W7HA 4GQAA 5CEJA 3G79A 1X7DA 4MIYA 4RLSA 2GZ2A 3PHJA 3U62A 4GLOA 4GH5A 4BKQA 1DC6A 2QZZA 3BIOA 3DAFA 2Z5LA 5ER9A 3WG9A 3OQ1A 5IZCA 1Z7EA 1SO8A 3PQDA 1ISIA 1E6WA 3FWZA 4JX8A 2EIHA 4DLBA 1Z7BA 1JAYA 2FR0A 3ASUA 3TSCA 3VKUA 3BTSA 3B70A 2B69A 5EQDA 1ZSYA 5TX7A 4J90A 1VJTA 5U9CA 3MJEA 3VDRA 4L0QA 1CIVA 1PL7A 3GGGA 3H5RA 4I8XA 5EPOA 1ZEJA 5IDWA 4P4LA 2HJRA 3DTTA 3MOGA 3G17A 1LRLA 4R1TA 4F6CA 3EVNA 5A02A 1CEQA 4A5OA 5IFLA 3INRA 2BGKA 5BNIA 1C0KA 4L9RA 2P9CA 4LMPA 4RDIA 3T4EA 3ENNA 3GNSA 2V6BA 4AVYA 2AQ8A 3RKUA 1U3WA 4NK4A 3ZWCA 1LBEA 4HWKA 2O3TA 3IDSA 3QIVA 3JD0A 1HLPA 3N7UA 2BRUA 4WEQA 4GVLA 3KZVA 5EL0A 1DJNA 1KC3A 5G0TA 4P38A 4D46A 5K6AA 3MJCA 3RFTA 1MLDA 4N54A 1UP4A 2A35A 2Q2VA 3JQFC 3M2TA 3AFNA 2BHLA 1UXGA 1P1FA
chains in the Genus database with same CATH superfamily
1ENPA 2H9IA 1B6RA 2AMJA 3UXHA 1MCZA 3D3WA 3EASA 1IVSA 2X15A 2BYTA 3FLBA 2ORYA 2Q3HA 2QRGA 3LUBA 4ZA2A 5EHIA 5ER6A 5CB4A 3QKWA 2V7WA 4PLGA 4U6QA 1Q0PA 1G5QA 3LFHA 4M22A 5KNLA 4ZHQF 4Q03A 4BJ1A 4S04A 2BT4A 6AT1A 4D81A 3ZDCA 1HQDA 2WOOA 4B43A 3RJZA 3O7MA 3D7NA 1DJPA 1TEZA 2AZXA 2HUNA 4LOIA 4DL9A 2OGZA 2JIBA 3AV3A 4PXAA 3TZ6A 2O5CA 2R8OA 3WBBA 1PGPA 5FO1A 2NU8B 3NHRA 1L4YA 3ADIA 3D81A 1Q1AA 4YJDA 1UAAA 1HEIA 4Q1VA 4LDNA 2VATA 4A6DA 3GLIA 1MAVA 2H4HA 3EGOA 5AKIA 3MELA 3ENQA 2H6EA 2RH9B 2L3JA 3GK3A 2P2NA 2RI6A 5L3SA 1M8JA 4HGQA 2YBDA 4QPZA 3H04A 3H9BA 1Z28A 3I9JA 1FFXA 4EARA 1XCBA 5AJUA 5JAIA 4W5TA 2PRTA 3FPKA 4N3CA 3PD7A 1FDVA 1TLTA 1J7JA 4YP6A 4GG1A 4IEEA 2FUG6 3A1EA 2QLJA 4ZN6A 4IIHA 5LIRA 1HYEA 3BGWA 3OPYB 4CCYB 4L4RA 1TIPA 1EFDN 1EFUA 3R3ZA 5ARBA 4K81B 3IA7A 1ONPA 2JFXA 3BHJA 1GYPA 1MRZA 2CZCA 2UZ1B 2M6KA 2VQFB 1EHIA 2I7DA 3WMFA 3FFXA 2QVCA 4N7MA 2B83A 2NUAB 1GR1A 2CJYA 3HHEA 3RIGA 4L5NC 4G09A 3D54D 3LGAA 1F2UA 1L5ZA 4PTYA 1ORVA 1XNJA 3PQ4A 5AJXA 1I5RA 3KD2A 5DTQA 5HVNA 1KH1A 1ZD8A 3NYRA 2XXAB 1OWPA 2IV2X 1WF3A 3ZIUA 4CM6A 3BFXA 2XTMA 3ELWA 3FVWA 2I9PA 1D9ZA 2VBCA 4QWMA 4BFSA 1KE1A 1UFRA 3W06A 4PPYA 1RPAA 2P6MA 4F71A 1ZR4A 3JQQA 3NV7A 4F21A 4ZPXA 4DNQA 1QOQB 4E07A 1FVFA 4YP1A 3ZV6A 3Q9NA 5C35A 4GZ6A 1G6HA 4LVUA 2V7QD 4PY2A 3CW8X 2NWQA 1P1RA 3LM8A 1P6XA 1U8EA 1ZLXA 2B4RO 5JNVA 3OF5A 2F8MA 3OUZA 1N7HA 1PAUA 5B36A 1W73A 1V7QA 5CLJA 2QDXA 4K9DA 1UIMA 3MGKA 2RJ3A 4EG0A 3KQLA 2L33A 1B0UA 2BE7A 1KJQA 3VU8A 1CY8A 3LX8A 4KWCA 4XYLA 4F9FA 2AZDA 2RGUA 2CXNA 3O82A 5L53A 3HB5X 3OEED 1KSFX 2AC2A 4X71A 3FROA 4EG7A 1NU6A 2FW7A 2WU0A 4XZ3A 2C1ZA 3DKIA 2DAPA 4MQEB 2CLCX 4ESOA 1POXA 4HUJA 3VZQA 2OM2A 3F6SA 1JSRA 3CV3A 3RSOA 4WY5A 2BP7A 2OV4A 4H7IA 5CDSA 2ZQYA 4Z4CA 1HTBA 2EJVA 3F6BX 3ODPA 3TW6A 4YFVA 3UGJA 1Q21A 1G0NA 2JIZA 5DNCA 5K8LA 4R2QA 3VV3A 3Q7QA 3I3OA 2HHHB 3ONVA 3LOQA 1S2MA 3LQYA 3WE7A 2QBYA 4ITUA 4ZVQA 2AI3A 2NP7A 3L8MA 3DMHA 1CS0A 4X97A 3VDXA 1SCKA 2H7VA 5DI3B 2IXTA 4LA4A 4OL9A 1RWOA 4XH9B 2ZTUA 1STOA 3G9ZA 4XGKA 2B99A 2AD5A 3C7DB 2LTRA 3B2NA 5EZ6B 5J4YA 2Z6AA 1PEAA 2JD0A 2ZBDA 3R7FA 3AUUA 3SF0A 1VFNA 4AZVA 2ZXUA 3T15A 1YV9A 4E2XA 2WJZB 1UFOA 2D2IA 3KUXA 3M9LA 4TPKA 2BB8A 1SHUX 2W11A 1NQOA 2W5UA 1WQ3A 1HXHA 4Z0HO 2R7MA 5CVTA 4LXXA 4JI8B 4RC9A 3WLLA 3BFPA 2J5KA 2CLFB 4QAQA 5EN4A 1TPYA 5K0EA 4KQ6A 1AKTA 4EBBA 1IY9A 2JOXA 3M1YA 5LP1A 4LRYA 2VDMB 5KYKA 1S2OA 4ZODA 2XEXA 1JWBB 1T4GA 3QEJA 4FHEA 1DKLA 4EG8A 3K5WA 3NGMA 4OJKA 4L4YA 5KB3A 3VGPA 1SC6A 2R60A 1T2CA 4MVJP 4JBHA 3ZU3A 4PQRA 1Q57A 3SQDA 4TX1A 3A2MA 1P0FA 5DKFA 1YB5A 4HGNA 1B7GO 3KZMA 4OLHA 4KQCA 1SQ6A 1CP2A 5D51S 2FXIA 5FLXC 2FKAA 2ZCVA 5FQOA 5ARDA 1VHLA 5F2NA 3RU3A 4K9PA 3EVTA 1O94C 3KYDA 1GUYA 1I6MA 2JG3A 3AVOA 3LWNA 1JHUA 4WNIA 1YR3A 5HE8A 4RM3A 2ZS9A 1XYYA 3JPYA 3PRJA 5BUZA 3KPUA 3SNHA 2WILA 3V97A 3T5GA 3TRDA 4M3NA 1Q1EA 2YTQA 1WKCA 5JZBA 3QTLA 4E5YA 4LZJA 3PQ8A 3PQEA 1UMBA 3FOWA 3LRTA 3ACCA 3OP1A 4MVJH 4GKJE 2FFRA 1QBKC 5ALKA 3BIXA 2VAWA 1WW3A 2VHUA 3PTLA 3VNSA 3WGJA 3RSSA 3PFKA 4G24A 4KXQA 5MDHA 1U7DA 2L17A 1BVHA 1TM1E 1DJLA 4WY2A 4G0XA 5DK6A 3WZLA 2D54A 1Z83A 1QHNA 3PGMA 3D8HA 3KXKA 3S3TA 3U26A 1AC5A 4EA6A 2QNRA 3P52A 3LC2O 4WTOA 1C81A 5JYEA 1X7XA 1IEWA 1EK2A 4E94A 1TC1A 2I54A 1S8NA 1GD1O 1SD1A 2J32A 5JSUA 4ZEMA 3I5MA 2J87A 3DTYA 3H86A 5B3KA 1U0BB 2IYXA 2VRCA 2E5LE 1HE3A 4PIMA 4Y30A 6GPBA 4EVRA 2H52A 5KINB 2N3ZA 4A1OA 3THNA 2CLOB 3M8KA 4AJ1A 4NCIA 4MDFA 1UK9A 2NO7A 2NTNA 1GZHB 4PZLA 4WXRA 4BLQA 2PLRA 4JT4A 4U4AA 1GFSA 4HAUA 2NU6B 5DEOA 4AF6A 5DRTA 1E94E 4Y0VA 5IH7A 3H5OA 3OE1A 3UICA 2C31A 2ON6A 5K3SA 1RNLA 4HVLA 2I91A 1U11A 2BGLA 4TS3A 1PUJA 2QD4A 3EUWA 2J0QA 3I4LA 3EXFB 5L8VA 2ZIEA 2E5WA 4QTZA 4XVUA 3O4VA 4Y7CA 1KEZA 2FWJA 1YONA 3UFXB 1B23P 1PJZA 1YZHA 1NNUA 2EOYA 1A69A 3ISJA 2QVXX 1XDWA 4IDCA 4TMWA 1A71A 2KONA 1FNDA 2Y2UA 3JZIA 3MTJA 3UC9A 1MZVA 2RG1A 1CUBA 4YJHA 5HFAA 1XXHE 3I6BA 4YP5A 3DXZA 2O2YA 3LDFA 5ITVA 5KMGA 4URWR 1Z35A 2FMXA 2ZR0A 1O89A 4KIGA 3UXEA 1GUBA 5YASA 2ZM5A 4R2DA 1E5TA 3L0BA 4MCJA 3D2LA 1FFEA 2FY8A 1EVYA 4P36A 1KVSA 4LJ4A 2GFIA 2V59A 4JMLA 5DX1A 4AT1A 3E3OA 5JAMA 1SC9A 3U44A 1NVXQ 1KMQA 2ONZA 2HQBA 4HNAB 4J0KA 4KQXA 4KO2S 2ENWA 3KE9A 2VP0A 3KAJA 3JD2A 2JIMA 4PYKA 1XLTA 2J9XB 4ARAA 3M82A 3MWDA 1E7YA 1QGDA 1XRSB 4Y2HA 3VX3A 3K32A 4YRMA 4LU9A 5AE1A 1P61B 2XI4A 1E1CB 3AR4A 1KYTA 3KEMA 3LIPA 4HC4A 5HIMA 3PL5A 1R1DA 1ODIA 2C1EA 4OGKA 3GT0A 4M30A 3AFMA 5AHWA 4ZMSA 4ZDJA 3C6YA 3KSBC 3BJEA 2WSLA 1ODJA 2QD2A 1ZJ6A 4ZGBA 1MQ9A 5BRNA 2VYVD 3CPSA 4Z3DA 2WFLB 3L4BC 4JUCA 4RPHA 5IEBA 4CQMA 2JF0A 2BFEA 1T1SA 2DPGA 3BF8A 2G67A 4JKIA 3IDZA 3LBYA 2J0SA 3NHUA 1CUSA 4JNCA 3S40A 4CMBA 3ADDA 3HBAA 3LGSA 2FWBA 1TYDE 4G4GA 4MUXA 5DHUA 3OCYA 4AWAA 3O1LA 1PCXA 3ETNA 1SRQA 3L9WA 3SX2A 4EB8A 1B41A 1Y7PA 3F6GA 2I2XB 4FJ2A 1AKQA 2AN9A 4MEJA 2QD3A 1XRRA 3D4BA 3LYUA 4H7PA 1OYOA 1T39A 4QTYA 4GP7A 4AIRA 1C7QA 4HSGA 4HNGA 2FW8A 1YDGA 2JD2A 1DV2A 1RQ2A 3EMVA 2ATEA 4URHA 5HZKA 3T1YB 2VJDA 3OZDA 3HXPA 3ZI4A 5K09A 4HTGA 2AYYA 1JKIA 1IJKA 1FLVA 2O4UX 3N86A 1A97A 2GZDA 2XPCA 4G89A 1PFVA 4S2UA 4WUVA 4YLEA 1H5NA 2B4AA 2B8NA 1HKHA 4E5KA 2AE1A 2EXXA 3OIFA 3FBGA 5KHAA 3IULA 4X7PA 4NNPA 1NXTA 2EHJA 2BR5A 2ZYUX 3DBRA 1ISFA 3P9IA 4WAUA 3GFPA 3ZXYA 4DLNA 4EY7A 5LDHA 1GSHA 1L2TA 1T26A 2IZZA 5E7JA 4Q4HA 3S2SA 1U2QA 1H23A 3T99A 1UT5A 3PX7A 1TO6A 3G13A 4IQ4A 2EFYA 4JP8A 4AMYA 3ZJ4A 1HDOA 4LTMA 1X1RA 2FGGA 4QEDA 1XZNA 3A6JA 1L5OA 4HR7A 3X1DA 4ZJYA 5CU7A 2IEYA 1ORTA 4GW3A 4FONA 4RNDB 4QD3A 3KXLA 2OY0A 4HWTA 3N74A 4I55A 4J7AA 2ZRIA 4LRXA 3TRJA 3HJUA 3IQEA 4J6EA 1JPUA 2ZYWX 2IZ1A 5DISB 3GJ3A 4RIGA 4L74A 4RK4A 1D2GA 3T7IA 1Z34A 2QRQA 1G64A 4V0KA 1AKUA 2WINI 4JBIA 1RXSA 2C83A 2WZBA 1X2BA 2HBZA 3WGKA 2HQ1A 1LFAA 1E58A 3V8RA 3A7DA 1TT7A 4Q39A 2R8EA 1XP5A 4GMXA 4IQFA 3HTXA 3DBLA 1P3DA 2I2CA 4EKEA 1I13A 1CUHA 1UJ6A 4MW6A 3ZLBA 1E1RD 1FA9A 2FKNA 3I37X 1WHQA 3ABZA 3GEHA 2BBGA 3LDAA 5BN5A 3OCVA 2FV4B 2Z2XA 3I53A 2J6HA 4KDFA 5I7OA 5KZMB 2JGMA 4YN3A 2QTGA 4RK6A 8LDHA 2YXLA 1BWRA 4DLVA 4WXMA 5IWCA 4L0DA 4XGQA 1PLJA 1XVTA 1Z4JA 1SHTX 2E2WA 3WRYC 2ZE5A 5EGSA 2FDXA 1P81A 3NC1C 1ZD5A 1KAGA 3WADA 4R54A 5IYZB 2IIBA 4LDJA 4RWZA 3N6VA 4OMCA 2VK8A 1R4MA 3FUVA 3P5SA 3UBMA 6REQA 3WZMA 4KIUA 4F84A 3QZUA 4NMXB 1X94A 1Z75A 4IIXA 2ENAA 2DG2A 3E5HA 3HE3A 2J3KA 1R4NA 3GUUA 1YRHA 4BFVA 1CZRA 1ESZA 3NRJA 2QRVB 4OMFG 2G6TA 1Z6AA 4KN6A 3KZNA 1KQNA 1ZN7A 2Z3WA 2HTFA 3LZDA 3QJGA 1B6GA 4HDSA 3PK0A 3GJQA 4IJQA 3RW9A 3GO4A 3T5PA 1FFBA 4O59O 4JD5A 4UBIA 2J08A 4W6ZA 3NLLA 1PR2A 2NZJA 3KYJB 3ICCA 4QUKA 1D1TA 3JQ8A 1AHIA 1YR1A 2IY7A 3VYWA 4ZK6A 2ZS7A 2ZYDA 4XWAA 4CHTA 4NE9A 2GT1A 1Q16A 5I51A 1H2AS 4ZYVA 1OLSB 2EDCA 5KPJA 1KTIA 1RLUA 3MW8A 3B7WA 4I46A 1DMRA 2GWRA 2FZ4A 3NIGB 5KJFA 3QTBA 2P9FA 5GONF 2JLVA 2GILA 1ISSA 4F3YA 4CUZA 3FMGA 2HC5A 4EWLA 4UUMA 2XQFA 5EE5B 4PN3A 3A6FA 4LGMA 4HUTA 2QLTA 3LP5A 3ER8A 4TWBA 4OSPA 2RC5A 1N1EA 3B6MA 4OHKA 1SIOA 5K0NA 2L6MA 4IDFA 5JH7A 1ILWA 1RI4A 1UDXA 2QX9A 1NJ2A 2M7QA 1OLUA 4CFZA 4Q4CA 4LF9B 4QLAA 4L8VA 2PCLA 3ENZA 2OYCA 3T35A 2OHGA 2JFQA 3BWYA 3EXG2 4FBMA 1VKOA 3WGLA 3WLIA 4BNZA 1L4KA 1ITZA 1L4UA 1LPSA 2JAHA 1L7QA 3C6XA 3ITNA 3K0BA 4URYR 2NM0A 3VTFA 4YAKA 2C3UA 3EN0A 3O8CA 2J07A 4JN6B 2OZVA 2HDHA 1JJ7A 2Y67A 3EEBA 1U65A 4HRXA 4LRWA 2DR2A 2PMBA 1Z4LA 1PRYA 2CMDA 2DLKA 4RL4A 4CV2A 4Q4LA 2YXNA 2OVFA 2G5TA 3ZOKA 3ZZMA 1INLA 4X6YA 2H06A 2Q5EA 5IBCA 2VF1A 3MJDA 3PKZA 5K0BA 1JEQA 4LDRA 4CL0A 2Z6QA 4CEJA 1GU0A 3OSZA 4Z7JA 4EYEA 3OHSX 1C3OB 4HT3B 3O8LA 1H66A 2R7LA 4UE2A 2NV6A 4PU0A 3QKRB 4PG4A 2G7ZA 5HDBB 4C6HA 5AVTA 4HDQB 4J2HA 3KC2A 4OFWA 4G1EB 3OM9A 2GN9A 4XLLA 1BHSA 1DG3A 1ZWLA 2F1RA 3CCBA 2MINA 3U3JA 1J5EB 3ESZA 4TL9A 1OJLA 4I5EA 4BVEA 1JIXA 2HIGA 3AHJA 3K6SB 1ODKA 1VB5A 4TV8B 5F3DA 4FGSA 4OCZA 3ECRA 2D1TA 1E1YA 5SZIA 1Z0FA 2IITA 4PZZA 3WHPA 1W36D 3GZNB 1PBNA 2W6MA 3A8TA 3ONDA 2IGBA 4FQ8A 3GA7A 1E3LA 2EPOA 2P9YA 1J49A 2X7XA 5A4DA 4RS4A 3QVOA 1C5KA 4IJKA 5EJFA 5KEIA 3KWLA 2CVQA 3T34A 2ZANA 4C2AA 3DE1X 4RJLA 2EOZA 2G72A 2FUCA 1ECFA 1VSBA 4H7FA 3Q3GE 3IB6A 2CBGA 2KBEA 4HLCA 3ZCPA 5TQVA 1P4GA 2RDMA 2BN4A 2HQOA 3OOHA 2DCMA 2Q5CA 3G2QA 3WL4A 4BBAA 1AN9A 1Q0UA 4RY8A 2K7ZA 1PO7A 1QP7A 3AUFA 3H1AA 4GXQA 5CVUA 3CF0A 4HRAA 3CLUD 2CW5A 3I34X 3PUWA 4ZXPA 5CVDA 2H1VA 5CFFE 4ZD6A 1DAFA 5AKEA 2Q8NA 2JVAA 1EA7A 3IBYA 5FFNA 5FPTA 4AQDA 1Z6YA 3WIVA 3JASA 5TMPA 1HORA 1NFFA 3OT1A 2F1OA 2P2ZA 5JQWA 4TTRA 3RRFA 1A8IA 1MORA 3P71T 2PE5A 4NHEA 1DBQA 2WOJA 3I1FA 2A0XA 5CA1B 3C3PA 3KVNA 1V4BA 3VNUA 3D31A 1MG0A 3U48A 3CF4G 4CMJA 5K3EA 1SXJE 4R69A 2O2JA 3A4VA 4BLWA 2A5YB 1EWRA 1WDKA 5SYMA 3U9TA 5I4BA 3T0GA 2XGMA 4OKNA 5ALMA 4OXYA 3IQFA 4NAUA 5BW6B 3SOZA 1KHHA 4C3ZA 1AV6A 1AB5A 3NTOA 4LWPA 4NKRA 3MPUA 4M1OA 4N40A 5KTKA 4GQIA 1WB5A 4M49A 4MV1A 1VE7A 5H3LA 5DHAA 2I2AA 3UAXA 2O2HA 5CTJA 3AUKA 1HYQA 5EEHA 1SVMA 3I2GA 1SHLA 4AY5A 2DYKA 3EQ6A 1M72A 4YCJA 4PYRA 4S24A 3GUHA 1KAEA 1SXIA 1E5XA 5B1IA 4BV8A 1ZAAC 4L2IA 4AZ3B 1A27A 2GD2A 3S81A 5CYPA 1USIA 2Z56A 4OVKA 2O59A 4EYKA 5B55A 1J23A 2GJKA 2QD5A 3CTPA 1ZM9A 2FWMX 1IUNA 4FR0A 5F21A 4F38A 3OIUA 3BEOA 3I2KA 2YW9A 1TCBA 2PANA 1ZNYA 1WA5A 3KZXA 4KPUA 4RIEA 5CLIA 5LA6A 4AXBA 3KOYA 3DO8A 4KYTA 4P5PA 1BBOA 1P0MA 1W34A 5HUHA 4IMPA 4U2CA 5I7UA 3BQ9A 2ACWA 3RIHA 1TQ4A 3N2KA 3CZ4A 4CIDA 4P3YA 1CHDA 1BH6A 4JJ8A 3B6IA 4TRNA 5B1HA 4GLFA 4CDNA 1CV2A 4IF4A 2FMFA 4JFAA 2A1TS 1T25A 1EH5A 3JWGA 3K09C 1HE8B 1NR7A 4IG4A 4J94A 5AKLA 4D3FA 5I45A 2X13A 3L1KA 3ESDA 5BN4B 4MHTA 3RROA 2NXJA 3F6CA 3PXEA 1TM7E 4MLCA 1TKCA 3D7LA 2V6IA 4HDOB 5KO2A 4ZAYA 1H85A 2P3OA 2WNHA 4PTLA 2BGMA 3L0IB 4XIJA 3OE4A 1N2SA 1C4KA 4LX0A 4Q3OA 3ZXXA 4ETNA 3K70D 3U4GA 3T06B 5B7QA 3ZLJA 1MB3A 2WP8J 4D44A 1XVAA 4CODB 1U5BA 2ZU0C 3OPXA 5TS2A 5KREA 2XNKA 2GA8A 5CM9C 2RHJA 4PEVA 3D6JA 4Q1BA 1RHMA 3CMMA 1ACMA 3JCZA 1FDOA 4H08A 1LKZA 4YCCA 1DU4A 4NIMA 5JO0A 2GJ9A 3AEKB 1CJSA 2X2EA 3X1XA 1CDOA 3EA0A 2F1KA 1M6VB 3FPGA 1IHYA 1YL7A 2EFDB 3HR4A 3UJBA 1WUJS 4DPLA 1KEWA 1J33A 2W70A 4YT2A 4AMBA 2Q0SA 3PD1A 4WN3A 1ZCBA 3DJYA 4ID3A 5BN1A 3NM5A 1P47A 3UN1A 1QH9A 2R11A 5JZMA 4WBNF 4YPVA 3ANLA 2XMQA 3Q3VA 3RB8A 3OZVA 4CM1A 3LC0A 1RADA 2Y93A 1A5BB 1OTHA 4RF3A 2XCIA 1TKRA 1G8FA 3O4FA 5E7IA 1U2ZA 3RVPA 3TEFA 1PD0A 1TTTA 3VHQA 3PQ3A 4MH0R 4Q1DA 1Z26A 4RABA 1GEGA 5FTJA 1M0WA 1JLHA 3GLHB 4FC7A 4KQEA 3E22A 1E5VA 1L6RA 4TV9F 3GD5A 2VHJA 5ALEA 2IDJA 2LRSA 5DXAA 2WKSA 1UKZA 3L2OB 2P3SA 4TWRA 5IF9A 3UT5B 3L00A 1IZ9A 2AWNA 2JIDA 2R97A 1H4VB 4YMVA 3GFBA 5CCBA 1RC0A 3CKKA 1NIPA 1W4RA 4IKEA 4Q3CA 3TE6A 3DXXA 4MMXB 3GVPA 3FLAA 3BRCA 1QVAA 4WJZA 1TFRA 1Z0JA 3DM5A 8MHTA 2VH5R 3PZRA 4F3TA 2WYHA 3PUXA 2XGJA 4LF7B 2B5WA 2X0JA 3Q5GA 4OB6A 4EKDA 1BX3A 3MB5A 1FK8A 1KI6B 4NDAA 4Y6LA 5ALWA 3SAJA 1UC4B 3ZHVA 3STWA 2H1CA 3EZXA 3E3AA 1ESMA 2WWRA 2IEGA 1W29A 3QLTA 5DW0A 3OECA 1OX4A 1GZ5A 2XQKA 5MFPA 4C0HA 5F9HA 3UB4A 1K63A 1UEJA 2BGNA 3CEAA 2YINC 1KGDA 2CMHA 3HPQA 3SLKA 4AYXA 5LP6B 2HPVA 2R6GA 1FDWA 2ZPTX 2HCFA 3I9KA 4MUBA 1MOQA 3ZYZA 3FGNA 3OZRA 3FOEC 1T6XA 2PLNA 1SZPA 4G5GA 2O5RA 4I50A 3VNBA 3QELA 3VOSA 1MTOA 3LUCA 1DX4A 2EKPA 5IBQA 5U1PA 4IOKA 5AI0A 4NLLA 3G02A 4E11A 2D2EA 1MX9A 3ZY2A 3L77A 4GNKA 1P45A 4JR1A 3RTGA 4BC0A 3U61B 1DUVG 1II0A 1ZMBA 1QCZA 3D2AA 2VQEE 3HXMA 4UU0A 4BIMA 3I1IA 1TA4A 2VHCA 3BTOA 3S44A 4L4SA 4GSLA 4FMCB 4N5LA 4NCNA 2W6QA 5LD2B 3OC6A 4XPIB 4ZXFA 4EYSA 2GPAA 3KB6A 2I71A 4X7RA 3OQIB 3ZVRA 3GIDA 4LF8E 2PV0A 4MDEA 4RHBB 4QYIA 3HADA 1YUJA 5FLKA 1YS9A 3WFJA 1CZHA 3EZGA 3BVPA 2Y66A 3QXGA 2XB8A 2G5CA 5EYPA 1Z33A 4D9NA 1UBHS 1OH8A 2G1PA 2O8BB 1N5LA 2XSZD 3S2ZA 1NUSA 2GWHA 3ROTA 2ZVJA 4ZU3A 5FPKA 2VSNA 4B83A 1GV1A 5JNWA 4QA9A 4KQKA 2JK1A 2QZPA 4WCFA 3B3JA 3H3JA 4M1YA 1T8PA 2QTBA 2JBWA 4XB2A 3I61A 1D8AA 4WK0B 2QU8A 5LBIA 4BVAA 1IUPA 2PJRA 3VSDA 3ZDAA 1SCAA 4ISBA 1U63A 3D8BA 4OOFA 5TF4A 4ER5A 4CMAA 4PLZA 1HC7A 1ZC4A 1JU3A 4IO0A 2TMGA 4WOCA 4F3CA 3AZOA 3ETLA 1ZD9A 1ENOA 2WWGA 3MIIA 1GN8A 4GE3A 1P7YA 3DOIA 3OJ0A 4TRRA 3CF2A 1WETA 5DSTA 1FUKA 3JQ9A 3TGLA 3G89A 3G82C 2BTEA 1RPTA 1FDRA 1DI0A 2UZ3A 3HN6A 3PPWA 2H2WA 2Q9BA 2X14A 1JEJA 4KGDA 5CX4A 1GIAA 5FPSA 4X64B 1UF9A 1RMTA 2YWXA 3N7AA 3TH5A 1E0SA 3ZWQA 1L3BA 4FI3C 2C9ZA 3FLEA 3P7MA 3AERA 4TL6A 4BVBA 4HNVA 4EPWA 3GRVA 5JNRA 5LKAA 1SVWA 1RC1A 1GNSA 2H5LA 2BTOA 5GVRA 1FJHA 3MHPA 2PPLA 4P84A 1Y63A 1CJTC 1XG5A 3A6HA 4MKIA 4R1QA 2IWHA 3UUWA 1UQTA 4ZHQB 5F33A 3NWBA 4CLOB 1T5DX 4JQZA 4IIFA 5IN5A 1PZGA 4OYLA 1MIOB 3EXEA 2XVMA 1N92A 1PNVA 4ZCSA 4J7XA 3VMMA 2EPLX 3SKVA 1AGNA 3UEOA 2NGRA 3SMQA 5HJ5A 1JFFB 3DHEA 4OA8A 3V5NA 3ZG6A 2WD7B 4KXUA 1YAJA 1UBKS 2WZOA 5HF6A 4BAZA 4CM9D 2I4RA 1E1DA 3RC7A 5HOQA 2GF2A 3MMZA 4V39A 4P58A 5DCLA 3FETA 2H1HA 4NBWA 4WMLA 2JHCA 1H93A 3A7EA 3MTBA 2OAP1 3HU3A 3NXSA 2JANA 1V45E 2VPPA 1FLAA 2HWWA 2VPYA 4MMYB 3RI3A 2BMAA 1UHZA 2P79A 4QEKA 4DC9A 1RXUA 1SG0A 2PXHA 1S6YA 1UPCA 3C8ZA 3FPEA 1GUAA 3KLOA 4KLZA 5T3YA 4X24A 5AJYA 1GTRA 5AJVB 3S0JA 1I5OA 1YCHA 3TNDA 4L4UA 1YFHA 3CMCO 3KZYA 4PS1A 3O4IA 2BDEA 2DB3A 1U0HC 4UAGA 2LDXA 1C3VA 3VPDA 1X7GA 2YUTA 2ZJ1A 3EGWA 2PGLA 4D3ZA 3HDJA 5K0TA 1FFGA 1MR3F 2I65A 4PC3A 1AY0A 3T3DA 1CFJA 1JR3A 1LPAB 3NIBA 1VC2A 3E9ZA 1K7FB 1SXJD 3LYLA 2YWGA 4Q02A 2L0XA 2WD8A 4BAUA 3DQPA 3WDMA 4YCNA 4AS2A 1MV8A 3M34A 2GHTA 1EE1A 2OXFA 1KK3A 4RV9A 3IAHA 1SU4A 4OA5A 3SZRA 1XXLA 3U3RA 1JQDA 1RFLA 2FN4A 3B7GA 3NP7A 5JZ9A 4I8DA 3GFSA 1VL2A 3QNUA 3KR2A 2QTFA 5J4VA 2R1UA 3DV0B 5AKKA 5KVVA 5EMJA 2EWMA 2ZIFA 2OHOA 3MFQA 3R8XA 4GGPA 3VPBA 3Q7TA 4F7DA 4L1KA 4FN4A 1TIKA 3Q5EA 4R7ZA 4B2YA 3FDFA 4PZYA 4UAUA 2OFFA 4DUYB 1XVVA 2W2NA 3N0WA 5CH3A 2N9UA 4OSOA 2WIKA 3P9KA 1O03A 4RFSA 5G4KB 2JARA 3IQZA 4DMGA 4CKCA 1GLVA 1EG7A 4MB0A 4ZT4A 4G6ZA 5C8ZA 3UENA 2ZDQA 1R0LA 1WXWA 4ID9A 3WB1A 4HXFB 4Q4AB 4IUCS 1E60A 1T5SA 2ZR7A 5JSKA 1TMGE 3EA4A 4QQ8A 5FUWA 5BNFA 5C2JB 2JFYA 5CB4F 4FE3A 4R1NA 2PHZA 3GGPA 1BVYF 3BXPA 3PNSA 3AJ8A 1PSZA 5D7BA 2P91A 2LGJA 4BFXA 4F5WA 2PJDA 4GPZA 4Q5IA 2X6RA 3PGLA 1YE8A 3ZNQA 4B7UA 5TVGA 4QQFA 1FUIA 5SY9A 4PE5B 3NDRA 1ZO8A 1RXVA 3OJXA 4BV9A 4X8HA 3THSA 3TLJA 5B5SA 1WNTA 1Y82A 1ZK0A 1V95A 2VJLA 1DP4A 2FMHA 2ZUUA 3HA7A 2B8TA 4BNWA 1Y6FA 2IH2A 1ZD2P 2VQSA 1WULS 4C78A 4LWQA 4YRJA 4IF6A 3PENA 3N7TA 4FZVA 1K86A 2FPMA 3RVQA 4A2WA 5CAEA 2NTVA 4TVBA 1XLTC 3KOWA 1KDYA 3VC1A 1GFIA 3IOYA 2JKVA 3AF1A 1GNRA 2C4TA 4N4RB 3R76A 1T29A 3IHLA 4B3ME 1WUIS 1RLIA 2OO7A 3G2PA 1LPMA 1U2SA 5HIKA 3PL1A 5CNIA 3C1TA 4G81A 2G04A 2JD1A 3NBAA 4DYVA 3NX4A 4BX8A 2WWTA 1VE5A 4DV1E 1VBNA 3PPXA 3QMMA 2ZK7A 1KQOA 4C7MA 4IXWA 2MIIA 5AJTA 4L07A 4UEQA 5C5DA 4KZKA 2XUQA 4GSYA 5KJ1A 4AD8A 1GPWB 1ZUWA 2W6CX 2RHMA 3L1IA 4NENB 2KM1A 3G3EA 1E77A 4P3KA 4YMSA 1YZLA 2BFDA 4JUBA 4E5DA 1Z5PA 3RYCB 4M89A 4DA6A 3KHUA 4AKGA 4M9VC 4I1RA 4S35A 1UBLS 5JJIA 3Q40A 3GA5A 4UCXA 3EDMA 4FSDA 4LISA 2F7SA 2YVUA 1DC5A 1GVHA 2NUPB 3ZKWB 3S2UA 4QTTB 2NW6A 3AJEA 5EE0A 1PL6A 1KRWA 4HJXA 4O3MA 2KPOA 2IV7A 2NTYC 4HCJA 3PXBA 4CF4A 1QFXA 3KJQA 3IJPA 3RRZA 1OQAA 4LXYA 5DPMA 2O14A 5DULA 2HF7A 2OSVA 2DGDA 3ESBA 4JSTA 4JVNA 1R0YA 4ACAA 4BBJA 2DQYA 4J3NA 2ZUBA 1JSLA 4RH0A 2XZDA 3OTIA 3LPCA 1D6JA 3O8RA 1M10A 1U8ZA 2FE4A 1ESCA 1ZXLA 3A1DA 4DT1B 2B4TO 2I9KA 1IBKE 2D5CA 2HPZA 2FOLA 2I22A 3COJA 2PH3A 1YRWA 4YHBA 4M87A 1W9MA 3HXQA 2OCKA 2GCOB 1T2AA 4NCBA 1M2VA 3UJ7A 4FYHA 3TNLA 1YZNA 5JXWA 1BDIA 3LV8A 1F12A 3RHTA 3E9RA 1GNVA 1YZTA 3SE7A 4Q9AA 1WABA 2EPNA 1J0AA 2AKAB 2ECKA 2ODRC 2ZJOA 3JQPA 4HQ0A 2BISA 4CLRA 1QRUA 5HZMA 1XUOA 2XT0A 3D6NB 3PV0A 2V3WA 3S1AA 1S01A 2L2NA 2PO7A 2VJPA 1Z74A 3WL7A 1H69A 2Y4NA 4R41A 5B58T 4N03A 3CE6A 2GPYA 1M75A 3K2QA 4IHQA 5J9FA 4DLYA 4YK7A 4ZJZA 1A9OA 3UWOA 2Q1XA 3DNMA 5E4TA 5FA5A 4H1TA 2E55A 3VZDA 3PFHA 4REMA 4Q7EA 3H3FA 4K0KE 1U9IA 2XZPA 2IOYA 3FPHA 4LSWA 1Q0LA 2ZRQA 2MU1A 2R25B 3UZUA 3GLGE 1QX4A 2FRDA 4EPXA 1B16A 4R01A 5BVGB 3UMJA 3UA4A 2J9RA 4RTQA 1GAJA 3V4ZA 4JEIA 2ZBGA 4C4AA 4ODIA 4D9HA 4D4JA 1O08A 1D4FA 1YK0A 3GCDA 3TW4A 3VHRA 4YRBA 5IT4A 3S1SA 4OHYA 4IJDA 4DR3E 3IHWA 4IR7A 3BMQA 3O1HB 4C21A 4ETWA 5A4JA 3L92A 3MRVA 3GFQA 4MGIR 5AW7A 2CT8A 1RZVA 2OBMA 1EGVB 4URVR 2I29A 1AT1A 1E2NA 4GECA 2VK2A 2PKXA 1UZNA 2OXRA 1SEVA 3QYPA 1S2LA 1KYVA 2JXPA 1IAQA 4DMHA 4FI3F 4G36A 4RLHA 1T36B 1A82A 3VKWA 4BNUA 5FAKA 3JZDA 3HWSA 1DBSA 3D59A 4RS3A 3DOHA 3I9V1 2W2KA 3O9MA 1Y4ZA 2EL5A 1H8HA 2ONKA 1O0WA 2OV3A 4INAA 1GL3A 2FUNB 1BROA 5AXCA 3ZH2A 4MLVA 3SQOA 4QOGA 3K9NA 1I33A 2CNLA 3AZPA 1T9AA 3HEBA 2ERCA 4II2A 3IKTA 1ORWA 3H1PA 1QGAA 4XSHA 2ERYA 3AEUB 3HCDA 4KYUA 4D3YA 4YJ3A 2C95A 3C3WA 4IIBA 4BKUA 4COOA 2BH2A 2NO6A 1W47A 1YA4A 2A57A 4CFSA 3IAXA 2RGYA 5B53A 7ABPA 1Y9EA 2OFOA 2PFGA 5LIPA 2WIBA 5LVAA 3M1LA 1X7WA 3SX0A 2WWFA 3NZEA 4O4IA 1VB3A 4FE4A 3PEFA 2VCEA 1WV1A 3TLBA 4GZMA 2ZB4A 1P73A 1NSYA 4IV0A 3HY3A 5CBKA 4F2JC 4XPZA 3T9FA 1ARZA 2OESA 2XH8A 3CVOA 2G9UA 1KEEA 1KPHA 1QG4A 1VGQA 4DV2E 1KK1A 1YRQA 2B37A 2OEPA 3GJSA 1LK5A 4N3GA 3TDNA 1Q83A 1V5IA 2HQRA 2V7QA 4AWBA 4MGKR 1AKEA 2B78A 2IFTA 2XCQA 5EEGA 5DGDA 2QUJA 4P8RA 4A5SA 4DNFA 1AUPA 1SOWA 7GPBA 3LT5A 4QG7A 2OCBA 1BKDR 3HCOA 1FTWA 1KVTA 1NOIA 3ADCA 5FLEX 4N1AA 4L28A 3Q3JB 2CYBA 2WKPA 3E9QA 4DIFA 1Y3CE 1Y6GA 4QPDA 1JDNA 2AJCA 2PZEA 4M9CA 4DR5B 1USVA 2UU9E 3FNIA 4DV6B 3KQUA 3C6ZA 5GOZA 1WPQA 4U9UA 3MLEA 5LKRA 2WTAA 4JODA 4UM9D 1NF9A 2HYDA 4UE3S 5IBPA 3RRMA 3R3VA 4X95A 2QP4A 1FSPA 1XTVA 1Y6ZA 2EMKA 2GZMA 1XCGB 4MS4B 3ECSA 5FUXA 3KWRA 1BGVA 3F46A 5LYJA 2I2FA 2WWHA 3NXKA 2AK2A 5CH5A 4BCDA 4OAPA 3LD9A 1X80B 4XWYA 2J0EA 2H54A 2HH9A 2VF5X 2AI2A 2XY4A 2WYIA 3KTOA 3Q41A 4JQYA 4PG7A 4RVUA 3TOCA 4WSPA 2CFIA 2J4CA 2ET6A 1E9AA 2LRHA 3AHIA 2OM6A 3GB9A 1UAGA 3EFOA 3FNRA 4MQ4A 4TS4A 5ELMA 1W2WB 4C43A 1Z4NA 1SVKA 4XYGA 5KOJB 1UJNA 3AJRA 3LBHA 3R9XB 4AF7A 1YF3A 3WL6A 3PGJA 2WF6A 4EECA 3OQMA 1CZNA 3EOAI 2PRYA 3C6MA 3NB0A 1GUFA 4GR9A 2NQ2C 3IPCA 1XVUA 1H3FA 3HMKA 2IHKA 1XA3A 2R4UA 3GMTA 4MW0A 5F98A 5BRAA 4X1OA 2Z2ZA 1I94E 1JSZA 2EJBA 2ONCA 2YRXA 1U3CA 3WTBA 4GUAA 2FPPA 2YIMA 1YA6A 1KYYA 3UATA 4WK6A 3PTZA 1V9LA 4YUVA 1ECPA 4MQUA 2ZS8A 3E27A 5E9AA 2FVYA 2OAQ1 4ZAZA 1SVLA 4BMZA 1AX9A 4FPXA 4TS1A 2Q6OA 2NXNA 3R6LA 4UARA 5D8DA 5B2FA 3K92A 1MAAA 2HIHA 3R3JA 4HHEA 1TTPB 4ZCRA 4YBZA 1OMOA 4H17A 3WR5A 1YJ5A 1A2BA 3W8NA 1N1GA 4FFBB 4MMZB 3WLFA 4CM8B 4B3TB 2EMIA 1PQUA 3QVSA 3NAZA 4XVRA 3O5AA 3QQPA 2EFEB 7YASA 5JZSA 1HOXA 3VR1A 1TUGA 2A14A 2C3OA 1NI5A 4PHFA 3CR8A 4H7KA 4URXR 1EJ6A 4CQJA 4AJ9A 2H63A 1J24A 3I09A 4BX0A 3EEFA 1ZAYA 2OB1A 3N9IA 1CB7A 1JNXX 4ZAGA 3SIPA 1RJ9B 3TCKA 2UV8A 3HPZA 1R9MA 2II6A 1C9YA 1FBNA 1FRVA 3H05A 2OQVA 4D98A 5C7LO 2LNDA 1KY2A 4RENA 2XTNA 3Q8XB 4Y7DA 4F6RB 3SHOA 3QK7A 2DX7A 4Q0MA 3AKZA 3UANA 1E2DA 2XZTA 4Q19A 3AWDA 4DBLC 5FHRA 2WQ7A 5A2GA 1OX5A 3BD7A 3NS7A 1NONA 4KO8A 3IOCA 3WWOA 1RTTA 4H0CA 4JOCA 3TPZA 1H05A 3E1GA 1WMFA 3O92A 5J2TF 5FT9A 3DEAA 4TVKA 121PA 4UHCA 1QIFA 2DBRA 4JEUA 2VH1A 4PSAA 1CVLA 2WU4A 3RS7A 5B4TA 3ROPA 2G71A 1ZMOA 1X38A 1ZW6A 5K0ZA 1VYTA 2AV6A 3RS9A 3R4CA 1Z6TA 3ZCVA 3UM9A 3CRRA 4CL3A 5A3JA 4KR9A 3S8YA 2A0WA 2HHLA 5AKZA 1AA6A 1FF9A 3ND5A 4LHYA 3PJFA 1YHZA 1YZUA 4I66A 4DKJA 3OVMA 1AOXA 2KOUA 5KL4A 2RHOA 3F5MA 3PDCA 3SEAA 3C6QA 1Y81A 2RKBA 3AY3A 3Q7RA 2RGEA 1A88A 4JI6E 2FG6C 1E0JA 3U39A 4KSBA 4YRSA 3LOUA 5GONB 3DXFA 3C14C 4WBSA 3B1JA 3N2NA 1NV8A 4RJJA 4Z7NB 1H9CA 3JWJA 2HSZA 4EGQA 3HYRA 4I55F 2OA0A 1NF2A 3OPYI 1YO6A 2R65A 3F3SA 2ZSIA 1FCJA 2A9OA 1XTQA 4JMPA