1GZ6A

(3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
301
structure length
301
Chain Sequence
b'SPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGSRMTETVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17 BETA-DEHYDROGENASE 4
publication title Binary Structure of the Two-Domain (3R)-Hydroxyacyl-Coa Dehydrogenase from Rat Peroxisomal Multifunctional Enzyme Type 2 at 2.38 A Resolution
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dehydrogenase
total genus 101
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1gz6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gz6A01
5EN4A 5COAA 5FYDA 3CZRA 3SC4A 3GVHA 3T7CA 4BKQA 2EKLA 2P4QA 3BMOB 3QVXA 4R54A 3DR3A 4BGIA 1DRVA 4CUJA 3P2OA 1BSVA 3HZZA 3TSCA 1N92A 5K0ZA 4RVFA 3WTCA 1HYEA 2NQTA 1GD1O 4ZN6A 3CXRA 2XAAA 3P5SA 1P0FA 3WWYA 1XG5A 4MVJD 1BXZA 2HK9A 2Q2WA 3C7AA 4Z9XA 4AJOA 4AL4A 3IMFA 1Z7EA 1YB4A 1H9AA 1X0VA 4FC6A 4MVJH 4A03A 4OL9A 2X1HA 1XEAA 2FPPA 2NM0A 4ND2A 2JHGA 4RO0A 3R6DA 4J49A 4AJ1A 1H94A 4J43A 1PS8A 4E5KA 2X22A 5AQ1A 4GAEA 5L40A 3RBZA 2PGJA 5KIAA 3VVBA 4AJ2A 3RD5A 2PLAA 1KEUA 3QRWA 4RORA 1UXHA 1YBAA 1YBVA 1DFHA 1ZZEA 4L4SA 4BKRA 4E5PA 3HADA 2D5CA 4MVJP 2V6GA 4L74A 2IYOA 3WSWA 5H83A 3DZFA 5DCWA 2UV8A 4CMEA 1VL0A 1Y5MA 1UDAA 2FSSA 3ZWBA 1LC0A 3UN1A 4NU6A 2VWPA 1H6AA 1VRWA 2XPCA 4FFNA 5LC1A 2J5QA 1RJWA 1ISGA 2A4KA 3KLMX 3GGPA 3PGXA 4B7UA 1A5ZA 1JW9B 1T25A 4RPHA 4E12A 1PJTA 1GQQA 1YL7A 5G2OA 3EMKA 1O0SA 3FBTA 2EP7A 1P33A 3JQAA 4FFPA 3FHLA 3JYPA 3D5QA 4IGEA 4CJXA 1I2ZA 1EVZA 2PV7A 2ZB3A 1PWZA 1RM3A 3I3OA 2ZTVA 1TT7A 1WZIA 1CWUA 3DZJA 2EIHA 4R01A 5T6BA 4ZRMA 1EMDA 2RH4A 3RC2A 4L76A 1AXEA 1ISIA 2EGHA 5CG2A 3SJUA 7ADHA 2IZZA 1G6KA 3BIOA 3TL3A 4O1MA 1JDJA 5DN9A 4E30A 4CPDA 4Q3BA 1YB5A 3VZQA 1GV1A 1RWBA 3MJTA 3BZUA 4DXHA 1ISJA 1NQTA 3NX4A 4FS3A 5DOZA 3M6IA 1QMGA 1P1JA 4A2CA 2X7HA 5JMWA 1RM4A 2E82A 3PTZA 1S6YA 2J6IA 4I8XA 1O5IA 3KTDA 4RDIA 4RQUA 1XU7A 5U4QA 4J7CA 3GRKA 4JROA 1I2CA 4J9UE 1Q0QA 4FN4A 4IIUA 5BSEA 2WWRA 2NTVA 3FR8A 2ZQZA 5KTKA 1WMBA 1VSUA 3QSGA 4FW8A 1P0CA 4OAQA 4OH1A 3DL2A 3H9GA 3KM0A 4MP3A 2IEDA 4FIZA 4II3A 3WWZA 5IDYA 3GY0A 1V9LA 3JD4A 3I1JA 3E9MA 3D3WB 4Y6RA 3GLQA 4JGBA 4Q39A 3RC9A 2JD1A 1K6XA 5CDGA 2OO5A 3TWOA 3WLEA 3G0OA 1X13A 1C3VA 2H1SA 4QQRA 4M89A 3DBLA 4R4JA 4XYEA 1I30A 3WNVA 3Q2IA 3GVIA 3AWDA 4NNJA 1WXDA 4L0QA 4RLHA 4YJHA 2C5EA 1HDOA 1GDHA 1E6WA 3PXXA 1PGJA 1OAAA 3AU8A 1C1XB 3C1OA 3ADPA 3L07A 4QT0A 5KJ1A 2HMWA 1LTHR 1YQDA 3ICPA 4BO0A 3VZRA 4QO8A 5TS3A 3IUSA 2DU8A 4G81A 3GF4A 2NACA 2FR8A 1XGKA 4KDFA 4U0KA 1NPDA 2OMEA 2XF8A 5I7VA 1JVSA 4DIBA 4LSMA 9LDBA 4ZHSA 4MINA 5T5QA 4NJMB 3ETEA 4HP8A 5IZCC 4ND1A 3ZHYA 3NJ4A 4H16A 2H9IA 1QXSA 4LRSB 1HZZA 3JQ8B 4EITA 1R15A 1IULA 4J90A 2O2SA 4KUGA 4QO7A 3OJOA 1XSEA 4PLHA 2PKQP 1OI7A 5L4SA 4J9VA 4LCJA 4MVJE 4UEOA 1VL8A 5L51A 1EZ4A 1XCBA 2O3QA 4MO2A 4PVDA 4W99A 3B1JA 5AXAA 4NU5A 4D43A 4PIVA 4EUEA 5EESA 2BGKA 4TVBA 3ZWAA 4BB5A 3ZNNA 2Q45A 1KVUA 1ADBA 2P9GA 5C37A 4H3VA 4Z9YA 5TLSA 1WDKA 2ZJ0A 5G0VA 4GWGA 4CV3A 3JYLA 4AICA 3WS7A 1LEHA 5A02A 2R00A 2RHCA 3CINA 2NU6A 2VYVA 3KEQA 2Q99A 4MOWA 3NAQA 4A0SA 3MOGA 4BKUA 4FPXA 4HX5A 3WBBA 1BVUA 5I9NA 2V6FA 1GUFA 2HKIA 3GNTA 3HB4X 4MIYA 3RUFA 4PLWA 2O4UX 3ZU3A 5ICSA 4BKPA 2CSUA 2HMVA 3ZDFA 3LVFO 3QJ5A 3H9JA 1E3WB 1VKOA 4BNFA 3CKYA 3GQVA 3ZWYA 4I5GA 5HRUA 4QEDA 5H81A 2ZATA 1BTOA 2HJRA 1T4DA 3O03A 2GZ1A 4CM8A 5F3RA 2D5AA 4BIIA 2J3IA 3DONA 4FJ2A 2ZYGA 4K26A 4RVGA 5DBIA 2P5YA 3I83A 1GL3A 1WNTA 2V6MA 4WASA 2Y1CA 1LDGA 2HK7A 1DC4A 4JQCA 2BGLA 4CLEA 5I8ZA 2OOSA 1QV7A 2IODA 3TZHA 3R1IA 1EK5A 2FSVA 3JSAA 3IS3A 2JD0A 3KSUA 1VL6A 4CMIB 2ZTUA 1GUYA 4QFCA 3RBXA 3DTYA 1DPGA 1U28A 3CE6A 2PKRA 4ND4A 4H15A 1A7AA 3AFMA 4ROSA 2UDPA 2GO1A 3QWAA 4M1QA 1I3NA 2IZ0A 3OIDA 1O95A 1VE9A 3K96A 4CMCA 3C85A 3HJAA 1YOVB 4W7IA 3ZU4A 4Y6PA 4RJTA 2OFPA 1SOVA 2DM6A 2CFCA 3I9KA 2C29D 4LGVA 1LQUA 3U4CA 4DPKA 4ZQGA 2POQX 1KERA 2X9NA 1B8VA 3UCXA 2VZ9A 3AOGA 1PJLA 5GMOA 1GCOA 4RPKA 5JDCA 1E3IA 1LLUA 3M1AA 5C3MA 4OOFA 2NV6A 4MKZA 4W6ZA 3ST7A 4YDRA 4IDBA 4IJWA 1R4NA 1NFQA 2FPGA 2GASA 4NMHA 1KVSA 1N5DA 3AI1A 1NR1A 4RPLA 1UP7A 2ZK7A 4H7PA 4WEOA 3IJRA 1UDCA 4Z0HO 4Q9NA 2GGSA 3HN2A 2VHYA 4B8ZA 2UAGA 2P2SA 1VJ0A 4IDGA 3CSDA 2JL1A 3WGZA 1CQIA 3VZPA 4XRGA 1MFZA 3OIFA 3TF5A 1YS4A 1GPJA 1LRKA 1PU2A 2QX7A 2IXBA 4BO5A 5T8KC 1E0DA 1HLDA 5EINA 4EZBA 1ONPA 2JCYA 4RV9A 3WQQA 2NVUA 4G2NA 3N7UA 3EYWA 4Y6SA 2B37A 3ZHZA 2VYVD 2OGUA 3LT0A 4G65A 4AJLA 1E5LA 3CMMA 3GOHA 5G4KB 1I10A 4B3IA 3GRPA 2Z95A 1HDGO 1EEHA 1LU9A 3OBBA 4J6FA 1RKXA 5CDUA 1HE3A 1PZEA 3OFSA 1B8PA 3FRJA 2C20A 4E5MA 2OBYA 5DOVA 1XU9A 1HWYA 4RF2A 1SC6A 5L53A 1SMKA 5IFLA 1Y7TA 3IQDB 4XQGA 3EHEA 3U9LA 4BNXA 2ILTA 2R2GA 4BO9A 2O4CA 2X9GA 4L9RA 2VRCA 4PGFA 3CTMA 1ZK4A 2TMGA 3ZWPA 1MGOA 3U4DA 2W2LD 5F1PA 4F45A 4N7RA 4CV1A 4FB5A 1TVEA 2Z1MA 1LNQA 4D46A 3PZBA 4CL3A 5J23A 1O89A 1RYDA 4UVHA 4D79A 4PLGA 5CEFA 3W8FA 2X23A 2GUGA 3JQGA 1E7WA 4MJLA 2PK3A 4E21A 5A4DA 4TRRA 4DBVO 1DHTA 3N58A 3OEYA 1ZEMA 4J1QA 4R1SA 1ML3A 3GN2A 2EW8A 3INTA 3RQSA 1ISMA 4J7XA 1YJQA 3RUIA 1D7OA 1E92A 5EERA 3ZH2A 4JBIA 4RVHA 4NDNE 1TXGA 4F3YA 4B4OA 2OL4A 1ZEJA 4J2OA 4E32A 4B4VA 4XA8A 4BNGA 2C5AA 4I08A 2JHFA 1C1DA 3EY4A 2WD7A 3GHYA 3H8VA 5L7WA 3GPDG 1EUZA 3JQBA 3DMYA 3WX0A 3UCEA 1LRJA 2IYPA 2EWMA 1BW9B 3AUAA 2Q2QA 3FNHA 4PLCA 4E2ZA 5ADHA 4I5EA 4FFMA 2P68A 3QA9A 2Y0DA 4LMPA 4XX0A 2EP5A 1I5RA 1GEEA 3AM5A 1JA9A 4FR5A 3E03A 4KP7A 1KVTA 3LZ6A 4KWIA 5JDIA 4OXYA 4TZTA 5CPFA 3MJSA 4BNZA 4TZKA 4CMEC 3EDMA 4CM5A 1XWFA 1B3RA 2FR1A 5JAMA 2DBVO 2QRJA 4B7XA 2GNAA 3L0DA 3V8BA 3L9XA 4YJGA 2YQ5A 1NBOA 4L75A 4B4UA 5TF4A 1X1TA 1WLYA 1X7HA 1ZKMA 4PG4A 4DC1A 2OP0A 4WOKA 1FDTA 1DEHA 1Y8RA 5DT9A 1C0LA 1NHWA 2WTBA 4W9NA 5DBFA 2I76A 2PZJA 2GF2A 1VJ1A 1DO8A 1SB8A 3FI9A 3A4VA 1M76A 3GVPA 4JBHA 4LVCA 4OO3A 1YWGO 4XJSA 5IDXA 3GVXA 1UP6A 1K2WA 3SLGA 4BV9A 1Y8QB 3FR7A 4YRAA 4D44A 4P8RA 4TKLA 1ADGA 4HXYA 3LLSA 3H3JA 4BO1A 1GTMA 3SLKA 1ADCA 4XIJA 4ZQEA 5CEJA 4OQZA 4PZCA 2EEZA 3DOJA 5G0TA 4BNMA 4MP6A 3IP3A 3CH6A 4BNJA 4C7JA 4DMMA 1F8GA 4N54A 1YGYA 3E18A 3ZWVA 3ZU2A 5ILOA 3KVOA 1T4BA 3UHAA 1EBUA 1TI7A 4PZDA 2DUUA 2G76A 3D4NA 3RKRA 3LU1A 4BQPA 2I5PO 3PK0A 3ITKA 1U8XX 1Q0HA 2I66A 3DZHA 3IAHA 3ABIA 4NQZA 4DRYA 3GAZA 3OEWA 4OOEA 4XGNA 3NEPX 4MVJA 5KVCA 2B5VA 4XKJA 4D0SA 3JD3A 4WCFB 2Q50A 4CQLB 3QWIA 1E1MA 3DBRB 1LDNA 3O26A 3ITDA 4B3JA 3VPHA 3QY9A 1YDWA 2LDXA 3PWKA 2PZLA 1O94A 2UUPA 2Y0CA 3TRIA 4JCOA 5FFFA 4N5MA 4YT5A 4DQUA 1T2AA 4Z0TA 3K2BA 1MB4A 2CNBA 5BR7A 5JY6A 1GZ4A 3NTQA 4GGOA 1KY5A 4MIEA 2EHDA 4ZD6A 1PZGA 4PG6A 2P9CA 3D4PA 4NBTA 5U9CA 3PHGA 4GLOA 3LT2A 4KDEA 1UZLA 1WP4A 2Q2VA 2GZ2A 2J3KA 4F6LA 1DIRA 5F21A 1K6JA 4ZRNA 2VUTA 3AY7A 1HE2A 3PLRA 2PZMA 4X54A 3WYEA 5KJ6A 2YZ7A 1Y6JA 2YYYA 2FMUA 1YQXA 3IJPA 1GZ6A 4GQAA 3JYOA 1O9BA 4CLRA 3ASUA 4MVJI 4CLHA 3D5TA 3ADOA 3TL2A 1YRLA 2EKPA 4GI2A 1UP4A 2PR2A 5JS6A 3EZLA 4KUEA 4IJKA 4NG5A 4ALLA 1DXYA 3GMDA 2CD9A 1U4OA 4FJ1A 1XKQA 4U5QA 4B8WA 1UAGA 1U7TA 1JAXA 4UUNA 3E48A 2YJZA 3WMWA 1DB3A 2DT5A 3K9QO 2ZCVA 4HFJA 4M49A 3S2GA 4GSKA 1U8FO 1VPDA 1WZEA 3RC7A 3ULKA 3OJEA 4O5OA 5CEEA 3WGTA 4DLAA 4D41A 2QRKA 3F3SA 4IDAA 1NQAO 1PJ2A 1EE9A 5T57A 3B6ZA 2CZCA 2W98A 3M2TA 1IPEA 4BO4A 3QHAA 5A5FA 1UUFA 1YKFA 5EMHA 1K6IA 1TT5B 2Q49A 4XQCA 3HDQA 3EVTA 1HEUA 5DNAA 1R16A 2X0JA 5G0SA 2GLXA 3PZRA 3ROPA 1WMAA 3PYMA 2X0NA 3S1LA 4BHTA 2D2IA 5CFZA 3ROMA 3IKVA 3S2EA 3WICA 1A27A 5TQVA 3VH4A 2RIRA 1LDMA 5L45A 3EUWA 3B70A 5HS6A 3VPXA 3AM3A 1LI4A 3RAJA 1RM0A 3KYBA 3OQ6A 4TMFA 2ZIZA 3HDHA 5I9MA 2R00C 3JTMA 4XB1A 3VDQA 3ZCXA 3DAGA 1QSGA 2EG9A 3RIHA 4DLLA 3CMCO 1E7YA 1TLTA 3PDJA 3GN1A 1EUCA 3PIIA 4LK3A 5IXSA 1F8FA 4II2A 2E49A 1J4AA 3MEQA 3K73O 1A9YA 4K6CA 3RFTA 4NPCA 1BGVA 1GQ2A 3AOEA 2FY8A 2GERA 3V1YA 3GZNA 4YRBA 3FSRA 2ZQYA 5HA5A 1R66A 5CHEA 2X0RA 1ENZA 5T64A 4E6PA 2FP4A 3U0BA 5JFOA 3JD2A 1T1SA 4UREA 3TN7A 4PRKA 1PL8A 3EAGA 2HU2A 1I0ZA 3DBHA 3EK2A 4W82A 3ZV3A 3JQ9A 3MJ4A 3WGHA 4XJTA 4BQRA 2NU7A 3DHNA 1WPQA 2GN9A 1P77A 1Q7GA 1PQUA 2YW9A 3KUXA 2VUUA 4M54A 4N5NA 1B15A 3W1VA 2SCUA 3L4SO 1ZUD1 4PG7A 4BNLA 3HDYA 2G5CA 1LC3A 4UVDA 3ETGA 1FJHA 1M2WA 2JCVA 4YACA 1AGNA 1GQYA 3L6OO 1XA0A 1P1IA 4NJOA 3MWDB 3HSKA 2BF7A 5EL0A 4BO7A 1Q0LA 4YAGA 2V65A 5GZ1A 2Y1OA 4XQ9A 2P91A 5JE8A 2AQ8A 2B0JA 1YO6A 4M86A 4Y8VA 3ROQA 5B4VA 1OZAA 4ESOA 1BXGB 4CR7A 3BMCB 3U5TA 4CMJA 3AW9A 5JDCC 3NKLA 3GG9A 2J5RA 1NP3A 5A06A 1ZJYA 4J1SA 2PNFA 1JKJA 2Q4EA 4GMFA 1KVRA 3RI3A 3RUDA 2HSDA 1HSOA 4Q3NA 4AJEA 2CF6A 1ISHA 3KYCB 5L4NA 4BUCA 5FI5A 2PH3A 2X0IA 1WW8A 3DTTA 3V1TC 1ZO8A 4ND5A 1G0OA 4I9NA 3Q9NA 1SB9A 2O3SA 5TSDA 1Y1PA 4YPOA 1IPFA 4KMSA 3VC7A 2P5UA 5AXCA 4ZU3A 3BMOA 2BH9A 5THKA 3G1TA 3RSHA 5JC1A 1CETA 3F1LA 4MDHA 3SJ7A 1HL3A 3QVOA 1E5QA 1ONOA 1EQ2A 5TIIA 2RCYA 1AHHA 1GY8A 1VM6A 3BMNB 2GYYA 4BNWA 2D3TA 4WNCA 5ENDA 4HNGA 1PQPA 3COSA 1YJ8A 3GUCA 2VWQA 4NZ9A 1LDBA 1R0LA 5B1YA 1EDZA 1P1FA 3EGOA 3ON5A 3NDIA 4NI5A 2PGLA 2AQKA 3I9NA 3AI3A 3JQCA 4KZPA 1GAEO 4E5YA 5KCZA 1DFIA 4R41A 1YVEI 3BTSA 1JKIA 1U1IA 5BT9A 1JAYA 3ZW9A 5LDHA 1T2FA 3VTFA 3ZW8A 3LT1A 2V7PA 3LF2A 1DAPA 1O8CA 3FTNA 3NGXA 1IZ9A 1HDRA 3TZCA 5KKCA 1U5CA 3C24A 1B16A 3TOZA 2C0CA 1P1KA 4R69A 4HV4A 4HFNA 1GFSA 1HYGA 4HADA 1AXGA 4NK5A 3BMQB 3PRJA 4XDZA 1M6HA 4PLYA 3WDSA 5JAZA 3PWZA 1DIHA 4WK6A 1UR5A 3AY3A 3WXBA 5KVVA 2FZEA 3H5AA 3AJRA 1UJMA 4XQEA 4P38A 4DGSA 4AJJA 2HMSA 4JJFA 2YV2A 4PRLA 4MKRA 1UZNA 4R1TA 1U2GA 5LDGA 1N9GB 1R0SA 4NFYA 3VKVA 5JMPA 4CMHA 2HLPA 1B14A 2Q46A 3NDRA 5MDHA 2O7QA 1H2BA 2B35A 2VWGA 4HNHA 2ZJ1A 3ZWXA 5CP8A 3WJ7A 1GCUA 1J0XO 3C7DB 2WYWA 2BKAA 2I65A 4WCDA 1D1TA 3W4IA 2E48A 1ZW1A 2PZKA 3BA1A 4ITUA 3FN4A 1NQOA 3E6AA 2CF5A 3JQBC 3OA2A 4IPTA 2QRLA 3X2EA 1ZK1A 2WD8A 3OSUA 1E77A 3DHYA 2FZWA 5I9LA 4F46A 2QYSA 4I9UA 3LQFA 4AJIA 4OKNA 3E5RA 1Z7BA 2BFMA 1E3LA 2B4TO 4IJUA 3WGOA 1Q7CA 3IC5A 5I7EA 4HBGA 3ZWWA 3AUUA 3OJFA 3K92A 4IJVA 2J3HA 1LLCA 2YV3A 4UVGA 1SAYA 3ZN2A 1NVTA 5JDIC 4CM6A 4J1TA 5IN4A 4CV2A 2AE1A 4CQMB 1SEVA 3O8QB 4OGWA 4JJGA 3NTRA 3GT0A 4LRTB 1XELA 4BNTA 4YT2A 1IB6A 1SO8A 4I1IA 3UF0A 2B4QA 3L4BA 5I7FA 3R0IA 3V2GA 3VKUA 2Y05A 5TGDA 4Q3DA 4W9NC 1GV0A 1U3WA 1YL6A 1OC2A 1NPYA 3D3WA 2PKQO 5C7IO 1FDWA 2BD0A 3O9ZA 1U9JA 2X5OA 3DFZA 2A9FA 2DBRA 4IXTA 3X2FA 3ZWMA 3BTUA 4C7KA 3ZZNA 3GR6A 4CMBA 3D4OA 2NU9A 2X6TA 3ONDA 1YB1A 2FWMX 4W4TA 2RAFA 3FWZA 2W2LA 3I23A 3WGQA 8LDHA 3GG2A 3PJEA 4FD3A 4IS2A 2CUKA 2Y93A 2AG8A 4G5HA 3WSVA 3K30A 2Z1NA 1HT0A 2YDYA 2HQ1A 1C1XA 3VH2A 1QKIA 1E7MA 4BOYA 4P4GA 2WEKA 1JKFA 4WE3A 4BO6A 3RCBA 3RUHA 1YXMA 2DFDA 4R51A 1T2DA 4S3MA 2OUIA 1HE5A 1W73A 4JNKA 3PJFA 5GY7A 3FNGA 4EW6A 4NJMA 4CMAA 4IQ0A 4YA6A 2I67A 3H5NA 3RBVA 2NVWA 4QXMA 3WTBA 3VTZA 4N18A 2Y1GA 3DBVO 3I6QA 3JQ8A 3VPGA 3AFNA 1UAYA 3FWNA 4UVIA 2DPHA 1I36A 3ENNA 3KB6A 3S2IA 4A10A 1ONNA 4IMRA 1DLIA 2GR9A 1EQUA 3A14A 3G49A 1C14A 1PJQA 3K5PA 2E37A 1DLJA 3UGKA 3F47A 3GA0A 2CVZA 5A9RA 3Q3CA 3KYDB 4YTEA 3G79A 1ULUA 1Y5RA 2QIOA 4BGUA 5K6AA 3T4XA 1XIVA 1V35A 3BHJA 3TDKA 5AXDA 2YHIB 4BVAA 1N7GA 4FDAA 2EJWA 5DP2A 5KKAA 1P44A 2B5WA 1YONA 1QG6A 5JO0A 2H5LA 2QHXA 1ZJZA 1GR0A 4NR0A 1QR6A 4M87A 2C2YA 3IDSA 1JLLA 2RBEA 5CDTA 1QYXA 3NTOA 2WYVA 3GFBA 5U1PA 1R4MB 4PVCA 5JBIA 1F12A 1JWAB 5GZ6A 5DULA 2GN4A 4CQMA 1BRMA 2PA3A 1F14A 3RU7A 3GDOA 3V5NA 4GX2A 1V3UA 1E3WA 1TA4A 2G82A 1WAMA 3QLJA 4ONEA 1CQJA 1HRDA 4GX1A 3FPLA 4KQWA 1GPDG 5IF3A 3B20A 1UZMA 1KC1A 3NUGA 2X4GA 3KHUA 4R9RA 3GC6A 4TRMA 3UICA 3HQ4O 3UCFA 1G0NA 3BAZA 4FFRA 3A06A 1JQBA 2W2KB 3GVCA 1P31A 3QWBA 4Z0PA 5FI3A 4CMIA 2Q1TA 3CIFA 3RROA 1U2DA 2X5KO 3PJGA 1MXHA 1ID1A 4FCCA 1E3JA 1CDOA 2LDBA 2QQ5A 4CLOB 2W8ZA 1HDXA 3QW2A 4RZHA 3UW3A 2IZ1A 4NK4A 1YOVA 2Z5LA 4OXKA 1MG0A 2IDZA 4RF3A 5TC4A 1N1GA 4UULA 5G0WA 4YJDA 5JCXA 2AQIA 1N8KA 3OA0A 2DVMA 3ZHBA 1R12A 1CIVA 4TVOA 3I52A 4OYRA 4B79A 3DQPA 2NSDA 1X15A 2Q1UA 4IS3A 3GEGA 3W4KA 4XRRA 1XYGA 1KC3A 3M1LA 3SXPA 2A94A 3JQ7B 3F4BA 2D8AA 3P19A 3QVWA 4BNVA 2ZYDA 5MGBA 4YQZA 2VZ0A 5T67A 1LX6A 1Y81A 1NM5A 1B26A 4L8VA 4S1VA 1Y9AA 2EV9A 5A3VA 3RFXA 3PYXA 4NBUA 1T26A 3AOEC 3TPCA 3D0OA 1NWCA 3NRCA 4XWYA 3D1LA 3SEFA 3VOSA 2O3RA 2VT3A 2YFHA 3VPSA 2Y99A 1PIWA 1YBMA 3S8MA 3PWSA 1EFKA 1CEQA 5KOIA 1W4ZA 4U7WA 3OETA 4DUPA 3AU9A 1HXHA 3JQ9C 4E4YA 5K9ZA 2Y68A 1IY8A 3TZ6A 4YVFA 4BNHA 5DZSA 5IDQA 4IY1A 1IUKA 1ZSVA 4MKXA 5DBGA 1EVIA 5IN5A 1SBYA 3C8MA 3DMTA 4PN3A 1EVJA 2DTDA 3JYNA 4K6FA 5F5NA 4BNIA 4CMKA 3FPCA 1D3AA 1B7GO 2EGGA 1ZK0A 4IINA 3DZKA 5TX7A 5HTOA 1RM5A 4XD2A 2VWHA 5G4KA 3W8EA 2O2YA 4CQMD 4UEKA 4GMGA 4Q3AA 4ALNA 1EE2A 4P4LA 4ZQFA 3IUPA 4PG5A 4O0LA 4QFDA 1HF3A 1PGQA 1AN9A 4DTIA 4BMVA 1UXKA 5DCUA 4O6VA 2CMDA 3L77A 2ZKLA 2IXAA 4E2WA 5JYEA 2BGMA 5A1TA 3UAGA 1TEHA 3PJDA 4PLZA 2DTXA 2YFQA 5EPOA 3PHIA 4YQYA 3KZVA 5JYDA 4YEDA 4AFNA 4K1LA 4EGFA 1GADO 1I3MA 2GD1O 4YWJA 4GVLA 2J3JA 4HKTA 1U3TA 3VVCA 1H6DA 3LDHA 1NR7A 3B1KA 4GWKA 1NX6A 4J3FA 4R5MA 2UUOA 5IG2A 1X0XA 1ZMOA 2QZZA 4YBZA 4CODB 1I2BA 4HUJA 4J4HA 2HK8A 2AG5A 3RUEA 1FK8A 1HSZA 4I9HA 1J6UA 3H6KA 2JFFA 4YJFB 5A9SB 1MG5A 3F5SA 5L3ZA 2PWZA 3RUCA 3SVTA 1E3EA 3PP8A 1GYRA 2A35A 3FF4A 3PI7A 4NBWA 3WGGA 6ADHA 1C0KA 3PQDA 4E5NA 3JQ7A 1NQ5A 3WBFA 4RF5A 4MVJF 4E3ZA 4CM4B 4IDCA 4BMNA 4DIOA 3ZV4A 2H6EA 3AUTA 3FNFA 3T4EA 4UUPA 1I32A 3BTVA 2IE0A 1LUAA 1BW9A 2VHVA 1XR3A 3ENKA 4MVJM 2GRAA 1QORA 1DIAA 3ZV6A 1ZNQO 1PS9A 2DLDA 5JAQA 1V3VA 3LSYA 3ASVA 1T24A 5IXYA 3DFUA 4YAKA 1G1AA 2NU8A 2DKNA 3FCOA 1PWXA 3PLNA 1NVGA 3H9QA 1JTVA 3K2EA 2OHXA 1PJSA 3DEYX 2HJSA 1IYZA 4GL4A 1PGNA 4YYZA 2EW2A 4E31A 3WMXA 3O38A 1MA0A 1ZXBA 1H5QA 3SBOA 1N2SA 3HFSA 3LC1O 2WDZA 2VHZA 3D64A 4RZIA 4XIYA 3OECA 1GYPA 3JQDA 2ZYAA 3UUWA 2QW8A 4RDHA 1ZIDA 3K6JA 1KYQA 5IZ4A 1Y8QA 5HWSA 1VSVA 4W7HA 4WNIA 4AJNA 3Q9UA 4WLUA 2X5JO 4FFOA 1A4IA 5GZ3A 2IEBA 1HDZA 3C3XA 3DDNA 5CAEA 5KVQA 4JBGA 3GMSA 5TT0A 3NYWA 1MLDA 3OICA 1DSSG 3WNQA 3I9JA 2Y1FA 2BLLA 3BTOA 1I24A 3U62A 3TZQA 1X7DA 4NHEA 5TT1A 3CUKA 4M55A 3IKTA 4EI2A 4URFA 4OXNA 2G0TA 3DHEA 5CG1A 4A26A 2E4AA 1NFFA 3D3EA 2CDBA 2VZ8A 1U3VA 3TZKA 1IOLA 3JQAB 2CDCA 1J49A 4QTZA 1EK6A 4IQGA 3JYQA 4WGGA 4MVJG 4D3SA 2D4AA 5DCYA 3WG9A 2BI7A 3HWRA 1Z74A 3KEOA 2VTDA 4WCFA 1B8UA 5HBRA 2FRDA 4BL5A 4CQLA 2CVQA 1M67A 2BELA 3DBRA 1UXIA 2HMTA 3E1KA 3MCVA 3TQHA 1MV8A 2QZ9A 3NT5A 1BHSA 3H2SA 1PX0A 4NFSA 1LSOA 1ZCJA 3PHJA 2O23A 3T7EA 3ZHXA 4FSHA 1BWSA 1PZHA 3L4BC 1LSSA 3EC7A 3BYZA 4XDYA 3CEAA 3E8XA 2AEFA 1UXGA 4MP8A 5JC8A 4RGBA 4TSKA 2X86A 1XQ1A 1Z82A 4Z9FA 1IHYA 4JN6B 3H4VA 3ZWOA 3PEFA 4LW8A 4R1UA 4Q3CA 3MJCA 4HFMA 3TNLA 2VHXA 5A3JA 2QYTA 3MJEA 1V0JA 4CM3A 5L9AA 1A72A 5A5EA 4WLFA 4FGSA 4FQ8A 1MUUA 1X7GA 4IQ8A 2OXIA 4I5DA 4LSWA 2JKVA 4EUHA 7MDHA 2GN8A 3DC2A 4PCVA 4WLNA 3ZU5A 5A9TA 4R9SA 4Z3KA 4OKIA 1JWBB 1F0YA 2NNLD 1N7HA 4LN1A 5F5LA 3F9IA 3MTGA 5JO9A 1NXQA 3WJAA 3P2YA 5DF1A 4LCEA 1WDLA 2G1UA 1LSJA 4IGFA 1BVRA 3I4CA 1KVQA 3AM4A 3K31A 4PLFA 2NADA 3JQFA 3DBLB 4GBJA 3QWFA 1EVYA 5IDWA 4DVJA 1LLQA 3UFXA 1PQWA 4BNKA 2I99A 2D0IA 1UH5A 3HHPA 1MFPA 4YJHB 5TJHA 4WLVA 2RHRA 5JCJA 4NBRA 4D45A 4XEHA 2Q4BA 4Y9DA 3ONEA 3W6UA 5KNLA 1W8DA 4ZJUA 2GZ3A 1I3KA 1NYTA 1OOEA 4WEQA 3WGYA 4RPJA 3DO5A 4J4BA 4JX8A 5B12A 1F06A 1BDBA 2PY6A 3GZ4A 4GX0A 5JAIA 2B83A 1ZMTA 1VJTA 3GDFA 1TT5A 4BNUA 4BS9A 3AUSA 2B36A 3RWBA 4BNYA 3FBGA 2HUNA 2NWQA 5K6AC 5JXWA 4J1NA 3OP4A 3KO8A 3G1UA 2VOJA 4ND3A 4DA9A 2GDZA 3U4IA 4JP3A 4NBVA 2NQ8A 2HCTA 3PIDA 4YT8A 4IM7A 5KJEA 4D0RA 4RVDA 3RFVA 3GFGA 4PLPA 3WFJA 2AW5A 1LBEA 3L6DA 3HE3A 5G0UA 3QVTA 4FOOA 2HRBA 4O59O 4UAGA 4ZQHA 4DLBA 4GVXA 3SC6A 2TMDA 4YRDA 5G4LA 3ANMA 4XYLA 4A27A 1HDYA 1E6EA 2BMAA 3TFQA 3KETA 3RJ9A 1Q1NA 5AVOA 3DZBA 1ISFA 2GN6A 4KQXA 1DDOA 4WLOA 2WMDA 2WSBA 5C7OO 3F46A 4E2YA 1AUPA 4IZHA 4AJKA 4EJ0A 2EKQA 3F5QA 1QLHA 3VZSA 2VYND 2ZB4A 4BV8A 4JJIA 1DIBA 5IAAA 5JW6A 3WOHA 3KV3O 1XLTA 1QLJA 3OM9A 5COQA 1A71A 3VAZA 3WLFA 4PFJA 1PGOA 3GPIA 3MOIA 1QP8A 3I9LA 3INGA 3ZGYA 1NAHA 3OJLA 1LLDA 4BO3A 2EXXA 4MIOA 2F00A 2QG4A 4RVUA 1EUDA 5KJCA 2V6BA 2CY0A 4TRJA 1P9LA 3ZWNA 2BFAA 3IP1A 3W8DA 3E9NA 3WYBA 3BHIA 3JQ6A 5ES3A 4DPLA 4K9DA 4LVUA 1B2LA 4CLXA 1KS9A 2ZB7A 4AJHA 4CM8B 2IRWA 1DC3A 3HB5X 3GAFA 4B3HA 3I9OA 1TB4A 4OIMA 1K5HA 2NLOA 3DZGA 4YT4A 3VHRA 4YAIA 1C0PA 4O63O 4GKBA 1QV6A 5BSGA 3JCZA 4XZ3A 4YAJA 4A7PA 1C0IA 1IHXA 2O3JA 4OQYA 4XR9A 3NT2A 3F4LA 4GPD1 1DOHA 1E7SA 2EF1A 3AI2A 3ZWCA 4DQVA 4FFLA 1SZJG 4AVYA 1WWKA 1D4FA 1NTOA 3GH3A 5IJZA 4OHUA 2HAEA 4PLVA 2B69A 4B7CA 5A03A 1BXGA 3BMCA 3STHA 1E7RA 5JPIA 3TFOA 1D8AA 4CR6A 1M66A 4J7UA 3H65A 5JCJD 4TROA 1Y9EA 2YUTA 3OQBA 2EERA 3KYCA 4AG3A 1HDCA 5KWEA 1J5PA 5H82A 1Z75A 2BHLA 3GGGA 1KY4A 2Y1DA 3U3XA 3WQRA 5FWNA 1OMOA 1DBVO 2YV1A 4RF4A 5BNTA 5L4LA 1P1HA 5F1OA 1YE3A 2HO5A 5DDIP 1JU9A 2Y66A 4M8SA 3B1FA 2X58A 4A5OA 4OSOA 3S55A 4ALMA 3JQAD 4DIFA 2O7SA 4DYDA 1R4NB 4TRNA 1F17A 3WYCA 1P74A 4UEJA 1GYQA 3WFIA 2WM3A 1IE3A 1YDEA 3BMNA 5TNXA 2BFOA 1SEPA 2O50A 3KOUA 3DMTC 3LLVA 3BXXA 3G3EA 4Z6KA 3ICCA 4P22A 4QECA 5AOVA 3QVSA 1I01A 2XXBA 2ZTMA 1AHIA 2PFGA 3GUYA 3NDJA 2JAHA 1UXJA 4WUVA 4IDEA 3ORFA 2AXQA 2R6JA 3INRA 1BXKA 4CM9A 1PJ3A 2AHRA 5ILGA 5BSHA 1T2EA 1NWHA 3P7MA 3RJ5A 2ET6A 4KTVE 3AK4A 4D3DA 2WE7A 1I3LA 3QQPA 4CL8A 1NHGA 1ZVMA 2DPGA 4IZIA 2NVUB 1E1KA 1M6WA 2OP1A 3OH8A 4CV0A 2JFGA 3UKOA 4KWHA 4UUMA 4RQTA 3D7LA 1XHLA 5L7YA 1DJNA 2RH8A 3ZI0A 4XCVA 3C1TA 5B37A 1E3SA 1OBFO 4BO2A 4GH5A 3MJVA 1AE1A 3Q1LA 1ENOA 2C82A 4LISA 4DMLA 4D7AA 4EJMA 9LDTA 2D1YA 1HE4A 3MTJA 3RASA 4KUHA 1HETA 1RYEA 5A05A 3BMQA 3HDJA 4NFHA 1FF9A 4WPGA 2BRUA 4NIMA 1IZ0A 3KSZO 3H3FA 4N5LA 5EJ2A 1V8BA 1PR9A 1MC5A 5AXBA 2FPIA 4JXKA 1I8TA 4E0BA 1N9GA 3RVDA 3UVEA 2GPTA 2P4HX 3GNSA 4BNNA 4J16A 3U09A 4EEZA 1UDBA 3V1UA 4JIGA 3V2HA 4ID9A 1LA2A 1LDYA 1KBZA 1V3TA 2DQ4A 3PQEA 1E1NA 2HMUA 1NFRA 2YHUA 4L73A 3QP9A 3EZYA 3VDRA 3CPSA 3JQGB 1DIGA 1HKUA 1PGPA 2CDAA 5COBA 2ZTLA 4U0JA 3ZNPA 1SOWA 4R16A 1ZH8A 4EBFA 4IMPA 4U6SA 3F1KA 3CZMA 3W4JA 2A92A 1QYDA 5HM8A 2NVBA 3A9WA 2Q1WA 3E9QA 1NPTO 2JJYA 3RKUA 3UOGA 3NT4A 3PFWO 3OF2A 3S2FA 1DHRA 1X1EA 2I3AA 2UYYA 2YQ4A 4IUYA 1ULSA 4MPDA 4D3FA 3LK7A 2VHWA 4BGEA 4BMSA 3ANNA 5FF9A 4CUZA 1EBFA 1Q2XA 2E6UX 2FHSA 1C1DB 2WD7B 4WLEA 3O8QA 5I8WA 3RU9A 4R3NA 3ZNQA 5JY1A 5CDYA 3WB9A 1L7EA 1FDVA 1MC4A 2YDXA 2C2XA 4QUKA 4FGWA 3GDGA 1T2CA 1CF2O 3UH1A 3GEMA 3JD1A 1K0UA 2Y67A 1KIFA 4Q3EA 4XYGA 2NUAA 3JD0A 1HZJA 1O6ZA 1QRRA 1OFGA 3IIEA 3QE3A 1ZSYA 1QYVA 2NTJA 2DFVA 3GHHA 1CERA 1VLLA 4AJPA 1CYDA 1M75A 3L6EA 4E13A 4NH4A 2XOXA 3HFGA 1B3BA 4CM9D 8ADHA 5DP1A 3ZNOA 3GK3A 4YJGB 2EJVA 3I9MA 1ARZA 3NV9A 2BI8A 2P9EA 1Y8RB 4WJZA 3LC7O 4FC7A 3L9WA 1A7KA 2UVDA 3ETDA 4JP2A 2FN7A 4R5HA 5KVSA 3AY6A 1CRWG 3N74A 3PDUA 1E1LA 1E7QA 1P1RA 3V2UA 3KXDA 4ZGWA 1DRWA 5C7LO 1Z73A 2H63A 2AE2A 5ENVA 1SNYA 1KEPA 3OHSX 1Z45A 1SPXA 3FTPA 4XYBA 4E2XA 3KBOA 4EDFA 2HRZA 5ITWA 4WCFC 2C59A 3PVZA 3LF1A 3R3JA 3PHHA 4CR8A 3G17A 4JK3A 1YQGA 4OM8A 4U6QA 3GNQA 2AMFA 4B4WA 5HS4A 2WE8A 1PS0A 4CMGA 2VT2A 1H9BA 1H0KA 4GGPA 5CDSA 5ICMA 5JNLA 1B0AA 2VTEA 1N1EA 4XR4A 3A28A 4TQGA 5JSFA 1FDUA 5AYVA 1IL0A 4HFRA 5L7TA 3KYDA 2NTNA 2JCXA 1X14A 4ZICA 2OZPA 4EUFA 1ADFA 5IZCA 1PL7A 2YHIA 5BNFA 2Q1SA 5KJFA 1RPNA 2I6TA 6LDHA 3R3SA 3JQEA 4J2HA 2PD4A 4YXFA 2ZCUA 4J4TA 4J0EA 2OORA 2Q3EA 4GSLA 4HY3A 5ITVA 4JLWA 4CLDA 4F6CA 1JN0A 2FR0A 3HG7A 3LC2O 3QWHA 1PEDA 3LYLA 1PL6A 1U3UA 2CVOA 5BNIA 2XXJA 1R4MA 4ZA2A 2FOIA 2DUWA 4XB2A 1DJQA 1HLPA 3WIEA 3HNPA 2B4RO 2DAPA 4DQXA 2DC1A 1NNUA 3WIDA 2VN8A 3QV1A 3H9EO 1SCUA 1U7HA 3VH3A 2HDHA 2C7GA 1FMCA 1ZBQA 4ALJA 3MWEB 4DL9A 4WECA 1CJCA 3JQFC 1V6AA 4J91A 4D42A 1PJCA 4QSMA 4ALIA 2PGDA 5TJ9A 3OQ1A 4EYEA 1MP0A 1KEWA 4XGKA 4EEXA 3IOYA 4INAA 2J5KA 4KOAA 3I6IA 1T1RA 1ZXLA 3NGLA 4K28A 1VKNA 3EVNA 3K8ZA 4ZVVA 4CLRB 4DC0A 2DTEA 4U8GA 4RL6A 2W2KA 1PJ4A 2JD2A 2O48X 4ZQBA 1P45A 5B4TA 4FOSA 2VNAA 1H2HA 1L7DA 4YAEA 2C07A 4EJ6A 4BB6A 4P4NA 3LT4A 3OJ0A 4RVSA 1W0CA 1VC2A 3TOXA 4QX6A 1PJBA 3ONFA 4YR9A 4I5FA 4CLOA 1EDOA 4OSPA 4ALKA 4IIVA 5ER6A 3RUAA 2C54A 4WOJA 1JVBA 5EIOA 2YY7A 3HN7A 1YL5A 1ENPA 3C7CB 3O4RA 3EW7A 1K89A 4TKMA 1LQTA 2C7VA 3VPFA 5CPBA 1HYHA 1L1FA 2AEJA 2JFHA 1ZK2A 1D1SA 4R1NA 1LXCA 3PFFA 1S7CA 1PSDA 1WDMA 2O3TA 1I33A 3H5RA 4FJ0A 4RPGA 5FEUA 2PTGA 4R68A 3ANLA 1DC6A 4R3WA 3PHLA 3H2ZA 4FBGA 3UXYA 4BKOA 1ENYA 1HTBA 1P3DA 1R37A 1U4SA 3PGJA 2X8LA 2VRCD 3F6YA 2X9VA 1DFGA 5L95A 4Z3DA 2I9PA 1Z6ZA 3WR5A 1DAOA 3DXFA 1GEGA 3HUDA 4XGIA 2J8ZA 1ZFNA 4A73A 5BQFA 2W90A 3A1NA 3Q6IA 1EFLA 2VRBA 2PD3A 2VNSA 2WYUA 2Y0EA 4IBOA 1NASA 2I3GA 1ORRA 4DYVA 4OMUA 1KEVA 2Y1EA 1W6UA 4GKVA 2AQHA 1NVMB 3DWFA 2OBNA 2W4QA 5JLAA 4Y98A 3ZV5A 4TWRA 3ROKA 3WQSB 4BO8A 1LSUA 1YH3A 4OJNA 1XDWA 3OMLA 1BDMA 1PR3A 1VI2A 4UVEA 2DBQA 5BSFA 2PD6A 1BMDA 1E6UA 1H6CA 3KRTA 1GUZA 5F1KA 1ZSNA 3FD8A 1R0KA 3GZNB 3BHMA 2JAPA 1KETA 1MX3A 4C4OA 4CM1A 5I7SA 1PTJA 1GU7A 2DBZA 4YB8A 5ER9A 3DBHB 1A4UA 3Q11A 4J0FA 3TJRA 3QIVA 1OC4A 3RC1A 2AA3A 2O3UA 3I4FA 5B4UA 1ZK3A 1LRLA 2AEMA 3M2PA 4UUOA 5EQDA 4HWKA 3KLPX 3KSDO 5T8KA 3PYLA 4RCVA 3U49A 3DOCA 1K3TA 3FNEA 2PH5A 5A04A 4DREA 4IXWA 1MXFA 4RLSA 4PZEA 4ILKA 1DC5A 3U4HA 3H9UA 3H7AA 3JV7A 1QYWA 2VUSA 3NJ8A 4Y67A 3VH1A 4BGVA 1DRUA 4KTTE 5EQFA 4WKGA 1NAIA 2WJPA 3Q0EA 4CM7A 3DAFA 1FDSA 3C1AA 3DB2A 4L4XA 3DOOA 2BFPA 1PZFA 4DBZA 3GGOA 4DPMA 4GX5A 2VQ3A 3Q2KA 2GSDA 1H6BA 5C5IA 4CUKA 2VCYA 4IDDA 4PG8A 5LCXA 2GCGA 4XYMA 4E33A 1A9ZA 3SX2A 3OIGA 1U5AA 3GEDA 1WVGA 1KOLA 1LJ8A 1H93A 4AJ4A 2F1KA 4YJFA 1GZ3A 5THQA 3E5MA 5A9SA 1FXSA 4LMRA 3PQFA 3DZIA 4L4RA 3PPIA 5TRTA 2ZB8A 1BG6A 2VOEA 3W6ZA 1QYCA 2D59A 2VYNA 1XQ6A 4YCAA 3I5MA 4IDFA 3DAPA 3E82A 4PLTA 3WGIA 4CM4A 1R6DA 4DWVA 1LDEA 1Q7BA 4GLLA 3IL2A 3MZ0A 2G17A
chains in the Genus database with same CATH superfamily
5JXIA 2XOKA 3CR7A 4YRIA 3MWYW 3OOJA 2LO3A 1Q1QA 2EKLA 3BMOB 5E1OA 2O07A 2XIJA 2WJZB 3P2OA 2D2FA 1J8QA 3HZZA 2GEBA 3B6JA 3WTCA 2BCJQ 2YFKA 1PJZA 1TVKB 3CXRA 1AT1A 2C2ZA 1I9CA 1P0FA 2GBLA 1XG5A 2QN2A 2XAAA 3JASA 3P5SA 1ST2A 2Q2WA 4O08A 2VQEB 1EFDN 4AL4A 1YI8A 1YB4A 3OIVA 4N49A 4OM7A 2GHTA 3LOQA 2B9EA 4GBGA 4A6XA 3QKTA 1ZESA 2CKMA 2GBIA 2X1HA 4I8IA 2JLSA 4V0LA 2FPPA 3NYRA 4US2R 5JSQA 5IEJA 3HCPA 4AJ1A 4R2PA 4K3VA 4K9MA 2H0RA 1H94A 4J43A 3PC6A 1PEKE 3SN6A 5AQ1A 1OV6A 2WBSA 1OTYA 2BTQA 4OCZA 4WY8A 5EE9A 1FQOA 5HUQA 3NMUF 1G20E 3VVBA 2G7ZA 1SHLA 5DYWA 2JHAA 3VBEA 4G3XA 2YYSA 3U4AA 2YTOA 1RWXA 3HCCA 2V7WA 3I37X 4RIGA 4ZK6A 3UAZA 3UIEA 1GO2A 1ZZEA 1DFHA 1NBME 3JTZA 1GT6A 3M5PA 3OPQA 2XDQB 4L4SA 4YO8A 5DMHA 4WV3A 5M04A 2D5CA 4MVJP 5ENZA 2V6GA 2YXNA 4L74A 1LI7A 1TTPB 4C9BA 5AKEA 1KF0A 4YCNA 2LTAA 3PHCA 1Y8ZA 2IYUA 4LE2A 4N5DA 4RLFA 1VL0A 4XIFA 4NV3A 4F4JA 4CL0A 1JZTA 1CZLA 3UN1A 1DT3A 4NBLA 4NU6A 4URHA 3ZCRA 1H6AA 2W42A 1N3LA 1X7XA 4FFNA 3UTCA 1HX7A 3SHVA 3QPBA 4O4JF 1YZLA 2G25A 2HMYB 3V34A 4JNCA 5DHRA 4EHDA 4AY5A 4GOKA 3ZY6A 2IY8A 3VPBA 3DFMA 3QLUA 1QPZA 2A4KA 2MC6A 3MINB 4RCZA 5A4FS 1ZJWA 3ODPA 3GGPA 3AW8A 1JW9B 1T25A 1VIAA 3KKNA 1OQAA 4HLCA 4QPCA 5EZYB 3TLGB 3FMVA 5G2OA 2NXCA 3W05A 4F06A 5AVQA 3FBTA 5HSGA 3ICEA 2WSYB 3JYPA 2RHTA 3I6YA 3QE9Y 1KI9A 2J5XA 2P9YA 2R2AA 4UOQA 4IO1A 3LYAA 4V02A 1DJMA 2PV7A 4MWCA 4AN4A 2FKAA 5KNCD 4FZ5A 2FPXA 4K8RB 1LVHA 1SVIA 3W2GA 5DYGA 1ILEA 5KNCH 5G1NA 3RLIA 1Q92A 4R01A 1Y6ZA 1DEKA 4BLWA 2DR2A 1RJGA 4RSMA 3GLKA 1DX4A 2B20A 3DS8A 1YQ9A 3RC2A 1QKKA 4DR7E 2RK6A 4I1UA 4L76A 1EFUA 4X1YA 2EGHA 2PRIA 4INOA 4Q9AA 5CG2A 1KOJA 3PDCA 4O1MA 1Y4AE 3IBTA 1G8KA 1P1BA 4GHWA 3OLZA 1D2RA 1ZHFA 5KX5F 1IN8A 1OD6A 3MJTA 1ISJA 1RWWA 4XI9A 4UBLA 4AZ0A 5DOZA 3EZ9A 1QMGA 4C2AA 1RM4A 3X3HA 4I8XA 2DX7A 4RDIA 1O5IA 3KTDA 2JFPA 1XU7A 2I1LA 4Y1FA 3JWEA 1GVHA 4KLCA 1N3IA 5DBOA 2XOKD 4FN4A 3WLLA 4S35A 5BSEA 2QRVA 3MT7A 1UPUA 3T1NA 3ZD8A 4DUYB 3VNAA 2JLWA 4E1VA 4KE7A 1XXHA 1A8SA 4P3KA 3M33A 1CZUA 2QWXA 2WFLA 4WZAA 4EP1A 1XTVA 4DR6E 2X41A 4AX8A 2QMQA 2ISQA 4FW8A 1DAFA 3F2IA 1EYZA 1FSSA 2GEUA 2PCJA 4KN8A 4UKDA 3H9GA 1XI2A 2IEDA 4P0QB 5EIWA 1DP4A 2PMCA 1OI2A 1V9LA 4N8DA 5LBIA 1B00A 1UM9B 2HGZA 1UPXA 2PEYA 3DR5A 3LFTA 4L0CA 3W6NA 4X5OA 5A7HA 4JGBA 1YCGA 4Q39A 2JD1A 4YAWA 3TX2A 2XBMA 3EXEB 4DV3E 2A0KA 3EF0A 5CVUA 2M98A 4ZT4A 3G0OA 1N2CA 1X13A 1KU6A 2G4VA 3TBHA 4ETMA 2WVAA 3H2JA 3H9BA 1EA5A 2VF8A 4LMAA 1I30A 2VH5R 3FA2A 4QU0A 4XYEA 1P60A 4AM8A 5AVRA 5IRCD 3H0CA 4MYUA 2JGDB 5IBRA 1N8NA 1XD9A 3GVIA 3VDXA 3TECE 3I2HA 1FZTA 3DXXA 4JBYA 3ABQB 4RLHA 1JG6A 3H7IA 4YJHA 1P0IA 3T3IA 1E6WA 3EAQA 3HACA 1I4TD 2YS6A 1PGJA 4BYGA 1NZDA 2QD2A 2GB4A 1Z28A 3ADPA 5KJ1A 2HMWA 3QG5C 3WA6A 4FGUA 1LTHR 2DR0A 2HPZA 2PKYX 4BO0A 1MD9A 4QO8A 5KSZA 4UZFA 3SP1A 1CV2A 1WQ1R 1DKRA 1GG9A 4QD3A 1XPOA 2H48A 5AKXA 5JARA 1JZQA 4Y2UA 2FWPA 1OV4A 4I4NA 1NPDA 2Z57A 3CX8A 4O4HB 2QRUA 4OU4A 2XF8A 4DV5B 1IN5A 4F4FA 3WRWA 4ZTZB 5IEBA 1OH8A 1F0PA 4MINA 5HKKA 1RFLA 2V3CC 1H65A 2PS9A 3ETEA 5IZCC 1DAHA 4JEHA 4IJ5A 1I5EA 4ND1A 4B83A 5AM2A 3RVBA 2YCLA 1HA3A 5BVHB 4H16A 2H9IA 5CLGA 1HZZA 3NHFA 1ZRHA 4RYLA 1JHYA 2CVFA 3WJ1A 2V3WA 4GKKB 1OFUX 2OORC 2RI1A 1XNQE 2VLBA 4Y2JA 3Q7QA 5KNDA 1P47A 5T4FA 2N3HA 5A69A 2Y4NA 3HVIA 4PLHA 4U2FA 3LHDA 1NYRA 4HGRA 5L4SA 4HAYA 5KL6A 2EN4A 4J9VA 3HB0A 2Z08A 5L51A 4B3RE 1E2HA 4MO2A 1VLZA 3E81A 3ESXA 5K0GA 2EFYA 4IWXA 4PIVA 3AR4A 1RS0A 4Q9HA 2WQ7A 3ZE8A 2IHNA 4OXQA 3P1XA 2BGKA 3PUWA 4BB5A 3LBIA 1WXXA 1Q50A 2I7XA 3B1VA 3HA7A 1ADBA 3ONWA 3EXG2 4RKFA 2O14A 4Y1EA 2NUTA 4Z9YA 2UXCB 5DM4A 2ZJ0A 3PDWA 2GTPA 2IU3A 4PPGA 3JYLA 2PS3A 3EUEA 5HIJA 4AICA 5JADA 3K9LA 3WS7A 4LIPD 1Z5GA 5EIEA 3KZNA 3WMRA 1THZA 2FGKA 3FCUB 4X66E 1C29B 4AP9A 2NU6A 3KEQA 2HT6A 4RGYA 1RKBA 2LUOA 3UKDA 2MU1A 4BKUA 4XAQA 4HX5A 2PGXA 3CNHA 3KPUA 5I9NA 2V6FA 2JZNA 5IYZF 4MIYA 4H31A 4K9SA 4UATA 1ZM4A 2ENAA 4H7DA 4JYBA 4PLWA 5AD1A 3GLFE 3NWPA 4HCJA 2VHUA 4D9HA 3ME5A 1ABFA 5LP1A 4JJ4A 5LL6P 1VKOA 3SICE 1M1YA 1DXOA 1B41A 1UMKA 1U7ZA 2NZXA 3I6ZA 4WKPA 4J2TA 1BTOA 3O03A 5A6SB 2GNOA 4MLVA 1G18A 1KRHA 1XN1A 1Y9DA 4FJ2A 3HUEA 5C5DA 5CD1A 3ZVKA 4B74A 4MI1A 2P9QA 1Y3BE 2G1KA 1WNTA 3L0PA 4TMXA 3LOPA 2HN9A 5YASA 1XJ0A 2V7XA 1T1EA 2X8AA 1FFCA 4QOGA 5K1ZA 4MR8B 2HQRA 1DC4A 4URYR 5J9FA 2BGLA 1XA4A 1AC5A 1NCSA 3IBYA 1DWQA 1JTEA 3HJGA 3DD1A 1N8TA 3K1JA 2HC5A 1Q3KA 4DDHA 1N9ZA 3JSAA 3OPYB 3IDAA 3LCCA 4QFCA 5JD6A 5K8CA 3DTYA 4LJYA 1JEQA 2EFEB 3OMXA 3W3AA 4O4IF 3TB4A 4MV9A 1WKCA 1X7ZB 2PKRA 2F3SA 3UAWA 4QVIA 3OM0A 4HEHA 1A2QA 1DV1A 4NZMA 2IZ0A 1JU3A 3AHJA 4WKBA 4QHYA 4QQFA 3AFIA 4RTPA 2GF0A 2JARA 4I3FA 4GPZA 2WU3A 3F96A 4MI9A 5I47A 1A9XA 1ZU4A 3ILVA 3CIOA 3KB2A 4KYVA 4DQLA 2FMXA 3I9KA 4G5GA 2CJPA 3A6ZA 3GAAA 1FYVA 1BX3A 5EHQA 1YKGA 3T7IA 4GU5A 4ZQGA 3JQPA 4S2UA 1J7KA 2AOWA 3REQA 1JT9A 1XVTA 3DYVA 2WF9A 1ZN7A 3G0IA 1GNSA 3AOGA 4L27A 3BH6A 4QKQA 4MA4A 3O31A 4HDKB 4PZYA 3SSNA 5F23A 2HNKA 4P32A 4BQFA 2Q8PA 3NTXA 1L5YA 2P5SA 2JC3A 9MHTA 4L51A 2E87A 3TXYA 3ZTWA 5KWIA 1R4NA 1ILWA 1NFQA 4RKRA 2FPGA 5FOSA 1A5BB 1QGOA 2GASA 2B3TA 4MV4A 3W5AA 4B6QA 2WJVA 3Q8MA 3UMSA 1V6CA 1N5DA 2P8SA 3L00A 3GFPA 1GTSA 1C41A 1YR6A 4LSGA 2AKYA 1UDCA 1AV7A 3GUZA 3NM6B 4W7SA 5K03A 2RAUA 3V4SA 3AVTA 1K27A 1UEIA 2JKZA 2XGSA 2O8VA 3E1GA 3CSDA 5BR8B 1KPGA 3U7HB 1CQIA 1KZ7B 2BDEA 3W5SA 5HKAA 2Z5FA 3NIWA 4JVLA 2LMZA 3GGSA 4XVCA 1N2JA 1DG1G 1WMDA 4KLAA 3C3EA 3DJFA 3OIFA 1LLMC 1FYFA 3TF5A 1JILA 4IIJB 3R9XA 2IXBA 1G20A 4DCJA 1RU3A 2XDYA 3C8ZA 4BO5A 5T8KC 2P5TB 1E0DA 1HLDA 2X40A 3FRIA 3I2JA 2JCYA 4RV9A 4JXXA 5HP4A 3MCUA 3EYWA 2CBZA 4LVOA 4Y6SA 2B37A 4I50F 3ZHZA 1NBMA 4RTLA 1USKA 5E9QA 4I36A 4KIWA 4XSHA 1XFDA 3LS2A 1E5LA 1JQEA 3CMMA 1I10A 4NYIQ 3SKXA 4HQFA 4RJ2A 3UG7A 4B3IA 4CKCB 2ODQA 2X9QA 2X1LA 3D6HA 1CVLA 2ZB2A 3X1JA 4J29A 2ZIWB 3OBBA 1L5WA 5CDUA 4KAJA 1PK7A 1PZEA 1DQSA 3N2ZB 3CZ4A 3OFSA 3SZRA 4QULA 4WK2B 2PKEA 2ZKIA 3J7TA 2R3SA 1QO9A 3WL7A 4NG4A 1NNSA 1XTIA 2BWJA 1HWYA 1PW5A 4KNWA 4LHSA 2BGRA 5AASA 2EJUA 2Q6OA 3DD5A 5L53A 1RMDA 2XZTA 1EFRA 2NYRA 3VR5H 1B8NA 1RIIA 5FTJA 3VV2A 4JH0A 3N8GA 4YUXA 1Y7TA 1TJPB 1QIFA 2IJGX 4BNXA 3PXBA 1L4UA 3N0XA 3R7WB 1WCIA 5JRJA 3TSAA 2O4CA 3WZMA 2X9GA 4MAMA 3ZEAA 1BDHA 5KC8A 2VRCA 1ZNXA 3NOQA 3N28A 2HB6A 5CXXA 3CTMA 5EA2A 4N01A 4YUVA 2TMGA 4GZ5A 4LJLA 4ZZ2A 1S3IA 2BE9A 1VPTA 4RHBB 2Y9PB 3R4VA 1OFVA 1XL1A 2W2OA 4JASB 5E4TA 4F45A 5DV9A 3AR8A 2Z1MA 2XTZA 4DWJA 2NO9A 4D46A 5JHGB 2XT9A 3WLQA 2DSYA 3VAYA 1J2UA 1JDVA 4HUQB 5CEFA 5J23A 4PYQA 2DMIA 4D79A 3W3AD 3HXOA 3W8FA 3PRKE 1E4OA 3HLTA 3JQGA 2M1SA 1HMPA 3VNQA 1F9EA 2PK3A 2I55A 1ZCFA 3MT8A 4CKBA 4E21A 4OL0A 1T13A 1PSWA 3M83A 1K68A 2BHRA 3BFPA 4ZDJA 4L0MA 3VTKA 2WNIA 1KJ9A 2QMUA 1F51E 4PYJA 4ID3A 3C3YA 4MCHA 4X60A 1HE8B 4G41A 4LG1A 3VQTA 2O7NA 5IWAE 1ZISA 2YZ2A 1QX4A 2PSJA 1J5EE 1GPMA 3NC4A 2EW8A 3WLSA 1FP2A 3BDIA 3D5EA 1BKSB 1O6FA 3WGLA 3QE4A 4BVFA 1P6XA 3L8YA 2HJJA 1MJFA 4YC7A 4NWIA 1E92A 1SXHA 1CTQA 1N3YA 1OILA 1U8AA 2XA9A 4LDRA 1VMKA 5AM4A 3MMXA 5FTWA 1IVYA 1JGTA 3A3PA 5AJHA 4F3YA 4E32A 4J2OA 5JPDA 2UYHA 3TM4A 2VQDA 3NRBA 4P92A 1QDUA 4XA8A 2C5AA 2BC9A 4X8WA 5JHHB 3NWJA 4FCTA 2WD7A 3WKDA 1T3LA 3GHYA 2ZIAA 5ABPA 1S01A 2RB5A 3GPDG 3OY7A 3JQBA 5F76A 3DMYA 3IQGX 3KFXA 3WX0A 1ZOSA 2E85A 2IYPA 3E2PA 1OBOA 1V9SA 2XV1A 3BEOA 4PLCA 1U0NA 1VE1A 3NTVA 4XX0A 1K7YA 3HM9A 2X7XA 3EH1A 5CYOA 3ZD9A 2VQEE 4E5DA 1JHRA 4Z4EA 5B2FA 1I5RA 4KQ6A 3DHWC 2I9IA 1U0TA 3AM5A 2WYOA 4F7WA 1V5FA 1T4CA 4FR5A 2NU8B 1XC7A 2M7QA 1X1RA 2JLAA 4UTRA 2OB2A 3U60B 2RI0A 4HYQA 4LTNA 4FWTA 2HJVA 4QJ3A 1B3RA 2YJ4A 2I78A 3U1BA 1NONA 4KHPE 2H18A 4U2EA 3IAM6 1E4EA 2EC5A 1XO1A 2GNAA 2DH5A 3RDPA 1OZFA 1C0EA 4NY1A 4YJGA 13PKA 1RXYA 4L75A 2WD9A 3QU2A 3A05A 4LOJA 1X1TA 1BVYF 4LFCB 2YRMA 1ZL2A 1HI9A 3M9WA 1Y8RA 3MS2A 2CNOA 1A9PA 1C0LA 3OTHA 4EIWA 1XNRB 2ENWA 2I76A 2PZJA 3CV3A 3FI9A 3L7CA 4HPWA 5DBFA 4JBHA 3JATA 5IDXA 3DKPA 1E9CA 4M9VC 1UP6A 2J31A 5FPYA 4B17A 4B46A 4BJ1A 1HO3A 1Z15A 3LCVB 1UDRA 2MHCA 2IWHA 4TKLA 4R9NA 2H36X 3DEHA 3KAPA 1C7ZA 3NPAA 2Z8ZA 4HXYA 5G02A 4B76A 4HTGA 1T0BA 4KLZA 4KKXB 2YU5A 5AK6A 5FULA 5CAEB 4QGHA 4IL5A 5FWDA 2CXRA 2X8WA 3C74A 4JQYA 3K71B 1I6MA 3D9QX 3MBKA 4PZCA 4AT1A 3ZE1B 5JZOA 2D54A 4ZRDA 1BBOA 5G0TA 4BNMA 2PBRA 2AX3A 1ZUNB 1KO7A 4Q28A 4FZJA 1RXUA 4CEHA 3L7IA 1SC4A 1JR6A 1EFRD 1UKAA 3R24A 4IOJA 3DUFB 4Y6QA 4QATA 2CWDA 2B7TA 3ITNA 3P2KA 4N54A 4P34A 2IS2A 2MT9A 1D2GA 3NP7A 5KTRA 3KZMA 4Y0AA 1PD0A 4JDUA 1N4AA 3RH0A 1X6VA 2R1FA 3W04A 3KVOA 1T4BA 4GF5A 5DFAA 1W8IA 2G76A 1RLOA 2GCEA 3Q6MA 4YV1A 3RKRA 2A1TR 2XNSA 4IV8A 3VR3A 3PK0A 5AM5A 1VXOA 1LPMA 3ITKA 4Q4AB 1U8XX 5C0OE 2I66A 3ABIA 3ZV7A 1IY1A 3K3PA 1GPUA 3GFSA 3PNPA 2KBEA 4X85A 2XMPA 4TLLB 4G2TA 3RW9A 5SYMA 1MZVA 1Z68A 2B5VA 4KKVA 4BVJA 1RHQA 4WCFB 2BEUA 2YRWA 2YRKA 2GYVA 3JRNA 4X6XA 2IKQA 3QWIA 4CQLB 2H11A 2M6LA 5CBPA 2K7IA 4AY6A 3UK1A 2AUMA 1LDNA 1RMQA 3QY9A 2LDXA 3E27A 3GPCA 4JHXA 5JWHA 3AR3A 4GEQB 3PWKA 2D9HA 2UUPA 2Y0CA 1JHAA 3TRIA 2B7LA 1NOKA 4KU4A 4O2AB 4C14A 2OD2A 3TQTA 1CXZA 1MB4A 2CNBA 3EWSA 4B2IA 5BR7A 2B82A 5LLDA 3PFKA 4LC1A 1GZ4A 2IEAA 3GLFA 2ANBA 4BBPA 2EHDA 1DGCA 1GCGA 1NT4A 1WZCA 2X8JB 1PZGA 1X2BA 1U1GA 4DUYE 2VIIA 2P9CA 3D4PA 3KQPA 4UHJA 3FHJA 3PHGA 1FUYB 1QRSA 3TR6A 4ZOEA 3GZTB 1KI6B 3FDIA 4KDEA 4G1BA 4ER5A 1W35A 4MH0R 5F21A 1K6JA 3IMCA 3AY7A 4JLOA 1FFBA 5ITZA 3WYEA 1P2FA 2HRQA 2FMUA 4TKUB 1EX7A 3R5HA 1FEZA 5J5VA 3IJPA 4GQAA 1GZ6A 3ZE6A 4CLRA 4MVJI 4CLHA 2ZRKA 3D5TA 3S27A 1GSAA 4DLZA 5HOEA 3QUTA 4LXTA 2P67A 2UVPB 1JV2B 4I0WB 4IKPA 4WESA 1T0UA 3TJMA 3F97A 3DDCA 2CEAA 4BFLA 1JP7A 1OE0A 5LA6B 3L1IA 4EW2A 4L57A 3PV0A 4Q12A 1A1HA 2ZJYA 2GZDA 3AFGA 1XKQA 4AU1A 4U5QA 4EL5A 1RWVA 1EK0A 4U9IS 4DBLE 4RTRA 4OX9B 1V8DA 2YVQA 3IRUA 3N59A 3E48A 1R5OA 4L8WB 3C3KA 1RD4A 4LZJA 3A4MA 3K9QO 1V1RB 2V5AA 3M1IA 2YTZA 4HFJA 4M49A 3F6GA 3PC3A 4GOJA 5E0OA 1U8FO 2O7RA 4WQMA 2ZRQA 3NHAA 4XLTA 1X48A 2AL7A 3Q8KA 2OY0A 4RXUA 2WILA 4GPEA 3OJEA 5ESXA 1F2IG 3UQYS 2G5TA 2CB9A 4MUJA 1J0CA 1TCBA 4DLAA 3ZVRA 1CUEA 1XPRA 4IDAA 1EE9A 4LHEA 5T57A 5LYJB 2CZCA 2W98A 3SIPA 4QPDA 3STXA 4BO4A 1R6AA 1SBCA 3LA6A 1V7CA 2DGDA 5EMHA 3ASYA 1YUMA 5FPPA 1KAGA 1KFBB 5TSEA 3PGMA 1N6OA 1Q0ZA 2BCEA 3HDQA 4J0KA 1HEUA 2FMFA 2I71A 4HDMA 4QJ4A 4TYMA 3T3EA 3RYIB 1FLDA 1JLRA 3VZDA 3ZQUA 2JLXA 3P4XA 3PQ2A 4MRMA 5A2QA 3ROPA 3PYMA 2D2IA 1EFCA 2E2WA 1LK5A 4IICA 2IYAA 2MR6A 4HEIA 1KY2A 4MV1A 3S2EA 5L45A 4PR3A 2RIRA 4GKKE 4WAUA 5C8XA 1ND5A 4R8MA 5HS6A 3AM3A 3RAJA 3ZIUA 3LVRE 2QN6A 3PNVA 3CQ9A 5FUXA 1NN0A 4KLNA 4MQUA 5I9MA 3WVNA 1KFEB 3ZCXA 4NYMR 5KEIA 1BFKA 3VR3D 4ASUD 4DLLA 1TLTA 5BY2A 2BB8A 1XWWA 1KYVA 3FKQA 1N6KA 4LK3A 2BM8A 2JI9A 5EJFA 1V4BA 1OA0A 4AZ3A 3N86A 5A4KA 1WEHA 2OYCA 1CSEE 3K73O 3DTVD 2UXCE 4Z1MA 4GNRA 1O2DA 1BGVA 3NEAA 1G8AA 3SNKA 2JBAB 4JL5A 4HJRA 2ZU6A 3GZNA 1T5BA 5J1TB 3V1YA 3FSRA 3OFJA 4BCBA 4M6WB 4CNBA 5CFLA 3S8YA 5CHEA 1XQYA 1P61B 5K6RA 1ENZA 4E6PA 2QLNA 2B1RA 2IYQA 3JD2A 3KL4A 1CBUA 4GI5A 2QSUA 4UREA 4X0EA 4F8JA 3TN7A 4PRKA 2EOFA 4KPYA 5LKRA 5EC8A 4W82A 4PAWA 3SQOA 2M4IA 3EGXB 1ZYUA 2J9ZB 1U0OC 1FQWA 1U5BB 2R96A 5TS2A 4BQRA 2GN9A 3HEBA 2YW9A 4BP9A 3ZBTA 1F2UB 1XAJA 2R6ZA 2RH5A 2FSVC 1WSBA 2VUUA 4N5NA 2NO5A 4KAFA 4Q93A 2QTRA 1ZUD1 3FOWA 3HLKA 4TVKA 5LYYA 3L6RA 3HDYA 2V54A 1M73E 2W6IA 2G5CA 1Z2EA 4Q01A 3PKZA 1UOOA 1R9NA 2OXRA 1U28C 3WLOA 1YRQA 3HVHA 1M2WA 1P5FA 3A1CA 5BN3B 5AVSA 2O20A 4LXGA 5L3RA 4YMLA 2FPOA 2D6FA 2NO0A 4JGGA 1GQYA 2PWBA 3E7PA 1O95C 1I80A 1P1IA 4KNVA 2VYQA 5D3MA 4DLTA 4PYKA 3RV4A 2J7PA 2VJPA 3EXAA 3NKVA 5EL0A 4DR5B 3H2GA 2P4EA 1KFCB 3A25A 2V97A 2Y1OA 4U6NA 3JALA 4XQ9A 2C5HA 1C1HA 1WQ4A 5KC9A 2AQ8A 4M86A 1YO6A 2CL6X 4WFIA 4ACAA 1J1IA 3UMFA 4Q7JB 5B4VA 1OZAA 4CR7A 3BMCB 4B40A 2Z98A 4XLLA 3EB9A 5JJBA 2FPRA 4HRYA 2BFWA 2J5RA 2W58A 5A06A 2PE5A 2PNFA 1HKHA 1SJ9A 1AV6A 1JKJA 1HDIA 2J5BA 2Q4EA 4GMFA 4GP6A 4LC9A 1JPVA 1L4MA 2ATEA 4AJEA 1ISHA 2P3OA 3KYCB 1CUAA 1VBFA 3NBZC 1D0IA 3WGVA 3CB2A 3ZGOA 3ZGZA 5FI5A 1IN1A 5CFFE 2AMVA 2GMWA 3QX9A 4OGGA 2ZUSA 3F4KA 2QSZA 4AKSA 4UOZA 4RD4A 1G0OA 4AIRA 3Q9NA 4CI0B 2VP9A 2H3HA 3A9VA 1IPFA 2WCC3 1GRCA 2P6PA 2ZTSA 1E8MA 1UOPA 3BMOA 1QAMA 5THKA 4ENVA 4PBTA 4RK4A 1MAWA 3RAGA 3LTNC 3KWRA 3BWCA 3L41A 4H3HB 4S1PA 3DHVA 4I7EA 4NOJA 2Z9DA 5TEVA 3EF3A 4ZAYA 1T3ZA 5LZ9A 1OAKA 1L3CA 1MO6A 1TVKA 2Y6UA 1HL3A 3ROFA 4BJ6A 5DNYB 2EMCA 1AHHA 1GY8A 2WSLA 1WL8A 3TW8B 3FDZB 2MDGA 1D03A 1LCIA 2IFTA 2D3TA 2R76A 5BR8E 4K05A 2C31A 3D3NA 2WHYA 4HNGA 4B8YA 1KDVA 4NZ9A 5H68A 2V9ZA 2HTFA 2BJHA 1UWLA 2Q5FA 4P7FA 4AURA 2JGNA 1PYOA 4UHDA 4BJ3A 4NI5A 4DARA 2PGLA 3GQBB 4D57A 2AQKA 5BORA 1ZKDA 2ARKA 2ZJ2A 4NS4A 4Z1MD 4DA6A 2G0NA 2VK1A 4KZPA 1VA4A 4E5YA 3AVWA 2QLJA 2W0SA 3CLTD 1O5OA 3G89A 2P3QA 1RPZA 2AG1A 2DR3A 2ZPUA 4R71A 4ZVRA 2QTNA 2XDQA 3LKDA 1E9DA 2XUJA 4DLYA 5BT9A 1T2FA 4R7TA 2LRSA 1F4LA 1KPIA 2PIDA 1OLUB 2FG5A 4P08A 4WOCA 1SXQA 4LUCA 3A1TA 4OHBA 1M10A 2GJ8A 2XUOA 4IMJB 4UBOA 1O8CA 2GILA 3NGXA 3HSSA 1K6MA 1WDWB 4B45A 1YMQA 5AVXA 1U5CA 4XGRA 3TOZA 2DEUA 2XRYA 2N0SA 10MHA 1CEXA 4Q82A 4R69A 3HYRA 3NHBA 1GFSA 1HYGA 1KNXA 2ZZKA 1NP6A 1N0HA 2J3DA 2AR7A 1U6IA 2W6ID 4PWYA 3WDSA 4OHCA 3PWZA 3EMDA 4F92B 2HLHA 2XSZA 4C4AA 3MINA 1UR5A 2V8BA 1YFZA 3WXBA 3H6GA 2NYUA 3OOYA 4N3AA 4KR9A 4G1EB 3CTPA 4JAVC 5GGYA 3TLGA 5EZYA 1MJNA 1RP1A 3ZOQB 1A9RA 1PDWA 1ZVQA 5CCEA 1HT1E 1TA0A 3D3JA 2WG1A 2H2IA 3KOMA 1GG2A 2RBGA 4NFYA 3TZBA 1U6JA 1LW6E 1NTRA 2E89A 3SQXA 2Q5IA 2QUIA 1K88A 3CUTA 1CR2A 1H2BA 4B6PA 2VWGA 3WGKA 1RI1A 1EVLA 1M34B 3FVTA 4BFZA 2XZLA 3Q6NA 1J0XO 3Q15C 1NG1A 5J63A 3I2KA 2I65A 2DWQA 1L5KA 1P75A 2F43B 1IN6A 4BLRA 4CHGA 2X19A 1I7SB 1ZW1A 4ITUA 3F90A 2UZ1B 2YCBA 4YROA 1PLLA 5EKUA 1MOSA 3BE5A 3OKAA 4QG7A 2CF5A 5JTTA 5EXPA 4MVXA 3RVKA 4FYHA 1L9XA 4L8LA 3KK0A 4L78A 4ZAXA 2CMFA 4DDMA 2FZWA 4IOKA 3RTCA 1I3CA 5C53B 2QYSA 1ZJ5A 3AHDA 1SFEA 4AJIA 4B87A 2VDJA 1E3LA 2ZRBA 3HBMA 2UXDE 2I2WA 4QVGA 4TSRA 1A50B 3S3TA 1Q7CA 5I7EA 4A4DA 3UK3C 1QQAA 3ZDBA 3T12A 1N25A 1TTQB 3OJFA 3CKMA 4C2TA 2WKWA 4UVGA 1XZGA 3I1YA 4CKWB 3LGSA 3AUJB 4MZDA 3O8RA 4CM6A 2OV4A 3GPLA 4QDKA 2SHKA 4DLKA 4CV2A 4DY4A 3EG9B 1U8YA 1Q95A 2XQFA 3NTRA 4LWOA 1H8HD 3LVQE 4BNTA 4YT2A 3FFXA 4I1IA 5JJLA 3L4BA 4ZVMA 5ERGB 3A4NA 4F2JC 3VKUA 3W34A 3OZVA 4A8JB 4GR4A 2AHOA 3IDOA 4Q3DA 5DK6A 1KWKA 1GV0A 4FDMA 3TTYA 1UM9A 3P26A 2PRZA 4EHHA 1WE2A 5G3YA 1OC2A 1NPYA 2F1OA 3A9RA 2OEPA 2W48A 5JRDS 5AKYA 2ZWIA 3EXEA 3NC1C 4D80A 3BGHA 1JI3A 3AKCA 5B1EA 4NYJR 3DT9A 3O8OB 4FKZA 3ZWMA 4C7KA 3KPYA 2WAYA 2ELZA 1AQUA 1JR2A 4BKMA 4UFPA 2JB9A 4A16A 2JGDA 1SZDA 1Z4LA 1JQJC 3K4HA 3STYA 4HAOA 3FWZA 2W2LA 3I23A 3WGQA 3A6FA 5HQTA 2AR9A 3DE3X 1UMCB 4BVGA 4BB9A 5BWBA 1XNRE 4FD3A 1G8JA 1TGVA 4JB0A 3H09A 4ABTA 3QFSA 2QNBA 2Y93A 3K70C 4G5HA 2Q8NA 3K30A 2HGHA 3J80C 2HQ1A 4IRMA 1QKIA 4UDYX 1DQZA 1TF2A 3AP3A 4UMVA 5DHPA 4E5UA 2VP4A 5KYGA 3RQIA 1I14A 1UOEA 3E1SA 3LKZA 5I7AA 5M7EA 3OEED 1H2RS 1UDXA 5KOHB 4KC0A 4F84A 2I2BA 3M5WA 4UUBA 4CEJB 1UMDB 2JLZA 2EP8A 3RUHA 1TYEB 3I01A 4B85A 1TC2A 2QVYX 2DFDA 2KQUA 3AXSA 5BW8A 1EXDA 2EZ8A 2FDRA 4O4HA 2WINI 1WY7A 4M1ZA 4BBZA 2G80A 3BFJA 4HLDA 2ATXA 3GA5A 4A0RA 4CMAA 4EW6A 3UJNA 3EH2A 4IQ0A 2I67A 2EL5A 2WC1A 3H5NA 2FJUA 4I1VA 4V0QA 5KHAA 4BBYA 1NF8A 5BVHA 4EVIA 3AL2A 1EJBA 3QZUA 2Y1GA 3ZLVA 3UPUA 4YPFA 4Q16A 1T5IA 2ETXA 1I36A 2FFBA 3KB6A 4HZIA 5FHRA 1ONNA 1X8LA 1ODTC 3LRXA 1EQUA 1Y63A 4XFDA 4QJBA 1O94C 1PJQA 2AZMA 3HMKA 3DE6X 1W59A 1YULA 4C30A 2WK1A 5F98A 4RHXA 5DGHA 3F47A 1ZY2A 1QH8B 3HBFA 3LBFA 5AHOA 2WKQA 3QPUA 1XEXB 2WIDA 3G79A 3KVYA 3Q5EA 1Y5RA 4TT8A 2ZIFA 5DASA 5EXDA 4BGUA 4Z4GA 1C9KA 1XIVA 2P7HA 3B5JA 3BHJA 4CKZA 2FPWA 4BVAA 1N7GA 3NUQA 4WXEA 2FRXA 3HL0A 1GNQA 2EJWA 4UAVA 3WY9A 3EEQA 4YDHB 5KL5A 1QG6A 4LEIA 2H5LA 1HQKA 2A5LA 1JIKA 1GR0A 2CJFA 2QHXA 3TR0A 4M87A 4Y7DA 2OCDA 3WAGA 5HDBB 1KIAA 1AVTA 1IAVA 4G86A 4TL7A 4F3CA 2KSQA 2IS4A 4LGYA 2MDTA 4G9EA 1WUYA 1E8NA 3Q5GA 4OJTA 5GZ6A 3GJXC 4J03A 3FTDA 2ZUBA 2W4MA 4RM3A 5DULA 2KHXA 2ZUDA 4CQMA 1R3DA 1R74A 3AESB 3JZDA 5T3YA 3UYKA 4DNOA 4DIDA 1T6XA 3V5NA 4CN8A 3C3JA 4BWYA 1V3UA 1COWA 3FUCA 2B8NA 3QMWA 4QM6A 1VHTA 2OECA 3W0LB 5KUTA 1GPDG 2C61A 3JY6A 1TAHA 2VG8A 5LP6F 3RYTC 5A6SA 4ZYZA 1T8YA 2WIBA 1EWTA 1UZMA 3DP7A 1NG9A 1FSPA 3WMEA 2REBA 5HK8A 1CY0A 4LF8B 4LYDA 3EQ9A 1TVMA 1AK1A 4R9RA 2CL7X 2FZ5A 5L8VA 1OGYA 3PFIA 4X1IB 1T10A 2OQRA 3UCFA 3IR7A 2VP0A 3UICA 3A8TA 1DTWB 2BKVA 3BAZA 4MR8A 3OTOE 4IH4A 4Y2TA 4INZA 1JQBA 3UJDA 2YV5A 2BZSA 5DW0A 4Z0PA 4O3FA 2LTRA 3OPYA 4EY3A 3QPAA 4D9CA 4D9FA 3NHWA 2IEZA 3P9XA 5ALKA 2QSJA 3PKJA 4OX9E 3PEUA 4I6EA 5B58T 3JR7A 2AN3A 1X7ZA 2AN5A 4R2XA 1MXHA 1SHZA 2WHPB 3ZUPA 4IV0A 1CDOA 1MOPA 4MYCA 4Q6WA 1AQNA 2I7TA 1NVVR 2LDBA 5DGXA 3OT1B 4ICIA 4RFSB 1KH1A 4M4SA 1ZD8A 3QW2A 2CN1A 4A0GA 4C3OB 4EKIA 3ECRA 4NK4A 1QBKC 3FCAA 4MRPA 2R7AA 2P9JA 4Y9TA 4QLBA 2PUJA 1CX9B 3E5NA 4L3VA 4UXIA 2GAAA 2AQIA 3A1WA 4CI9A 2EMYA 4IOMA 4NYIR 5ULLA 3ZHBA 2ZUCA 1CIVA 1J21A 1RQXA 3N70A 1B2RA 4CFZA 3FCYA 1FBNA 2XI4A 4B79A 4OX9Y 4PC1A 2FG6C 1PSZA 4KACA 3EVZA 3W2FA 3WHKA 2NAPA 5DTJA 4PPYA 3CRRA 4IS3A 5SICE 2XGJA 4XRRA 1XYGA 4HDOB 4HDKA 3ZKWB 1RQRA 5I5EA 2GJ4A 4AG6A 4ZVNA 1FPMA 5IJ9B 2X3UA 1WXIA 3JZMA 1NZJA 4P5PA 3RF6A 2D7DA 2A0WA 4KIFA 1RAFA 2WU1A 1RZUA 2YBDA 5T67A 1G9SA 1D0SA 1LX6A 4FFBB 3LUHA 1RCFA 1TUGA 3R3UA 3U3OA 5A3VA 5EHZA 3EEOA 1BC5A 3W06A 4KMRA 3LG2A 3PDHA 3Q7SA 3H11B 4GC9A 1M54A 3O83A 4CTKA 1Q77A 4GLBA 2NUEA 4WX9A 1UANA 2EOXA 3DNMA 1MNAA 3EZ2A 4FHCA 2O3RA 2VT3A 2YFHA 3BSWA 1PT5A 3KT6A 3LPLA 5IT9A 4HWPA 4YFYA 3E15A 3HPSA 2Y99A 2HA7A 1PIWA 3NBQA 5FTNA 1YBMA 3UENA 1T4MA 1GUDA 4LAFA 2NNWB 5F12A 4MYDA 1NURA 2BE7A 1W4ZA 2PZAA 2Z04A 1QFMA 3FF1A 3H99A 3OETA 2C04A 3Q3JB 1Q14A 3DOFA 4RVCA 3DLAA 3EQ6A 2XTAA 1IY8A 2C4VA 2DFPA 3KZKA 3T4UA 5MF6A 2A3RA 4IIJA 4YVFA 4FONA 4QJIA 3KWFA 1ZITA 4KGZA 4HGOA 4MKXA 5JQGF 2XTNA 3W5IA 1EVIA 4FMDB 5IN5A 1JDPA 2R4UA 1FLNA 1ORTA 5C51B 7MHTA 3UXEA 4PN3A 2O8CB 4F6MA 2LGJA 3JYNA 5E7MA 3VR6D 1D3AA 3EEIA 1Q0TA 1S3SA 2J0SA 4XD2A 5DGIA 4MQMA 2VK8A 4RNDB 2HPVA 2IOQA 3NM5A 4LJ5A 3ZHQA 4FR0A 2O2YA 4CQMD 4CKCA 3LLHA 2AI1A 2W2QA 2YVUA 4K8OA 4O4LB 1IRIA 3K94A 3T4PA 4ALNA 3NIFB 3TD6A 1COWD 2RONA 3QU4A 1B0ZA 2B78A 2BT4A 1AN9A 4OAOA 3ISVA 4EHKA 1VFPA 2ADMA 1XTBA 1ECBA 2EPUA 3KC2A 1GKKA 2ZRFA 3LFUA 1QH0A 1XDZA 2CMDA 2VRWA 2P2GA 3D6JA 1X9GA 4NCJA 4UBNA 3T0GA 3KU1A 4OJYA 4E2WA 2BGMA 4JWTA 3R7WA 4YWHA 2XLBA 4J6EA 1TEHA 4B5LA 3NC0C 1FXUA 3EOBI 4XUCA 3T95A 3FJOA 3WZLA 2YFQA 5JYDA 3KZVA 2ECFA 2C5FA 3IOBA 3L1KA 2WRZA 4K1LA 4AJ9A 4LYAA 3KJQA 3NASA 4Y0NA 4OHFA 2ID9A 3Q1KA 4R9UC 1MHTA 1K5PA 3UJ6A 1SC9A 4GVLA 4OBXA 5HIKA 3WLHA 4HUQA 3PKIA 1IK4A 1U3TA 5EZ6B 1E4YA 2NMVA 1QGAA 4UCFA 3I04A 5G53C 2EBUA 4FHEA 4GWKA 4J3FA 3ZVLA 3I6MA 4NHOA 5IG2A 1X0XA 3LX6A 1ZMOA 2F4NA 3BD7A 3C43A 4LQ4A 1J22A 4RA9B 2J41A 4OVKA 5ERXA 4HUJA 2HK8A 3FDFA 3C7KA 1HSZA 3T15A 3JRWA 4D9EA 1MG5A 4LPKA 5L3ZA 2XMSA 4MJ3A 5IBQA 3IEPA 3SQNA 3PSAA 1GYRA 1L0BA 2C7BA 1EUYA 4LBYA 1FYDA 1T2VA 4IW3B 3L0CA 3DF7A 2FLKA 2OXTA 3WBFA 4Z49A 4MVJF 1S8FA 2IYYA 1Z8DA 3FSGD 1P7YA 4IVNA 3O9MA 4E6EA 5CNKA 3D6FA 5D7BA 5IAKA 4QDOA 3TIXB 2WKRA 1S7GA 3TLBA 4P2BA 3ORRA 1Q12A 4KYIB 2ID4A 4GP7A 5LLTA 2J48A 4JVOA 3GJ8A 1K97A 2WZCA 4NEGA 3M3PA 3R0ZA 1CUBA 2B6HA 4JLSA 5HKLA 5DHAA 4JI6B 1WU8A 4JJAA 3CG0A 3FUTA 2VHVA 1HV8A 3DAOA 2H1HA 3ENKA 4H3KB 3U7QB 1RHKA 3BM5A 2AG0A 4MVJM 2E5WA 2JFZA