1GZ6A

(3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
301
structure length
301
Chain Sequence
SPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGSRMTETVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17 BETA-DEHYDROGENASE 4
publication title Binary Structure of the Two-Domain (3R)-Hydroxyacyl-Coa Dehydrogenase from Rat Peroxisomal Multifunctional Enzyme Type 2 at 2.38 A Resolution
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dehydrogenase
total genus 101
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1gz6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gz6A01
3QVSA 4OXNA 1VM6A 3FNHA 3ZNOA 3UVEA 5I9LA 3H65A 4CM4B 2G1UA 3ZV4A 3VPXA 1ZK0A 3D5QA 2PZLA 3H4VA 2OXIA 1LRKA 4FOOA 1O5IA 1SNYA 1LBEA 2JHGA 4L0QA 1QYVA 5LCXA 4BMVA 1GYPA 5DCWA 2D2IA 1E0DA 1MFZA 1JTVA 2I5PO 2NACA 4XDYA 1XA0A 5T57A 3NTQA 3U4DA 2JD0A 4IBOA 4ZQHA 4AJKA 1XKQA 3F9IA 2OFPA 4RCVA 1PJTA 1HDCA 4Y8VA 5I7FA 4IDAA 5DZSA 3Q2KA 4XYEA 1KEWA 4LGVA 3WGHA 3QIVA 1RYEA 4ZRMA 3VZQA 1T1SA 3AFNA 4HUJA 2CFCA 3HZZA 1U8XX 3LT1A 2VHYA 3INGA 3DTYA 4RZIA 4E5KA 4B4VA 2PFGA 1F8FA 2D59A 3U4HA 3UUWA 5BSGA 3KYCB 3NDIA 1I01A 4JNKA 3QRWA 4M86A 1ZXBA 4WCFB 4GLOA 1KYQA 4FGSA 4OJNA 1CYDA 1KEPA 5COBA 4XWYA 4KOAA 1B0AA 3TF5A 3CINA 3E9MA 4DPKA 1F06A 1PQUA 3PJDA 5F1PA 5G0UA 4CLOB 1KY5A 1U4SA 1Y5RA 4XGNA 2ZB4A 3DOCA 3I4FA 1IOLA 1I2CA 4IDBA 3A28A 5A04A 1VL6A 4WASA 2V6FA 4LCEA 2X9NA 4XB2A 1XYGA 2E37A 1ADCA 4NFYA 4ALJA 3PZBA 5F1KA 5G4KB 3U4CA 1G0NA 2CSUA 1KOLA 2GR9A 2NLOA 4MVJP 3AUSA 4UVEA 4GX0A 2D1YA 5AVOA 2P68A 1CDOA 4N18A 4N5MA 4N54A 4I5GA 2I3GA 3KO8A 1EVJA 3ZWNA 4CMHA 3D3WA 3RU9A 1YDEA 3FRJA 2FPPA 1EQUA 5I9MA 4NHEA 4UUPA 3RVDA 5EIOA 3QVOA 1Z75A 4GSKA 3M6IA 3AOEC 4IGEA 3AFMA 1ISGA 2RAFA 3FR7A 1A9YA 1YXMA 1LDNA 1N8KA 1T2AA 3MTGA 4PN3A 3ANLA 3W4IA 4FFPA 4ID9A 1TLTA 4YJFB 2B4QA 1J4AA 1DAPA 2OP1A 3HFGA 4MIYA 2OGUA 5IZ4A 5TT0A 4J7UA 1OBFO 1FF9A 1IHXA 4IDEA 3I23A 1UZLA 5B4TA 1RM4A 2EIHA 5COQA 3BMQB 4PLVA 1PJLA 4ZHSA 4FFOA 3OA2A 3GR6A 4JX8A 4YR9A 4RQUA 5ICSA 3IL2A 4DA9A 3ITKA 1K5HA 1J49A 2VYNA 1HYGA 4R4JA 3RJ9A 3K5PA 3DFUA 1J0XO 2BELA 3RFVA 5CEEA 5T5QA 2CNBA 4EUEA 1UXIA 1B8PA 3DO5A 3E18A 1WVGA 1SCUA 1U9JA 3F3SA 3WS7A 4RO0A 4LCJA 5KCZA 3HWRA 3D3EA 4C7JA 4O1MA 4A7PA 2CUKA 3O8QA 1UXKA 1NHGA 3L4SO 1HDOA 4NK5A 1A7AA 1M6HA 1PGJA 4FFMA 2ZATA 4RPLA 2GD1O 1NPYA 2X86A 2VTEA 4J1TA 2O3SA 3BAZA 5HM8A 1ADBA 3GG9A 2FHSA 2YHIB 3WGYA 1ML3A 1X1EA 1KS9A 4WK6A 5B4VA 1GAEO 3CZRA 1JWBB 4UEJA 3TZHA 4HADA 1OOEA 3HDYA 3PK0A 3SBOA 3VZPA 5KVQA 1ORRA 1PQPA 3KSZO 2Q2QA 1V35A 3QVWA 4JQCA 4I5FA 4CR7A 3FN4A 4XR4A 1VI2A 4U5QA 1HZJA 4BKPA 3ROPA 4EEXA 1SO8A 3SLKA 4GMGA 1PQWA 3D4PA 3PZRA 1EVYA 4CMCA 3GNQA 1E3SA 3GVHA 4IDDA 1W4ZA 1Q7GA 4HFNA 4Q3CA 4DL9A 1PJ2A 1IPFA 5KIAA 4XGKA 4AJNA 3RBXA 1WDMA 2YV2A 3V1TC 4CM5A 3DZFA 3GEMA 4HY3A 4ALMA 2WMDA 3DR3A 1OFGA 4OO3A 1F12A 2RHCA 1O6ZA 3GMSA 4R1NA 1Z82A 5DOVA 5F3RA 3FWNA 3S8MA 4L73A 4NDNE 1EFLA 2TMGA 1U2GA 3FPCA 4RF5A 5A05A 5THKA 1MG5A 4NJMA 1MFPA 4J3FA 1X7DA 3ZV6A 4PVDA 2V7PA 1YQGA 4RGBA 4RLHA 3WSVA 4D0SA 3ZWBA 1HLPA 1GTMA 4AJPA 3GEDA 5EERA 4J7XA 4IXTA 4E21A 1GPJA 2ZYDA 1XWFA 4ZU3A 3L6DA 3RFXA 1P45A 3KVOA 2VYVA 3PJGA 1UP7A 3U5TA 1YOVB 4OKNA 4ZJUA 4B7CA 1NR1A 3OBBA 3VKVA 4IPTA 3EC7A 5G0VA 3QHAA 4CLEA 5IN4A 5L7WA 3D4OA 3I6IA 2ZB7A 4TRRA 2EEZA 1YB4A 5I7VA 2BHLA 3ZU5A 1HDXA 3CIFA 1GUYA 4UULA 3UCFA 4K9DA 1P0FA 3ZWMA 1HSOA 3FNGA 1BMDA 2B36A 1XQ1A 3PDUA 2LDXA 1KVUA 1U28A 2D0IA 2E48A 4KZPA 4NR0A 3GC6A 2OZPA 1NAHA 2EXXA 4E33A 4HFMA 3K73O 1WPQA 2IEDA 2HSDA 3PVZA 3ZV5A 5TJ9A 2HUNA 4DTIA 2EJVA 5I9NA 4IY1A 1N1EA 3OJ0A 4F46A 3KEOA 4Y6RA 3HNPA 1ZXLA 3H5RA 4I5DA 3LU1A 4GL4A 1ZK3A 2EKQA 1ULSA 2DBZA 1CQIA 4M1QA 3PIDA 4E32A 4TROA 2R2GA 4BNYA 5J23A 2UVDA 1FK8A 1FMCA 3C1TA 5CDTA 5I8WA 4WOJA 1WNTA 4KUEA 4DXHA 3U9LA 1KVQA 3JD0A 3KZVA 4J43A 2B5WA 1NVTA 1I5RA 1QV6A 1NFRA 2VZ8A 4GWKA 3EYWA 4LW8A 3ZWPA 3BZUA 4EJ0A 4Z3DA 1GR0A 1DIRA 1R16A 5DCYA 2EF1A 4B8ZA 2P4HX 4B3IA 2AQHA 3RUDA 1K0UA 1KY4A 2XAAA 3ADPA 2GDZA 1BTOA 1U3TA 3IQDB 4OQZA 2WJPA 1B7GO 5EQDA 1Y8QB 3WR5A 3GZ4A 2VHWA 4JBIA 2AHRA 2HK7A 3KYDB 4WE3A 3WYBA 2W8ZA 4U6SA 1BWSA 1HE2A 1ZUD1 3GH3A 2BI7A 1ZJZA 1TA4A 1EE9A 2ZYGA 4GVXA 3HB4X 2CDCA 4GX2A 3GG2A 2AMFA 5AXBA 3HUDA 1Y8RA 3PFFA 4CQMD 3PYXA 4CR6A 1P1FA 3ZNQA 3OEWA 4S3MA 4DWVA 5JO9A 3WBBA 4FFLA 1YL7A 1CEQA 3MTJA 1ISHA 1ZSYA 5GZ1A 2VNSA 2PKQP 2Y99A 1V3VA 1GV1A 4WGGA 3OFSA 3W8FA 1P31A 1YQDA 1DC3A 1ISMA 1YE3A 3O4RA 3MJEA 3QWBA 1CQJA 4GI2A 1MXFA 2Y1CA 3ONFA 3DOOA 5IG2A 3OJLA 4ALIA 3GNSA 2O2SA 3DZKA 1U4OA 2I67A 3UAGA 3ZNPA 1MC4A 4DQVA 4YT4A 1WMAA 1KETA 3TQHA 4R51A 3MWEB 2BRUA 2VHVA 4BOYA 4JCOA 3Q9UA 2EGGA 3DMTA 2GYYA 5U4QA 3PQFA 1D4FA 1HL3A 5DT9A 3F4BA 4FC6A 5GY7A 3JD4A 2QX7A 1I3LA 4PLZA 2Y67A 4WLOA 3WQRA 1GCUA 4NFHA 3VOSA 5L7YA 3FD8A 4GKVA 4IGFA 3UXYA 1KIFA 2O2YA 1QXSA 1WXDA 3DB2A 3VZSA 5CDSA 1RM5A 4Z9YA 2Y1DA 3R3JA 5G2OA 2NVUA 2B4TO 3IKVA 2GUGA 2G17A 1V3UA 1ID1A 3GHHA 4Q3EA 4FS3A 2BGMA 4MIOA 4D7AA 1GFSA 1W0CA 4GAEA 5ER6A 3MEQA 3E6AA 3ITDA 3ICCA 2V6GA 3KM0A 5KJEA 4U7WA 2ZB3A 4PCVA 2YV1A 4YVFA 4XQEA 2NQTA 2VUUA 3GRKA 2B83A 3WLFA 1E7MA 1GEGA 1BHSA 1I8TA 3TL2A 2WD7A 1ZMOA 1GDHA 2YFQA 1TT7A 1YB1A 2DPGA 1SBYA 5AOVA 5F5LA 2F00A 2X6TA 1CWUA 2OBNA 3ZCXA 2W2KB 5C37A 2GN9A 4RL6A 2W90A 2ZQYA 4FB5A 1T1RA 4YWJA 5IJZA 3BMCA 2C7VA 3MZ0A 1VSUA 2AQKA 4IDGA 5DNAA 2AQIA 2VZ9A 5DN9A 3OHSX 5G0SA 1IYZA 2EG9A 1FJHA 2PTGA 2NNLD 5DDIP 1K89A 1HRDA 4XYLA 5L4LA 1VRWA 2YQ4A 4MP8A 5I7SA 1NPTO 2W98A 3RQSA 3S55A 3CTMA 3U3XA 1ZNQO 2C59A 2EKPA 4UAGA 3NAQA 1U7HA 5ICMA 5TSDA 2RH4A 4XDZA 2FRDA 3WGOA 1RM3A 3M1AA 1MV8A 3BMOB 4DGSA 2J5QA 4BNNA 2C20A 4TKMA 4L4RA 3AW9A 4J1QA 1PWZA 4GH5A 1HF3A 1YVEI 3DHEA 1U1IA 1ZFNA 1VJ0A 4R5HA 3FNEA 2Y0EA 1LU9A 2J3HA 2I66A 3MOGA 4HWKA 3B1JA 3HFSA 4CMEC 4D0RA 7ADHA 1PJQA 4Q3NA 4CV1A 1DFHA 2Z95A 3MCVA 2OP0A 4R9RA 5FI5A 3RUIA 1HYEA 2DVMA 4IDCA 1ENPA 4YA6A 3Q3CA 1GU7A 4BO5A 1PR3A 4B79A 4IS2A 1NYTA 2JHFA 2GN6A 3OIGA 2IEBA 4BNGA 9LDTA 4XCVA 3TZCA 4XYGA 3WGGA 1MC5A 2PD6A 4W6ZA 3D5TA 1C1DA 1LJ8A 1P77A 2CVZA 4OAQA 4DMLA 2H5LA 2VWQA 5JCJA 3IDSA 4UVDA 4A27A 1WDKA 2D8AA 2E6UX 1T24A 5B12A 4GVLA 4J7CA 3JQ6A 3BMNB 3TJRA 1C14A 2X23A 4J9UE 1U3VA 3VAZA 4IJWA 1YJQA 2O3QA 3QWIA 5BSEA 1TEHA 2WDZA 4CUKA 4E0BA 4RF2A 5AXAA 5EQFA 3F1LA 4JJIA 4XKJA 1EUDA 2C2XA 1DC5A 3S2EA 4J91A 4BO9A 3E1KA 1Y1PA 1X1TA 3DZGA 4H16A 1GZ4A 1R0KA 5B37A 2GLXA 3DHNA 4MO2A 4BGUA 1DJNA 1EBUA 4HFJA 3WICA 3I3OA 2HJRA 4QT0A 3ETEA 4NFSA 3ZHYA 1Y9EA 1LDYA 4M89A 1P0CA 1MB4A 1WDLA 4E4YA 1PEDA 1AE1A 3DXFA 4KQWA 4ZRNA 3CEAA 1KEVA 4ITUA 1R4MA 1W8DA 2GRAA 4AJ1A 4BMNA 4DREA 1CRWG 4OQYA 2O7QA 1D8AA 4I1IA 4CMIA 4CV0A 2IZ0A 3TPCA 4BKOA 3JYPA 2X0NA 5I7EA 4B3JA 2X4GA 3UOGA 3B20A 4YDRA 4K28A 4O6VA 3UICA 4OXKA 5HBRA 1BW9B 3ABIA 2CF5A 3HHPA 3ONDA 2G5CA 2BKAA 3AU8A 3GK3A 4P4LA 4KUGA 4FOSA 4CQMA 2JAPA 2GZ3A 1M66A 1A72A 4HP8A 5G4LA 4R9SA 4MDHA 4DPMA 2FSVA 2HO5A 3E82A 3G1TA 3LT2A 2HMVA 2PY6A 3TZQA 5T6BA 3H6KA 3H9UA 3WIEA 2CVQA 4ALKA 1XEAA 3WJ7A 1BXZA 3KUXA 3OQ6A 1GD1O 1SAYA 2WYWA 4A26A 3DMTC 3PWZA 4MVJI 1U7TA 4KUHA 4YAKA 3U09A 1A9ZA 1MUUA 3WG9A 4DVJA 5KOIA 3JQCA 3GA0A 3RUHA 4DBZA 1ONNA 1Y5MA 4J1SA 4NNJA 2NVWA 4HFRA 3LT0A 4OKIA 3PGXA 1H9BA 4QXMA 4TVBA 4BNTA 3I52A 4LRSB 4RVFA 1SEVA 5IAAA 1CJCA 2HCTA 4TMFA 4YB8A 4BNHA 4HKTA 2WE8A 5ILGA 4BQPA 1PZFA 3WXBA 1VJ1A 2YJZA 3R0IA 4FJ0A 1Z45A 1Y9AA 3NX4A 4JK3A 4WLFA 4BIIA 1DC4A 1R4NA 1CETA 3DZHA 3VH3A 2XXJA 3GRPA 4QX6A 3WFJA 4JBHA 3E03A 3PQEA 3A4VA 1JQBA 4FCCA 1B3BA 5CHEA 3PXXA 1BXGA 1A27A 2JFFA 5JNLA 4EW6A 4Z3KA 3K92A 2OOSA 5JC1A 4ND1A 3VKUA 1HEUA 3FTPA 4FJ2A 2ZKLA 4RJTA 1H94A 4EDFA 4NZ9A 9LDBA 4RF4A 1DHTA 2HRBA 2X9GA 4MVJE 4FR5A 4ZQGA 3D4NA 3ZHZA 3B1KA 2Y68A 2PZMA 4O0LA 3E48A 3HDHA 3JQ9C 2UUPA 4B8WA 1QG6A 1YO6A 2HDHA 1JN0A 3OJOA 2Z1NA 3LDHA 4GX5A 3JQAA 3WYEA 1EEHA 3TRIA 3MOIA 5KVSA 2YHUA 2H1SA 4BS9A 2IXAA 5JMPA 3P7MA 4D43A 4A5OA 3NYWA 1XU9A 2X5OA 1H0KA 2WTBA 4DQUA 3KBOA 3HJAA 3HG7A 3H2SA 5EPOA 1YH3A 1QSGA 2DTEA 4BNFA 4KTTE 5EMHA 1ZO8A 4A10A 4MJLA 1GEEA 1P1IA 4YJHB 4DIOA 3IJRA 1HE4A 4G2NA 5EL0A 1NVMB 1PWXA 1ONPA 1VKOA 2UV8A 3RJ5A 1G6KA 4IUYA 3S1LA 1TXGA 2FR8A 3DAFA 2WYVA 1YL6A 2NU7A 2Y93A 3WNVA 2IRWA 5A9RA 2DFDA 1P44A 2CF6A 1AHIA 3INTA 4BO2A 5FEUA 4Q39A 3TZ6A 4IDFA 4E2YA 1NP3A 1T2DA 1QLHA 3NGLA 1SPXA 1NWCA 5F21A 1H5QA 1DDOA 4E2ZA 2O50A 4OYRA 1M76A 4FIZA 3VC7A 1BDBA 3JYNA 2ZJ1A 1GYRA 2CDAA 4WLEA 1GQ2A 2VRCD 3H2ZA 4G5HA 4PRLA 4E12A 2I99A 4NU5A 4BNMA 2YYYA 1PJ3A 2JCYA 2FMUA 3GPDG 4LSMA 1Y6JA 4QFCA 2Q1WA 3PGJA 3VHRA 4J16A 4H3VA 1E7WA 1VC2A 2GO1A 1DRVA 1B14A 1NQOA 4RVGA 3H9JA 1QMGA 1DAOA 3UW3A 1V6AA 4NI5A 4IZHA 3NT2A 4L75A 4Z0HO 2G76A 4S1VA 3AM5A 1M6WA 1R6DA 1WZEA 1ULUA 3GLQA 1M67A 3DBRB 1K6XA 3N58A 3ORFA 3FSRA 3ZI0A 2ZIZA 1L1FA 5L7TA 1MP0A 4BNZA 3VTZA 5JSFA 2IDZA 3OSUA 5HWSA 4U8GA 3L6OO 3I9OA 1N5DA 2A35A 1IUKA 1E6EA 4BO4A 2X0JA 3DDNA 4PFJA 4WUVA 1WZIA 3GMDA 3GVPA 4FPXA 2EP7A 5ITVA 1LI4A 3GVIA 2EP5A 1JDJA 2FZWA 5C7LO 3I9KA 2AEFA 1Z7EA 3F47A 3UKOA 3X2FA 1NQ5A 3PWSA 4GQAA 3LLVA 2DLDA 3VTFA 1NQTA 1Y7TA 4GPD1 4YJGA 2XF8A 1RWBA 3HDJA 2CD9A 5DF1A 2AA3A 1SOWA 3EUWA 3AU9A 1UP4A 1O0SA 1B8VA 3AUAA 3DAGA 3A1NA 4AJJA 3GN2A 4WLUA 3WGQA 4E2XA 3A9WA 1LC3A 3FPLA 3GFBA 4CLDA 5C3MA 4HV4A 2X9VA 2SCUA 3NJ8A 1EVZA 5FYDA 4EYEA 2OO5A 4XJSA 3WMXA 3D64A 3IJPA 4FFRA 4UEKA 2V6MA 3TL3A 1SB9A 1JAXA 1UJMA 1N9GB 1LUAA 5CP8A 3HN2A 4PG5A 1N1GA 2Q1SA 4W9NA 1Z7BA 1B15A 1C3VA 4E31A 1DIGA 4CLRA 1BG6A 3WTBA 4PIVA 1DO8A 3QP9A 1E3IA 3O26A 4AL4A 5JFOA 3ST7A 3NV9A 1P33A 2DFVA 2I65A 3QVXA 3JQ7B 4OM8A 5L53A 5IXSA 3V2HA 1A4UA 4RVDA 3DBVO 3AJRA 4HX5A 5ENVA 2VOJA 1M75A 2QZZA 1T25A 1KBZA 1YL5A 3H9QA 1D1SA 4MVJM 4BO3A 4LMRA 2BGLA 2D4AA 3LSYA 1HDZA 5JAQA 4ZQEA 5CG1A 4BNIA 3JQFA 3UCXA 3ZHBA 4XGIA 4MVJH 2O7SA 3FBTA 3WWYA 5A3JA 3ZDFA 4WNCA 2OBYA 4FC7A 1ZSNA 4RPHA 1ZK1A 4BO8A 3QW2A 4KMSA 1OC2A 4PLWA 3TNLA 2FOIA 1R37A 2UYYA 2OUIA 1E92A 3GOHA 4CLOA 2WD8A 5BSHA 3PIIA 4BGEA 2O3RA 4ND5A 3ROQA 4F3YA 1Q0HA 5T8KA 4FGWA 1LLUA 1XDWA 2D3TA 4PG8A 2GPTA 4KTVE 1YBAA 5DP2A 5JBIA 2RBEA 4MOWA 4D3DA 3QV1A 1ZVMA 1I30A 3ZN2A 3JV7A 4KP7A 2LDBA 4PLGA 4J0FA 4GSLA 3WTCA 4DMMA 5ENDA 3AK4A 2ILTA 3OQ1A 4GKBA 4NBRA 4PLCA 2C5AA 2CZCA 2Q2WA 4YEDA 5A9SB 5L51A 2VOEA 5IDYA 3VH4A 1LSJA 4PRKA 3BHMA 1LTHR 5TS3A 4R1TA 3L9WA 3DZBA 1I10A 4PLTA 2Q46A 4PG4A 5ER9A 3KB6A 4YAGA 5IF3A 4J2HA 3F46A 5TT1A 3I9NA 4Y98A 3JQGA 5JW6A 2AE2A 4WLVA 3ZW9A 4OHUA 4CMEA 2E82A 1ISJA 1MLDA 4J4TA 3NT5A 3O03A 3ON5A 3VPHA 3TWOA 1KERA 2JCVA 2DBQA 2NUAA 4YJFA 3SEFA 4WNIA 5LDHA 4ND4A 4ZD6A 1DPGA 3ZH2A 2VWPA 2O4UX 4PZEA 4EBFA 3JSAA 1PR9A 1U2DA 1VPDA 3CE6A 4MKRA 3BIOA 3OJEA 2C7GA 4A2CA 3KSDO 2Q3EA 1O94A 3K6JA 4NBVA 1XLTA 3JCZA 3VPGA 3D0OA 4I5EA 3BMQA 3ZZNA 3OP4A 5EN4A 3WWZA 3OMLA 2HMUA 2UUOA 1X15A 3GT0A 3KLPX 3LT4A 1GZ6A 3PPIA 4MVJF 3RBVA 3AWDA 4R68A 3NT4A 3WGZA 2A94A 3PYLA 2PA3A 1M2WA 2PKRA 4J2OA 3VH1A 1SMKA 3KSUA 4W7HA 4YXFA 2I9PA 3BMCB 2WEKA 4IMRA 1LDMA 5GZ6A 4TKLA 2PWZA 3DTTA 1U3UA 1JKFA 1XCBA 1ZK2A 6LDHA 5JAMA 1TVEA 1BGVA 4DIFA 3Q0EA 1B16A 1BVUA 1R66A 2R6JA 3K8ZA 3PRJA 1V9LA 4M87A 4AJOA 1GV0A 2X7HA 4CL3A 3EVTA 3GUCA 5F1OA 3WX0A 5KJFA 5BT9A 1AUPA 2YDXA 3IP3A 4O59O 5BNTA 2VRCA 4E13A 2PGLA 2P5YA 3UN1A 1D1TA 1UAYA 2X5JO 2YHIA 2A9FA 2ZJ0A 3T7EA 2NSDA 4Z9FA 5ILOA 1T2EA 3ICPA 4CM7A 4AJ4A 1E7QA 3AI3A 2W2LD 4Q3AA 5H81A 4AJIA 5JMWA 3FBGA 1LC0A 4G81A 4YQYA 2CVOA 2DM6A 4ND3A 1OI7A 3QSGA 1NX6A 5A03A 5JS6A 5HA5A 1C0IA 4IZIA 3L6EA 2J5RA 2D5AA 2HLPA 3JQ8B 2PV7A 4NQZA 4YT2A 2A4KA 1GUFA 2WSBA 1SEPA 3INRA 5K0ZA 5KJ1A 1C1DB 1GZ3A 4DLBA 3TFQA 4IJVA 4W82A 4YRBA 4NIMA 3GGOA 4IMPA 1FDSA 4CQLB 1CIVA 3TOZA 1E5QA 1FXSA 2YV3A 3KETA 4CMGA 4CUJA 3DBHB 2WM3A 2H6EA 1PGPA 3U49A 2Z1MA 5MGBA 1LEHA 4M54A 1VL8A 3DAPA 3RCBA 3N74A 4J6FA 4Z6KA 1U5AA 4LMPA 2G0TA 3CKYA 2HMWA 5DOZA 3GZNA 1D7OA 2J6IA 1I0ZA 2VHXA 4R1UA 3OM9A 3BTVA 1PL8A 2RIRA 4INAA 3ZWXA 2E4AA 3PHIA 3W8EA 4CM8B 1JW9B 1D3AA 5FI3A 2I76A 4OOFA 4YT8A 1E6WA 4J49A 2CY0A 3G3EA 2B5VA 1JWAB 1VE9A 1XIVA 3EW7A 1ZW1A 1I24A 3K2BA 4W9NC 2ZTLA 2WWRA 3F1KA 5JE8A 4CM3A 3IOYA 5DP1A 1RYDA 1IZ9A 1Q7BA 1R12A 1R4MB 3ENKA 3ZV3A 2HJSA 1N2SA 2QW8A 4DLAA 3T4EA 3W8DA 3ZNNA 2GSDA 4JJGA 2ZCUA 4BHTA 4MKZA 5C7IO 5JAZA 1WP4A 4IINA 1QYCA 1NTOA 4IQGA 4J9VA 3NRCA 4WCFC 4J0EA 5A02A 2PNFA 3SJ7A 3NDJA 4PG6A 3JQ9A 1YB5A 3CUKA 5G0TA 1H6BA 1L7EA 3B1FA 1UDAA 4DC1A 1T2FA 2GN4A 3JQFC 2NU9A 1Q7CA 4X54A 4ESOA 4CPDA 1EUZA 2GGSA 3AUUA 2DBVO 1I3NA 4TWRA 2PD4A 1EUCA 2X5KO 3FTNA 1YKFA 4NMHA 6ADHA 3HE3A 5T8KC 4DYVA 3UFXA 2GASA 4JLWA 4R41A 4IQ8A 5JDIA 5L4SA 3RC7A 5A9TA 1PIWA 2Y0CA 3FNFA 4YTEA 3C7AA 2IXBA 3ANNA 3K2EA 5U1PA 3WOHA 2DBRA 1DIAA 1PGOA 4IS3A 5A06A 1NFQA 4UVIA 2Y1FA 3PHJA 3EHEA 1YQXA 2AXQA 2NV6A 3I1JA 1C1XA 5CFZA 1PZGA 1XGKA 1ZCJA 3E5MA 4R69A 2GF2A 3QWFA 3AM3A 3L0DA 3VDQA 1P1RA 3KLMX 3ADOA 1HETA 1O89A 2IZZA 1WAMA 2QZ9A 4KQXA 1T2CA 5T67A 1E1NA 4U0KA 8LDHA 3U0BA 4GX1A 4ALNA 4NK4A 1UUFA 1Y8QA 3TFOA 1KEUA 1XU7A 2PH3A 4J4BA 1YWGO 3BTSA 3KYDA 3DZJA 5KJCA 1FDTA 1TT5A 3DZIA 3X2EA 4C4OA 4CMJA 1OZAA 3OA0A 4LSWA 4DRYA 1V8BA 4DPLA 2VT2A 3T4XA 4ZN6A 4O5OA 4RV9A 3H5AA 4R5MA 4XR9A 3IUSA 5G0WA 3DQPA 2X58A 4MKXA 5FWNA 3RFTA 1EFKA 3RWBA 2PLAA 2GCGA 3PTZA 4BL5A 4CM1A 1UXHA 4QTZA 1B8UA 4M55A 3TN7A 3C7DB 3ENNA 1E5LA 1ZMTA 1QP8A 2AE1A 3HDQA 3DBLA 3JQAB 4IIUA 3GFGA 1QYDA 4P38A 1ENOA 2IE0A 5TLSA 1LLQA 1ZIDA 3Q11A 2EGHA 2RCYA 3ZU3A 3M1LA 1HWYA 3C24A 5JC8A 2QRJA 1JU9A 3GGPA 2OHXA 1K2WA 4U0JA 4BNJA 4A0SA 4BGIA 2DKNA 4XQCA 3ZWYA 5KVVA 4OSPA 3DL2A 4B4OA 2JAHA 3MJVA 1GL3A 1HDYA 3KTDA 4NG5A 2C54A 1E7YA 2VYND 1QKIA 3AI2A 1LA2A 1WMBA 1S7CA 3BTOA 1N7GA 1DRUA 2ZYAA 4IQ0A 1R0LA 1IHYA 1ZKMA 2BH9A 2YDYA 3R3SA 4AVYA 4CM9D 2Y1GA 1LQUA 2QYSA 1E3JA 4OH1A 4II3A 2TMDA 3BTUA 3PQDA 2NU8A 3GNTA 3F5SA 3P2YA 2B35A 3PHHA 3U62A 4ZQBA 1HLDA 3KEQA 1VJTA 3I5MA 3WIDA 5EINA 2X0IA 5TJHA 3C1AA 1XQ6A 1E3WA 3A06A 2EJWA 4I9UA 1ONOA 4F6LA 2YY7A 2W2LA 3D3WB 4JIGA 3ZW8A 3OH8A 4XD2A 4OIMA 4GLLA 1WW8A 1H6AA 1T4BA 5TC4A 1PL6A 2FPGA 2FR0A 2Q1UA 2BGKA 4NH4A 5C5IA 5L40A 2P91A 3SC4A 3OICA 4XRRA 3SXPA 3JD1A 2C29D 1EBFA 1ARZA 1PSDA 1LLDA 4CM6A 2JJYA 2FP4A 2JD2A 1EMDA 5JY1A 3QQPA 1EDZA 4TRMA 2JL1A 2HAEA 1VKNA 3AY7A 3ZWOA 4Y67A 1PS0A 2C5EA 3L77A 4LRTB 4EGFA 2NTVA 3EZLA 4I8XA 5L9AA 1EDOA 1PGQA 2QG4A 4PZDA 4QECA 2DUUA 3VVBA 5JYEA 4D44A 2BFOA 4Z0PA 4PLYA 2FR1A 3UHAA 3O38A 1SOVA 4QO7A 3JD2A 1IY8A 2IZ1A 2GN8A 3R6DA 3ASUA 3SX2A 2EW8A 4GWGA 2RHRA 2J8ZA 1EZ4A 4XZ3A 4L76A 3GAZA 3V5NA 4E6PA 3EVNA 5TQVA 2NTJA 3EGOA 3RUCA 2EHDA 4LK3A 4QFDA 1NBOA 1ADGA 1NVGA 2J5KA 4RVUA 4CUZA 4BNXA 1T26A 4WEOA 3O8QB 1JVBA 2RH8A 1I2ZA 4XQ9A 2VYVD 4QO8A 4RPKA 4E30A 2Q49A 5C7OO 4CMAA 1JKIA 1HXHA 4LN1A 3WQQA 3H5NA 3SJUA 4QUKA 4YT5A 3LVFO 3ZHXA 4RQTA 2NM0A 1DFGA 1I33A 3D1LA 1TB4A 3DC2A 4EJMA 4IIVA 1PZHA 5H83A 2VQ3A 5KTKA 3S2IA 4RPGA 3SLGA 2PKQO 3JD3A 4R54A 3FR8A 4DC0A 4OXYA 4XX0A 3B6ZA 4N5NA 1E1LA 4E5YA 3K96A 3BMNA 2VWGA 2POQX 2VZ0A 4KWHA 4YAEA 5K6AA 5TF4A 3RC1A 4N7RA 5JDIC 4R1SA 3GAFA 3H3JA 4D41A 4CLRB 2PD3A 1GUZA 1JAYA 2VNAA 3ETGA 4YYZA 2HKIA 2ZTMA 4FJ1A 2D5CA 2O3UA 4URFA 1JKJA 1PJ4A 3I9LA 2VTDA 3V8BA 1KVRA 2VCYA 5EESA 1YBVA 4L9RA 3PHGA 3OJFA 4FW8A 4GGPA 4HBGA 1XSEA 1Z73A 2GERA 5A4DA 1K3TA 4CL8A 3JYQA 1FDVA 3PFWO 1V3TA 4L74A 3CSDA 1LLCA 3MJCA 2Q1TA 4FN4A 3EMKA 1NQAO 1UR5A 3NUGA 4K26A 4NJMB 1K6JA 3RUEA 4XYMA 4ROSA 3NDRA 3NJ4A 2NVBA 3MJSA 4PGFA 5L3ZA 1A7KA 3GDGA 4Q3BA 1HTBA 4E5PA 5THQA 3C7CB 4Y6PA 5L95A 2VT3A 4TRNA 3G0OA 3IMFA 3JQEA 2PGJA 1K6IA 3OEYA 4J1NA 1BVRA 1J5PA 3LC7O 3QA9A 3ZU2A 2IYOA 1UZMA 5I8ZA 3FCOA 2Q4EA 1BW9A 3GDOA 4ZQFA 4BO7A 3H9EO 1SB8A 4BNWA 3HN7A 2R00A 4KDFA 3GQVA 3BXXA 1FDWA 1O8CA 3W4KA 4UUMA 4CLHA 3PYMA 5JCXA 3RD5A 4R3NA 1YJ8A 4PLPA 3WQSB 4FSHA 1ZEJA 1G1AA 4ALLA 4CMBA 5JYDA 4L4XA 3JQGB 3OIDA 1H6DA 5TRTA 1PS8A 3V1UA 1DLJA 4BUCA 4K6FA 3GHYA 3HB5X 1HYHA 1P9LA 3GVCA 1X0VA 3WMWA 1DXYA 2BFAA 2QYTA 4LVUA 3C3XA 4OOEA 3RC9A 2DC1A 4Y9DA 1E77A 4XRGA 4HNGA 1UZNA 1VSVA 4NBWA 4R16A 5AQ1A 1HDRA 3F6YA 4MINA 1BDMA 4U6QA 3AOGA 5F5NA 2C07A 4NBUA 3QVTA 4D45A 2I3AA 3ONEA 4Z0TA 1T4DA 1ZJYA 4I9NA 4WOKA 5DBFA 3VZRA 1HE5A 3DMYA 4J4HA 4RDIA 1QV7A 2JKVA 4MIEA 2I6TA 4JP3A 5IN5A 4CM4A 3KRTA 4DQXA 2EKLA 4L4SA 1G0OA 3Q6IA 1H2HA 3W1VA 2EW2A 3CPSA 2J3JA 4RORA 3UCEA 4CM9A 1DC6A 5IZCC 1V0JA 3JYLA 3ZWWA 3OECA 4F45A 1E1MA 1R0SA 3M2TA 1JLLA 1E3EA 2NTNA 3OETA 3UH1A 1WLYA 2C2YA 5JDCC 5AXDA 1GYQA 3I83A 2P4QA 4AG3A 1DBVO 4PVCA 3CH6A 1Q2XA 3CXRA 4NU6A 4GMFA 3CMCO 3GEGA 3JQDA 1PJBA 5A3VA 3OIFA 2QIOA 1H93A 4KWIA 4W7IA 4WECA 4IJKA 3I9MA 3N7UA 2O48X 1OAAA 4OGWA 4TQGA 5JPIA 3WNQA 1YBMA 2UDPA 5TGDA 3RKUA 2OL4A 3L4BC 3KYCA 2Y1OA 3JTMA 3LK7A 4XIJA 1Y8RB 3UGKA 4AICA 4JGBA 2NQ8A 1HT0A 1P3DA 2Y0DA 2Q50A 4WCFA 4B3HA 4BO1A 4E3ZA 2H9IA 1R15A 3QWAA 3LZ6A 4R01A 5BNIA 3F5QA 5TNXA 5CEFA 1HZZA 2AEJA 1Q1NA 5ADHA 1RM0A 5B1YA 3AUTA 1B2LA 3I4CA 4LISA 1X14A 1X0XA 4YJHA 5IXYA 5IDXA 2B69A 4WEQA 2FZEA 2ZK7A 5CPFA 2VHZA 4BB5A 4ND2A 2O23A 2HK8A 2BD0A 2OORA 5DCUA 4RLSA 1UP6A 5A1TA 1UDBA 3LC2O 4RVSA 5H82A 4DBVO 3C8MA 5G4KA 5JO0A 3HQ4O 3BA1A 1DJQA 1I3KA 3E9NA 1BRMA 1J6UA 3LF1A 4JJFA 4LVCA 1P1KA 4H15A 4RF3A 1ISIA 3WBFA 4BVAA 1U8FO 2DQ4A 1NWHA 1N92A 1P74A 2B0JA 1C0PA 1H6CA 1PZEA 2CDBA 2JD1A 3GPIA 3Q9NA 5CDUA 1IULA 2NADA 4YAIA 1DIHA 3MWDB 3VPSA 4TZTA 5K9ZA 3GZNB 3C85A 1ISFA 1QORA 4RVHA 3LF2A 2YQ5A 3CZMA 1H9AA 3H8VA 3ZWVA 1DSSG 4NBTA 4O63O 3AY6A 2NVUB 4IJUA 3VPFA 2XPCA 5K6AC 3F4LA 1PL7A 2NU6A 3WFIA 1OMOA 3K31A 3EAGA 3TZKA 2B37A 4RPJA 4MVJD 1HE3A 3DBRA 4E2WA 3JQBA 5KVCA 4YQZA 3W6ZA 3ZGYA 4FDAA 4C7KA 4GGOA 4L8VA 3TDKA 2GZ1A 4AJEA 2WD7B 1XHLA 3PI7A 4CV2A 4BO0A 3FF4A 3ETDA 5JCJD 4YAJA 1KC3A 4UREA 5A5FA 5GZ3A 4EEZA 4RDHA 3RUFA 3RKRA 4DLLA 4OL9A 1CERA 3DHYA 2O3JA 2Y1EA 3T7CA 1NNUA 4TZKA 4W4TA 1E7SA 5AXCA 3V1YA 1N7HA 3S2FA 2YW9A 2X8LA 1UXGA 2ZTUA 3IIEA 3GY0A 3UF0A 1L7DA 5KWEA 2IODA 5KKCA 1NXQA 2UAGA 4CODB 1KVSA 4CV3A 1NPDA 4A73A 3WGIA 3RAJA 4P4GA 1NM5A 1Q0LA 2V6BA 3O9ZA 3RBZA 3PHLA 4UVGA 3U4IA 1CF2O 2DUWA 4BNUA 2XOXA 1LDGA 5BNFA 4EI2A 1C1XB 3I6QA 2R00C 4JXKA 2YUTA 1IB6A 1U3WA 2QRLA 3TOXA 1DEHA 3W4JA 1MA0A 4Q3DA 2HMTA 1DB3A 1O95A 2EWMA 4P22A 1E1KA 1AXEA 3V2GA 1C0LA 7MDHA 4JROA 3W6UA 5CDYA 1IE3A 3RI3A 3RUAA 1N9GA 3TSCA 4FQ8A 3VDRA 2P2SA 3BHIA 4B4WA 4BO6A 3LLSA 4M49A 5EJ2A 3GF4A 1Q0QA 2BMAA 2O3TA 4PLHA 4F6CA 3D7LA 3V2UA 2VRBA 2DTXA 2X22A 1TT5B 1GQYA 2JFHA 2VUSA 3KHUA 1Y81A 4XA8A 1XELA 3WGTA 3JQ7A 5CEJA 2QHXA 1I36A 1PJCA 3IAHA 4YBZA 1DRWA 2GNAA 5BR7A 4P8RA 5GMOA 4PG7A 3G17A 4D42A 5FFFA 4BMSA 5DBIA 5TX7A 1MGOA 1JA9A 4WJZA 2PH5A 1KVTA 2AQ8A 1X13A 1B3RA 2X1HA 2ZTVA 5HS6A 5L4NA 1A5ZA 4BQRA 3LYLA 3NGXA 1YS4A 4FD3A 4YJDA 4FBGA 4BB6A 2FWMX 2BFPA 3B70A 1LRJA 3HADA 4ILKA 4EUHA 1AXGA 4WCDA 4AJLA 2DT5A 3DBLB 3STHA 2V65A 5BQFA 4MP6A 1I32A 3RIHA 3H3FA 1ZEMA 4XB1A 2DU8A 5TIIA 2HK9A 4AJ2A 3DFZA 2E49A 1F14A 3ANMA 1F0YA 1HKUA 1RKXA 3AI1A 4DIBA 1QLJA 3K9QO 4UVHA 4EITA 1YOVA 1ZK4A 1NFFA 1W73A 1ENZA 2F1KA 4UUOA 4XYBA 4D3FA 4P4NA 3QY9A 5DULA 5A5EA 2QQ5A 2O4CA 3FHLA 4PLFA 1DFIA 1GQQA 1PS9A 4EJ6A 4OSOA 4BKQA 2DPHA 2PZKA 5A9SA 1ZSVA 1YONA 4BKUA 1PJSA 1EVIA 4CMKA 3EY4A 4YCAA 1PX0A 4TRJA 4B7UA 3AY3A 3KV3O 4G65A 3PJFA 4AFNA 4CMIB 1SC6A 2C0CA 3BHJA 3PP8A 2Z5LA 2Q99A 3GVXA 3PDJA 2ZB8A 3QLJA 1RJWA 2FPIA 2EERA 3IKTA 2AEMA 2JFGA 1EE2A 4UEOA 5KKAA 1HDGO 1U5CA 4I9HA 3COSA 4MVJG 1NAIA 1DIBA 5HS4A 3OF2A 3P2OA 3RU7A 1E3WB 5KJ6A 4YPOA 1Z74A 1MX3A 3VH2A 1WWKA 2P9GA 1LDBA 4CQMB 2VN8A 5B4UA 1DLIA 1LX6A 2FY8A 4WLNA 5CPBA 3JQAD 3PJEA 4QEDA 1BXKA 1MXHA 1B26A 3L9XA 4JP2A 2EV9A 2P9CA 4YACA 4B4UA 1GPDG 4EUFA 1A4IA 2JCXA 3ASVA 4BKRA 2W4QA 1NR7A 4K1LA 3GDFA 4XEHA 3IC5A 1F17A 2XXBA 2HU2A 1LSUA 1GY8A 4H7PA 2P5UA 3NTRA 2Q4BA 4E5NA 1DOHA 3NEPX 1GADO 3SC6A 1E6UA 4DYDA 1I2BA 2PR2A 1OC4A 1ENYA 2BF7A 4Q9NA 4XJTA 1SZJG 2J3KA 1PGNA 5L45A 5JXWA 1FDUA 3EDMA 3ZWCA 8ADHA 2G82A 2HRZA 5LDGA 4QQRA 1DHRA 4YRDA 1H2BA 1XG5A 2VWHA 2A92A 5CAEA 1LSOA 3MJ4A 4EZBA 2P9EA 4RZHA 1R4NB 2HMSA 4N5LA 3LC1O 1W6UA 3BYZA 3WJAA 4BV8A 4HXYA 4YRAA 1UH5A 1BXGB 1IZ0A 1X7GA 5MDHA 1C0KA 3WDSA 5ITWA 3JQBC 4AJHA 1P1JA 1UAGA 4NPCA 5CDGA 3M2PA 3LQFA 2AG8A 3WYCA 3DWFA 3GN1A 3GUYA 3G1UA 4II2A 3AM4A 3IP1A 2DAPA 1VLLA 2BI8A 4M8SA 3KOUA 4TSKA 4MVJA 5IFLA 4JBGA 3L07A 3JQ8A 5AYVA 2C82A 3FI9A 2CMDA 4CR8A 3ZWAA 2DTDA 3WB9A 3K30A 5BSFA 4KDEA 3CMMA 5JLAA 3PWKA 3ZU4A 2BLLA 4JN6B 4D46A 1QRRA 3I9JA 3AOEA 2WYUA 3DEYX 5KNLA 5HTOA 2Q2VA 3IS3A 3WSWA 4CLXA 2Y05A 4CQLA 1AN9A 4ZVVA 1IPEA 4PZCA 3VVCA 3P5SA 1ZH8A 1ZZEA 2ZQZA 4J90A 3E8XA 3DBHA 4E5MA 3E9QA 4TVOA 1LSSA 3ULKA 2VUTA 4BV9A 2Y66A 3RSHA 2NWQA 2X0RA 2YZ7A 1QYXA 3KXDA 3NKLA 4BNLA 3NTOA 1LRLA 3QJ5A 4XQGA 4IM7A 1NASA 2FN7A 2FSSA 1LXCA 4Z9XA 3ROMA 1RPNA 1LNQA 3R1IA 3Q2IA 3IUPA 1QR6A 4OMUA 1QYWA 5CG2A 4ONEA 4A03A 3DONA 4DUPA 1HSZA 3DOJA 3QWHA 4CM8A 2PGDA 1LQTA 1GCOA 3H9GA 1XR3A 2YFHA 3RC2A 1EK6A 3S2GA 3RROA 1YRLA 4BGVA 2AW5A 3PLRA 4WPGA 1ZBQA 1TI7A 3EK2A 5IZCA 3A14A 3EZYA 3FWZA 2PK3A 4Y6SA 4W99A 4D3SA 5JDCA 1VL0A 2ZCVA 4ZICA 5JAIA 1EK5A 2IYPA 2Q45A 1E7RA 1F8GA 4K6CA 4GBJA 1YDWA 1MG0A 1AGNA 5IDWA 1PTJA 3QE3A 2W2KA 1O9BA 2QRKA 3PEFA 1E3LA 4ZGWA 2ET6A 2GZ2A 1IL0A 5LC1A 5IDQA 2HQ1A 1NHWA 4MP3A 4IXWA 3HSKA 1KC1A 2BFMA 3ROKA 1UXJA 2WE7A 3C1OA 3L4BA 3JYOA 5COAA 3WLEA 1Z6ZA 3MJTA 5FF9A 3RASA 1PU2A 4HNHA 3PLNA 2OMEA 1YGYA 4I08A 4MPDA 3GGGA 2H63A 1EQ2A 1AHHA 1X7HA 5T64A 1JVSA 1A71A 3G49A 2J3IA 3P19A 4QSMA 3Q1LA 5JY6A 3OQBA 5HRUA 4UUNA 1S6YA 2B4RO 3G79A 3SVTA 5ES3A 4CJXA 4BNKA 1LDEA 1BSVA 4WKGA 5DBGA 4D79A 4BNVA 3BMOA 4XIYA 4B7XA 1UDCA 3KYBA 3H7AA 2PZJA 1P1HA 2AG5A 1ADFA 1I3MA 4FFNA 3E5RA 4NJOA 4ZA2A 4R3WA 4YJGB 5U9CA
chains in the Genus database with same CATH superfamily
4R8LA 5DN6A 4RZQA 5JCXA 3FNHA 2ONZA 3UEOA 1FZQA 1PNQA 3NHPA 4Q34A 4KG7A 1N2EA 2ODWA 3MGAA 4NZVA 1TTQB 2PZLA 4OHYA 4X6LA 4JYBA 3C16C 4MUFA 3QPDA 2JFNA 3A2LA 3UAWA 2APJA 3E84A 1V43A 1J00A 4U4AA 5FQNA 4C7OA 2UUAE 1O0CA 1IAVA 5LBTA 4HDOB 2BZSA 4DMRA 1NW7A 4L0QA 1QYVA 5LCXA 1XZNA 1RMTA 5DCWA 1OPRA 1E0DA 2I5PO 1JTVA 4E88A 4YUVA 5C18A 5AUPB 4WFTA 1KO1A 3K8YA 4KWCA 5TGTA 5A62A 2XOKD 4ZQHA 4AJKA 5J47A 1KRHA 2CJWB 2O2XA 3F9IA 3GJRA 4ZVUA 4RCVA 4FSDA 4N41A 1HDCA 5FOSA 1K98A 1XJCA 5I7FA 5DZSA 3Q2KA 2PKEA 5EY5B 3R0ZA 5TQ0B 1C2YA 3C4QA 2NN3C 1T1SA 3AFNA 1F5NA 4UHJA 3EIQA 1PUJA 3RT7A 3LT1A 2CNDA 4BCCA 3INGA 4BQSA 1YFZA 4B46A 4C0SA 2ZWAA 5K8TA 3PDHA 4E5KA 1CE8B 5F3WA 2V7GA 5CW2A 2PFGA 3UUWA 2QTAA 2IYTA 2JIOA 3O92A 1Y7IA 1DKRA 1B2RA 1SUEA 2Y6UA 3TGPA 5AM0A 3NDIA 4MGHA 5CGQB 2GBIA 1PLKA 3D6UA 2LBSB 1IIBA 1OKKD 3EXHA 3Q8MA 3EWIA 4QWMA 5E6UA 4QHSA 4TL7A 5LQAA 5COBA 1O8BA 3LG2A 4MUKA 1N0HA 2W6ID 4XWYA 4DVGA 4KOAA 4M1MA 1NVWQ 4EUSA 3TF5A 3Q3GE 3F2VA 4DV3B 4CF3A 4DPKA 3DD1A 5HIIA 3FOCA 4MV6A 2EOFA 1S2GA 3EDRA 4CLOB 1DU4A 5G0UA 4XGNA 4WCVA 4F2DA 3PRKE 2FSHA 1EA5A 1VL6A 1QJCA 4WASA 4JQYA 2I4RA 4QUHA 3ILVA 4P08A 4JX9A 4XB2A 1CKEA 1XYGA 4B3GA 5IDVA 4ALJA 2XI4A 4NCBA 1D1QA 3PC2A 1EGQA 1G3UA 3PZBA 2AUMA 2C4WA 4ND6A 1QCYA 3DMDA 1IZ8A 5F1KA 1DTWB 4AKTA 4CDNA 1NBHA 3IELA 3QBTA 2IYXA 2JAUA 3T94A 4GX0A 3AL0C 2IPXA 4MWGA 4YMTA 2ONYA 3P1JA 4N18A 3M49A 4JGGA 4N5MA 4UDXX 4HGQA 3WMFA 3WIUA 1ZNZA 2FWIA 2Q9BA 4TVSA 1IQRA 2JLBA 2ID4A 1K8ZB 3E22A 5IWAB 3CZ4A 1NVFA 1NRIA 2A1TR 4M1SA 4RMJA 2B0CA 4I5GA 3KXIA 3KO8A 4PWYA 4Q1VA 2OY0A 3Q0IA 3TQRA 3D3WA 4AKSA 4KR0A 5DGIA 5LA6A 2WU4A 2HHHE 3KPWA 3RU9A 5JRZA 3I09A 2O0JA 3BZBA 4QDZA 1EQUA 2UZAA 4N3CA 2GEDA 3HA5A 4HYYA 3RPEA 5AIBA 2HRQA 3OIUA 3B53X 2C98A 4GSKA 4FDVA 2Z83A 1B6RA 1E4VA 3N8NA 4R05A 3NHBA 1ISGA 1LX7A 2PUJA 1RWWA 1RQXA 5EHZA 1EHIA 1T0UA 2CBGA 1EH6A 2F67A 4FFPA 1NBAA 1XXLA 4FYVA 2F8MA 4ID9A 3FX2A 3K94A 3HUTA 1J4AA 1DAPA 1IG3A 3K9HA 1OFIA 3WI7A 621PA 5JUWA 1SUSA 2B99A 4MQEA 1DG1G 1W5EA 3NCHA 1TF5A 4FBMA 1MVNA 3L8GA 3QXHA 4NS1A 3UK3C 1S2NA 3R7DA 1IHXA 4IDEA 3W9BA 2N3HA 4UBJA 3ADGA 2AKYA 2OXTA 4BFCA 5CBKA 3WHLA 1B0PA 1AKYA 5LLTA 4CNBA 3ADDA 1WBDA 5COQA 1BMFA 2ECQA 3FWPA 3G89A 1HG0A 2HT6A 1F2DA 3F7MA 4V0MA 3U13A 3W7AA 3GR6A 3B1ZA 2QD4A 4O2BF 3LQQA 4KC0A 4Y2GA 2OB1A 2QQEA 5EMJA 4MPPA 3RK1A 5A5VA 3PVSA 5ICSA 4LJ7A 2QRZA 4QJ4A 3ITKA 1OBOA 2DCUA 1BBGA 1NXTA 2Z0MA 4YK7A 4R4JA 2Q28A 3DFUA 2F8SA 2GBGA 1WXEA 4ZO6A 5T5QA 1V2HE 2QRUA 4C2TA 1RTKA 1T0BA 2Y4NA 3DO5A 3E18A 1AQNA 4BMCA 3GBPA 2ZBDA 4WIAA 4DV2E 3WS7A 4S24A 1W4AA 1U1FA 1ST2A 3BD9A 4FFBA 1TU4A 3KU1A 4MS1A 4RK7A 1J22A 2PGAA 3GQBB 2PGIA 1J33A 4UCFA 1W44A 1LZKA 2OCGA 3W2TA 1NHGA 5MFZA 4EDHA 3WJ2A 3CJQA 4AI6A 2YWRA 1QWSA 2FTKE 4YX9A 3COWA 1AS0A 1NN3A 2D4HA 3SM9A 3SYLA 1N2GA 2Q9CA 4MYUA 2Q9UA 4TTVA 5IMBA 4D9KA 4J1TA 5DHUA 4K6KA 2Z8YA 1JI0A 1RHKA 2ACEA 2DQKA 2FHSA 2HEIA 1QIFA 2IVZA 3AZPA 5E2BA 1ML3A 3ZQJA 4WK6A 5B4VA 2IC5A 1KQPA 4YJ3A 3KSMA 1JWBB 4EJ2A 4LXYA 1RLUA 3IMKA 3HKEB 1KAEA 2C1ZA 1PG0A 4GLFA 4DY4A 4L5CA 3R3VA 4R0MA 3ZCSA 1E89A 2EU8A 2I2WA 5KVQA 3KSZO 1T3HA 1I80A 1MC1A 2VHUA 3HBMA 4G1VA 4LOIA 5FUWA 4E1BA 1L5QA 2EM0A 1XYYA 2Q2QA 1RCUA 1JIJA 2JFYA 4IX1A 4WY5A 3E7DA 4TKUA 3UJ6A 1JZTA 3G2NA 3FN4A 4XR4A 3BE5A 4U5QA 2V8OA 4BKPA 1SO8A 2GM9A 3ASYA 1GZUA 3L79A 3SLKA 3ZWKA 4FB4A 1BRTA 4ZT5A 3D4BA 4CRWB 2C03A 3GNQA 1W4ZA 4ZFNA 5EIEA 1SHTX 3Q8KA 3EQ7A 5BSRA 4UOZA 3R5FA 1XCJA 2I03A 4DB4A 2EPMX 4AJNA 1Z07A 1UOOA 1D2NA 4ETIA 1WDMA 2EN2A 3V1TC 1SHUX 3ZJVA 2ODBA 3OT4A 2YSPA 5IM5A 5HVNA 3HJRA 2VXCA 4DQ0A 4HY3A 3OUUA 3S44A 4OO3A 1V1RB 3CWCA 3PD7A 2O1WA 3FWNA 2WABA 4L73A 4P36A 2H3EA 3E3MA 3H5IA 3EXIB 1VYTA 2TMGA 4ZVQA 3K9CA 1ZD3A 5A05A 3H1TA 1MG5A 3D02A 1AO3A 3UT0A 1UM9B 2JGKA 2ZSBA 1GRVA 3TTTA 2R8BA 2PX6A 3ADCA 1U90A 5LYJB 1YFHA 1QP4A 2PX0A 4RLHA 4D0SA 1X7WA 4RENA 1CV2A 5BN5A 1VLQA 2OUKA 4QAJA 1GPJA 2VDNB 1CC1S 1PYGA 5B7QA 2ZRDA 3NALA 4XOUA 1TL7C 5EVJA 2VYVA 2V7QD 1UP7A 3OZBA 2HJWA 1D6JA 3VPCA 1X8XA 4G86A 4F38A 1P0IA 3W2IA 4OQ4A 3VKVA 4IPTA 1PX2A 3EC7A 5G0VA 3EVBA 1TTPB 2H4FA 2CHGA 2JGMA 3QHAA 4LNHA 4LNUA 2WWFA 4XJXA 2RGYA 4CLEA 1H22A 2C61A 1QRUA 2FOXA 4M30A 2HNKA 4Q9KA 5LNK1 2ADMA 3CIFA 3PPWA 3QFRA 4HB3A 4B3MB 2IS6A 3EUAA 1X1SA 1Z6QA 5ALNA 1Q6ZA 4EPWA 1D9XA 4EG8A 1SXHA 1OLXB 1FS4A 3VSCA 5TV2A 3ZWMA 1MIOB 1PVDA 2JPDA 3TMYA 4DV7B 3FNGA 4AW9A 1G8FA 1XVUA 3KOYA 2P6UA 1BMDA 2B36A 3LBHA 4MR8A 2E48A 1KVUA 2D0IA 4FDLA 4L8LA 3WYNA 4NR0A 2EYQA 3GC6A 2FV4B 1BXRB 1NAHA 2ODEA 3KKLA 3TI7A 3HNRA 2B7LA 3OF5A 1E9CA 2REOA 1KFBB 4L15A 3WWEA 3LK6A 1WPQA 2HMAA 4PZPA 4TT3D 3G0HA 4ZCLA 1CQXA 3B36A 5TJ9A 1ESEA 1DEOA 5IHXA 3UAZA 4NP6A 1DEAA 1JGTA 1TC2A 2ENAA 1Y80A 2JLXA 4W1PA 5EE9A 3ZD8A 3VV3A 5C51B 5LQCA 4WJLA 3O4IA 3ZK9A 2WKPA 2D7DA 4KO2S 3HEMA 4M1QA 5CLIA 5AKEA 4KMOA 2FWRA 4TROA 4V0ME 3ESAA 2EMBA 5HTKA 2VJMB 4B2YA 1WXFA 1VIMA 5LP1A 2FR8C 2H8GA 3UFXB 3H11A 3ZOKA 1KP9A 1FMCA 3C1TA 3FLAA 3BA6A 1QUEA 1XUOA 3QVGB 4L7VA 4E51A 5CDTA 3D7MA 1MRNA 2XVAA 1EFAA 4KUEA 3EF0A 3JD0A 3KR2A 4YDSA 2X4LA 3KZVA 3W3ZB 4J43A 3CUUA 3LA6A 2HRRA 3B52X 4BWYA 3C5HA 1NMYA 5IP5A 1I5RA 1SCQA 1Y63A 5BQXA 3SE0A 3NGMA 1GQOA 2PXCA 2FK8A 1WCIB 4Z3DA 1GR0A 5DCYA 2EC5A 5EEGA 3T7AA 4RTQA 5J2UA 1I1NA 3MMNA 4URHA 4RC9A 1K0UA 1T4LB 4Q4HB 3ADPA 1W88B 2N1BA 2XUZA 2VDKB 5BN1A 1U3TA 2F8TA 4OQZA 1YVPA 5EE3A 1ML4A 1T3TA 3NWBA 2BEWB 4EZIA 3SWWA 5T41A 5CAEB 4TL9A 1ODCA 1S2IA 4WE3A 3N75A 5TPWB 3V9AA 2W7TA 3Q87B 3RNLA 1IJEA 2NTYC 5LMNE 2ZJ7A 1BWSA 2ZANA 3IV7A 2RHLA 3GH3A 1ZJZA 2GB4A 2NPIA 2P5SA 1A1IA 3R6GA 4HWOA 5CB4B 3C5CA 1EWYA 4XGQA 5E1MA 3STUA 4BPRA 4LF4E 2UUAB 1JJFA 3AHCA 3JAMA 1OT3A 2IPLA 1ZKDA 3PFFA 2HV8A 4JQSA 3WK7A 1F1JA 4PAMA 3OTQA 3PYXA 4CCSA 1LPOA 1P18A 4ER0A 2VR1A 3LBYA 1JHZA 3IP6A 2CFSA 1GNLA 1P1FA 5EYPB 3ZNQA 3LQRA 3UB4A 1TM3E 4M0MA 5CYGA 4QM6A 4OXQA 3GFQA 2AWOA 3O47A 1ISHA 2PMBA 3TW0A 4Z4EA 3OFSA 4WZBA 4I1PA 1YB6A 1NXWA 2WUGA 4MWEA 1VDMA 4JLOA 3R0JA 3KOMA 3QWBA 4V2UA 5DTEA 4HT3B 4B4DA 2Y1CA 3CW8X 2CGEA 2VBFA 3ONFA 1JQ3A 3OJLA 4ALIA 5LL6R 2B7VA 4PZ9A 3DZKA 3PDIB 4DIEA 2FB9A 4LYEA 4WESB 3QF4B 3CURA 3PGA1 1MVOA 5KYUA 1SBQA 2OHJA 1M7GA 2VPIA 3FTDA 4C7VA 5LLDA 4JXZA 2GLTA 1RKVA 2ZVDA 3AF3A 2P6OA 3A4TA 3V1NA 4BNDA 2IY8A 1GPBA 2GYYA 4CIXA 1XF1A 4IAOA 1SVOA 3IEXA 4GXNA 2CJPA 3T8YA 1VLZA 1IG0A 1XHEA 2EMIA 3G88A 4YC7A 1UJNA 3JD4A 3FSJX 2QX7A 1I3LA 4J1TC 4WLOA 1QRTA 3C6XA 3OEHA 1RWKA 1NT4A 5TSEA 2ORYA 4LFBE 3FD8A 5ERGB 4CKCA 5HUJA 5TQ2A 3UWDA 3UXYA 1F2UA 1WXDA 3W8RA 3BORA 3V33A 4KFSA 3DL0A 3R40A 5LBIA 1DBSA 1QIDA 2EX0A 2BFNA 2M4IA 3PDWA 1QRDA 5IARA 1P5ZB 1QF9A 3FI0A 4NY1A 3TOSA 5KWVA 3KVRA 5EUQB 2GUGA 3P1XA 2EM7A 3WHPA 5F7OA 2PFKA 3ZU6A 4O3FA 2G5PA 3BICA 1X7YA 1GAXA 4MQFA 2MU1A 4FS3A 4MIOA 1GFSA 1W0CA 3QKRA 5BW8A 1H3EA 1FUUA 3EF3A 1SXJA 2Y8EA 4HYEA 4ZTUB 1ZQ9A 3IODA 2GCEA 4IIFA 1GUAA 3DNMA 3IB6A 1ECPA 3MUEA 1DVRA 4YVFA 1WDWB 2YBEA 2NQTA 3DDWA 3AC0A 1D2GA 3EDQA 4WKNA 2V03A 2G36A 3N6XA 1TQHA 1GEGA 4M2ZA 1BHSA 3S70A 3TSWA 2BTQA 2LNDA 2ZKIA 5JFTA 3PC8A 5GJCA 4HQ6A 2WFLA 3DC7A 3VPDA 3H8WA 2LUQA 1XN4A 1YB1A 2DPGA 3DPSA 1GPKA 4HH3C 4QU0A 4ZVNA 1LKZA 3U60B 3V00A 2X6TA 1CWUA 1G8SA 2OBNA 2TSYB 2GN9A 3ETJA 3V97A 4OLAA 1X3CA 2W90A 3R7FA 2YJ5A 4KJXA 2GBPA 1T1RA 3VA7A 2OSVA 1P6UA 3V4ZA 2V5UA 1UJ5A 3MZ0A 1LV7A 4L4UA 4DSAA 4BC9A 1DPFA 2BGIA 5K4GA 1MHTA 2F59A 5IRCD 3SHWA 4HEA1 4KFTA 2JANA 3LYHA 3TLJA 3OHSX 1WOYA 2WVJA 5WRFA 2ZAIA 1HRDA 3ZX4A 1VRWA 4TUYB 3THYB 3WL4A 1TE2A 1WQ4A 2WHYA 3UK1A 1CJSA 1X94A 2G28A 2CDRA 3S55A 1NE7A 1ZNQO 2C59A 2EKPA 3L4EA 3NHSA 4WK4B 4FK5C 1BN6A 2OM2A 3E9EA 3MJRA 3Q6NA 3FOFC 4FGZA 1JR3A 1BU8A 2H57A 5J4KA 3N8HA 3MT9A 1HYBA 1YZKA 2RSLA 2WF6A 3E2IA 2Z5VA 3GD5A 1PK7A 1WUKS 4GXRA 1J7KA 1E2HA 3M1AA 3WGOA 2WU1A 4MVCA 3BMOB 4EWLA 4O4JB 1Z5WA 5CH3A 3NBKA 3AW9A 4EB6B 3K6KA 3VU9B 4NENB 4AZTA 4BDTA 3EZGA 1ZFNA 3PITA 1VJ0A 2ANCA 5E8RA 3G2KA 4DV2B 1W5TA 1L4NA 3RRMA 5L3QA 5J9FA 1RCTE 5LOVF 2DWPA 5CDFE 2F1JA 1BX1A 3HFSA 3DCYA 1KFKB 1PBTA 5KREA 2C2GA 5LJLA 3AHDA 3MCVA 1XALA 2AR7A 4FOLA 2ES4A 4XASA 5G41A 3PPVA 4W8HA 1ENPA 4RV5A 3VYWA 4BO5A 1U9ZA 5TMDA 1OYOA 4MIKA 4JI2E 2AHOA 1E2GA 2DFTA 1K5PA 4OJKA 5FOQA 2IYVA 2AJLI 2GN6A 3AEKB 3C41J 4KK3A 3MJDA 4LJ8A 5EMMA 4BNGA 3ABZA 4W5JA 9LDTA 2BCGY 3FLBA 1ULAA 1JT2A 4BX2A 2CV1A 2PUAA 2FPOA 4C7OB 2PD6A 4MV5A 3LYAA 1P77A 4RY2A 1RKBA 1O94C 3X1YA 4EFMA 1SGWA 4M1KA 1WUYA 4A27A 2C3OA 2RKOA 2BEKA 4H7FA 3M7IA 4WKBA 3BMNB 4B48A 5LFAA 3BDAA 4B0OA 2C94A 1H0SA 3LZCA 1TIPA 3OZVA 3GEEA 2QLJA 3EQ8A 4GMHA 3ZS9A 3DL4A 2W43A 4I9GA 1CVLA 5JNVA 3M9WA 4WZBE 2XLBA 3A11A 1BEUB 1GJRA 2CNKA 1BVHA 1TEHA 2C5HA 2GCIA 4HQKA 4ZEWA 2IV7A 4C78A 4CUKA 4E0BA 4PSAA 5AXAA 2JJQA 1FFSA 5EQFA 4OXRA 3LVQE 2CCJA 4ZZ0A 4NONA 1FDOA 2VYFA 4DV6E 4E15A 4NZPA 5KKNB 1CJMA 4XKJA 4J0JA 3W8NA 2W2OA 4TLLB 2PT5A 1K86A 2AKEA 1I4LD 5SICE 2H1HA 3HWX1 3Q40A 1Y1PA 4H16A 4QAQA 1GZ4A 1R0KA 3EXHB 3FRIA 3PX3A 2YT4A 2Z09A 4HF7A 4BGUA 4MO2A 1CB0A 1EBUA 4RHUA 4JZKA 3U1TA 2G7HA 1TZKA 1ZRNA 1PL0A 4UKDA 4NFSA 2HJHA 1TUGA 3T54A 3WJ1A 1Z34A 4F71A 4ERNA 5FAKA 3HY4A 4N3NA 3EBPA 1USGA 2H9YA 4MYCA 3GUHA 1W5BA 3DOIA 1P0CA 1OA0A 3TVYA 1Q0SA 4RH8A 2XA1A 1PEDA 1AE1A 1BKDR 1FRVA 1P2VA 2A5JA 4R6WA 4AJ1A 1NJ1A 1RZUA 4KKVA 5B6JA 5HRCA 1CRWG 4OQYA 2HQOA 1D8AA 2O7QA 4G4IA 4MA0A 4P92A 3GLGA 1AU9A 2IZ0A 3EZXA 4BB0A 3AHHA 3T3DA 2X4GA 1QPBA 3JAMC 3A1VA 1JYEA 1R64A 3ZDBA 2VK1A 3QVLA 3FY4A 4O6VA 2CLKB 3TIFA 1M7HA 3BKWA 3FNRA 3RF6A 1EI9A 2QMUA 1BW9B 4OLHA 1UADA 2CF5A 1RI2A 1LS1A 2FQQA 2W6JA 4E07A 5LIPA 1KZ6A 1W6RA 2AOVA 2BKAA 3AU8A 2B61A 3GK3A 3BXFA 3GYBA 3WLKX 2RK3A 2RD2A 4AIRA 2C88A 4EY3A 2IHUA 4P4LA 2F7SA 2Q6KA 2KBEA 4A3SA 3SBEA 5DBHX 4FOSA 2CXQA 5DK6A 3ED5A 5JD4A 4CQMA 2A0UA 2CXXA 2GZ3A 4UC0A 3EEFA 1LVHA 5AW9A 3U37A 1VDZA 2X0FA 2FSVA 3E82A 3D6TB 3MTAA 4N1AA 3EPPA 1U0GA 3OJXA 1OUMA 3H2KA 2HBYA 1GPNA 2ZIEA 4E4TA 3JW8A 1X9GA 4IDHA 2B7BA 1PNTA 4BVLA 4KPFC 1C7JA 4JBLA 3LXRA 2YRFA 3I61A 1GD1O 4MQEB 4NPHA 1G3RA 1XMOE 2WYWA 1KJNA 2WKWA 3PWZA 4FHGA 5CCDA 2DEUA 4DB2A 4YAKA 1ZQ1A 3U09A 2AB0A 1MUUA 5CT6A 5KOIA 1MGTA 3GA0A 3AVQA 5HPYB 5GADl 4TVBA 2BMVA 3WLQA 4BNTA 2XWJI 5CFPA 9MHTA 4HUQB 3PI6A 2II6A 1ZIYA 4YB8A 4HKTA 2XB4A 1M6VB 3D6HA 3T5MA 2J0EA 5IXJA 3X0DA 3KKEA 4KSCA 2OCLA 1AAYA 1YJAA 1WY5A 4FJ0A 3QU5A 5B64A 1FSPA 1JDTA 2GBLA 4WLFA 2XTZA 3M9LA 2CBZA 4BIIA 5JS7A 1CETA 3DZHA 3RSSA 3HZRA 4QX6A 3NHMA 4ADSG 2HW8A 1ZH6A 1E4OA 3E03A 1T1GA 3PQEA 1PFGA 4HEHA 3D1JA 1BXGA 1W2WB 4OJYA 1SXJC 3M4JA 4YHHB 2DX7A 2BGRA 1VKHA 3LCMA 4FFBB 4MS1B 5B6PA 1VXOA 2NO9A 4RNCA 1XRPA 5HUHA 1KJYA 4X92A 3RIYA 3BWYA 3WBKA 5HKKA 1HEUA 1YI0A 1N5RA 2D62A 2BP7A 2REBA 4IXDA 2QNBA 2XMQA 1T0JB 1ZM4A 2ZKLA 2HFJA 1H94A 2L2QA 3O95A 1YA8A 4QYXA 1IK6A 5FLXA 4RF4A 1N6NA 2HRBA 1BS1A 1W0KD 1ZH0A 4MVJE 5E3JA 2L0XA 2ATVA 2X5XA 2QLLA 1NATA 3N0XA 3RF7A 2PZMA 3RRXA 3ZHZA 2AYYA 4BCBA 3TOVA 2VJYA 5JZ9A 2PUBA 4A6EA 1YR6A 2HDHA 3OJOA 4GX5A 2Z1NA 4YRCA 4Z2AA 1FFGA 1C4XA 1G7TA 2PQ0A 3U7HB 2VBGA 4PSUA 1JDZA 1PDWA 4Y1RB 4YCNA 2YHUA 2H1SA 3JRNA 4UMDA 5K3DA 4RELA 3HVUA 3D6VA 3ZQKA 3H86A 4D43A 4IZ6A 3NYWA 4LF4B 1H0KA 3KZCA 1DQ3A 3NONA 3D8UA 2QVCA 3NOOA 2Y3IA 2BONA 3H2SA 1H2YA 3J81A 2DTEA 3KWFA 1Z2OX 4FZJA 4TKUB 4KTTE 1X9HA 2VF2A 1ZO8A 1W94A 1HMYA 2M9MA 2XA2A 3FWYA 1FTYA 1P1IA 1J9EA 2H4JA 2XB9A 3EGDA 4Q19A 4V24A 3FPFA 4DIOA 3IJRA 4G2NA 4LF6E 2EFHB 1ONPA 1W52X 1JJVA 4V0KA 4IUYA 4QYIA 5BSWA 3BL8A 3DMNA 1JXOA 1YL6A 2WYVA 1U0TA 2C2MA 2QENA 5FXMA 3TLCA 4QVIA 1RDFA 1N4AA 1M0EA 1AHIA 1KEZA 1M2JA 1KJJA 2EZ9A 1AH5A 1B6SA 4Y0VA 2WD9A 2JK1A 1RXUA 4IDFA 3W04A 3U56A 1NP3A 1T2DA 4QBKA 2C8JA 4PYIA 5F21A 1DDOA 1Z0UA 4JJAA 3CT6A 4OYRA 1YRAA 1M76A 4NOKA 2OXRA 3KDPA 2HCJB 1UKVY 3OOSA 3VC7A 2OV8A 2I6GA 3WP0A 3BK1A 1GYRA 2EN7A 2CDAA 3K4QA 4WLEA 1JHUA 1WUIS 2VRCD 4IKOA 4PRLA 3W5UA 4ZYLA 3GLGE 4NU5A 5JU6A 4PZ0A 2VATA 2IH5A 2JCYA 4LS3A 5CLJA 2VXBA 4FZRA 1XNHA 5LXTF 1Q17A 3KAJA 1G6Q1 4DCVA 3IEUA 5BRJA 1VSTA 3NEYA 4C29A 3INNA 1JQDA 4XSVA 5E4FA 4DR7E 4DF3A 2GO1A 1YU6A 3WLHA 1NQOA 2AYZA 4LNUB 3WIBA 4BU1A 1YTUA 1Y8ZA 1UPTA 3ELWA 4L75A 1B1AA 1H4TA 1MENA 4IDPA 3LCVB 3BXOA 1G5IA 4QWWA 4U7HA 2WQ7A 2V9CA 3MNFA 4EMBA 3GLQA 3B9QA 3HXLA 2VAVA 4GPBA 2R5NA 4HQRA 4Q16A 2HJVA 2SBTA 3KKOA 1WPXA 1RAFA 1USVA 1GTVA 3MAJA 1GL7A 1UBLS 2AC4A 3HZOA 3OPVA 1O6BA 1TKBA 2E1MA 1KARA 4AMUA 1JQKA 5JSFA 4B3TB 4EATA 2JFPA 3SQXA 4W5TA 1RQGA 4A1OA 3I9OA 3P0JA 1Z6AA 3WRWA 3TAHA 4Q4JA 3IAXA 2JZCA 1IUKA 4CHTA 1IY2A 4JCCA 4F2PA 5ADWA 4WUVA 5JNTA 4WADA 5DX0A 2ONJA 4G5YA 2WUFA 2GJ9A 2IPNA 2WTNA 3CEHA 1LI4A 4E14A 4DADA 1J97A 1V5EA 4GPIB 5JHHB 4EW1A 1M5RA 5C7LO 4BQIA 4AT1A 1WX1A 5CCBA 3TTXA 3EFEA 1Z7EA 3UQYS 1I94E 2IUFA 1C3XA 4G8CA 4M1TA 4UCWA 1FKAE 2LBPA 3C1UA 1W76A 5I9SA 2DFPA 3BSFA 1YSAC 1AUVA 3F73A 2DLDA 3ND5A 2JASA 1NQTA 4JMLA 3SX4A 1Z7YA 4BTVA 5HFNA 1QKJA 4CEJA 1E66A 4L07A 3H1AA 3EUWA 2V88A 1H1TA 4P7BA 1FQWA 5ANRB 3LOPA 3AUAA 3V1MA 5SYAA 2ZZNA 4D1YA 3WGQA 5LNK6 3SKXA 3QBDA 3I01A 3FPLA 4JXXA 2BEUA 3PT9A 4UHEA 2X9VA 4HMOA 3IHWA 1EVZA 1Z3CA 3LBNA 5J2UB 1ST3A 3CNBA 3SZOA 4B0PA 4DR4E 2OO5A 2YQZA 2RKWA 3AETA 1GSOA 3GFFA 4FFRA 3ZZUA 2Z6UA 4P4TA 1P2BA 1HBJA 1NE2A 3B51X 1U0RA 1J0BA 4DMHA 3RR2A 3I6ZA 1UJMA 2YZTA 1HUQA 4DLTA 4J0IA 1K5DA 3LHSA 2B6NA 1R2QA 1N1GA 4HDAA 2BTOA 2Q1SA 4LK2A 3V6LA 1Z7BA 2O07A 3T5CA 3WRXC 4GECA 1YJCA 4MVXA 3E0QA 4QC2A 4PIVA 1L5HA 4FCWA 5A1JA 4CLRA 5IJ0B 5T6JA 1FUKA 4OOGC 1V9SA 4EAAA 3TSOA 5AKXA 4X7MA 1G59A 1NG1A 4G1EB 3O26A 4JI2B 2V0CA 1UHZA 4WFJA 4AL4A 5JFOA 2DFVA 5ECGC 5HIMA 1W85A 3AR3A 1ZJJA 3V2HA 5DTQA 3DBVO 4GR5A 1RR6A 5ENVA 4I66A 1Q0UA 1T25A 4Q1CA 4XSHA 3ZHOA 4KHPE 1YUBA 4D8UA 2IPOA 2ESRA 4MVJM 1UBJS 3F8TA 1U0JA 3IAM1 4LMRA 2QMQA 5AKIA 5KDLA 1Q6YA 3W79A 1I5EA 4B3XA 3VR3D 2EMYA 2BOVA 5JYBA 1UEIA 5A4MS 3K6SA 2GNOA 2IYFA 2GAAA 4KE7A 3TTUA 2AI2A 3UCXA 4XGIA 1NSFA 2FEOA 2RMKA 4MVJH 3CRMA 3GXBA 1Q0RA 3ZDFA 4FC7A 3VR0A 3GMIA 4WZBB 4WI1A 4DKXA 3LGAA 3HXMA 1HK7A 1OC2A 4KMSA 1OR8A 4KPGA 2FOIA 3I12A 4UCQA 4WAUA 3ZQ6A 2ZRFA 2F3UA 2K4MA 3RIXA 5BUSA 5BSHA 3PIIA 2N0SA 3GPLA 1Q0HA 4U8HA 3HUEA 1LLUA 1RIFA 1XDWA 2PGOA 4FGWA 1UJCA 4DV6B 2GPTA 5DP2A 2RBEA 1XKLA 2EP8A 1K27A 2EFYA 4RK1A 1VG9B 2FAXA 3GT3A 5AHWA 5I3ZA 1DQSA 2J0UB 4YAOA 4F0JA 4ARIA 3IQZA 5HEKA 3A58B 5BVGA 5JAUA 1XD2B 4J0FA 3R23A 1NVUQ 1QIJA 2WVHA 3MWYW 5ENDA 3IAFA 1ULHA 3ZDXB 3AHJA 4LPSA 4HDKA 1QK5A 4Q4DA 5FLXC 5JNWA 3AWIA 4YEDA 1Y6QA 1CUYA 4BNDB 3VKFA 2ZRKA 2VOEA 4PC6A 3OFKA 5IDYA 4A8HA 1LSJA 4JC8A 1LTHR 1TYCA 3L9WA 3PFHA 1I10A 3MUOA 4G8BA 2C7BA 2JHPA 4U2CA 3UTCA 1QH1A 2J3MA 4PG4A 4XD7A 4EJSB 4GXQA 4JDPA 1TZJA 3AR6A 4JSRA 4Q3LA 2LO3A 4AO8A 1V5WA 4CKCB 5IF3A 4DNXA 3I9NA 1O57A 4Y98A 1F2UB 2AE2A 2H1LA 4DJJA 3A9RA 3RT1A 1MLDA 5FPYA 5D3MA 4TT3A 2WHPA 1X5WA 3W3AD 2JCVA 5CH5A 4YJFA 3LY9A 3SEFA 2C3PA 2M6RA 3OZ7A 1ZU4A 3M5DA 3SGLA 5DM70 1IQOA 4JI7E 2P4SA 4YMUA 1DPGA 3ADJA 4KXMA 3J81C 1WXQA 1JMVA 4R2EA 3ORSA 2JI6A 1PR9A 4M0EA 3KHTA 3CE6A 3ROGA 3PBKA 4X1KA 3TR5A 2GPNA 4ZHQB 2FSIA 3OQMA 1CY8A 1NXXA 2RC6A 3QXGA 4GZ5A 1QHYA 3VKGA 3NAZA 1JPNA 2G4VA 3C48A 2BTQB 2BFEA 3BMQA 1M9NA 4H1HA 3ZZNA 3DWGA 1KKMA 2WFLB 2X2PA 5GJWC 3SYMA 1X15A 1R0XA 2H08A 1KJZA 2OBMA 3IP5A 3G23A 2G72A 1RI1A 1XQXA 1ZN7A 1NQWA 2PV0A 4J0KA 2HHAA 3TNFA 1I2MA 3C7KA 3BE4A 5HOEA 4GO1A 1ZBTA 4J2OA 2I4IA 2LE0A 2KWIA 4W7HA 4N39A 3IBCA 2VJQA 3KEFA 2VG8A 5J4YA 1OLUB 1VE1A 1EWKA 3AEUB 3CBQA 3OZRA 4UM8B 3T99A 1EM8A 4G5FA 1XMOB 3B9BA 1KO4A 2VA9A 1JKFA 1FU7A 1UZUA 1ZK2A 4DLUA 3EG5A 3RIGA 2O1EA 3UY4A 4DIFA 3ELDA 5DIFA 5ALKA 4QSHA 1Q50A 4NC9A 3L8FA 3PRJA 1MX9A 4PO3X 1G60A 1SRRA 1GU0A 4FFDA 5H4HA 3TQFA 4ECAA 4L2IA 2XD9A 1MVLA 1LPPA 2J4CA 3IRVA 4JI6E 1MNAA 3KP1A 3HJTA 3KJIA 4ZT7A 4R03A 4I1UA 1VIYA 5ERYA 1WB9A 1S9DA 4TGLA 1GWNA 4X95A 2RAUA 1GTL1 3DMFA 2HN9A 3THXB 2WKSA 4OJMX 3D3QA 3IP3A 3DE7X 1ZGJA 4HDMA 3AF5A 1JX6A 2YWJA 2P5YA 1UAYA 3FCAA 3E58A 3IERA 3GEPA 3NIBA 4ZCPA 4F9BB 3T7EA 4Z9AA 1Z22A 4MJXA 4Z9FA 5ILOA 2Y92A 2DRIA 1JJBA 1JHXA 4AJ4A 2RGXA 3M4XA 2B94A 4BBPA 3X1KA 3H5VA 1ECBA 5JMWA 1XKTA 3O1JC 1WPRA 4AWBA 4U3JA 2J6BA 1CQPA 4G81A 3JWIA 1NOJA 2YYAA 4N8DA 2ZSJA 5JCOA 2D2VA 2GCOA 3KEGA 4GI5A 4RIFA 3SJCA 1NX6A 1MPXA 2G9QA 4TLAA 3QEOA 3L6EA 2IY9A 1KOFA 2J5RA 2D5AA 3PXCX 2B8EA 3JQ8B 1T8PA 2B1RA 4HEA6 4NQZA 2A4KA 2ERXA 4PN7A 1VJRA 2PKYX 4FFVA 4ZQIA 4B9EA 1SEPA 5JASA 3GLFA 1Q83A 4R1PA 2O52A 2IL1A 1GZ3A 3BGHA 2AZDA 3TFQA 2VKTA 2VP6A 3T1NA 5A3SA 2CNNA 1C7IA 3GGOA 4CQLB 3L0BA 1CIVA 2DUJA 3C3DA 1R5OA 5KYWA 3TOZA 2AW3A 1L4UA 1N5OX 1W49A 2IQIA 3N2IA 3ZZ1A 1QR2A 4L5JA 1KMQA 1AHNA 4RM3A 1JR6A 1SVMA 2H6EA 2QIPA 4G5RA 4TMVA 1GTJ1 1JJ7A 1TQ4A 3DAPA 3CWQA 4P5PA 4PS1A 1SQGA 5IW8A 3RV4A 3ES9A 4J6FA 4EKGA 3OOEA 1U5AA 1NF9A 1RP1A 1P60A 5IEJA 3RKUA 1N57A 4RNDB 5FP0A 1U02A 1MNQA 4LOJA 3QOXA 3HR8A 3GBSA 3AF4A 1J0DA 3HWSA 1H2ZA 2VHXA 1WW2A 2PA0A 1E79D 1GRNA 1FNSA 3H18A 1PL8A 1P29A 4INAA 2E4AA 1QAMA 4F5ZA 5BYJA 3L7BA 3THWA 1WO8A 2OBLA 2OLKA 3BSWA 4ED9A 1FZTA 4TQ9A 1WZUA 3IQEA 2QU8A 3SVLA 4AC9A 2B5VA 1JWAB 3DEKA 1XIVA 1TECE 3G6WA 2Q21A 1ZW1A 1F4LA 1HR0E 4BDSA 1XZLA 1LBHA 4O08A 5JE8A 4BPBA 1OW3B 1RQ2A 1AUOA 2OHOA 1NDUA 4B6FA 4LZAA 4ME6A 4DIKA 4LUCA 3P0HA 2JGRA 1E8NA 1O1YA 3PQ3A 2NZ2A 2QR3A 4PYRA 3TR6A 4CM3A 1Q7BA 3ENKA 3RTDA 4MQLA 1NG9A 1M1ZA 1N2SA 2QW8A 2Z30A 5FFMA 4Y1FA 3GLGB 3ZNNA 3M34A 5CR9A 2P77A 5JAZA 3WAGA 1XL1A 1WP4A 1J1IA 2ORIA 2ANBA 4IINA 5BRAA 1B00A 3FHJA 4J9VA 1Q11A 1CZLA 3FFBA 1E96A 3GGSA 1CW2B 1HFJA 3P9RA 4GOMD 2AD5A 2V98A 5F2KA 5A02A 2QGNA 3EGIA 3JQ9A 3CUKA 3MBIA 5G0TA 2HA3A 4DR7B 2C9CA 3B1FA 3DMGA 4RIGA 1T2FA 5TS2A 1AGRA 4EPRA 2M98A 3MOSA 2MWMA 2XNKA 2WSSD 1Q7CA 2X8JB 4X54A 3C0KA 4XDHA 4ESOA 2HXYA 1P81A 3WWOA 3FHOA 3J7Yp 1TCCA 1YRWA 2GLUA 3EUEA 4JJ4A 2XIJA 5E4TA 4UDYX 2GGSA 3IVCA 3AUUA 1N0IA 4N76A 3UT5A 2VJBA 3ABRB 4X8LA 2IDMA 1BWPA 2PD4A 1E2JA 1EUCA 5BMVF 3VISA 1YKFA 4YP6A 1FA9A 3NWEA 5FI1B 2OORC 4R41A 1SKBA 4OGGA 1LTQA 1TEZA 1NQVA 2Y0CA 4AULA 3WZLA 1GNVA 3C7AA 4XX1A 3O8OA 4IS3A 1DIAA 2MMGA 2QY6A 2XUPA 1GR1A 1NFQA 4UVIA 5E9QA 3KYJB 3ORRA 1XVIA 1EFVB 1O4VA 3N3AC 1UQRA 4C7BA 1P2SA 3I1JA 3TM4A 4M1ZA 3HABA 1R18A 3GP3A 4JI3E 5DWDA 4OHBA 1KXZA 5JARA 5HBGA 2GF2A 1NY6A 5C1OA 5A0TA 2FW7A 3AM3A 1FP7A 3REGA 5BR8E 4QVGA 2GCNA 4Z99A 4EM6A 4DDUA 3HCOA 2JLSA 3EGCA 1M8FA 2B2XA 3UMBA 4TMXA 1O89A 3BERA 1WAMA 1PR0A 1U5BB 1WZCA 1I94B 4KQXA 1RAIA 1T2CA 4U0KA 3OKAA 4O2RA 3EIUA 4JC0A 1Q3TA 1JIKA 1JYFA 1UUFA 1Y8QA 2G77B 1J2YA 2KBFA 4FI3C 5ALSA 2PH3A 2Z2IA 5DX8A 4EY5A 5JADA 1YWGO 2QAJA 4TYPA 2HWXA 1CRZA 4Y2PA 5MHTA 3HSSA 5KJCA 3H1FA 4KGDA 3I5AA 5I5GA 1L3IA 5DHTA 1TK9A 3QI7A 3MMZA 3KOXA 3N0TA 3PUJA 4WINA 5TE9A 3X2EA 1XMQB 1Z4MA 2C2HA 1PNVA 3ICQB 3OA0A 3U7EB 4LZNA 2Z08A 3LKDA 1X1CA 2W6NA 4S1TA 3TMAA 1IPHA 4G0NA 4KCGA 2QL6A 3T4XA 1IK4A 3D8NA 5CUQA 4DR4B 5F52A 4NICA 1U63A 3CUTA 2X3FA 4KVAA 1RRGA 1RWQA 3DULA 4MKXA 2WF5A 1QTRA 3DKRA 5EXTA 4EECA 2Q5OA 5FWNA 2QNRA 4IHJA 1T5HX 1RRVA 2GCGA 2PLAA 2FWAA 3L7MA 3M6WA 3PTZA 3QH4A 3L01A 3PV0A 4CM1A 4QTZA 3S0JA 4J0QA 3M9XA 3PC4A 4M55A 3TB4A 3ZE8A 4AG5A 5AKLA 3FOAA 2AK3A 1A1HA 1L5MA 3DBLA 3HKBA 4M1YA 4IIUA 3CS3A 3OAAA 3ZEAA 4AQYB 2JZNA 1ENOA 4XVUA 1B69A 2HTFA 1LLQA 1ZIDA 2WB4A 2EGHA 2RCYA 3KXLA 3OZWA 4V03A 5AOCA 1WMEA 2ZYWX 4OL0A 5ENZA 2Z5GA 1XPRA 1GTSA 3QELA 3PNOA 4Q7MB 1YIDA 2H5IA 3C24A 2ZYHA 1JU9A 3I6YA 3RVNA 2OHXA 1K2WA 4ZYVA 4KHPB 4BGIA 1GQRA 4OSPA 2PS3A 3TDNA 2JAHA