1GZ6A

(3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
301
structure length
301
Chain Sequence
SPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGSRMTETVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binary Structure of the Two-Domain (3R)-Hydroxyacyl-Coa Dehydrogenase from Rat Peroxisomal Multifunctional Enzyme Type 2 at 2.38 A Resolution
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dehydrogenase
molecule keywords ESTRADIOL 17 BETA-DEHYDROGENASE 4
total genus 101
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1gz6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gz6A01
3BHJA 2EKLA 3N74A 2PWZA 2OBNA 3I23A 5JW6A 3S8MA 2Y1OA 3KVOA 4B7XA 3GHHA 1AGNA 1DOHA 3DBHB 3TL3A 4C7JA 4E2YA 4WK6A 1PZGA 2X0IA 4CM9A 1DRWA 3H5NA 4HADA 4GX1A 4I9UA 1Y8QA 3OA2A 3G79A 1E77A 3WBBA 2PKRA 2NSDA 5L53A 2P5UA 4D79A 3D3WB 1E3EA 2AW5A 3I9MA 4JLWA 3H5RA 3PYLA 3QWFA 3EZYA 2CF6A 4ZQEA 1MX3A 1H2HA 1Q7GA 4OXKA 4TSKA 5G0WA 5GY7A 4CV3A 3VPGA 1ISIA 4NPCA 3PDUA 2WWRA 3GMDA 3OJEA 4PLPA 2AHRA 4EW6A 1R0KA 3LLSA 3GY0A 3WGYA 3PIIA 4DA9A 4D0SA 2GN6A 1LDBA 3NJ4A 2PZLA 3NTQA 2YV3A 3JD1A 1NP3A 2VZ0A 2YFQA 1QYCA 1JTVA 3P2YA 4OMUA 4MOWA 1KOLA 4U7WA 1R12A 5JCJD 1W73A 2O7SA 4YEDA 4ZICA 1KEPA 3U5TA 3DBRA 2OFPA 2QQ5A 3V1UA 5JYDA 1Q2XA 1B2LA 2XXBA 4CQMB 3PYXA 4FOSA 1I8TA 1Z75A 3RC9A 1ZXLA 2JCXA 3C1OA 3JTMA 2IZZA 3JQEA 3ICCA 4GQAA 4JP2A 3UCEA 2CMDA 4RQTA 3OM9A 4CPDA 1D1TA 1NQ5A 3RCBA 4XIJA 3TDKA 3DFUA 4L9RA 1XU7A 1P31A 4WOKA 2O4CA 1O9BA 1UP6A 3EMKA 4J43A 3RJ5A 1BDBA 1U2GA 1ADCA 4XQEA 3JQ8A 1T26A 2O23A 3GVPA 5KKCA 3AFMA 3E48A 5TJ9A 3ORFA 1R37A 1SB9A 3ZU3A 4CV0A 2Z1MA 2O7QA 2JKVA 4YAGA 4IXTA 4IS2A 2X5KO 3K5PA 3WDSA 5JAMA 5JPIA 1PL8A 2AE1A 2QZZA 3KYCB 2DM6A 4FGWA 5L9AA 3H8VA 1EVYA 1H6DA 2FHSA 1DIBA 2J3KA 4CL3A 4K6CA 1XDWA 1M66A 3Q9NA 3WYBA 4CM1A 2DU8A 3RQSA 4OGWA 1HLPA 2EXXA 3ZWBA 4EJ0A 4ZHSA 5KTKA 4YTEA 1QKIA 1NAIA 4GH5A 2W4QA 4TVBA 1W8DA 2Z95A 1V35A 3I9JA 2I99A 2Y1EA 2PH3A 2Y68A 5EERA 5IAAA 3FD8A 2CNBA 3RWBA 5F1OA 2BI7A 5JSFA 3UAGA 3ZI0A 1LI4A 4LCJA 4CL8A 4XQGA 4D3FA 1HE5A 4L8VA 1X1EA 1KIFA 4OHUA 5ICMA 4NFHA 4JXKA 4J1QA 4F3YA 4FR5A 4U0KA 1TT5A 1P3DA 3RBXA 1LLUA 3KZVA 3AU9A 2AQIA 3E5MA 1P1JA 1R0SA 5AXDA 5DF1A 4MVJG 3IOYA 2B35A 3TL2A 3GZ4A 5DDIP 3GQVA 3AUAA 4TVOA 1RM0A 2VYNA 3MCVA 2FR1A 4GGOA 5G0SA 4LGVA 2C5EA 1SNYA 3M2TA 3ZV6A 4ZQHA 2UUPA 4PZEA 4GPD1 2DLDA 2WMDA 4HBGA 3ZWWA 4RVDA 3WGIA 4RF5A 4BO0A 1JN0A 1PJLA 2PFGA 4CQLA 5CEEA 1UP7A 4FPXA 4Z9XA 1MG5A 3KEQA 1ID1A 1OMOA 1KVUA 4AJ1A 3JSAA 5L45A 4GKVA 4FD3A 4B7UA 1EUCA 2D8AA 2Q99A 1NAHA 1FDVA 1YJ8A 4YJDA 2DTXA 3RKUA 2J3IA 4J4HA 3ETGA 5EN4A 2X8LA 1PEDA 1PZFA 4AJEA 2NVWA 2QX7A 4PLVA 4DYDA 2PKQO 1PL7A 4GWGA 4XGKA 2QIOA 1ZXBA 1PZHA 3EDMA 3NDRA 1Y9AA 3ZV4A 1PGNA 2JD2A 3RIHA 3LLVA 4IJWA 4FB5A 1T1SA 1A7KA 4NNJA 3VPFA 3P5SA 5JAQA 1EQ2A 4J0FA 4GGPA 4WE3A 3AOEA 3AFNA 4ID9A 4TRMA 1EE9A 1PJ2A 4PN3A 1YKFA 4K9DA 4KTTE 5JO9A 4UVHA 4RGBA 4EUEA 1ENOA 1WLYA 3TFQA 4IQ8A 2VUTA 3WNVA 1ZSYA 4AJIA 2FSSA 1Y8QB 3GZNB 1O0SA 1PGPA 1HZZA 3DZFA 3QVTA 3VH4A 4BNKA 2HUNA 2PZMA 1ZVMA 3ROPA 3QW2A 3EW7A 3B1JA 1V9LA 2PZJA 4GX0A 4ALJA 2CDCA 4FJ1A 3WBFA 5DP1A 4CV2A 3RC2A 3H4VA 4MIEA 1GPJA 1FK8A 3MWEB 3R0IA 1PJBA 5ITVA 1OAAA 4FW8A 4BGVA 1E5LA 3B6ZA 1PS9A 1LA2A 1PR3A 1U5AA 3KM0A 3DHYA 4UAGA 2RHRA 4YAIA 2JCVA 4KZPA 5CPBA 3IP1A 4E3ZA 4R1UA 3OJ0A 3E18A 3WMWA 5BR7A 5KOIA 1U3UA 1ARZA 4UEKA 3EAGA 4E5KA 4U6SA 5I9MA 3RU7A 3GNSA 2JD1A 2AQKA 3I6QA 1YB1A 2VUSA 3OP4A 2FP4A 5GZ6A 1YOVA 3WFJA 3TQHA 1XSEA 3STHA 1WNTA 4XJSA 3DMTA 4ZQFA 1OC2A 2P5YA 4NH4A 1HDOA 2ZK7A 1UJMA 2CVOA 4OIMA 2CFCA 3NEPX 1QR6A 4C7KA 4E32A 1UXHA 1E3JA 3GEDA 4A73A 3M2PA 3O4RA 1DAOA 1ONPA 3PQEA 1LSUA 3FCOA 4NBRA 3DZHA 3ZCXA 4D41A 3PHJA 3S2FA 4RPJA 4DIFA 2VNAA 2H1SA 2IEBA 3GGOA 2R00C 2V65A 1HRDA 1MB4A 4MVJM 4CLRB 4FFLA 2NU8A 3OSUA 1N1EA 1RYDA 4BB6A 1NXQA 3BA1A 3IMFA 3TFOA 4NK5A 2AEFA 1VM6A 3CINA 3U4HA 3OEYA 3L77A 4U8GA 4RJTA 4I5DA 3INRA 3RROA 5F3RA 1LDMA 1ENZA 3C24A 2X58A 4WCFA 1XWFA 3ONDA 4DBZA 1ZUD1 2GYYA 3GUYA 3IAHA 4YJFA 3F46A 4IDDA 4Q3AA 3V1TC 1Z73A 4I9NA 5A5FA 3PI7A 2VHYA 1BTOA 4S3MA 2Q3EA 1DXYA 4RVGA 1QMGA 3KSZO 3K96A 5HS6A 4ROSA 3SBOA 3OIGA 1E1KA 2GN8A 5AXAA 4E0BA 1HSOA 1KVQA 1G0NA 4CQMD 1H2BA 1E3SA 2W90A 5U9CA 3IS3A 4CQMA 2I76A 1FDSA 1DFIA 5KVSA 1LLQA 1VC2A 3BMQB 2EW8A 2ZQZA 2O3RA 1LU9A 4O1MA 1SO8A 1UUFA 2I67A 2W8ZA 3KYDB 1DB3A 4PLCA 4R01A 4KDFA 1LLCA 3DBLB 4IDBA 5AOVA 4WOJA 1MG0A 1J0XO 4KUGA 1FJHA 1O6ZA 2WYVA 1L7DA 5HTOA 1U9JA 4FS3A 1LQUA 5JCXA 1E6WA 4BNWA 3DC2A 2GZ1A 3TOZA 3V8BA 4YYZA 1H6AA 2UDPA 4AICA 1E6UA 4XRGA 2D59A 5EMHA 8LDHA 1SOWA 1Z6ZA 5T57A 1U8XX 3BTSA 1ENYA 1VL0A 2WDZA 4II2A 4NK4A 1K2WA 4KQWA 1O95A 4YJGA 4E6PA 1G1AA 4YJHA 3FNEA 4FBGA 3WG9A 2TMDA 1UDCA 2G17A 3UN1A 4UREA 1ISJA 4M49A 5TT0A 3ZHZA 4BB5A 3RUCA 2B5VA 1MFZA 2HKIA 1NVTA 1PZEA 1WDLA 1I36A 1LC3A 2CD9A 1HYHA 3F4BA 4Z3DA 1ULUA 3EZLA 3FBTA 1C0LA 1M6HA 1P9LA 4I5GA 3VH1A 1ZZEA 2DPHA 2UV8A 4CMIA 5BNIA 3ZWVA 5JDIC 1U2DA 3D5QA 3JQFA 3L4BA 1UZMA 4BNMA 1E7YA 1EMDA 1ZSNA 3CZRA 1IE3A 5TRTA 3IKVA 3NGLA 4FJ0A 3DZIA 1P1IA 4YAJA 4ZQGA 4E33A 3W8EA 3MWDB 3GRKA 4TQGA 5L7YA 4ONEA 2CDAA 1VKNA 3KRTA 1DJNA 1KVTA 1ZH8A 4CMEC 2VWHA 1E3WA 3IC5A 4OXYA 2D2IA 5EQFA 2O2YA 1QYVA 4BNJA 3PFWO 5AXCA 1M6WA 3ZU2A 4BKOA 7ADHA 1A4UA 1GQYA 9LDBA 4FFPA 1W6UA 2O2SA 3PQFA 4XJTA 3V2HA 1D1SA 1G6KA 2GO1A 3O8QB 1V3UA 1V8BA 3CUKA 3OFSA 3BIOA 4PZCA 4D0RA 3CE6A 3PGJA 4Q9NA 2X4GA 5LDGA 1QV7A 1UXKA 5KJCA 3ITDA 2GSDA 1GQQA 1NVMB 3CMCO 3PZRA 2NU7A 4AJ2A 4E4YA 3RUIA 3NTRA 3WR5A 4DLAA 3L6DA 3RKRA 1YJQA 4MP8A 5CPFA 3RSHA 1X0XA 5FF9A 3ST7A 2A92A 5ADHA 1KY5A 2YFHA 1B7GO 2PGDA 4XD2A 5DCWA 1ONOA 3KOUA 2E48A 4AJHA 2DKNA 2RH4A 3VKVA 3JQBA 2W2KA 1ONNA 3D0OA 1EDOA 3I4CA 5H81A 2J6IA 2LDXA 4E31A 5I7FA 1LSJA 3QWBA 1NM5A 1LJ8A 3JQ6A 4HUJA 1YXMA 4WGGA 3HDHA 1C1DB 5ER6A 5C7LO 2EP7A 2RH8A 3JD3A 1SOVA 8ADHA 1IPEA 3DL2A 2Q1TA 3BHMA 1YBMA 4BO6A 1YL6A 3Q1LA 2E49A 1I3MA 2BRUA 2EERA 2QW8A 1YO6A 3FNFA 2HRZA 5CDTA 4IINA 1MXFA 2VYVA 4F45A 4O0LA 2I3GA 2VHXA 1OZAA 4R41A 4YQYA 3AI2A 4HFNA 1E6EA 5JY6A 4TRJA 5HM8A 1R4MA 2AMFA 1QLJA 4C4OA 2VHZA 4Z0TA 4JJIA 3P19A 1NFFA 3QWAA 1QRRA 2F00A 4XGNA 2O3JA 4BNYA 3A28A 1V0JA 4DYVA 3D3WA 3GT0A 4ND4A 2ZCVA 4A7PA 1S6YA 4W9NC 1P0CA 2GLXA 3HB5X 1PL6A 1PS0A 2EW2A 3BTUA 4OAQA 3WSWA 5IJZA 2FPIA 4XIYA 3F47A 2YW9A 2EJVA 1NX6A 3UCFA 4A03A 3GLQA 4O59O 3AY7A 3UHAA 2PR2A 5DCYA 1NPTO 5FYDA 1OC4A 3UF0A 1AUPA 1DEHA 4KDEA 3U3XA 4A2CA 1DHRA 1P44A 4FJ2A 2WTBA 3GDFA 4JROA 1E1NA 2HU2A 1TB4A 4LSMA 4Q39A 1H5QA 1Q1NA 5H82A 4XYEA 5JY1A 2ZTVA 4GBJA 3HHPA 4U6QA 4S1VA 3NGXA 4YWJA 1YDWA 4WLNA 1RM5A 1T4DA 4P8RA 4BO5A 3SC6A 3HDJA 3RUDA 1T24A 3DO5A 3EGOA 5EPOA 2HLPA 1Y81A 1ADBA 2C54A 4MP6A 4NFSA 3AUTA 4BO9A 3GN1A 3OBBA 3MJEA 3LVFO 3QP9A 4HNGA 1VE9A 1F14A 4YCAA 1BVRA 4J91A 1B0AA 1HZJA 4YT4A 5DBGA 1U4SA 2EHDA 2B0JA 4YT2A 4EJMA 3WLFA 3PIDA 4Z3KA 3IUSA 3KETA 3X2FA 4NHEA 2DBRA 2FPPA 3EYWA 2E82A 3BTOA 3E9QA 3GAZA 4GX5A 4JBGA 5BNTA 4RPHA 1VKOA 4EBFA 4IDAA 3E8XA 1U3TA 5I7VA 1JQBA 3FF4A 1PQUA 5HA5A 1X1TA 3DOJA 4MVJI 4Z9YA 2VRCD 1IZ0A 2HMSA 2OHXA 1RM3A 2YV2A 4DTIA 3WTBA 1N5DA 3GDOA 4BO3A 5FFFA 3VZSA 3H2SA 4HV4A 2G82A 2BGKA 5DN9A 4ZQBA 4CM4A 1ZK4A 3TN7A 2YHUA 4M87A 3ZWCA 2IZ0A 3PXXA 2IXBA 1GDHA 2BFMA 3BYZA 5DCUA 5TLSA 1A72A 5IDWA 4Q3CA 5L4NA 2EIHA 4PG5A 3BMCA 1VJTA 4NBUA 5BT9A 2Y0DA 1E7SA 1U1IA 4IZIA 2B4RO 1Q0QA 1C0IA 2JAPA 3E1KA 1UDBA 1XLTA 3ZNPA 1QXSA 2DC1A 2EWMA 2V6GA 2YYYA 4K6FA 3E82A 3ZWNA 3GMSA 1GD1O 1GUZA 3EY4A 4U0JA 4NG5A 4OYRA 2GUGA 3JD4A 2PA3A 1XQ1A 4HX5A 2YHIA 4YVFA 3S2GA 1D4FA 4KQXA 3ZU5A 2PD6A 3GHYA 1E3LA 2W2KB 3M1LA 1BMDA 4KP7A 4CLXA 3KV3O 1RPNA 4MP3A 4XRRA 1KYQA 1R4NB 4A0SA 4I5EA 4YBZA 1DBVO 3L07A 4P4GA 1LXCA 2HSDA 1NWCA 2UYYA 3BZUA 3ZNNA 1ZBQA 1PU2A 1HDRA 1AN9A 3I9KA 1J4AA 3QIVA 1T25A 2R6JA 3TPCA 1ZO8A 4CMBA 5A5EA 2E6UX 4XB1A 2NWQA 2AQ8A 1JKFA 3D4OA 4I1IA 4D45A 2IEDA 4Q3EA 2VT2A 1T4BA 1Z74A 2Q2WA 2NLOA 3DHEA 4J7CA 4FGSA 3K8ZA 5IZCC 2XOXA 3UUWA 1IOLA 3NUGA 4YXFA 1IY8A 3CEAA 5A04A 1JLLA 4MINA 3OQBA 4QUKA 1R6DA 4IM7A 4R69A 3PLRA 2HO5A 1PSDA 2BH9A 3EK2A 2YZ7A 3ZW9A 4B8ZA 1W0CA 3TZ6A 3RUFA 1EBUA 3AY3A 1Q7BA 2X9NA 3PFFA 3FNGA 1ZK0A 4HWKA 4ZVVA 1XYGA 3L4SO 4BL5A 2G5CA 1CETA 2Q2QA 1D8AA 4CUZA 2QG4A 5U1PA 1DSSG 1YQXA 3F9IA 4UUPA 1CERA 5L51A 5A4DA 3D7LA 3FBGA 2G1UA 2RHCA 4OKNA 5G2OA 2P91A 2AEMA 1TVEA 3F5SA 4G5HA 5L7TA 1BDMA 1PS8A 4ND3A 4CJXA 4R1SA 5G4KB 3KSUA 1DFHA 1JVBA 3GFBA 1KERA 4IIUA 1DIRA 2ZB4A 2B4QA 4G81A 3TNLA 3JQ7B 5JYEA 2BGLA 3U09A 3AI3A 4RPLA 2Y1DA 2EKPA 3BMNA 4BO1A 5CG2A 3WS7A 4IS3A 3AI1A 4D44A 5C7OO 1P1RA 1XHLA 2C59A 2X22A 4MPDA 3Q3CA 4AJ4A 4IMPA 5BSEA 3MTGA 2D5AA 1X13A 3NDJA 3LC7O 3ROQA 4J3FA 2VYVD 1KY4A 4PRKA 4YA6A 1PJTA 4FC7A 1LBEA 4WLEA 2CUKA 2FZWA 1BSVA 3DOOA 4ALIA 1VLLA 5I7SA 4NFYA 5T5QA 4L4XA 2QRJA 4GVXA 1JW9B 3PVZA 3QWIA 4BHTA 2VHVA 2YDYA 3ULKA 3KLPX 3A4VA 4OXNA 5CDYA 1J49A 1JA9A 4A26A 4PLHA 2R00A 1PWZA 3RVDA 2GNAA 1PX0A 2Y93A 2O48X 2PY6A 2RCYA 1NTOA 1N2SA 3R1IA 3RFTA 4YT8A 1VJ0A 1LEHA 3V5NA 1PQWA 4J1SA 1A27A 4IUYA 4R4JA 5ILGA 1AXEA 1HDGO 2V6FA 2ZJ0A 2SCUA 3PJGA 5C37A 3DXFA 3GF4A 5AYVA 2IDZA 2WD8A 3LC2O 3MEQA 5KKAA 2PGLA 1PJ4A 4RF3A 4Y8VA 4BV8A 2IRWA 4ZA2A 1YL5A 3O38A 2AXQA 5IDQA 3I1JA 4LN1A 1EQUA 2HRBA 4ITUA 5DZSA 5ILOA 2Q45A 2VTDA 2W2LD 1X0VA 2Q1SA 1GEGA 4DQXA 2JJYA 4E13A 2QRKA 4E5YA 3ONFA 3DAPA 2FWMX 3P7MA 2FSVA 4EGFA 4IDEA 1NBOA 2FMUA 3IL2A 2UAGA 4FFNA 1DRVA 2ZQYA 1JU9A 2RBEA 3CKYA 2HAEA 3JQGB 1GTMA 5FWNA 5KVCA 4L4SA 5JC8A 4QECA 4UUMA 1ZJZA 3U0BA 4XYMA 2EGHA 4JBIA 4CM8B 2X7HA 1F17A 2EF1A 1EZ4A 3FN4A 3D4PA 4LW8A 3KEOA 4RDHA 2VHWA 5TGDA 4IQGA 1I30A 3WWZA 3G3EA 3KO8A 5G0TA 4IMRA 4CLOA 3HB4X 1KEWA 4PVDA 4Z9FA 4LMPA 3GDGA 3QY9A 2P9CA 5B4UA 3ABIA 1BVUA 3F3SA 1HEUA 4Q3DA 1KEUA 2GN4A 4E5PA 1DO8A 1MGOA 1NVGA 1YB5A 1PJSA 2NTJA 5K0ZA 3A14A 3PTZA 2DUWA 4E2XA 5KVVA 4N7RA 1DAPA 4BNFA 4HNHA 1K89A 3OQ1A 2Y05A 4F46A 4KTVE 4GX2A 4BNUA 1XIVA 1LSSA 1P74A 3VDQA 1KEVA 1LDGA 3QVOA 5J23A 1B8UA 5AXBA 1P77A 4CLEA 1GV0A 3UFXA 1CQJA 3MOIA 3LSYA 1E1LA 1O89A 3DMTC 4XDYA 5KNLA 2NVBA 1KC1A 4URFA 3WLEA 1I3NA 2HK7A 3VVCA 3K30A 4XWYA 5HBRA 3K73O 2HMWA 4TZKA 4AJKA 4WPGA 1I10A 2F1KA 1VL8A 1ZK1A 2YV1A 2Y66A 3JQAA 1EUDA 1I01A 2E4AA 3C85A 2GD1O 3RJ9A 3QVSA 3GG9A 2VTEA 4CMAA 2PK3A 1QG6A 3HUDA 3JV7A 2B37A 5ICSA 3HG7A 5EL0A 2WSBA 2Y67A 3H3JA 4EDFA 1C0KA 1U7HA 3PRJA 1MLDA 4KWHA 1QYWA 2BD0A 3IKTA 1WMBA 1U3WA 3RBZA 4AJLA 3B70A 4JX8A 2OZPA 4PRLA 4DREA 1ZEMA 4CM6A 3KUXA 4PLYA 1QORA 4QT0A 1E7QA 4TROA 4H7PA 3TZQA 1HDZA 2J5KA 3K92A 2BHLA 5KWEA 1EK6A 3GGGA 2IYOA 4ND5A 2BKAA 1QV6A 5IXSA 1I2CA 2Y99A 4NJMA 4MVJA 5G4LA 4BQPA 2BFAA 6LDHA 3RAJA 5DULA 4BNXA 1UR5A 3C7CB 3D5TA 1UP4A 1CF2O 1EEHA 3C8MA 4II3A 1HWYA 1MV8A 5TS3A 3PWSA 1ADFA 1GCUA 3PEFA 1Z82A 4LVUA 2ZCUA 1NHWA 4ALLA 4L74A 1YH3A 4DMMA 4M89A 2FY8A 2OMEA 5L7WA 4UVIA 1DDOA 4QX6A 2NACA 1N92A 1T2AA 5K6AA 2OP0A 3GRPA 1IB6A 5B4TA 2Y1GA 1X7HA 1UH5A 3GGPA 3OICA 1B8VA 4FOOA 2WEKA 4L4RA 4NIMA 3L0DA 3L6EA 3VZRA 5C5IA 2O4UX 1M76A 3CTMA 1HE4A 4B3IA 4TMFA 2A9FA 3EVTA 4IJVA 5GZ1A 1I2ZA 3HN2A 4WNCA 2B4TO 3K2BA 1V3VA 1C0PA 4Y6PA 1WVGA 4AFNA 4MIOA 4E21A 4FFMA 5B12A 1FDUA 3WJ7A 2ET6A 1D7OA 4IGFA 2Q4BA 4A5OA 3VH3A 1HT0A 3DZJA 4I8XA 3PHLA 1IL0A 3WQRA 1HE2A 5L40A 3HJAA 2C2YA 4Q3BA 3SXPA 3UXYA 3JD2A 2DFDA 5AVOA 4XKJA 3RBVA 4O63O 1HDXA 4AJOA 1E3WB 2Q4EA 3W8FA 4W6ZA 4D7AA 5I7EA 4DMLA 3WNQA 1HL3A 1Y8RB 3HADA 2IZ1A 4NZ9A 1EFKA 2CVZA 3COSA 1GYRA 1RM4A 1HE3A 2NM0A 1BW9B 3ZHXA 3W4IA 3B20A 4BO2A 1A7AA 4QTZA 1PGQA 1L7EA 1DC6A 4R5HA 1BG6A 5T64A 4WEQA 1HXHA 2AQHA 4PGFA 1KVRA 3GN2A 4WKGA 4RZIA 3INGA 3OETA 3GFGA 2DBQA 3WQQA 1GAEO 3JD0A 3SLGA 4G2NA 1DC4A 1E7MA 4L0QA 5F1PA 5JCJA 1K0UA 2ILTA 3ETDA 3AM3A 5JDCC 3HFGA 2H9IA 2DFVA 4YJFB 5HS4A 3ZGYA 2FOIA 1PIWA 5IXYA 2HCTA 4NBVA 1Z45A 2ZTMA 4TWRA 3RUAA 5EQDA 3ZH2A 2WD7B 3VC7A 3CMMA 2AE2A 1WWKA 3ZWYA 5KCZA 5I9LA 4X54A 1O94A 4BOYA 3CPSA 1XR3A 4H15A 1ZK2A 3AW9A 3T7EA 1K6JA 2GN9A 3Q6IA 4BMSA 3CXRA 3FI9A 4PG6A 3KLMX 1JKIA 5I8ZA 2DVMA 4W82A 2OORA 4IQ0A 1Q0HA 4CLDA 5CDUA 2J3JA 5JC1A 3ZU4A 1NPDA 4J1NA 2HDHA 2C82A 2QZ9A 5A1TA 1ML3A 3CH6A 3WX0A 5JS6A 4WUVA 3LK7A 3RD5A 3GEGA 1U3VA 5JAIA 4RLSA 2ZYGA 3UH1A 4CM7A 1O5IA 5KJ6A 3TZCA 1UZNA 1NPYA 2B83A 4OM8A 1SB8A 4RV9A 1ISMA 5C3MA 4YRBA 1ZFNA 3LT4A 4FC6A 3GVIA 1IZ9A 4DWVA 1TA4A 4J2OA 4DLLA 2X0NA 1P1HA 2R2GA 1GY8A 1DC5A 5B37A 1TT7A 3ROKA 3I52A 1V6AA 4BKPA 3DTTA 2D1YA 4H3VA 5JLAA 4D43A 3O26A 4E2ZA 3VHRA 4BNNA 5TF4A 1UXIA 2BLLA 1I0ZA 1OBFO 3H9UA 3I9OA 3JQAD 4CLRA 5JXWA 4OOEA 3DAGA 1NASA 4JGBA 4FIZA 1UXJA 4YAEA 1YRLA 4RVUA 4RL6A 3OJOA 4MVJP 4BNIA 4NU6A 3PGXA 3FR8A 3NJ8A 4LSWA 3PHGA 3KHUA 6ADHA 2YQ4A 2JFGA 3QJ5A 1KC3A 1T1RA 2PH5A 1WZEA 3G1UA 3T4EA 3DEYX 4PLGA 1GUYA 4FSHA 5CHEA 3PJFA 4ILKA 4LK3A 4RO0A 2VWPA 4W9NA 1I5RA 3MOGA 1XCBA 3H65A 1LDEA 3ASVA 3ZWOA 2H6EA 4HKTA 4WJZA 3HFSA 4UVDA 1H9BA 1NNUA 1VJ1A 3G1TA 4TRRA 4DL9A 3WGQA 2PLAA 2ZB7A 3IIEA 2VT3A 4M8SA 3SJUA 5TC4A 1DJQA 1GL3A 3LYLA 3V2GA 4E30A 1WPQA 2GR9A 1HSZA 3GEMA 4PG4A 5CG1A 3VZQA 2NNLD 3R3SA 4J49A 3H2ZA 3QRWA 4WASA 4JBHA 3E6AA 4XR4A 4D46A 1YS4A 1Q7CA 4NQZA 4B4OA 1WP4A 3CSDA 5TT1A 2DTEA 1VI2A 4JQCA 4F6CA 4YQZA 1BWSA 1F0YA 4BNLA 3DFZA 3VOSA 3H9EO 4R1NA 3AWDA 5DP2A 1FXSA 3VTZA 4ND2A 5EESA 3EVNA 2I65A 4JJFA 1BHSA 2CF5A 4JIGA 2Y0CA 4YB8A 4PVCA 3M6IA 4GL4A 4DC0A 4PLTA 4GLOA 3MJSA 1ZIDA 3SC4A 2PNFA 3Q9UA 4NI5A 4BNGA 3G0OA 1YE3A 3NT5A 2YUTA 3WQSB 3ZHBA 5CEJA 2GPTA 2IE0A 1TEHA 2UUOA 4L76A 3JYNA 1B3BA 3WYEA 3TOXA 2OL4A 2HK8A 4R3WA 4PCVA 4EUFA 4RVHA 1Y6JA 3ZWPA 4PG8A 5ES3A 1ISHA 2B5WA 1JKJA 4OSOA 2Z1NA 1H94A 1I3LA 3GK3A 1NYTA 1P0FA 4OKIA 2GF2A 2DQ4A 1EVZA 4LRSB 3JQ9C 2EGGA 1GZ4A 4CM5A 3ZW8A 4LVCA 2P9EA 1T2FA 2EJWA 4BIIA 1GCOA 3QV1A 1TXGA 3UOGA 3I9LA 3KXDA 5T67A 1IULA 5HRUA 2GERA 1I3KA 4ALNA 2O3SA 5G0VA 2BGMA 1I24A 3G17A 3VPXA 2B36A 1QYXA 3WFIA 4GLLA 1Z7EA 3FSRA 2VNSA 1KETA 1NFRA 2Q1UA 4NU5A 4YRAA 4J9UE 4JJGA 4CMHA 3LDHA 4IIVA 4RCVA 4FDAA 4CR8A 3UKOA 1QYDA 2CDBA 4ALKA 2I5PO 1GFSA 1X7DA 2NADA 4RF2A 2ZYDA 3E03A 1LLDA 4E2WA 5HWSA 4ZD6A 1QLHA 3WICA 4K26A 1DHTA 2ZTLA 1NQTA 1BXGB 3LT0A 3C7DB 2O50A 3DMYA 1K6XA 2OGUA 2ZATA 3FWZA 2GZ3A 3JQ7A 4KMSA 4AJNA 1GEEA 5TQVA 4BKQA 1LRJA 2FR8A 1BRMA 2DTDA 3BHIA 4B4UA 4DPKA 2GGSA 3QSGA 2XXJA 3DDNA 4EYEA 3L9WA 2PGJA 3GNTA 4E12A 1HDYA 4HY3A 1GYQA 1H6BA 1LRLA 3BTVA 2HMUA 1EUZA 1OFGA 1UAYA 3GVHA 4IY1A 1HYGA 9LDTA 1AHIA 5TIIA 1B15A 1ZMTA 3TRIA 2YQ5A 1WZIA 4TKMA 3WXBA 4P4NA 3AUSA 3K6JA 4O5OA 1YWGO 4GMGA 5JMWA 4UVEA 1BW9A 4NJOA 1H6CA 3ZN2A 3DBRB 4WLOA 3QHAA 1YBVA 2NTVA 2JD0A 3PK0A 3EUWA 1R16A 4DVJA 2Q1WA 3PP8A 3ZNQA 3AM4A 3VTFA 1R66A 1E7WA 4HFJA 3NAQA 3OQ6A 5MGBA 1XA0A 3AOEC 1ULSA 4M55A 3Q0EA 1M67A 2XF8A 4ZGWA 2LDBA 3HN7A 1SEVA 5EIOA 3W4JA 4MKZA 1YVEI 2XAAA 2VYND 4OQYA 2NV6A 1R0LA 3PPIA 2VZ8A 4OOFA 3TWOA 4JP3A 1H0KA 1G0OA 4YDRA 2DBZA 3ZZNA 2D4AA 1SC6A 4NDNE 4DIBA 2OBYA 2TMGA 4CR6A 3ROMA 1GUFA 4NR0A 1KVSA 1QSGA 3W6ZA 3D3EA 3HE3A 3ZWMA 2AG5A 4AJPA 4K28A 4W99A 4Y67A 4IXWA 3N58A 2ZB8A 4CR7A 2O3QA 4MO2A 1FMCA 4MIYA 3LF1A 2ZIZA 1JAYA 1V3TA 3BAZA 4O6VA 5ENVA 4AG3A 3AJRA 1CWUA 4P22A 4TZTA 5CDGA 4EITA 3QLJA 1Y7TA 1YQDA 3GUCA 1Q0LA 4WLUA 1PGOA 4QFCA 2JL1A 4TRNA 3HDYA 5A03A 4R54A 4KWIA 1JVSA 1EE2A 1U28A 4FQ8A 4JK3A 3HQ4O 3ICPA 3N7UA 3FPCA 2JFHA 1K6IA 3JYPA 3QQPA 1DIHA 2Y0EA 3KYBA 1NQAO 2NUAA 3SJ7A 5BSFA 1AE1A 1C3VA 3FHLA 1KS9A 1XGKA 1YOVB 2G0TA 3GOHA 1JAXA 1M2WA 5DBIA 4CM4B 3R3JA 5FEUA 5THQA 5KIAA 5JDCA 5H83A 1N7HA 4BNZA 4PLFA 3WIDA 2EKQA 4KOAA 4BMVA 1Y9EA 3PQDA 2RAFA 3RFVA 3LU1A 2P4HX 4I08A 1SAYA 1NR1A 4BMNA 5ER9A 2AA3A 2PKQP 4HFMA 4QFDA 3DBHA 3ZV5A 4ZRMA 4AL4A 1GQ2A 5A9SB 1EVIA 4N5NA 3HWRA 1C1XB 3OMLA 5EINA 1GR0A 4BKRA 4CLOB 1FDWA 3C1AA 1D3AA 1N8KA 3A9WA 3ITKA 4GKBA 4WCFC 5ITWA 2X6TA 3U4DA 5KJEA 3JQAB 1NHGA 1EDZA 4OO3A 4UULA 1X7GA 2V7PA 1JDJA 2BFPA 1ISFA 1LTHR 1LSOA 4WCDA 5A9TA 5AQ1A 5EJ2A 2X5OA 3FTNA 1PR9A 3GZNA 2A4KA 1HYEA 4BKUA 1C14A 4DBVO 5MDHA 1N1GA 4J0EA 4D3DA 3WYCA 4CMCA 2WE7A 4PZDA 4XCVA 3PWKA 1H93A 3SX2A 2Q46A 1B26A 3MJ4A 4WEOA 4NJMB 1YB4A 4MKXA 4XB2A 3JQCA 3PHHA 3V1YA 4YR9A 1ZMOA 4J16A 3NT4A 2H63A 3LC1O 4BGIA 4MVJH 1GADO 1B3RA 1SEPA 4J9VA 3MTJA 5IDYA 1T2EA 5TJHA 1A9ZA 4L73A 2ZKLA 4XYBA 4MVJE 1N9GA 1K3TA 5A9SA 1E7RA 1NR7A 3DQPA 1LDNA 4D3SA 1Y5RA 3OF2A 1RWBA 4CMKA 3D1LA 1YBAA 1MFPA 1A71A 1UDAA 1MC5A 2NVUA 2DPGA 5BQFA 2CZCA 4J1TA 4PG7A 4XZ3A 2POQX 4IDFA 3H9GA 2XPCA 3H3FA 4ZU3A 5ENDA 3GPIA 3RU9A 3KSDO 3ZV3A 4E5MA 3JQGA 1TLTA 4OQZA 1I32A 3JYQA 4RDIA 4I9HA 3VZPA 2VZ9A 1SZJG 3AOGA 5BNFA 3ZNOA 3F4LA 2Z5LA 1P33A 3V2UA 5KVQA 3OH8A 1M75A 2ZYAA 3BMNB 3S2IA 3U49A 1MXHA 4B79A 5L4SA 2NTNA 2DAPA 4QEDA 2YJZA 1YL7A 3OA0A 3RFXA 3I6IA 1GPDG 4MJLA 4BNTA 4BUCA 1F8GA 4F6LA 5I9NA 1VSUA 5F5NA 1CIVA 1DRUA 4I5FA 2C5AA 3GA0A 2P2SA 2IODA 3JQFC 2BI8A 3CIFA 3L4BC 4DLBA 3GC6A 4DC1A 1EBFA 2W2LA 1SPXA 1U4OA 1FDTA 4DUPA 4CMJA 4GVLA 1VPDA 3NKLA 4R5MA 2X1HA 3EHEA 4Y6SA 2W98A 3NV9A 2D3TA 4DPLA 4ZRNA 2NU6A 4DPMA 4W7IA 3OIFA 3K2EA 1CEQA 3GNQA 3JYOA 2RIRA 4UUNA 1YQGA 2X5JO 2P4QA 4OH1A 5K9ZA 2G76A 2QYTA 2FPGA 2OXIA 3RUHA 5B1YA 1AHHA 3W8DA 4BO7A 4R16A 2JHGA 1O8CA 3JCZA 3TSCA 4KUHA 1RKXA 1R4MB 4J90A 1MP0A 4IJKA 1LRKA 3FNHA 3KYCA 3X2EA 4J2HA 5JDIA 1DC3A 2HK9A 4H16A 5DOVA 1NWHA 3AY6A 3GH3A 3AU8A 1UXGA 1Y1PA 3R6DA 4A27A 3F5QA 5A05A 4N18A 3IQDB 1E92A 4FN4A 5L95A 4ESOA 3WGTA 1NQOA 1ZW1A 4XGIA 2VOEA 2O3UA 2FN7A 2J5QA 3JQBC 2JHFA 4XX0A 2C07A 4Y9DA 3SEFA 3WB9A 2GCGA 4DGSA 2YY7A 5JNLA 3TF5A 3HNPA 3M1AA 3NX4A 3IJPA 4IPTA 1PQPA 2EEZA 2NU9A 2NVUB 1E1MA 4UUOA 4BNHA 3B1FA 4J4TA 1WMAA 3EC7A 2HMVA 4AVYA 4BGEA 4CMIB 4BGUA 1T2DA 2I6TA 3Q2IA 1OOEA 2P9GA 1DIGA 2OUIA 1PJQA 3ADPA 3BMOA 3OJLA 5U4QA 4YACA 4U5QA 5L4LA 3ON5A 5CDSA 2Q50A 3RUEA 4B3JA 4ZN6A 1XKQA 2E37A 2EG9A 4XQ9A 5DNAA 1A4IA 3FRJA 3ADOA 3VAZA 5IF3A 1VSVA 2QYSA 1U5CA 4BQRA 1IPFA 2FRDA 1J5PA 4Y98A 3LQFA 4GWKA 3TJRA 2HJRA 4AJJA 2X0JA 4B4VA 1E0DA 3U4IA 1HETA 3E9MA 4M1QA 4Q3NA 2X0RA 4WLVA 3DB2A 3S55A 4B7CA 4CM3A 4B8WA 1A9YA 1L1FA 4J7XA 4IJUA 2V6MA 3H5AA 3VDRA 3DONA 1J6UA 4PFJA 3WTCA 4EZBA 1FF9A 4D42A 3QE3A 2VUUA 1CQIA 3WGZA 5G4KA 3T4XA 1IHXA 1GZ3A 4RZHA 3O9ZA 4CODB 3A06A 3Q2KA 4DIOA 4XA8A 5LDHA 3JQDA 3IDSA 1VRWA 1ADGA 2C2XA 1YONA 1BXKA 4WLFA 3C3XA 1IYZA 1HF3A 5COBA 2ZTUA 4MKRA 5FI3A 1B16A 2WJPA 3WJAA 5LCXA 5F5LA 1U8FO 4LMRA 3PLNA 3D4NA 1UZLA 3U4CA 3W6UA 4YRDA 4RLHA 5JE8A 3WOHA 1S7CA 3PYMA 5TNXA 2Y1CA 3OECA 3B1KA 2YHIB 2C0CA 4B3HA 3ETEA 5JFOA 2X9VA 3PZBA 4INAA 1XELA 3UGKA 4A10A 3UCXA 3S2EA 2DBVO 3MJVA 4R9RA 4YJGB 4BVAA 3ZWXA 4BO4A 4XYLA 1P1KA 5COAA 1XU9A 1I33A 3SVTA 4CM8A 3GR6A 2QHXA 1ZKMA 2PD4A 1EVJA 3GG2A 3PDJA 4ND1A 7MDHA 2PZKA 5CP8A 2NQ8A 1MA0A 4ALMA 2OOSA 3ANNA 5THKA 4L75A 1WXDA 3W1VA 3Q11A 3QWHA 5BSHA 3LT1A 3C1TA 4B4WA 3FR7A 1EK5A 1DFGA 4N5MA 4EI2A 4K1LA 2VOJA 1RJWA 3KYDA 3T7CA 1LX6A 1LC0A 4J7UA 4TKLA 2GZ2A 4GSKA 5F1KA 1EFLA 2C7GA 2J5RA 2H5LA 2WYWA 4XEHA 3U62A 1GU7A 1E5QA 2Y1FA 3DZGA 4EUHA 1Z7BA 1N9GB 3I9NA 4GAEA 3QVXA 4Z0HO 3ZHYA 3HDQA 2EP5A 3PJDA 3CZMA 2HQ1A 3AM5A 3S1LA 1DLIA 5A3JA 1CRWG 3ENNA 5IFLA 3IP3A 1XQ6A 5IN4A 4R1TA 5DOZA 3F1LA 5A02A 4LRTB 5G0UA 1HLDA 1PJ3A 1I2BA 3I4FA 3U9LA 1ZCJA 2QRLA 3WMXA 4QO7A 2VN8A 4WCFB 4FFRA 1RYEA 1ZSVA 2JCYA 1WAMA 2I9PA 3O8QA 4FFOA 5IG2A 4LISA 2J3HA 4MVJF 3D64A 2EV9A 1R15A 4IDCA 5F21A 2A94A 4IDGA 2GRAA 3ANLA 1X15A 2FZEA 3O03A 5JO0A 3SLKA 5BSGA 2X9GA 1WDMA 1N7GA 3VPHA 2VCYA 3G49A 3DTYA 2Q49A 5FI5A 3VVBA 1F06A 3H9QA 2C7VA 1LUAA 4IGEA 2VWGA 4M54A 1Y5MA 3TZHA 1C1XA 3NTOA 4N54A 4P4LA 2PD3A 5T8KC 4OSPA 2CVQA 2FR0A 1PWXA 2DT5A 2VRCA 3BMOB 3OHSX 3RI3A 2IXAA 4N5LA 1HKUA 1ZNQO 2BF7A 1XG5A 3RC1A 5GZ3A 3P2OA 5L3ZA 3ASUA 3I3OA 3LF2A 3NDIA 4BNVA 2BELA 4OL9A 1LQTA 4R51A 3DBVO 1SMKA 4QXMA 1BXZA 3ANMA 3INTA 2J8ZA 4M86A 4YJHB 4DXHA 2JAHA 4BS9A 5TSDA 2WM3A 2CY0A 3KB6A 3OIDA 2C29D 1LDYA 1BXGA 3UICA 3PWZA 1AXGA 3JQ9A 5LC1A 3MZ0A 2X23A 3GPDG 2ZJ1A 3K9QO 1LNQA 4FCCA 3RC7A 1IHYA 3FPLA 1ZK3A 1ZJYA 1KBZA 2O3TA 4R3NA 2HJSA 4RQUA 1MC4A 3ZWAA 4XQCA 2OO5A 5B4VA 3FTPA 3MJCA 1WW8A 1F12A 4G65A 4CMGA 3VPSA 2X86A 1C1DA 4BV9A 2OP1A 1K5HA 4XR9A 4Z6KA 1W4ZA 1GZ6A 5IZCA 5T6BA 3PJEA 4J6FA 4PLZA 3F6YA 4CUJA 3I83A 4HFRA 1YDEA 1R4NA 5JBIA 3L6OO 4CLHA 1SCUA 4QQRA 4CQLB 5GMOA 1XEAA 3HSKA 4YAKA 4J4BA 1E3IA 4WECA 4PIVA 3LZ6A 1F8FA 5CAEA 2WD7A 3K31A 4RORA 1TI7A 3E9NA 2P68A 3MJTA 1U7TA 1PJCA 2JFFA 4GI2A 5DBFA 4BO8A 5JAZA 1WDKA 4UEJA 1ISGA 2VRBA 2YDXA 4EEXA 4W7HA 3PHIA 3DZKA 4R9SA 4HXYA 3UVEA 3TZKA 3NYWA 1GV1A 4YT5A 1A5ZA 1ENPA 2D0IA 3QA9A 4ZJUA 2IYPA 1PTJA 4W4TA 2NQTA 1JWBB 4R68A 4CV1A 4PLWA 5K6AC 1B8PA 5T8KA 2HMTA 4OJNA 5A06A 1MUUA 4HP8A 5CFZA 1HTBA 5KJ1A 2GDZA 4NBTA 1NFQA 1PGJA 3I5MA 2GASA 3RASA 1CDOA 3UW3A 5C7IO 4YPOA 2C20A 2UVDA 4DQUA 5TX7A 1P45A 2I66A 3WWYA 1BGVA 4Y6RA 3HZZA 4Z0PA 4E5NA 4UEOA 4WNIA 4XYGA 1ORRA 2WE8A 4EJ6A 1T2CA 4RPGA 3VKUA 4JCOA 1SBYA 1CYDA 1UAGA 5CEFA 3WGOA 5IDXA 1HDCA 3DWFA 3E5RA 3IJRA 3OEWA 2DUUA 1Y8RA 3DOCA 3BMQA 2PTGA 3LT2A 2CSUA 2PV7A 2BMAA 3WGHA 3WGGA 2B69A 4LCEA 3JYLA 1IUKA 3VH2A 1DLJA 3NRCA 4XDZA 4QSMA 3WIEA 3ENKA 5KJFA 4IZHA 3OJFA 3DHNA 4RPKA 4KUEA 4RVFA 5IN5A 5JMPA 4CM9D 2AEJA 4EEZA 3AUUA 1QP8A 3KTDA 2I3AA 3DZBA 5I8WA 4JNKA 4CMEA 3DR3A 3KBOA 2A35A 3JQ8B 4DQVA 3ONEA 2V6BA 5COQA 4UVGA 1JWAB 2VWQA 3BMCB 3DAFA 3IUPA 5A3VA 4MDHA 1H9AA 4P38A 3A1NA 1P1FA 1TT5B 4CUKA 4NMHA 3WSVA 1OI7A 4GSLA 1DPGA 4DRYA 3C7AA 4IBOA 4GMFA 2ZB3A 4JN6B 1YGYA 5IZ4A 3BXXA 1GYPA 3NT2A 2Q2VA 3AK4A 1CJCA 2AG8A 2VQ3A 3H7AA 5A9RA 1VL6A 2BFOA 2D5CA 4MVJD 3H9JA 1DIAA 3DBLA 3W4KA 3L9XA 4QO8A 4RVSA 3FWNA 2WYUA 1B14A 1ZEJA 3ZDFA 4RF4A 4NBWA 3GVCA 3GVXA 3GAFA 3QVWA 1X14A 3H6KA 3F1KA 5DT9A
chains in the Genus database with same CATH superfamily
3WBKA 4Z4CA 4FE3A 2W6IA 2OHJA 2PWZA 3NUQA 5ETJA 2RGAA 3REOA 2C7RA 2Y1OA 1UK8A 3DBHB 4AMZA 5A5VA 2OBMA 3E3LA 2HGSA 2X0IA 3D81A 3OZBA 1DRWA 4MYUA 4WK6A 1X3SA 3VNRA 4JI7B 1ZRNA 1Y8QA 1SC3A 1QCYA 3OZIA 1SH7A 5CT5A 1CR1A 3KC2A 1Y5NA 3WBBA 1R10A 2WM8A 1TKBA 1GXSA 3D3WB 4DADA 2AW5A 3I9MA 1TM2A 2X1VA 1MEOA 1W4AA 4DSTA 2WMYA 1HZZC 5I7SA 4GZLA 4B3RE 1Q7GA 2W6QA 4TSKA 1P6QA 4FU0A 3VPGA 3RU2A 4OQNA 5DX0A 2QRVA 3T5MA 3PDUA 3GMDA 1J42A 3OJEA 4P4SB 4ZHQA 4DOMA 2IYZA 3AW8A 4X6YA 4UAJA 3WGYA 4DA9A 2AF3C 4DY4A 1WZ2A 3MBOA 2GN6A 4DLNA 2Y76A 4LA4A 2Q5FA 5JXIA 1O9HA 4IHJF 3MIIA 4LXXA 2X0FA 4QXAA 4HB2A 1NBAA 4TMVA 3LHKA 1QYCA 1JTVA 4FS8A 4OMUA 1NXTA 1QE0A 2ZYTX 5TY0A 2BJVA 4R2MA 2VDLB 4U7WA 5JCJD 4ZVSA 4KAJA 1P9NA 3RK0A 2XMCA 5CHYA 3T1QA 1FYVA 5FPQA 1ETHA 1P2BA 3UAOA 4CCWA 4JI6E 1E32A 3DBRA 2Y1KA 5FBRB 2QQ5A 1K4KA 3A36A 1SXGA 1T0UA 2ISCA 1UJNA 2ZR9A 4H7JA 4W5RA 2J7PA 4CQMB 2GEDA 4IXNA 3L7IA 1Z75A 3W7BA 3QEBZ 3K5IA 2YWCA 2V96A 5ARCA 5BWNA 3QU4A 2A84A 4GQAA 5LA6F 1HFEL 2PV0A 1GGFA 3FGOA 1I0LA 1ZG3A 5H02A 1J8MF 2Y9PB 3OM9A 4CPDA 4QASA 1O94D 1FPQA 1NQ5A 1U0OC 3RCBA 1E2MA 1ZIOA 2C4HA 4DLTA 1MX1A 2QNBA 2N47A 2O8FB 1QHYA 1SCJA 3ED1A 3R7WB 1OLXB 3P9QA 4CIVA 1UP6A 1GAQA 1O96A 2XCIA 3HUTA 4H7KA 1DTEA 4YI3A 1BDBA 3VR1A 2LE0A 3D8UA 5HGJA 4TYNA 5HJ2A 1T26A 1OYOA 4AO8A 3C3PA 3ABOB 1XZMA 4L50A 4WESB 3DOHA 3GVPA 5KKCA 3BZBA 1TNDA 2GTIA 1EWVA 3RTBA 2ECKA 2QJOA 1A1GA 4DR6E 1A8QA 1E8MA 1PFYA 2Q9CA 4YROA 4CV0A 4IXTA 2H3EA 4EABA 4EHHA 2X5KO 1EB9A 3TKLA 3HM9A 2QTVB 1LB1B 3LD9A 2Q4TA 4QYTA 3KYCB 5AHXA 4G24A 4HGNA 1LVHA 1KDRA 1TAQA 2K4MA 4GOLD 1VGVA 1TIKA 4KE6A 2J3KA 4Q4AA 4A2QA 4KWYA 3P2EA 4O2BA 3C3EA 1FNDA 2JASA 2RFLA 3AF2A 5E6SA 4HRAA 2P4SA 2WLTA 5KTKA 5LLSA 5KAMA 3ZWBA 4ZHSA 1ZICA 4YTEA 3FHTA 5E3JA 1L5YA 3RV4A 1YRBA 5AKKA 3Q7IA 2HFJA 3NM4A 3RRJA 2ZM5A 2Z95A 4P4UA 3VR4A 4GRAA 5EERA 4I8OA 1SXJE 4I81A 4TT3D 3RWBA 5KI6A 1TN9A 4RKFA 3ASYA 2B3DA 2QEQA 1DC8A 1GTJ1 2RDMA 3DW3X 3UAGA 3GBPA 1O2DA 3P94A 3ZDXB 3ONNA 1Z2EA 4LC1A 1PZNA 5FWDA 4CL8A 4D3FA 1UAAA 3ESDA 3VISA 2YCLA 4X92A 1TJ4A 3B3GA 4U02A 3IT3A 2Z3ZA 1C80A 3PPVA 4GW3A 1IG3A 1YHYA 1QANA 4V0OA 4ND7A 1WF3A 4U0KA 1VPLA 4RWEA 4UC0A 4D4LA 1I9CA 1KEEB 1TT5A 2I2AA 2WVGA 1LLUA 1TJ3A 4RSMA 4AQDA 3T95A 1Y1KE 4IGKA 2R6ZA 5BW8A 4L0MA 1D1PA 4BWFB 4NARA 3A9TA 4MQMA 4BPBA 1HDEA 4EBBA 3KE8A 4QLOA 1T2UA 1Y98A 1NJFA 1J1UA 3BSWA 4X1KA 3LUAA 2WV9A 3WLRA 1G41A 3CRQA 4O5GA 4Y0AA 1RNLA 4TVOA 1TYAE 3MCVA 4GGOA 5CU7A 3IOCA 5G0SA 2PX5A 4CDRA 5JWRA 1MGTA 2L2KB 2UVQA 4G0PA 4LZZA 4XH9B 5CITA 1GL6A 4FOTA 5HZHA 3H2YA 2X13A 3PQ6A 5HIMA 2Q8QA 1IXRC 4ARZA 3ELBA 4DW8A 1RC8A 4JI8B 5CFOA 2FF7A 4RF5A 1J8YF 1PJLA 3IKMB 2NUTB 3OSZA 2F9FA 4CQLA 2OV6A 2X4LA 1UP7A 3MSCA 5JG7A 3KSBC 1NMEA 4C4TA 2IS1A 1LLMC 1FFGA 1ID1A 1ZKDA 2QMEA 2WZQA 3LQYA 1K9SA 4L27A 1Z12A 1EUCA 3RF6A 4EUKA 1NAHA 1FDVA 4FCWA 3QLVA 1ANKA 1V2GA 2FSVC 2QNIA 2V58A 4K3VA 3VPBA 4OCZA 3BF2A 5DMXA 4GP6A 3N0RA 5LP6C 2GNOA 3PDWA 1OR8A 4OFBA 2LUPB 1Z6XA 3OOHA 2OAP1 4I2VA 4URVR 4FNGA 5EWMA 4O8ZA 4EVSA 2PJRA 2P41A 4JJ4A 4AJEA 1UPTA 3A58B 3H87A 2WTAA 3A32A 1P18A 2GLTA 2R1ZA 3AR5A 3EW9A 1ZD3A 1PZHA 2ZIGA 3HWX1 1TAGA 1Y9AA 5EE5B 3ZV4A 2V8BA 2DQZA 4Y1FA 2V1UA 3K8QA 1CK4A 1A7KA 3FLEA 3WGLA 1SOAA 2Z5FA 3UOWA 3ZKWA 3ZH9B 5JAQA 4GGPA 1GKKA 2VP5A 2EKBA 4MTLA 5PNTA 5FOQA 2YJ5A 4ZYXA 4R9UC 4OBEA 5IYZF 2EOQA 1KGDA 4KTTE 4GMXA 2YOFA 1ZX1A 2O6LA 2Q5LA 2Z9CA 2OR3A 1PD0A 2PX4A 3CFYA 4FX5A 2QUJA 4EUEA 3ROTA 2WT4A 3KJXA 4LGMA 4DV0E 1AQ6A 3JWEA 1A9PA 4TS1A 3WNVA 5FEMA 3E8MA 3AEYA 2AHOA 1P91A 1MEJA 1PGPA 3IHTA 5DNDA 3AI7A 3B7WA 1EGAA 1HEYA 4ARUA 2NU8B 1R3UA 5G3ZA 1X42A 4HTAA 1JG4A 3AKDA 5C8ZA 1XB2A 3BDVA 4GC9A 3WYNA 1EUCB 1VIAA 1FE8A 1BS2A 3EW7A 3QW2A 5JI3E 2PZJA 4GX0A 4RMJA 1G9XA 4G0VA 4AX8A 1DGQA 2FRDC 3RC2A 3Q12A 2PYZA 1CQWA 1GPJA 2F6RA 2P7HA 5F64A 1F48A 2Q3CA 3MSWA 1OIWA 1PJBA 2G08A 2G4VA 3DA8A 3LKDA 3R0IA 4HJRA 3PIRA 4MWBA 3SCZA 1I1NA 3A4MA 5ITVA 1HTTA 3T99A 5C8YB 5I7RA 2R87A 2ZZMA 4A2WA 3JPWA 4UZSA 3RUPA 1PR3A 5EIBD 1KMHA 2ZE5A 3CCCA 1CG6A 3PFBA 1HT3A 4ZQCB 4Q3LA 5CPBA 4E3ZA 2X7XA 1CUZA 3UB2A 4DGQA 1SIOA 1DVRA 4ZJPA 3QF7A 4UOEA 4TKVB 1MQSA 1T1IA 5HUHA 3KUCA 3BJRA 5JEEA 5JLJA 5I9MA 1Q14A 1TYZA 2V6JA 5I9IA 3GNSA 1A82A 5CXXA 2AQKA 5CH3A 3UC9A 1G16A 5IJ0B 3CLSD 3EN0A 1JKMA 3O2QB 4BFCA 1OH7A 4AC9A 2YXNA 5A69A 2DX7A 3V4ZA 2OFXA 4DB2A 2QTHA 4BLTA 2IDJA 2VAVA 1WNTA 4ZQFA 5KPDA 2H5IA 4H27A 3BGSA 3BX1A 1RFLA 4F3NA 3GP8A 3DTNA 5DGCA 1PDVA 2ZK7A 4BU1A 4C21A 3WWCA 1OLSA 2CFCA 3EZ9A 1E8NA 1QR6A 4KH0A 2C58A 4KXYA 3RYCA 1R0YA 1M9NA 4IWYA 3AB7A 4A73A 1ZLYA 3M2PA 1A4RA 1DAOA 2A57A 3UNXA 6AT1A 1PNOA 1YR2A 4EJFA 3EXIA 5HDQA 1X1AA 4NBRA 2IUEA 3E05A 1E1QD 1C3JA 1RQ2A 2IEBA 2K2WA 3GGOA 2R00C 4JB3A 3SYKA 4BZXA 4IKEA 5T6JA 1MB4A 1KR5A 4MVJM 4O2BB 2HHCA 4FFLA 4IO1A 2NU8A 4I14A 3R7NA 1GILA 4ZYEA 1JGTA 2PZBA 4GR5A 4HXFB 3LZDA 4KAXA 4OY3A 3SDSA 3H9CA 1S2MA 5HXAA 3TFOA 2XTAA 2AEFA 1MMFB 1FFXA 1VM6A 1Y1SA 4RK1A 3W1WA 4EVRA 4EUSA 1NLYA 4ZZ2A 4LHYA 1TCVA 2PYIA 3RU3A 2EOJA 1ENZA 1G8FA 1OXBB 3C24A 1BFDA 2LZ0A 3NVKI 4HS4A 4CKWB 3SVZA 1SKUA 2B0CA 4UOQA 1NJ2A 1SUEA 2ZITA 3IAHA 3SNKA 1O77A 2L19A 2PL3A 3R7DA 3Q41A 4ZTZB 3V1TC 4URZR 4I9NA 2F67A 4HR7A 3OCCA 3IESA 3OZEA 2MT9A 3PI7A 3IHWA 4M99A 2JJQA 4RJLA 4TTJA 4A1OA 4BMZA 4YUWA 3O4IA 3LYAA 3GLHE 4OJYA 4G97A 1XVIA 1P4HA 3PDCA 5CTJA 2Q62A 1DMRA 4E0BA 5BRJA 4DA6A 1HSOA 1E6CA 3EVAA 2VO1A 2VLIA 3NBQA 2IS4A 3U7QB 4OHXA 5DHAA 1U63A 2W90A 4R0VA 2WJVA 1OKKA 4NYJR 2CV0A 2P1RA 4CQMA 4PGGA 3HR4A 3HV0A 4OQEA 4Z86A 4EKIA 5KVSA 1VC2A 4BP8A 1EXNA 2ZQZA 4E22A 4NXNB 1TQ8A 3DXZA 4Q15A 4BY9E 3R77A 4DMIA 2AXPA 3DHVA 1ESNA 1KZ9A 1SO8A 2DPLA 2I67A 4H6XA 2GPSA 1G8PA 4K9LA 3BE8A 4KDFA 4QQ8A 5BXQC 4H4DA 2OG2A 4GMHA 5BVHB 3DBLB 3FNRA 2P69A 4RTKA 2XWQA 4LJLA 3MHTA 1SVSA 5FWYA 3PXUA 4D2IA 3HABA 4G5GA 1FS6A 5JWHA 5HTOA 3WLLA 4DLWA 1ESMA 2GEKA 4FS3A 3OEEA 4NQRA 5AKXA 5KYWA 3HJFA 1LQUA 2X4IA 3D7NA 5JCXA 4MKIA 4P4SA 2ACEA 3CZCA 4BNWA 3NIBA 3G0HA 4LWQA 2OAGA 4YRFA 1H23A 2X8JA 1NM5C 1RQLA 2KBEA 1RQ7A 2V03A 1ISSA 4L0CA 4QQFA 4AY4A 1P80A 4O33A 4BVEA 1N77A 5BWLA 5JJCA 1XRQA 1NW7A 2NT4A 1Z6ZA 4IIXA 3PD1A 1O95D 3BEOA 1TA0A 1GFWA 3R8FA 3BTSA 2Q2NA 1VL0A 2WDZA 5EXTA 4J0KA 4GFDA 1DT3A 1O95A 2EM6A 1KP2A 3IWDA 3IUJA 1TF7A 4KXUA 5IV8B 3FNEA 4YJHA 1DV2A 4HD8A 5JSYA 4F4HA 4JH0A 1QS0A 1DBSA 5TT0A 4C4XA 3K0FB 3FROA 3LBYA 3RUCA 3T6KA 1NVTA 2J4DA 1LC3A 1HYHA 5B1SA 4F7WA 2RKOA 4M36A 1QRUA 3KVNA 1M1ZA 5DVZA 1C0LA 1G4HA 1M6HA 1UK9A 1W9HA 1DQPA 2F8LA 3H5OA 1Z5OA 1NI5A 2DPHA 4O2LA 3L01A 4WOCA 5AIAA 5C5CA 2CK3A 4K0KE 2XNSA 1MQAA 4RD6A 5JDIC 2HR1A 3KKLA 1NBME 1AZSC 3K0CA 1EMDA 3PHBE 2IUSA 1V7ZA 2YH2A 1QGYA 2F43B 2IVZA 3EUAA 3GLKA 3IKVA 1FXWA 1KYXA 1P1IA 2O20A 3E2MA 4FJ0A 3SJAA 3U4QA 2BKLA 4NP6A 1WCV1 2A25A 1OTHA 1WHSB 4J16C 4NYMQ 4QHTA 1L4BA 4TQGA 5EKUA 1VKNA 4LECA 4WYQB 1ZVQA 3FWPA 1DJNA 1KVTA 2R5WA 4GVPA 1VGQA 1ZH8A 2O19A 1G6Q1 1Z7GA 5F3WA 1A5AB 1E3WA 5LQUA 3E3OA 3IR6A 3QX3A 2HH9A 3ESZA 4N5HX 4DILA 4MS3B 3NIWA 4HSGA 3PNMA 2W22A 5D86A 1WKCA 3ZU2A 1GQYA 4BKOA 4NOJA 4FFPA 3EUEA 2HU8A 2O52A 3PQFA 3P0FA 3V2HA 4IFTA 1CLEA 2GO1A 2YZKA 1Z2NX 3CUKA 1TMOA 2VSOA 3K1JA 3MCAA 1AH5A 1J99A 5DHTA 4E7PA 5CYOA 4KHPE 5KOHA 2GESA 1QV7A 1UXKA 2ZDQA 2VJBA 1AGPA 1LK0A 3VDNB 4E4YA 3LO5A 3UGKA 1YCDA 3RFUA 3RUIA 4KIJA 4ID3A 1D2CA 2QXUA 4MP8A 1RAEA 3FNQA 2A92A 4RW0A 5ADHA 2LMZA 1DOAA 2HDWA 1RZRA 4XD2A 3EEOA 1FNNA 1ONOA 2JFVA 2NG1A 1RZRD 2R11A 5C4MA 3ZPXA 2DKNA 2RGBA 5JD5A 2YMLA 3JAWA 5H59A 3JQBA 1ONNA 1YZUA 3VYTB 3R6TA 1JQLB 1KO4A 4I4IA 4XWOA 5H81A 1R6TA 3T0FA 3ZV7A 4BEVA 2LDXA 4UXIA 2OESA 4C07A 2YU8A 3HC7A 5MGNA 4FZRA 1Y5LA 3JQ6A 1LJ8A 1NDQA 3A4NA 3AG5A 1QJ4A 4KBYA 3OM8A 1SQ5A 2FX3A 1N6KA 2EP7A 2NZUG 3MT7A 3JD3A 5FT9A 4DV0B 2O2DA 4ZVTA 3NTLA 1IPEA 1B76A 1SCQA 1NVVQ 2BHSA 3DL2A 4IXDA 1WD5A 2ZRJA 5EUCA 1QIMA 4HHEA 1D7AA 2VPQA 4R81A 1EGMB 4DQKA 2QW8A 3EODA 4FR0A 1N78A 2HRZA 1XZBA 5CDTA 5KL3A 2LTSA 1MXFA 4O0LA 2I3GA 4DA4A 2O8EA 4R41A 3KQMA 3K2QA 2FMHA 4NEHB 4ND8A 3WWDA 2WJJA 1HX7A 3W77A 5CGQB 3MUOA 1R4MA 2AMFA 1QLJA 4C4OA 2ON6A 3LUDA 4H17A 1V7QA 1DINA 2FSFA 3A9CA 1UQRA 3MLEA 5K05A 4Z8XA 1NFFA 4IDHA 3IURA 1ICEA 1ZC4A 2AOVA 2X19A 3D3WA 3GT0A 1U02A 2KJQA 4RM2A 2QXYA 1V39A 1YJBA 1Z4NA 1KU0A 3TM4A 5K0NA 4Q7QA 3N0VA 3OKPA 5TEVA 3RG2A 4BC7A 3N3AC 4B34A 3FDJA 2G5TA 4XIYA 4DLYA 4QBTA 3H4MA 4ZZIA 3NBMA 4A03A 1GVNB 2P27A 4JQOA 3QJGA 1DTWA 3UHAA 1TW3A 3GRRA 5DCLA 1RLTA 1NPTO 3QYFA 6Q21A 3THXB 1GGHA 4GR4A 2HQRA 3KHTA 3IR5A 3O82A 3GLFB 2WWVD 5TQ2A 1VFNA 3JWJA 1Z1BA 2WTBA 1QONA 4FJ2A 4RMGA 1M5RA 4NULA 4JROA 1U1GA 2J0UB 2HU2A 1TB4A 1WEKA 3X44A 3AM1A 2NXWA 4Q39A 2GXAA 4LAFA 1MH1A 1DAIA 1H5QA 1VL2A 2C2HA 3IO5A 3IULA 4HN2A 3O3NB 4PS1A 2AG0A 1M2OA 2ZTVA 3K7EA 3CF4A 4WD3A 1OV6A 1KQNA 2C1ZA 1XXHE 4FEAA 4G86A 1RM5A 2GF0A 2P5TB 2I0FA 4JUDX 4P8RA 4V0MA 4UFOA 4BBYA 5EZYB 3RUDA 3D8RA 1T24A 3EGOA 4IO0A 2CT1A 4UBOA 3S7ZA 2NIPA 3ZXXA 5EPOA 4TL9A 3HB1A 5TDHA 3QKSA 4NFSA 2D1TA 2JBWA 3GN1A 2E7ZA 3OBBA 4NL4H 3ELYA 4HNGA 1VE9A 4MAAA 1F14A 4DUZB 3AC0A 5KYYA 1BVRA 3AHGA 4F2PA 4YT4A 4Q9AA 3LBAA 1L7NA 2BHTA 1U4SA 5JD3A 2FTXB 4J0IA 3LL4A 2ENAA 2EHDA 4J0JA 4DMHA 3WL6A 4B5KA 2X77A 4NZZA 4XIGS 3WVNA 3NEAA 4QARA 2XZOA 5EVJA 3GQBB 4Z3KA 2P2NA 4JJ7A 3WLFA 3KETA 2PT5A 4HDSA 4NHEA 4E03A 3GRVA 3EYWA 4FHDA 2E82A 4ZVMA 3F98A 3E9QA 4HDSB 2ZSKA 4QJIA 2R48A 2YN0A 4DWWA 1UBKS 1NBWB 2IW3A 3HKCA 5I4BA 4RTRA 2JHCA 2BGRA 4LWPA 1UBFA 2EX4A 3WMRA 1KQOA 3NTVA 1F5SA 3U7IA 4G9BA 2GETA 1P0QA 1X80B 1L3CA 2HMSA 4MPRA 2AD5A 1N6OA 1NQUA 5K4AA 5FFFA 3IA2A 2DQKA 3QKSB 4HV4A 2G82A 2VDRB 2ZIXB 1FFYA 3JVEA 1UMCA 1I4TD 3FMGA 4EHIA 1ZK4A 1DKRA 4M87A 4YP5A 3Q10A 2ZLBA 1VG8A 5EJEA 3NPAA 2IXBA 2IOYA 5DCUA 1A72A 1R8SA 1SHJA 4G4SO 4LZPA 4PFQA 3VYSB 2EIHA 3ZHOA 1ZPDA 4LV8B 1VJTA 3SM9A 4PNHA 1IQOA 1IY1A 3ZDYB 4M30A 1E7SA 1U1IA 2C5GA 4IZIA 4MGEA 4XSGA 4Y9TA 1C0IA 2JAPA 2GPYA 3TLCA 3ZNPA 3U7FB 1NW5A 3FPBA 1DIOB 2EFJA 1G55A 4RHCA 4YCDA 3AHFA 1LPPA 2FOXA 2FW9A 2V6GA 4UUBA 2XOKD 1P3JA 4FFBB 1FUYB 1GUZA 1W30A 3E9CA 2IYQA 4U0JA 3TLKA 4LXQA 4NG5A 2JCSA 1BEEA 4Q9IA 4GKJB 3GLFA 1ND5A 1YD7A 2QTGA 1QO0A 1PZXA 3M81A 4A4DA 4DJDC 4YAUA 4UBIA 2PD6A 1E3LA 4Q1EA 2HL6A 2W2KB 2CXPA 2XDWA 5CH8A 4YI5A 3M1LA 1BMDA 4KP7A 5ITZA 3UPTA 1JEYB 1QPGA 1RPNA 1Q74A 4MP3A 2UU9B 1QF7A 2QUBA 1X19A 4B2IA 1Y3FE 3AZQA 3C6YA 5FAXA 1G66A 1XDUA 5LZ9A 2OPBA 5F51A 2WT9A 1NWCA 1IBSA 1LFDB 3MERA 4I4LA 4WFIA 5TQ0A 4ZIRA 5BMVB 4N6OA 1E2KA 1MNQA 5TVGA 4RJKA 2YOHA 5IPFA 1T25A 1E79A 3FGPA 4XX0B 3RV3A 4BLWA 4O4JB 4JU8A 2EPOA 4XB1A 2NWQA 1CQXA 3EG9B 3SEQA 5LZ4A 5AHKA 1W4CA 1I6MA 5AK5A 4HUQB 1PQ4A 2VT2A 1NC1A 4BMYA 3CR7A 4TV9B 4GWLA 2JVAA 1AXRA 1JIJA 2EC5A 1R74A 4DEYA 1IOLA 3OX2A 1PSZA 3T5CA 1A8PA 2VBCA 3AG6A 1IY8A 1C2YA 4JZKA 2V1XA 4Q21A 5A04A 2BFDA 2YMMA 4RIGA 1R6DA 4C6TB 4KE7A 3PLRA 4Q47A 3ZXSA 5CFRA 2JFQA 1RT9A 1J2UA 2BH9A 3QXGA 4QOGA 4B8ZA 5TE9A 3O4GA 3TUJC 3ZE2B 4OQ4A 5L3SB 2EFHB 3AY3A 1Q7BA 4MVWA 4LDAA 4UM9B 2GD0A 4PX5A 3TQMA 4TUGA 1XYGA 2BDTA 3FPHA 3L4SO 2GEJA 1N4AA 1AQJA 1JA1A 1Z3IX 4CUZA 4EA8A 2QG4A 5U1PA 2WTXA 3UBTA 2QS9A 1D2HA 2PGOA 5DTMA 3TRKA 3QOXA 2QD5A 3EMDA 1RI2A 1T0BA 5L51A 2G1PA 1V7PC 4KWEA 4HNQA 2IV2X 1NVXQ 2H0AA 4IOLA 4G67A 3FBGA 2G1UA 2BEVB 2Y6VA 3PUVA 5G2OA 2O2ZA 2AEMA 1R9JA 2NAFA 2P91A 4LDRA 1J06A 4JC8A 2BEUB 1BDMA 3GO4A 1HL7A 4FE4A 3KWJA 3SF8B 1A97A 1OLUA 3NWBA 1N9KA 2AYYA 1HEIA 1FVOA 4R1SA 2XTNA 3K1YA 1B1CA 1LS6A 3GLRA 5G4KB 1NBHA 5L6MB 3ZHYA 1JVBA 4EY3A 1PG5A 3GFBA 1F2UA 2ZB4A 4QVIA 3JQ7B 1G59A 2DLKA 1YRQA 2Y2VA 2Y1DA 2HXGA 3IVCA 1A1IA 1Q6ZA 2C0QA 3DEAA 5CG2A 4IS3A 4H3SA 3AJDA 3ROZA 1XHLA 2H1FA 4AJ4A 1YCHA 3FVWA 4IMPA 2EN4A 2L2NA 1RBQA 4QOJA 1CZLA 2QK4A 2Q7DA 3REGA 3I1IA 3LA6A 3EVEA 4QOFA 1ZH0A 2V3VA 4FC7A 1FFBA 3PNVA 5FPHA 2OHHA 2D2EA 3VR0A 1Q7EA 2VJAA 3M89A 4Q6WA 4B6GA 3MGAA 3T15A 1JX6A 3ZHSA 3A70A 4BJ3A 2O8VA 4M88A 4URYR 2R4QA 3QOFA 4RIIA 2QRJA 3COZA 1B8NA 1C9JA 4GZ3A 4B74A 2I80A 2ZJ3A 1YB2A 3FPFA 4L8NA 2VHVA 2YDYA 3KLPX 4ZI2A 1JJ7A 4UASA 4JA0A 3KEFA 1FX1A 3NNDA 5FADA 4JBNA 1AKNA 4A26A 4B33A 4QM6A 4V0SA 4E09A 5H3HA 1OZGA 1SC1A 4N65A 3RVDA 2GEUA 2VDUE 4HWOA 5KINB 2GPIA 3T4PA 2R8PA 1HY3A 3OZFA 5SZJA 1C30B 1AVTA 4J1SA 1A27A 5ILGA 3R20A 5EG5A 2Q8NA 5CB6A 4BKMA 2O8DB 4Z4GA 5LP1A 4GYJA 1CFZA 4A0HA 1QZ3A 2XCTB 4WXHA 3PJGA 5C37A 3PXAA 2J0SA 1BFUA 4Q3KA 1EFCA 2IDZA 2WD8A 4HEA1 1MORA 4Q48A 1OY1A 1PJ4A 4RF3A 4Y8VA 4AB1A 4E1BA 5LLTA 3O38A 3GJ0A 3I1JA 1EQUA 4JVMA 2I91A 2VTDA 3TW4A 1RQXA 2W2LD 2Q1SA 3AL3A 1XTIA 3PF8A 1II8B 1W94A 3KE9A 4DQXA 2GS9A 4Z49A 2VAPA 3H86A 3KP1A 1PNRA 2YHSA 5FPTA 3P7MA 4QBFA 4IDEA 4Z9AA 1NBOA 2FMUA 4NDZA 5ERGB 2GUWA 1QC5A 2RKWA 3VYXA 5AM1A 4BP1A 2Q6LA 3W5IA 4ZVLA 4HH1A 3M1IA 1ACMA 4P1ZA 4ZC8A 4P54A 4YV2A 4UUMA 4JUAA 3KJIA 4MEBA 5FWYB 3U0BA 4U7FA 1Y37A 2B7VA 1JHRA 1SHLA 2EF1A 1P7VA 2Q7XA 3FG9A 3D4PA 3FN4A 4RETA 3UJPA 4G8JA 1XQVA 1KI7A 4BQEA 2Y8EA 4I1VA 2XMZA 2V0NA 3IQZA 5ESXA 3T3OA 2Y71A 1I30A 3W9BA 2BP7A 3RS3A 3D9QX 2ZUEA 2GVNA 1RP7A 2Q21A 3KOWA 3Q8WA 4TMTA 1PSWA 5TGZA 4PVDA 3BRSA 2DWCA 1Z25A 3UJ6A 2DPMA 3QY9A 2NUPB 1NVVR 5AICA 5B4UA 2VYQA 3EEQA 5AHOA 2I34A 3G9ZA 4PR3A 5ALMA 3QXSA 1HEUA 1Q20A 1SXJC 1GUDA 4Q3DA 4ETNA 1B69A 1NBMA 1Z7WA 2H57A 1MGOA 1NVGA 3CO0S 4LI0A 2GJ4A 5JS1A 3ZWQA 4L5CA 2A88A 3PTZA 2BMVA 4X62B 2BP7B 3R7BA 1KMNA 3ZYCA 5F12A 1K8ZB 3HJCA 3IDAA 4FTWA 3LXXA 3T1OA 8MHTA 3OQ1A 2QL7A 2Y05A 4F46A 2MSWA 4KTVE 4FNMA 1PQYA 5CFQA 2FMTA 4MVCA 2EMZA 1XIVA 2BM8A 3E7DA 2I2DA 2YTJA 1K0FA 1LDGA 3PQ7A 3P0JA 2GILA 4DLSA 4S12A 4DR7B 1GV0A 3UFXA 1P7PA 1AZTA 4DT1B 3U7GA 3LY8A 1FBNA 1E1LA 4Q28A 2XW6A 4PNZA 5D84A 4XDYA 2NVBA 1KC1A 4URFA 2CWWA 4FHFA 4PC6A 4LZWA 3EFOA 5AK4A 4FM9A 2XKKA 3W9YA 1DBIA 3FTDA 3K30A 4PAOA 5E1MA 4YLYA 1AB6A 5EIWA 1I10A 2FPKA 3C6KA 4J3JA 1RLUA 1VL8A 1ZK1A 2GBGA 2MDTA 2GZRA 2QPTA 5IH3A 3JQAA 3AKZA 4W1RA 3T9BA 1EUDA 3EIWA 2E4AA 4HQKA 2ROQA 3I34X 1GQRA 3C85A 2GD1O 3JVVA 4PC3A 1LJUA 3RJ9A 5HP4A 3EBOA 1VCHA 2VTEA 5ULLA 1QG6A 3T3IA 1POXA 1VRCA 3STWA 4KACA 4RFLA 2B98A 3ROEA 3VPAA 4CFZA 2B37A 4LY3A 4CTKA 2VG8A 5EL0A 5CIWA 3H3JA 4TXHA 1N75A 2XUKA 1C0KA 2GKOA 3T0IA 3PRJA 5A6SA 4MRPA 4WZAE 3W2EA 2HW8A 3IKTA 3K70C 3RYCB 1U3WA 3RBZA 1VECA 1YV9A 4MUGA 4ZOQI 2JFZA 4CKCB 2AFIA 1L4MA 1ZEMA 2FPSA 4JT2A 2XX3A 2XE7A 2NU9B 3AF5A 3BF7A 2J5KA 3KZYA 1A2KC 2CL0X 3K92A 5KWEA 1DDGA 4PSKA 3UB3A 3KG2A 3WDKA 3GGGA 1W1WA 4ND5A 3DR5A 2Y92A 2BBGA 4C22A 1OD6A 5GQSA 4NJMA 1SUWA 3ADIA 4M6WA 1WETA 4BVBA 4DV1E 1OB2A 2IXTA 4WBXC 5JXWA 4LXHA 1EFVB 4P5EA 1UR5A 2AW3A 2V7BA 1NW3A 1UP4A 1Z62A 4EG0A 4C7OB 2WG0A 2E5WA 1QTRA 3X1XA 3VO2A 4FYJA 3HLYA 1JYEA 1P4SA 5EHQA 5KOYA 4A0RA 4MLQA 4HQ6A 5HK9A 4LVUA 1VIVA 4Q9LA 2OCAA 1DL5A 4LK2A 1ZQ9A 3I3SR 1SVUA 1GWNA 4B31A 2ZRPA 4DNOA 3OE7D 4B2PA 2PAAA 4DNQA 1M7HA 1WQ4A 5K0BA 4DMMA 4M89A 2FY8A 2FTKE 3IA7A 3QMMA 5SYMA 1NMXA 2Z8XA 4PONA 3PFGA 1F9AA 4QYWA 1JZSA 1THZA 4QX6A 4RV4A 3W5JA 5JNVA 2BEUA 1JK1A 4EYOA 3QHQA 1NUHA 1YYWA 1N57A 4BP3A 3CUWA 4OSEA 2J0EA 5DHPA 5KL7A 1Q2UA 2KB0A 3G0BA 4L4RA 3LBNA 2O4UX 4TMZA 4H0NA 1YR1A 2C99A 3GRZA 1E2GA 2ANCA 3WK9A 5BN1A 1GPLA 2FPIB 5AP9A 2DMRA 2RI0A 4NC9A 4WN9A 1MIOA 3UW1A 2QPAA 1MIHA 2H07A 3CBGA 4RHYA 5G40A 1A8SA 1P4GA 1KWGA 1Z0SA 3KYIB 2A0KA 4FFDA 1SY7A 3ZJ4A 3T3EA 3UUEA 4DSAA 3HU1A 2O8CB 3BH0A 3P52A 2E2WA 2OYSA 1D7OA 2H1CA 4EZIA 3WHPA 3MPUA 4C6TA 3LLCA 4AY6A 3VH3A 3HM2A 2NUAB 3M6MD 5AKYA 1Q17A 1C7FA 4I8XA 3EG5A 5IBQA 3MUEA 4IVNA 3PHLA 4FYWA 3TTUA 1HE2A 2VF5X 1IEWA 4P7BA 4KK3A 2REOA 2O2CA 4LY0A 5KMGB 2CV2A 4XKJA 1T3SA 2JVIA 1ZGBA 5DBOA 1HDXA 1Z2DA 4YIHA 2Q4EA 4NCHA 1T13A 8ATCA 4O4JA 4MUKA 3BWEA 3OZ7A 2QT9A 4W6ZA 1O9GA 1OPXA 1SG6A 3HYCA 3VNBA 1KEZA 1HL3A 4V1CA 2W00A 3BB1A 3KQNA 1BDHA 4BQIA 2DHRA 1IUNA 4BECA 4NZ9A 2CVZA 3RH0A 3COSA 4JOBA 4KQMA 1Y82A 4RMHA 2ASEA 4EY4A 2XNDA 3HCCA 1WIWA 3K0AA 3U60B 2O2GA 2XHZA 1D4OA 1H4VB 2FH5B 4OLHA 5ITZB 2PU7A 4GO1A 2JIOA 4ZWNA 4I3HA 3GI1A 3ND8A 3CVWA 1U0NA 2G70A 2ZSDA 4YJKA 2PKYX 1BG6A 1PN3A 1FMJA 4PM4A 4OGGA 5AFSA 3PA8A 3GLGB 4MQBA 4PXYA 3GFGA 2QMYA 3R8XA 3SKVA 3RAGA 3V8MA 4LRWA 3SC2A 1WB5A 5BVGB 2XZTA 3TDMA 4R3UC 4EYKA 5TSEA 1DC4A 4L0QA 4LJ8A 1EGQA 1DGCA 3WL3A 2E89A 4EQ6B 1BX3A 2C00A 1E5TA 4TTAA 4CU5A 2R7MA 3AM3A 3CKLA 3HFGA 2ES4A 3F97A 3UA4A 1J0AA 1SZPA 1Z0IA 4YJFB 1NXPA 4ARVA 4EMTA 4MYDA 2CHFA 2FOIA 4JDUA 3V7WA 2V55B 2HCTA 1XMVA 1QH9A 1KMCA 5JCPA 1AKQA 3NRBA 3RUAA 4L9AA 3ZH2A 1XRMA 4R84A 1UMCB 4GPAA 3AF1A 1WWKA 3CKMA 4ZOLB 3ZWYA 3AF3A 3C5HA 1K8XB 3LV8A 4KITB 5I9LA 1G2OA 2C2OA 4IWNA 4X54A 1BJTA 3QTBA 5E2IA 3T5PA 2JLCA 2ZJ5A 3CPSA 4EIWA 1ZK2A 1K6JA 3P2JA 3N75A 4BMSA 4L6AA 5H4GA 3NYRA 3HCWA 4JFAA 5KCMA 1JQKA 3E23A 2AX4A 2YRWA 4ACAA 4LVOA 4IQ0A 2Q3MA 4DHEA 1B73A 1E9AA 4MTCA 3S1SA 1KAQA 4C1BA 2ZJ8A 2J3MA 2GF9A 2WKPA 3A4LA 4J1NA 4P84A 4XE5A 1D1QA 4YYEA 5K0SA 1C9EA 6PFKA 3PE4A 4KYIB 3ZJVA 1U5BB 3SBEA 3MXTA 3CH6A 3M7IA 4Q3OA 4XXHA 3WX0A 5E95A 4MUJA 3LK7A 1LY1A 4YO8A 4C29A 3GEGA 5JS6A 4D9NA 3MWGA 1P0PA 4EA7A 4JI3B 1E8DA 2ZJZA 5JAOA 1UZNA 4XFDA 2B83A 3R3YA 1U3GA 3O1IC 4RV9A 2CMHA 4MMZB 2JBAA 5IT0A 3H2GA 3FHOA 3WNBA 1YRHA 1VE7A 1ZFNA 2I1QA 1JNXX 2BB8A 1ADJA 2ZBGA 1N0VC 2SNIE 4K9PA 5JBQA 2DR0A 3ER8A 2FZVA 3G82C 4WIAA 4X95A 5ALOA 2IHBA 3FOZA 4J2OA 1ZHFA 4MW2A 3MTQA 5AI9A 4M0KA 3LTEA 5B37A 5FX2A 4DSOA 3L1KA 1WO8A 1J8QA 1TT7A 2NGRA 3ROKA 4GICA 4E15A 4DDVA 2W37A 4BKPA 5LDDC 3DTTA 2D1YA 2M9AA 3D8TA 2YX1A 3OIUA 4CF5A 3VHRA 4BNNA 3ESAA 3D8BA 3H9UA 2QZ4A 4LJKA 4ZV9A 1RYMA 3OTHA 4YJ2B 4OOEA 1SULA 3W06A 3W2TA 1EK1A 4JGBA 3WADA 4S1TA 4RXUA 4AZ0A 4YAEA 4L22A 3V2IA 3K6SB 2FUNB 2DHCA 3KHSA 2BCEA 3EUFA 4RL6A 5JXGA 3GJQA 4BNIA 4QDXA 2XUJA 3NJ8A 1SC4A 1M2KA 3OAAA 1VMKA 1V1MB 3PHGA 3UJAA 4CG0A 3ZCUA 1FZTA 1YT5A 2JFGA 4Z53A 3WLOA 1PR1A 2B61A 1KC3A 1RXIA 1VHLA 1XA4A 3BBPA 3R24A 2GEVA 2LR0A 5LJIA 2VHJA 1Z6TA 1II0A 4REMA 3QNMA 3PGLA 4KCGA 1GUYA 1XDDA 1X39A 5CHEA 4ILKA 2V54A 1JAZA 4YUAA 4AKTA 4W9NA 3SN6A 2PRIA 4ASUD 3SQMA 4ESHA 2ALJA 3ASVA 3MJFA 1I7LA 4B7AA 3I62A 2B78A 3E58A 2MIIA 5DLYA 4DL9A 1VJ1A 3HKBA 1G8AA 3TSOA 3CLSC 3EEBA 4LF4B 1AQLA 1NVEA 1R5JA 1TEVA 2PLAA 2VT3A 4Q34A 3SJUA 1GL3A 1SZCA 2W6JA 2CN1A 4E30A 1FSFA 1S01A 3O9VA 4HAWA 3H5LA 1RIFA 1MVNA 1UADA 1QX3A 2DHEA 2W6JD 3HEBA 1P9OA 5HQTA 4L7QA 3TG8A 3QFHA 3QFRA 3PNLA 1KI6A 1XO1A 2NP7A 5GGYA 3BG5A 4JBHA 2HSGA 1F38A 3E6AA 4M7OA 1T34A 3V34A 5F98A 4TYWA 2IYRA 4ETIA 3PUWA 1JG6A 5TT1A 2Z30A 4JQCA 4ER3A 1I2AA 1E89A 1X70A 4M46A 5EJ8A 1BWSA 4JKIA 5JVDF 1NU8A 3Q87B 2FSIA 3DFZA 3SYMA 1QBGA 3O4VA 3UJDA 1U7DA 1FXSA 3R9KA 4UBNA 2PLNA 1KYTA 1CZUA 5EESA 2WIKA 1URPA 2I65A 2IXGA 3O4HA 4HAXA 1AU9A 3CUEF 2EG5A 3O8LA 4QNMA 5D3ZA 4DNFA 4JIGA 2WJGA 5BOSA 3BH6A 3Q8KA 1ZIDA 2XGOA 2R6HA 3PENA 3QI2A 4DDWA 1YE3A 4X84A 3CUYA 1Y9JA 3KTAA 5IC6A 5BN5B 1Z08A 1BKSB 1PLJA 1XEFA 2PL9A 5ALNA 1ECLA 3BWYA 2I3BA 4WXCA 3WYEA 2HK8A 1MAWA 5ALFA 1Y6JA 5J4YA 1KH2A 1L1EA 5KHAA 3T52A 4C43A 1G38A 1YRAA 3AETA 4OLBA 4IIYA 3ZX4A 2Z1NA 1H94A 4HGZA 1M6YA 1MH9A 2WWXA 3EOAI 2D3WA 4PZAA 2XRMA 3RGGA 3RNLA 4LRSB 3KPJA 1GZ4A 1RW4A 2V8OA 3BORA 4LBYA 1A95A 3ZW8A 4LVCA 2P0AA 1T2FA 4CM5A 4LJRA 3D8SA 3FZYA 3LS2A 1GCOA 4BIIA 1TXGA 1GARA 1MDFA 3AERB 4PYRA 3RYFB 3EGEA 3LKVA 2VNKA 2QVLA 3NOVA 3PC3A 2I7TA 3TTVA 5EPUA 5F3WB 2GERA 1I3KA 4DQLA 1T4OA 1P4AA 2A9VA 3R8CA 4ALNA 4DRZA 5A5DA 2O3SA 5G0VA 2ZSFA 1GP2A 5DRYA 1ND6A 2VEOA 2UZ4A 3R5FA 1VKJA 5HZGA 1C7EA 4BFYA 1Z0DA 1NOKA 2XKAA 3WRXC