1GZ6A

(3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
301
structure length
301
Chain Sequence
SPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGSRMTETVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binary Structure of the Two-Domain (3R)-Hydroxyacyl-Coa Dehydrogenase from Rat Peroxisomal Multifunctional Enzyme Type 2 at 2.38 A Resolution
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dehydrogenase
molecule keywords ESTRADIOL 17 BETA-DEHYDROGENASE 4
total genus 101
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1gz6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gz6A01
3OQ6A 1YBAA 2DTDA 2PZMA 3OJ0A 3BXXA 2HMUA 2JCYA 5HS4A 1HDYA 1E6WA 1VRWA 3FI9A 2HRBA 3L9WA 2UYYA 4U0KA 5KVQA 1OC2A 3E48A 4QT0A 2P68A 4CPDA 1QP8A 3D0OA 4NBUA 2CVZA 2WE8A 4BO3A 1OZAA 1IUKA 2TMGA 3PQDA 1UXJA 4CMBA 4PLVA 4HWKA 3U9LA 4NU5A 1GV0A 2FPIA 3RBXA 3K9QO 2ZIZA 4N54A 1IL0A 1C3VA 2C20A 3FBGA 3KLMX 3GMSA 1PZGA 3LK7A 3PVZA 5DBIA 3BHIA 4M49A 2Z1NA 3AOEC 4TRJA 1D1SA 2DFVA 3KRTA 2HK9A 4XQGA 4BQRA 4EUEA 5G0SA 3MTJA 4D46A 3VOSA 2QZ9A 3RVDA 3PIIA 4S1VA 2AG8A 2X4GA 2D59A 3HHPA 4IDGA 3UOGA 2R00C 2GERA 1E7WA 4PG7A 2BGMA 1IE3A 1HE3A 1I10A 3GFGA 4DIOA 4CM4A 4E33A 1CDOA 2I99A 4I5GA 4QFCA 4IIUA 4R4JA 3EAGA 2D0IA 3HN2A 4XYEA 1ZKMA 3DHNA 3I52A 4YAKA 3GZ4A 3HDJA 2BELA 4CLOB 4WLFA 3GEDA 4WCFA 4A73A 2YQ4A 4Z9XA 3OHSX 4CLOA 4R54A 3FWZA 5F5LA 2VT3A 4N7RA 4M87A 1E92A 3UXYA 4KOAA 3Q2KA 5TF4A 5A9RA 5CEFA 3IKVA 3S1LA 3CUKA 4LSMA 1R6DA 1I0ZA 3PWSA 2HMSA 3NDRA 4J1NA 3K30A 1U2DA 2C07A 3KXDA 3OETA 1KEUA 4JLWA 3FSRA 5A9TA 3WGTA 1ZEJA 1BGVA 4D7AA 1DLJA 4IQ0A 4R9RA 3BMCB 4PLPA 4MVJM 2B4RO 4BMSA 4CM1A 2Q4BA 3PDUA 2Q3EA 4O59O 2E48A 4UVHA 3A14A 3OH8A 1QG6A 1P3DA 1QLJA 1Y8QA 3NTRA 4YAJA 4HFNA 1QR6A 1X13A 2RBEA 4YB8A 4TRMA 3WDSA 3VH3A 1CJCA 1KOLA 3ZHBA 1MV8A 4AJ4A 4YJHA 5TQVA 5JDCA 3D3WB 4Q39A 2ZTMA 3K2EA 1ZMTA 3BHJA 4YJFA 3KYCA 1I8TA 2GD1O 2NACA 4XZ3A 4AJIA 1V3VA 1PZEA 1E5LA 1VLLA 3GAZA 1YOVA 1EDOA 4EJ6A 4MPDA 2R2GA 4O1MA 3OJOA 1ZK1A 1ZFNA 3FNEA 1LSOA 4BO9A 1YE3A 1SO8A 1E7SA 3WGYA 3RC9A 4RLHA 3ZHXA 5B4TA 2YYYA 3DBLA 4XQ9A 1E1NA 2O50A 2VUUA 4CQMD 5CFZA 3PP8A 3WGHA 4A03A 3S8MA 1X15A 2UUPA 3ABIA 3VKUA 1EUCA 3WTBA 4KMSA 2GN6A 4CMIB 2G0TA 5CP8A 1J0XO 1AN9A 2JAPA 3TZCA 4GQAA 2IZ1A 3F1KA 3OA2A 4GLOA 4L4SA 1FMCA 1AUPA 2OORA 5TSDA 1PL8A 3F46A 4JIGA 4BV8A 4E5PA 1HSOA 1HXHA 3DC2A 4YT8A 2WEKA 1RPNA 4OH1A 4S3MA 2P9GA 1O89A 3KYBA 4XR9A 3WJ7A 2VUSA 3UICA 3DZIA 3ZNOA 2C29D 4I9UA 3WGZA 5CG1A 4DTIA 3AU9A 3ZWCA 2NU8A 2VT2A 4R68A 4YRAA 3W4IA 5JFOA 1BXKA 4Z0TA 3FF4A 3H9QA 1TT5A 1CIVA 3RUHA 3H5NA 1PJBA 1E1KA 2X5OA 1IZ9A 2GUGA 4XGNA 5DCUA 3RC1A 3ZWXA 5KJEA 4B4VA 2D4AA 4IIVA 4DL9A 2YFQA 2PY6A 1NQ5A 3E03A 3MEQA 2A9FA 4HFMA 4MVJP 2OXIA 5H81A 1WDMA 2JHGA 1HETA 3SC4A 3U3XA 1GPJA 3I23A 1MP0A 1SAYA 3AUTA 3QQPA 1XYGA 3BMNA 4RQTA 1B8UA 4LMPA 1TI7A 1X1EA 1ZMOA 3BIOA 1ZXBA 1UXKA 3ONFA 3RKRA 5JW6A 3ZU3A 3GOHA 3CMCO 5H83A 3GG9A 3C1OA 1VSUA 2XF8A 4JNKA 3TFOA 1GDHA 3FCOA 4MINA 1ISGA 2J5QA 3OP4A 3RD5A 4GX2A 1QYDA 3DAGA 4RVHA 4ALNA 4NQZA 1V8BA 2C2XA 3M1AA 3JQ8A 2PV7A 1F8FA 4ZD6A 1NYTA 3TZHA 4XRGA 4WCFB 1VJ0A 4NFYA 2NUAA 3M2PA 4IJWA 4A26A 4JCOA 2ZCUA 4Y6SA 3OECA 1EVZA 4Z3DA 1K3TA 3B1FA 3QHAA 2O7QA 3R3SA 4J49A 3DAFA 1E3SA 5L40A 4CV3A 2GN9A 2H5LA 3WIEA 1UDBA 2EKPA 4CLRB 4Y67A 2AG5A 4BNVA 2QYTA 1HKUA 5G0UA 4IPTA 1EQ2A 1LDEA 5AXBA 1NASA 3K6JA 1I32A 2JKVA 4DLBA 3LT4A 3ZGYA 3EK2A 3R0IA 2ET6A 4R3NA 3BA1A 3CIFA 3P19A 4C7KA 3DBRB 4P4LA 4CMCA 1CQJA 3B1KA 2HJRA 2P4QA 3OJEA 4N5LA 4AJ2A 1WWKA 1ADBA 4YJHB 5F1OA 1VJTA 1XIVA 2XOXA 2GDZA 4GSLA 3WNVA 4ND1A 2AE1A 3DHYA 1GPDG 1U8FO 1N1EA 1PGJA 4YR9A 1ULSA 3JD1A 1AGNA 4HNGA 2YV1A 1O9BA 3CINA 1WPQA 1V3TA 3F4BA 4K28A 1ZO8A 1B15A 3QVOA 4IDBA 1U5AA 4UVIA 3JD2A 3H5AA 3JD4A 1ZSNA 1PZFA 3D4NA 3PFWO 2Q2QA 4RVUA 3HDYA 3DMYA 3RFTA 4B3HA 4YDRA 1X14A 1Z75A 4FBGA 3STHA 5IZCA 3FPLA 5JLAA 1F06A 3ETEA 3WGOA 2G17A 3OIGA 2X58A 3H9UA 1E77A 4D43A 3ADPA 4CJXA 4Q3NA 3RUCA 4FIZA 3MJ4A 1IPFA 1ZSVA 3K31A 4P4GA 4R16A 3A9WA 3F9IA 1U9JA 1HL3A 4GH5A 5FF9A 3DMTC 3H3JA 3NYWA 3TPCA 3B20A 5DBFA 5T67A 1XA0A 1Y5MA 4XIYA 4Z0HO 2IZ0A 3GUCA 4TVBA 1P77A 3WXBA 2PH5A 2Q1WA 4Z3KA 2POQX 1HDZA 4CQMA 1A5ZA 1E1LA 4Q3EA 3U09A 2IXAA 4U7WA 4OKIA 3RC2A 4BKPA 2JFFA 4YAEA 3AM4A 4FQ8A 3ZNQA 5BNIA 3QVTA 5L3ZA 4ALLA 4PLYA 1XDWA 3GNSA 4IJUA 1A7KA 4PZCA 2O3TA 3PLRA 4E30A 4WNCA 3GC6A 4MVJE 1HYHA 3UGKA 1YQXA 1PWXA 2OP1A 2C5AA 5MGBA 1SEPA 2VWQA 4QO8A 1ISFA 1IHXA 3BMNB 3JQEA 3B70A 2EG9A 3WBFA 3NGXA 4DQXA 4A5OA 4LMRA 1PR3A 3DB2A 4K26A 4PLTA 1KVTA 3BAZA 4CM4B 4CUJA 4FS3A 4PG5A 5JAMA 3INRA 4ITUA 4U6SA 4WCFC 4CLXA 4CM9A 4GMGA 5EINA 4W7IA 1OAAA 2FOIA 4NBVA 4W6ZA 3FRJA 1KS9A 2HLPA 2WJPA 3K2BA 4KQWA 5ITWA 3ADOA 2P9EA 4MP3A 4PCVA 4LRTB 3RKUA 5DCYA 1NR1A 3PHHA 4J6FA 1PGPA 5HM8A 3I6QA 3ZHZA 1TT7A 2NVWA 4HFJA 4TQGA 3ONDA 5I9LA 4QFDA 3IL2A 8LDHA 1PS8A 4KDFA 3ANNA 3GGGA 3K5PA 2PWZA 2IXBA 1XR3A 5A9SB 2JL1A 3HN7A 1NPTO 3MJVA 4CV2A 3PYXA 4WJZA 3TSCA 1BRMA 1P31A 1T2DA 2NV6A 3HB4X 1T2EA 3NT4A 4WLVA 1HE5A 3IUSA 4OL9A 4PLFA 2GRAA 4LISA 1BMDA 1TEHA 1ZCJA 3KVOA 4RF3A 1BDMA 4WECA 2EGGA 3S2IA 4ZHSA 3C3XA 1I5RA 3FPCA 4J1TA 5L4SA 1EBFA 4ZICA 2AQHA 3WX0A 4IDAA 3ZWAA 1T1RA 4Q3BA 5T57A 5CPBA 1E3WA 4BKQA 2Y66A 2QRJA 3GGPA 3KZVA 1FJHA 5EN4A 3U4IA 4BHTA 3EMKA 4BGUA 2BFOA 2Q1UA 2I9PA 2VNSA 3O26A 3HZZA 4XDZA 5EJ2A 5ES3A 3WLFA 3P2YA 2Y68A 3PGXA 4AJLA 2X0NA 3H9JA 4YRBA 5EL0A 4ALIA 4MKZA 1R66A 1DLIA 3B6ZA 4CUZA 1NPYA 3WG9A 4OAQA 4II3A 5COQA 4XRRA 5TLSA 3TOZA 1R0LA 4AVYA 3I9NA 3SJ7A 3WGGA 1N8KA 4EUFA 2NSDA 2EWMA 1YQDA 4NZ9A 5K9ZA 1PJCA 3JQ7B 3LF1A 3QVXA 5LC1A 5A3JA 3OIFA 1G1AA 3KM0A 2DT5A 4NBRA 4C7JA 2JD1A 2Y1EA 4CQMB 4RF2A 5EERA 3VZQA 6LDHA 3GZNA 2X0JA 1YXMA 3WMWA 4JBHA 5G4LA 4R5HA 3V1UA 5DF1A 1BW9A 5A4DA 5BQFA 3WWYA 3LDHA 3KYDB 4AJKA 1DOHA 4DVJA 5L95A 3FNFA 1BWSA 4XJSA 4IJVA 1Z45A 2DBVO 2FWMX 4N5MA 3UF0A 5KVVA 3NGLA 3DL2A 1EBUA 1M6WA 2FZEA 3D3EA 1DAOA 3SXPA 3VH1A 3ICCA 4YT2A 2WD8A 4JJIA 3F3SA 4M54A 1GQ2A 1R4MB 3L77A 4ZQFA 5FWNA 1T25A 1OC4A 4ZQHA 5JCJA 1P0FA 2NWQA 4G65A 5IXSA 3DZGA 2UAGA 2D8AA 4DXHA 2OUIA 5TJ9A 3EUWA 2V6BA 4WLNA 2EGHA 4R1NA 3ULKA 1W6UA 2Q1TA 2QW8A 3PQEA 5IDYA 4A0SA 1J6UA 4XCVA 4E5NA 1EE9A 1Q0QA 1BDBA 1WZIA 3ZCXA 4ALMA 3C8MA 1UZLA 1KC3A 2H6EA 3AUUA 1CWUA 4NBWA 1MG0A 4DPLA 4BO4A 1YVEI 4PZEA 2JFGA 5B37A 4YTEA 1ID1A 4CMKA 2YW9A 5C37A 5IAAA 3GN2A 1UUFA 4INAA 5DP2A 1ZK3A 2IEBA 3E9NA 1DC3A 3DZBA 4BNNA 3ON5A 2W2KA 3IAHA 2PZJA 3S55A 1VL0A 3BMCA 5THQA 3JQAA 5KVSA 1NPDA 4MVJA 1MA0A 1CYDA 3E18A 1Y8QB 3I9LA 5I7FA 2OBYA 4J9UE 1UP7A 2QRLA 4YPOA 4XYMA 4NHEA 3QSGA 5EIOA 5AXCA 2YHIB 1LTHR 4ZVVA 4ALJA 3H3FA 5ER9A 4FJ0A 4E4YA 3W4JA 4FOSA 1SPXA 1X7HA 1EZ4A 2PFGA 4Q9NA 2CD9A 2EW8A 2NQTA 5LCXA 2Y1OA 2O3JA 3DWFA 4TSKA 2BI8A 1KVQA 2W2LD 1NFRA 1T24A 3IS3A 1U8XX 4C4OA 2PGLA 3WGQA 3SBOA 5DDIP 5DBGA 1ZK0A 1JAYA 1U1IA 4J4TA 5C7IO 2ZK7A 2FR1A 3DBLB 1Y5RA 1T2AA 4TMFA 4N5NA 3TQHA 3KTDA 1GUZA 4B4UA 1EFKA 1LA2A 1ZIDA 4K1LA 1X1TA 2CUKA 1DHTA 9LDBA 1XKQA 3H9EO 3D5QA 4II2A 2I6TA 3QWFA 1SNYA 4TVOA 1VI2A 3AM3A 3ZNNA 1TA4A 3FTNA 4YJGA 4W7HA 3ZV3A 2J3KA 4K9DA 4OM8A 3NV9A 3NX4A 5BSHA 4J1SA 2YFHA 3PRJA 2Y0CA 2BMAA 4U5QA 3ST7A 3E8XA 1GUFA 3H9GA 1E3EA 3VZSA 1YGYA 5T6BA 1MB4A 1JVBA 1P1IA 3G49A 3PPIA 4RF4A 4UREA 3ZN2A 5JXWA 5FI3A 2H63A 2O3QA 1DJNA 3ANMA 1WDLA 1GEEA 1P45A 4KZPA 4EEZA 2ILTA 5JS6A 4N18A 2BI7A 1UR5A 1Y9AA 2IYOA 1E7RA 4FPXA 4DBVO 4DQUA 1ZUD1 2EP7A 1E6EA 4ROSA 5AQ1A 4L76A 1BVRA 1P44A 5IDWA 2RCYA 2V6MA 3FNGA 2WSBA 1SBYA 1Q7GA 3BHMA 4GX0A 1UXGA 5ENVA 2Y1CA 4E13A 2X6TA 4YXFA 4MKXA 4BNWA 1H2BA 5TT0A 4I08A 5J23A 3L4SO 4MIEA 3CEAA 4WASA 1NWHA 4LSWA 1H6CA 5I9MA 4RVGA 3NDJA 3WTCA 3EZLA 1E6UA 3I4CA 3IDSA 1O94A 2VOEA 2GO1A 1LJ8A 1NX6A 3VZRA 3Q11A 3HUDA 1PIWA 4MVJH 1LDGA 1ISHA 4AJPA 3GNTA 2I76A 2Y05A 3TN7A 5IZCC 5G0VA 4BO1A 3PHIA 3QIVA 3TWOA 4E2XA 4IZIA 2QRKA 4CL8A 4TZKA 4JROA 4IM7A 4FCCA 4AJ1A 2X5JO 2CY0A 2C0CA 2VYVA 4FFPA 3KSDO 3RBZA 4M89A 3VH4A 1H9AA 4B7XA 4OYRA 2QQ5A 5TT1A 1FXSA 3GRPA 3R3JA 4L75A 1H9BA 4H15A 1HDOA 2XPCA 3EHEA 2GZ1A 3KETA 2RAFA 1V3UA 1RYDA 4KP7A 5C7OO 5L45A 4CM6A 5HRUA 2NTVA 1VM6A 4W9NC 1XSEA 5G4KB 2YZ7A 3MOIA 1GYQA 1LDBA 3AFMA 2NU9A 1ORRA 4PLZA 1HTBA 4OOFA 3GLQA 5KKAA 3VPFA 4ILKA 3JTMA 3VVBA 2V6GA 4F45A 3OQ1A 3SLGA 4D45A 1GZ4A 2HDHA 4CM3A 2DU8A 4XB2A 1U3VA 1QSGA 1XLTA 1HYEA 4IDDA 2O4CA 4WOJA 2DLDA 1T4BA 4XEHA 2OMEA 2EEZA 4A10A 4FW8A 2CF6A 1NP3A 2P2SA 1KVUA 1NNUA 3EDMA 4OKNA 3JYPA 3CKYA 4CR8A 1UH5A 4B4OA 4WCDA 4E6PA 4EUHA 1MUUA 4DIBA 3WIDA 3GVPA 3P7MA 3Q9UA 3AK4A 2F00A 4E5MA 1LI4A 2QX7A 4KUHA 1P74A 1MC5A 2CDBA 2WD7A 4IDFA 2B69A 2WTBA 5K6AA 3B1JA 3G1TA 3PZRA 2PH3A 3K96A 1QYVA 2DKNA 4W4TA 4OSPA 2O3UA 3AI2A 4YCAA 4M1QA 3GN1A 1PJ2A 3HFGA 3AOEA 4HKTA 4BNKA 4CM8A 1PR9A 1E7MA 3VH2A 2R6JA 3GZNB 3PJFA 5JMPA 4P38A 4FFNA 3RUEA 3WB9A 4IBOA 4YA6A 3ZWWA 4AJHA 5L7WA 3O8QA 4CUKA 1K6XA 3L6EA 4E32A 5I7VA 4R01A 3JQBC 3QRWA 3AUSA 1PL6A 2ZYGA 1AXGA 3ZWMA 3RCBA 3GG2A 4K6FA 4EDFA 2VHYA 4RLSA 2WDZA 3AY7A 2OHXA 4TKLA 3VPSA 4ONEA 3GPIA 3MJCA 4R51A 1P1RA 1HE2A 4BNYA 3KLPX 4DLLA 1BXGA 5EESA 4CMEA 3JQGB 1ULUA 5CEEA 2FRDA 2QZZA 1JAXA 1I01A 1X7GA 5U1PA 5DULA 2PR2A 2Q99A 4WK6A 5ITVA 4FFRA 2GNAA 3KO8A 5BR7A 2VRCA 3N7UA 1W73A 3IP3A 3TZQA 4B7CA 4EITA 4BNLA 1Q0LA 2Z95A 3Q2IA 5L53A 3RC7A 2VHWA 5LDGA 2Y1DA 3H7AA 1HEUA 1C0LA 1NAIA 2GPTA 2X86A 3L0DA 4GKVA 1ZBQA 4B3IA 3F5SA 3N58A 2B4QA 4CMEC 4PIVA 2BD0A 4ZGWA 5A02A 2HAEA 3I1JA 4PLCA 1PJQA 4J43A 2YHIA 3DTYA 1V9LA 3G1UA 2B0JA 4WOKA 4KWHA 1FK8A 5A06A 1I30A 2DBRA 2JCVA 4RPKA 2DC1A 1CEQA 3EW7A 3C7AA 2JHFA 4HV4A 5BNFA 1C0IA 2C2YA 1T4DA 2PGDA 5JO9A 4ZU3A 4OHUA 4YJFB 2Q45A 3F5QA 5IDXA 2NNLD 4QO7A 2AEFA 4RVSA 2CNBA 5F21A 3TL2A 1TLTA 4A2CA 4IGEA 3F4LA 2VZ8A 2E4AA 1OFGA 2VRCD 1Z6ZA 2D1YA 1NHGA 3NT2A 3QJ5A 1VL6A 4XB1A 1T2CA 3GHYA 4UUOA 5C7LO 2B36A 3GR6A 3QWIA 5DCWA 1K89A 5IN4A 1RM0A 4CM5A 5DOVA 4BO7A 3E6AA 1DO8A 1D1TA 1KY5A 4O6VA 1J5PA 5EMHA 4KTVE 3HNPA 3LF2A 3PJGA 5GY7A 2PZKA 3OMLA 2AW5A 2YQ5A 5K6AC 4HP8A 3P5SA 4NJOA 3JQ9C 5TS3A 3LU1A 4NI5A 4YAIA 2Q2VA 4W82A 2BRUA 3G79A 2XXBA 1H5QA 2ZYAA 1GV1A 1ENZA 3G17A 1PSDA 1VL8A 1WP4A 2DPHA 4I9HA 2C7GA 1IY8A 1BW9B 1HF3A 1LLUA 3E9MA 4HUJA 2NTNA 2B35A 4BO8A 1P1FA 3V8BA 3PTZA 4GGOA 3AWDA 4XIJA 5AVOA 5AYVA 4MVJF 1N7HA 1R16A 1V35A 1YDEA 2HKIA 1KVSA 3HG7A 1J4AA 1XEAA 5T8KA 3KYDA 2X8LA 1ZW1A 5JYDA 5ICSA 3V2UA 3ICPA 4BO5A 2D2IA 2VUTA 1B8VA 2O3SA 3JQBA 3EGOA 3WOHA 4XGIA 4YJDA 5JPIA 1HYGA 1HSZA 3NDIA 1F17A 1NR7A 3PYLA 5EPOA 4BNMA 4OJNA 3DOCA 2RH4A 3E82A 3CXRA 3FN4A 5FYDA 1NQTA 4XQCA 4D44A 3LLVA 1FDWA 3ONEA 1IULA 1MLDA 2ZB3A 3O4RA 6ADHA 1A9ZA 1VC2A 4PVCA 4BKUA 2DUUA 1LQTA 3IOYA 4BO2A 2X1HA 3CSDA 1HDRA 1LXCA 3RASA 1YH3A 4FB5A 5JY6A 2OZPA 1P1HA 5JMWA 2G1UA 2J6IA 4RF5A 3OSUA 4UUPA 5IDQA 3WQRA 1ZH8A 4DYVA 3H2ZA 1HRDA 1LRKA 2FR0A 1SOWA 1R12A 1N2SA 2PGJA 4RV9A 4Z9FA 2Q1SA 1SMKA 3WGIA 3UCFA 4D3DA 3PFFA 3DZJA 4LVUA 1ENPA 3JQAB 3Q9NA 4TROA 3NRCA 2ZJ0A 4YVFA 4GX1A 1EUDA 3UAGA 4CMAA 5ICMA 5ENDA 4OGWA 4JJGA 2RHRA 2W2LA 3E5MA 2O3RA 4RQUA 3HADA 1A4UA 2X23A 2VYVD 4R41A 2FSVA 4GVLA 4IXTA 3PEFA 1H94A 5CDGA 4BGEA 3OJLA 4ZN6A 1CQIA 1KEVA 4TWRA 1O95A 5CDSA 1IZ0A 5F5NA 2AA3A 3SC6A 4IGFA 4P4NA 1WXDA 2ZB7A 4GWKA 1G0OA 1LDNA 1NHWA 4JN6B 1Q7CA 1P1JA 2JAHA 4IQ8A 5FEUA 3ZWOA 1R4NB 1PEDA 1HZZA 4RPJA 5DZSA 2V65A 4IXWA 2PKQP 3AY6A 3PXXA 4CM9D 4Q3DA 1R4NA 4BKRA 4CV0A 4E5KA 4J4HA 3KSUA 4M55A 1KY4A 3ZW9A 4PLHA 3KSZO 1C14A 1QLHA 3DZHA 4IY1A 3F6YA 2HMVA 3OIDA 4J16A 4MDHA 2GR9A 3KEOA 4UEOA 2DM6A 1CERA 3H6KA 4CR6A 3DXFA 4OXKA 1YL7A 3GNQA 2IE0A 4RVDA 2OO5A 1N92A 3HDHA 4XYBA 3OJFA 2A94A 3NJ8A 3WFJA 3LQFA 2PZLA 1A4IA 1GAEO 3QE3A 4BKOA 3I9JA 1ML3A 4IDEA 4YRDA 2Y0EA 1VPDA 1B3BA 3LT1A 4Z9YA 3SX2A 1QV7A 3NEPX 4UVGA 2O2SA 4R5MA 2ZYDA 3FNHA 1ENYA 1D3AA 4DREA 4RZHA 1UZMA 5AOVA 5DOZA 2J5KA 3L4BA 4NDNE 5KJ6A 3GVCA 3RU9A 4YQYA 4DBZA 2BFPA 5A1TA 1NXQA 2Z5LA 1N9GB 4BNZA 1C0PA 1LSJA 3W6UA 1BVUA 3FBTA 1UP6A 3ZH2A 2PD3A 1H6AA 4PG4A 4U6QA 1LDMA 2NVBA 3F1LA 3E9QA 5JDIC 2CVQA 4U0JA 1AHIA 1F0YA 2AE2A 1U4SA 2NLOA 2B5WA 2EIHA 3A4VA 4CMJA 2BH9A 1U7HA 1O8CA 3OBBA 4HFRA 4HNHA 3FR7A 1YL5A 4XR4A 3UFXA 5GZ3A 1SB9A 5G0TA 4R1SA 3CE6A 1RWBA 3E5RA 3PHJA 1PJTA 3FHLA 4PGFA 4DYDA 1B14A 2FMUA 2O2YA 3JYOA 2EJWA 3RJ9A 5CDUA 4L4XA 3ZDFA 3GRKA 2J3IA 5A5FA 5A04A 4LK3A 5HS6A 3P2OA 1PQPA 1ZVMA 1P33A 2CSUA 3A06A 1DAPA 5L51A 3G0OA 5ILOA 1UDAA 2I66A 3RBVA 4B3JA 4DRYA 2ZTVA 1SCUA 4FC7A 3A1NA 3MJSA 2UUOA 4FFMA 2PD6A 3HJAA 2Q46A 5DP1A 1U28A 2UVDA 1A72A 5IFLA 3V2GA 2F1KA 4D0SA 4NIMA 4PFJA 3ITKA 2WMDA 2FPPA 5COAA 3C7DB 1ONOA 3R1IA 4AICA 1PGQA 3U4CA 5ER6A 1U2GA 2O23A 1O0SA 2HCTA 2RIRA 2BFMA 4J3FA 4NK5A 3RUAA 1K5HA 1H6DA 1HE4A 3MCVA 2GSDA 1K6IA 4G5HA 5U4QA 5B4VA 1HDXA 1YDWA 2IRWA 1UJMA 5JNLA 1KEWA 1BSVA 2C7VA 3OEWA 1UDCA 3PQFA 3RSHA 2DTXA 4H7PA 3TZ6A 5G4KA 2EW2A 4FN4A 5JYEA 4I5EA 2ZTUA 3ZW8A 2WM3A 4ND3A 2CF5A 4IS2A 4O5OA 4H3VA 5EQDA 1E3WB 1I3LA 1N7GA 4GL4A 5GZ6A 4J2OA 2YUTA 4Y9DA 4BNUA 2HUNA 4EI2A 1DC4A 2EHDA 4XYGA 3BMOB 1JA9A 5COBA 4WKGA 4HX5A 1UZNA 3WYEA 3JQFC 3BMOA 2A92A 1TB4A 2O4UX 3ROMA 3JV7A 3W8EA 3GEMA 3GY0A 4R1UA 2WD7B 3JQ9A 1GUYA 4BO6A 3GQVA 3LLSA 3GF4A 2AHRA 1PTJA 1U3TA 1DXYA 1Z82A 2FP4A 4JX8A 4L0QA 1O5IA 2EERA 4AG3A 1NVTA 1WDKA 1VE9A 2G5CA 4NMHA 1EVYA 4BMNA 2VWGA 1LSUA 2ZQYA 3WQQA 4CLDA 3PLNA 3QLJA 3C1TA 2HMTA 1YOVB 3CMMA 4FGWA 2WE7A 3KB6A 4J90A 2IZZA 1UP4A 4IZHA 4MKRA 1WVGA 4JP3A 1AE1A 1D4FA 4XWYA 1KYQA 2OBNA 4BMVA 4YWJA 1O6ZA 2HJSA 3OEYA 4XJTA 4TKMA 1ADCA 3V2HA 1EE2A 2YY7A 3AFNA 2D5AA 1HDCA 4UVDA 1JVSA 1B0AA 3ZWNA 1T2FA 1EUZA 4J4BA 4FFOA 1N5DA 3MJTA 3JSAA 3VTFA 2H9IA 3DBHB 3HE3A 1GR0A 4L73A 1YRLA 1E7YA 3FTPA 3DBHA 1I2BA 4X54A 1ADFA 3QP9A 3SEFA 1DHRA 4D3SA 3T7EA 1P1KA 4LCJA 1WZEA 1E0DA 3TJRA 3VZPA 1I24A 3CTMA 1ZSYA 4AJNA 1MFPA 2D3TA 5T8KC 1KBZA 4UAGA 1WNTA 3BTSA 3QW2A 3ASUA 4GVXA 1ZJYA 3NT5A 2Q49A 1YQGA 2AEJA 1XU9A 2HMWA 4LW8A 3U0BA 4MVJG 4MJLA 1V0JA 3T7CA 2VHXA 4Y6PA 1ONNA 1ISJA 3MTGA 3PZBA 4WEQA 3RUFA 1RM3A 3OFSA 1DC6A 2XAAA 4IINA 1RYEA 1S6YA 4GWGA 4TRNA 1Q2XA 5KNLA 1JW9B 4J9VA 1DFHA 1U3WA 5F3RA 4B8ZA 3BZUA 1GTMA 4CLEA 3QY9A 1RM4A 2CDCA 1M76A 3LC1O 2BFAA 2Y67A 3W8DA 4B4WA 3MWDB 4J0EA 2PKQO 2VHVA 4HXYA 3SLKA 4CV1A 2UV8A 4R3WA 2A35A 3PGJA 4BO0A 4BV9A 3ZNPA 2VYND 3ROQA 4ZJUA 4P22A 3RJ5A 4FFLA 1DFGA 5KIAA 1DDOA 4QTZA 1LQUA 1LUAA 5GZ1A 4W99A 3ZV5A 7ADHA 5KWEA 2QG4A 1JDJA 4CMHA 3PYMA 4NK4A 3H4VA 3LVFO 3ZI0A 3DHEA 4BGIA 1N1GA 1PX0A 1Z7EA 3DZKA 4B7UA 3VPHA 1PJLA 5JAZA 3JD0A 1KETA 3M6IA 4L74A 3JQ6A 4KTTE 3KOUA 3H2SA 1LRLA 2HK7A 1PZHA 1OBFO 4ZQBA 3A28A 3CH6A 4JGBA 2CFCA 2AXQA 3UCXA 4LRSB 1E3LA 4BQPA 1NM5A 3DEYX 3IJPA 2RHCA 5I8WA 3GVHA 1L7EA 3PIDA 2E82A 2I65A 4FOOA 3GT0A 3R6DA 1Y1PA 3WJAA 5TJHA 2VQ3A 4DLAA 2PLAA 3OQBA 2NM0A 1DBVO 2X9VA 3WSWA 5H82A 3UKOA 1ARZA 2OGUA 1MGOA 3D64A 3DDNA 2GGSA 5LDHA 1NQAO 1YONA 3D5TA 1DEHA 3DTTA 3L4BC 4FGSA 3KYCB 3ETGA 1JLLA 4L4RA 3TRIA 4AL4A 3JQ7A 4EGFA 5JSFA 1OI7A 5IF3A 3L07A 2B5VA 4XYLA 4PN3A 3BTUA 2QYSA 3DOOA 3I3OA 1QV6A 4RCVA 3GUYA 1KIFA 5G2OA 1Z74A 1OMOA 1PU2A 3GMDA 3JYNA 2IDZA 3TF5A 3HQ4O 1EDZA 4M8SA 5JAIA 4XA8A 4DUPA 5IJZA 3T4EA 4BOYA 3H65A 2J8ZA 4BL5A 5BSEA 2EJVA 2DBQA 3NTOA 4QUKA 1FDSA 5KOIA 4G81A 4ND4A 4BB5A 1KEPA 2PTGA 4UUMA 4YJGB 5HWSA 1MFZA 2V7PA 3PI7A 2IYPA 2X0RA 1YJ8A 2CMDA 4TRRA 4RL6A 3UCEA 3KUXA 4RO0A 2Y1GA 2P5UA 4E2YA 1Y8RA 1I2CA 1R4MA 4W9NA 1MG5A 4Q3AA 4EBFA 2Y0DA 1VJ1A 1JKJA 2NU7A 4I8XA 5KJCA 1K6JA 1M6HA 2WWRA 3AOGA 5KCZA 4WUVA 4J1QA 2P91A 3ROPA 4WLOA 1NBOA 1NFFA 3N74A 4ID9A 4OXNA 1LEHA 1NFQA 1ZEMA 1ZNQO 1DIAA 4QEDA 4RZIA 3ZV4A 3V5NA 4MP8A 3LC2O 1BG6A 1NVMB 2XXJA 4PLWA 4BNGA 3ZU5A 5B1YA 1QYCA 1PL7A 2OFPA 4HADA 4NJMA 2AMFA 3RQSA 3WS7A 3ROKA 3AI3A 1U3UA 4IQGA 3PJEA 1I3MA 1LC0A 3Q0EA 3FWNA 4H16A 4D79A 3TOXA 3GHHA 5I7EA 1G0NA 3HB5X 3W4KA 1B16A 2BHLA 4R1TA 9LDTA 4PG6A 2GCGA 4NFSA 5DN9A 4CM7A 4CMGA 1YWGO 3ZV6A 1HLDA 4BNHA 4QECA 1HWYA 3ZU2A 2AQKA 4Y98A 3U49A 5JY1A 3Q1LA 4RDHA 2CDAA 5T64A 2HK8A 2PA3A 2HQ1A 5JCJD 2GYYA 3VAZA 2W90A 1GQYA 2GN8A 3ZZNA 3PDJA 4J7XA 4FD3A 1UXIA 5JDCC 1L1FA 4MP6A 5KVCA 2NQ8A 1T1SA 4CLHA 3ZWBA 2JCXA 3JQFA 3RFXA 4BNJA 3VDRA 2VWHA 3GVIA 2JJYA 1YS4A 4WLEA 4DC1A 1OOEA 4J0FA 3UN1A 1XWFA 4OO3A 1JWAB 1S7CA 2VZ0A 4O63O 5A9SA 2BGKA 2LDXA 1CRWG 4I5DA 2Y99A 3GDOA 1Q7BA 2PKRA 1B8PA 3WMXA 5C3MA 3TNLA 1G6KA 4LGVA 4RGBA 3DR3A 3O03A 3AJRA 4XGKA 5CG2A 1E1MA 5TX7A 3LT0A 3WLEA 2B37A 2HU2A 1DC5A 4DC0A 3JQDA 3ASVA 5GMOA 5T5QA 5HBRA 5ILGA 5B4UA 1XELA 3GGOA 2X9GA 1BXZA 1HLPA 4NU6A 5TC4A 3INGA 4F6CA 1EFLA 1NVGA 3OM9A 4IJKA 1CF2O 3TFQA 3M1LA 2EKQA 1RJWA 5HA5A 3HSKA 3JYLA 3T4XA 4RORA 4Z0PA 3GVXA 4Z6KA 4DPKA 4D41A 2VOJA 4ZRNA 3EVNA 1YB1A 1PJSA 3ENKA 1I3KA 4DWVA 3SVTA 5BSFA 4DA9A 1UAGA 3O8QB 1YBMA 2VWPA 5KTKA 3VVCA 1DPGA 1XQ1A 3D4OA 4GX5A 4QSMA 2ZB4A 5L4NA 2JD2A 3D7LA 1Y8RB 2EP5A 4I1IA 3MOGA 1C0KA 3IQDB 3NJ4A 5CDTA 1DIRA 2FR8A 4E3ZA 3TL3A 4UEKA 1I3NA 3HDQA 4XQEA 5B12A 3BTVA 1FF9A 3ZU4A 1GEGA 3RWBA 1GADO 2X0IA 1PWZA 4BNTA 3RIHA 1NWCA 4YT5A 4PRKA 3F47A 4J91A 1IPEA 3U62A 3C85A 4FDAA 4HBGA 1DJQA 2FHSA 2O7SA 2DTEA 5L9AA 4FJ2A 3ZWPA 1T26A 2J3HA 4DGSA 1XU7A 4G2NA 1ZK2A 3U4DA 2FPGA 4OSOA 3KEQA 1PGNA 4BNIA 5JC8A 1YJQA 4OIMA 2PNFA 4D3FA 1SOVA 4NJMB 1LRJA 4J2HA 3WYCA 5TRTA 1U7TA 4KUEA 4IMRA 2SCUA 1DIGA 3VPGA 1YKFA 2J3JA 2Z1MA 3X2FA 5KJ1A 3WWZA 1Y81A 4MVJI 2G82A 3DONA 1BXGB 4BB6A 4MVJD 4GGPA 4DMLA 5BT9A 4L9RA 3D4PA 1Z7BA 3E1KA 3VC7A 3ZHYA 1C1DB 2GZ2A 3C24A 1H93A 3UUWA 4IMPA 1Y9EA 4YT4A 1UAYA 2X9NA 4WGGA 3VPXA 1XGKA 1XG5A 1SC6A 1B2LA 5A03A 3EVTA 2VCYA 5A5EA 4UVEA 3DFZA 4AJEA 2ZQZA 5CAEA 4YBZA 4GLLA 5JCXA 4I9NA 4UEJA 4AFNA 4E5YA 4DQVA 1I36A 1LU9A 2UDPA 3LSYA 4RPLA 1W0CA 1C1XA 2HRZA 3LT2A 2VRBA 1ZJZA 3QWHA 3LYLA 1JTVA 4YYZA 3WBBA 3PHLA 3D3WA 1KERA 3DBVO 1K0UA 3GA0A 3L6DA 3U5TA 3LZ6A 3UHAA 1M67A 3DQPA 2GZ3A 1R0SA 1W4ZA 3VKVA 2C5EA 2J5RA 2P5YA 4AJOA 1HDGO 4FJ1A 1X0XA 3BMQA 4PZDA 1QYWA 5C5IA 5L4LA 1LDYA 1E5QA 2YV3A 5AXDA 5JO0A 3GDFA 3I4FA 2ZKLA 1D7OA 1DB3A 4ESOA 2JFHA 3I9MA 4PVDA 4D0RA 3VTZA 2ZCVA 1K2WA 2JD0A 2VNAA 3QV1A 3VHRA 2DVMA 2P9CA 4CMIA 4EZBA 1I33A 3ENNA 1IOLA 2R00A 4FSHA 2YHUA 4GPD1 5IN5A 1I2ZA 1GZ3A 4F3YA 2EXXA 1VSVA 4WLUA 4BS9A 4YAGA 3FD8A 1DRUA 3W8FA 1ISIA 3CPSA 1E3JA 1PS9A 5TIIA 1A71A 3JQAD 5DT9A 1DRWA 1GD1O 4R9SA 2E49A 3D1LA 2VZ9A 1M66A 4BNXA 2Q50A 4E2WA 2CZCA 2AQ8A 1SZJG 2Q4EA 4UUNA 5TGDA 1L7DA 5CPFA 4GI2A 1DIHA 4JK3A 2CVOA 2FZWA 2IODA 1F8GA 2I67A 4ALKA 4NR0A 1GYPA 1GYRA 3C1AA 5L7YA 4B8WA 3EZYA 5L7TA 1NAHA 3S2GA 2QIOA 1PJ3A 2YJZA 1PJ4A 2DBZA 5JAQA 3K8ZA 1RKXA 3LC7O 1QYXA 1HT0A 4RVFA 1UXHA 1YBVA 1QMGA 2FN7A 3PJDA 4RJTA 3G3EA 1GQQA 2C59A 1LX6A 3RU7A 4P8RA 4WEOA 3ORFA 1KVRA 4K6CA 2GASA 2RH8A 3ETDA 3QWBA 2W2KB 2I3GA 1Z73A 4IDCA 1LNQA 3K92A 3ITDA 4XDYA 4Y8VA 4JQCA 1W8DA 3JCZA 3NTQA 3O38A 1BHSA 1ADGA 3S2FA 2D5CA 4BUCA 1V6AA 1ZK4A 1H6BA 2X5KO 4KDEA 1C1DA 5ADHA 1F14A 3DOJA 3GPDG 4AJJA 4J7UA 1KC1A 4BGVA 5IG2A 5KJFA 5IXYA 5A05A 3DZFA 2BF7A 1LC3A 1GY8A 1TVEA 5CHEA 3UVEA 3JQ8B 2A4KA 1CETA 1MXFA 4I5FA 2B83A 2EV9A 3KV3O 1AXEA 1E3IA 4PRLA 1DRVA 1P0CA 4YACA 1LLQA 4EEXA 3OA0A 2W4QA 4J7CA 3WYBA 2E37A 3NAQA 1MXHA 2WYVA 4KQXA 2X7HA 3V1TC 3ZWVA 3U4HA 1Q1NA 1QRRA 4CLRA 3L6OO 3GK3A 4ND2A 4KWIA 2DQ4A 3KHUA 1YL6A 4YEDA 1BTOA 1H2HA 3QVSA 2V6FA 3SJUA 1ISMA 3NKLA 1Q0HA 1GCUA 3GEGA 5JBIA 1XCBA 3I5MA 3IUPA 3QA9A 1A27A 1NQOA 3FR8A 4OMUA 2QHXA 4NPCA 4MIOA 3IKTA 3H8VA 1A7AA 3EC7A 1Y6JA 2OOSA 2W98A 4JXKA 3W6ZA 3HWRA 2DAPA 1MX3A 5JE8A 1ZXLA 2BKAA 3RUDA 5EQFA 5G0WA 8ADHA 1DSSG 1H0KA 3MZ0A 5CEJA 4DPMA 5CDYA 2VYNA 4A7PA 1E7QA 3MWEB 4GSKA 2VHZA 4OOEA 4PG8A 5K0ZA 2PK3A 1IB6A 1R15A 2WYWA 4RDIA 1JKFA 2NU6A 5BSGA 2E6UX 1LBEA 1SEVA 3JYQA 4M86A 2FSSA 1GL3A 1FDTA 3I83A 1EMDA 3L9XA 4CL3A 2ZTLA 2I5PO 1WAMA 1JWBB 2LDBA 4JJFA 3H5RA 3KBOA 4ND5A 4EJMA 1MC4A 2IEDA 1DFIA 1HZJA 4URFA 1U4OA 4EW6A 1YB5A 2VTDA 2W8ZA 3AM5A 4Q3CA 4MO2A 1M75A 3AI1A 3JD3A 4KUGA 4QX6A 4BNFA 5F1KA 1WLYA 1XQ6A 3VDQA 3WICA 4ZQGA 5DNAA 4B79A 4CR7A 4XKJA 3UW3A 3HFSA 2Y93A 1VKNA 4FC6A 3ZWYA 1VKOA 4RPHA 5A3VA 3I9KA 2GLXA 1RM5A 2PD4A 1IHYA 1IYZA 3I6IA 4MOWA 4NBTA 3S2EA 3W1VA 4GAEA 2ZJ1A 2YDYA 5AXAA 7MDHA 2B4TO 1N9GA 4F6LA 5MDHA 1QXSA 4GKBA 2O48X 4O0LA 3WNQA 2AEMA 3BYZA 3TZKA 2NADA 1GZ6A 3BTOA 5IZ4A 1TT5B 5JDIA 4LN1A 5FI5A 2HO5A 3OICA 1DIBA 1XHLA 4GMFA 2BGLA 3PK0A 4JP2A 1GCOA 4YQZA 1LLCA 4E0BA 5BNTA 2YV2A 3DO5A 4XD2A 3RAJA 4WPGA 4EJ0A 4DIFA 1PQUA 4D42A 3PHGA 4QQRA 5U9CA 4TZTA 2OP0A 2GN4A 1QKIA 4OXYA 1YO6A 3O9ZA 5JC1A 4NH4A 3DFUA 3ANLA 3Q3CA 4HY3A 5KKCA 2TMDA 1WMAA 4NNJA 2Q2WA 4DMMA 1X7DA 5THKA 2G76A 2YDXA 4WE3A 3WR5A 4E2ZA 3JQCA 1B3RA 3TDKA 3JQGA 3PWKA 1F12A 1M2WA 4ZQEA 3IJRA 1GU7A 2VN8A 2FY8A 2EF1A 2C54A 1JN0A 1U5CA 2ZATA 1ENOA 4Y6RA 4WNIA 3WQSB 2DUWA 5F1PA 2OL4A 1WMBA 3OF2A 3RUIA 2EKLA 4E12A 2HSDA 5I9NA 1GFSA 2I3AA 4JBIA 3EYWA 2X22A 3V1YA 4E21A 5HTOA 3C7CB 4CQLA 1SB8A 2GF2A 3COSA 3GH3A 3RI3A 3X2EA 4NFHA 1JU9A 1R37A 1LLDA 3K73O 1JKIA 4GBJA 4CQLB 4E31A 2Y1FA 1WW8A 2DPGA 2P4HX 3IMFA 2WYUA 4LCEA 1B26A 4CODB 1P9LA 3Q6IA 1NTOA 1C1XB 4NG5A 1JQBA 4EYEA 3QWAA 4BIIA 3RFVA 1PQWA 1ONPA 1EK5A 4LVCA 4ZRMA 3GFBA 1EK6A 3DBRA 3PWZA 1B7GO 5I8ZA 4R69A 1EVIA 1TXGA 3IP1A 4UULA 5TNXA 3DMTA 2H1SA 4OQYA 1FDUA 2BLLA 4PLGA 1FDVA 2NVUA 3GAFA 3BMQB 4U8GA 4OQZA 4MIYA 1R0KA 2NVUB 4IS3A 1ZZEA 4F46A 1EQUA 2AQIA 1PS0A 3AY3A 3DAPA 4CM8B 4XX0A 3NUGA 1A9YA 3AW9A 3UH1A 1EEHA 1Y7TA 1QORA 2NTJA 3INTA 4QXMA 4RPGA 3GDGA 1EVJA 1D8AA 5I7SA 3WSVA 3RROA 2ZB8A 3QVWA 5FFFA 3WFIA 1YB4A 4BVAA 4A27A 3IIEA 1AHHA 2C82A 1X0VA 4IUYA 3AUAA 3MJEA 1LSSA 3EY4A 3IC5A 4FR5A 4L8VA 3CZMA 3I9OA 4ZA2A 3AU8A 1PGOA 1J49A 4JBGA 3CZRA 3M2TA 2VTEA 2DFDA
chains in the Genus database with same CATH superfamily
2CUTA 4DR6B 4D4KA 3QKRA 4D9FA 2NIPA 5K7SA 2DTDA 1O5OA 1EHCA 2HMUA 3QLTA 5HS4A 2YZKA 5TQ0B 1EVEA 3FI9A 4U0KA 4JJEA 2O59A 2P68A 4Z53A 4ZOEA 4CKEB 1DC7A 2RONA 4NZYA 1OZAA 2B94A 2JZOA 2IP4A 4GFDA 4Q9DA 1T4LB 2IYUA 4ZANA 3TE7A 3U9LA 4DABA 2ODNA 4NU5A 1GV0A 1KZ6A 4BMYA 1YGPA 2P2LA 4QATA 2EYQA 3BCSA 3GRFA 2XOKA 4N54A 3H1PA 3RFUA 3GMSA 5AKIA 5EZYB 3DMFA 3AGPA 5ALWA 2LUPB 2ZRAA 5FPHA 3S6JA 4F4UA 4ZGBA 5FTWA 2F4VB 3BHIA 3UT5A 3F5MA 4DSTA 4GL2A 3F6EX 4TRJA 3C5EA 3FX2A 2H2HA 2XVMA 3IFSA 4NMMA 5LQSA 1E4EB 2Z2XA 3RVDA 4S1VA 2AG8A 2C92A 3ZD8A 1OGIA 2R00C 4G09A 3VM6A 1E7WA 4N0DA 3FCAA 4HDKA 3OCCA 1IE3A 1Q1GA 1NOIA 1HE3A 2H06A 3ELYA 1T6ZA 3I42A 3UZUA 2PBZA 3OFVA 4QOEA 4FR2A 4CM4A 4DZZA 1OBCA 2LCEA 3OPQA 1KRXA 1SZPA 4F3NA 3T52A 1D2GA 2YS7A 3IPRA 2GN2A 4FSDA 3EAGA 2D0IA 4OHPA 1Q17A 4TUGA 3UGJA 2I7TA 3W5HA 1ZGGA 2ABWA 1XQ9A 2BELA 1MGTA 2DQKA 2OAGA 2XQJA 4YAKA 1M1YE 1MOPA 4FB4A 5GIOE 2JJ8A 4I2VA 4WCFA 5JH7B 1SU7A 4DIDA 5ICGA 4M2LA 1W88A 3OHSX 1G9SA 3AIIA 3BDAA 5D7NA 5DCLA 4NDZA 4LGCA 4M0KA 1YASA 2YN0A 2XGMA 4DWJA 2XRZA 3TTUA 4M87A 4D82A 3KUKA 1A9OA 3UXYA 2ZRKA 3AX6A 2NYVA 3Q2KA 5AC5A 4DV1E 3OZXA 5HVNA 4Y1RA 3ZE0B 5TF4A 5CEFA 3IKVA 1GG9A 1PTKA 1X48A 3ND7A 3AEYA 1JQDA 1QZZA 1TRKA 3IEUA 4LSMA 3WRWA 1JSCA 4NHRA 1I6MA 1Z63A 2I8AA 3NHUA 4J1NA 1MT3A 3K30A 3FLBA 2BBTA 3KXDA 4ZAGA 2KI5A 3CRW1 4PXSA 1KOGA 2I87A 4HJXA 2JJ1A 1DLJA 2J87A 3AERB 3BMCB 4IQ0A 3WLLA 2RG1A 4CM1A 7AT1A 1X6FA 2Q4BA 1WQ1R 1FJGE 1I1OA 1WW3A 3CURA 1TKRA 3PXEA 3BZBA 3A14A 4B6OA 1Y8QA 2EW1A 3NTRA 4HFNA 1XFDA 2QSYA 3AEZA 5DYNA 2CTDA 1O95D 1X13A 2ID7A 1Y3CE 4JJ7A 3T38A 1TIBA 3TG2A 4IDNA 3VH3A 1CJCA 4OIFA 1MV8A 4AJ4A 5K6RA 3QG1A 4DR3B 1RHJA 5K1ZA 1VZ2A 1EGVB 1Y1SA 3D3WB 1PFQA 2MMGA 4HDSB 2JHPA 4OLFA 3CGWA 1LH0A 1V1MB 4G4IA 3T7DA 5EJAA 4LCBA 2VAXA 1SUWA 3AONB 1EFPA 2NACA 2GD1O 1I4DD 4AJIA 3NB0A 4EENA 1PZEA 2Z6VA 2M7QA 3GAZA 2BMDA 3GIWA 4EJ6A 4RKRA 4PPFA 2IUSA 4O1MA 2BFEA 4MWDA 1EESA 3A3NA 4M0PA 4QVGA 1W1UA 4L0MA 4O2BB 5E9JA 4IH4A 4BO9A 5H3CA 1SO8A 4H0FA 3KVVA 5BSTA 3RVOA 4XX0B 5KX5A 3BD9A 4CDGA 2YIVX 1CG6A 4H08A 1Z18A 3CPHA 2VPTA 2E5WA 1E1NA 1SHZA 1YPNA 4XGRA 5CFZA 2GSWA 2VPZA 4O25A 1AH5A 4HLQB 3PP8A 3RW9A 3WGHA 5AVTA 2UUPA 2ZUVA 3N8NA 4FDLA 2GN6A 3PE6A 1JHOA 4LJLA 3UUGA 3E9CA 2JCSA 1X6VA 4D6XA 1A1GA 1FMCA 4RZUA 3PNOA 2FDRA 2QJRA 2R751 1UDRA 3F46A 3PQ8A 3G2OA 4BV8A 1BGWA 1M7BA 3QXXA 3LYUA 5B36A 4QYMA 1HXHA 1JX6A 3DC2A 4GI7A 5A71A 2X2PA 1P8AA 3QFRA 3NWBA 2LCIA 1E3MA 3OUUA 4LNAA 3B9PA 4K6GA 1AQJA 5L6LB 4BFUA 4G0UA 2P9GA 1CUSA 5CX1A 4ZRDA 3T9FA 1O89A 1SUAA 3KYBA 4NMWA 4EJSB 2VUSA 3T3HA 3DZIA 3ZNOA 5E2BA 4EA7A 3I01A 1D6SA 3AU9A 1J24A 2JA2A 3WY9A 2PHZA 1DAIA 2MC5A 3LUBA 3U2QA 2RPCA 3D6TB 4UBMA 5HKOA 5K0JA 4YRAA 5IK2A 3MBKA 5CXSA 3PPXA 1QGZA 1VSTA 4HH1A 3Q3HA 4DV0B 1U8YA 2HTFA 3H9QA 3BWBA 4QASA 1UQUA 2AXPA 2FEMA 4OFXA 4YCLA 3WJ1A 2BMEA 3DD1A 5DCUA 4LE0A 3REGA 5KJEA 2D4AA 5KC9A 5JHGB 4DL9A 1FFWA 3ZQKA 2O1XA 3TAHA 2E4UA 4GR4A 4Z4EA 1CR1A 1KHTA 3MEQA 4EPTA 4BMZA 1YZUA 1ZCFA 2REQB 4TN5A 3RVQA 1HETA 1NVVR 2O8VA 1GPJA 2XIJA 5TQ2A 4E4TA 5YASA 3ETHA 2EJCA 1B8UA 1BOOA 2P2DA 3PDIB 1TI7A 2QLLA 1DCMA 1ZXBA 1CQXA 1FW8A 1P6UA 1EX7A 3BIJA 2D1QA 3RKRA 3ZU3A 5H83A 3C1OA 1VSUA 2XF8A 4L2IB 4WZBB 4RHBB 3TFOA 2HRDA 3FCOA 1Z39A 3Q88A 4MINA 4BQEA 1GTRA 2CCGA 4HZIA 2CHUA 3U56A 2C00A 1HPLA 1VL5A 4GX2A 2YWXA 3KZCA 2D00A 4H7EA 5AM5A 4RVHA 4Z2AA 4NQZA 3KFXA 3U80A 3TZHA 2DHRA 1YMQA 4ZD6A 2AF4C 1ZLXA 4IZOA 3EQ9A 4IJWA 2ECFA 3CRNA 4NFYA 5I9IA 2ZCUA 4Y6SA 4L5NC 1Z6XA 4LSGA 2YJ4A 3QHAA 3E70C 4JZKA 1DAEA 2IPNA 3BD6A 3TUIC 4ER0A 3R3SA 4J49A 1WCIA 1E3SA 1D2MA 4JOQA 4CV3A 2AZMA 3K4HA 3I58A 1TQDA 3WIEA 2FQXA 2RGAA 5GM2A 2LT7A 4JBYA 2ASEA 3N8GA 1XX6A 3VYYA 4LF5E 4MYDA 4JXJA 2JLAA 4J0KA 3VNQA 5LQCA 4HGPA 4IOLA 1J7KA 1DX9A 3K6KA 5KQPA 2P41A 1QHSA 5HDQA 2EBWA 3M34A 1GFIA 1JQLB 4J75A 4JLKA 4LWZA 2VTVA 3O2QB 3L2OB 5CIWA 3VDNB 3GJRA 4EJFA 2JKVA 4HYYA 3EK2A 1GOTA 4CVNA 2I4RA 2L42A 1EINA 2YMPA 3LPCA 4R3NA 4ZALA 3SD7A 3ND6A 3W9BA 4P4LA 4XWGA 1NZFA 4CMCA 5F98A 1K97A 2P4QA 2LRSA 4N5LA 2XMQA 4B6EA 3PSHA 3INYA 2UXDB 2LTSA 3AUXA 1TJ4A 4D9JA 1U8FO 4IV8A 4X00A 2MHCA 4AK9A 2ZRJA 5GM1A 1ULSA 1AGNA 1O57A 4UBKA 1LNZA 4D9MA 1F7VA 3HEAA 4ZYDA 3F4BA 4MA5A 2O7VA 3U48A 4CG3A 1RIIA 3W34A 1ZOIA 3H5AA 1FRFS 2E3JA 2EOAA 3LFTA 1L7QA 4IJ5A 1RVV1 2ZWPA 3C3EA 3G88A 4OUDB 3V7FA 1Z75A 1NUQA 2VJDA 4U5XA 1T36A 3U3ZA 4A2PA 3FPLA 3ETEA 2G17A 3E61A 3OIGA 3RIGA 1C9MA 2CYAA 5FFNA 1D04A 1NI3A 1Q3KA 4JJZA 2PMFA 1E62A 1RP1A 1RYFA 1EH7A 1MO4A 1KDYA 4V1CB 3RUCA 4HPJB 5IJAA 4B6RA 2DGCA 1GKUB 5DM60 2Z0MA 4P4GA 4R16A 1V9SA 3A9WA 2ZS7A 2W4MA 1AX9A 3COPA 1C8BA 2PX0A 3AP2A 3H5OA 3KOWA 4QHTA 3UYKA 4AY3A 4PQFA 4ESEA 1DI0A 3DMTC 3NYWA 5I9SA 1N77A 3B20A 2C9ZA 4RA6A 2IQIA 2L2MA 2B3TB 4EHNA 2IZ0A 1OAOC 4Z8XA 3PQ3A 2NOAA 2PH5A 2Q1WA 5T3UA 4Z3KA 4N41A 1HDZA 3FOEC 4WV3A 4R84A 1DQRA 4UPEA 1F2TB 2HU5A 4M9RA 4OLHA 4G0ZA 5CFNA 4DT1B 3MTAA 4OKIA 3RC2A 4BKPA 1C9JA 5JFGA 1THTA 1YOBA 2IW1A 1VRVA 3ZNQA 4HQLA 5DX1A 2XF2A 4IJUA 4K0KB 1U31A 2JATA 1DQ3A 1PT7A 5JY6A 2O3TA 3PLRA 4JBLA 4E30A 1YA4A 4WNCA 2F55A 2O8EA 4X84A 4MVJE 1HYHA 5E6RB 4R2LA 1YQXA 2PLRA 5JVDF 2ZJAA 1JT9A 2OP1A 1GTSA 3B5JA 4CU5A 3OTWA 2CV0A 5IPFA 2VWQA 1AY0A 4QO8A 1NI5A 4EI8A 3HXQA 4D5EA 1IHXA 3EIFA 4P82A 1XZLA 3BMNB 2YXDA 2PUCA 3FMGA 1WXRA 3B70A 3M5CA 4AKTA 2LO3A 1IWOA 4DQXA 3F3KA 3EC2A 3PXDA 4A5OA 1PR3A 3DB2A 4PLTA 2ACKA 3H2YA 3AHCA 4FS3A 1SRRA 4U6SA 1NMZA 3BBLA 3CLTC 4WCFC 4CGYA 2V86A 1CZRA 4GMGA 2OQRA 5EINA 2H7XA 5D51S 1BJRE 3MT9A 3QX3A 3PNPA 2FOIA 4NBVA 1H0RA 3PUVA 4JB8A 4EP1A 1Z4LA 4ER3A 4LMBA 2HLPA 2WILA 1JGTA 4S0ZA 4KITB 4H6WA 3ELUA 3SQNA 1NN1A 5DM0A 121PA 4C29A 5CB4A 5DCYA 3OZGA 5LQKA 3CUUA 1PGPA 2VF2A 3PT5A 5DLPA 3ZHZA 5HM8A 3FGZA 1ZYUA 2JAXA 2NSJA 2RKWA 2VUHB 3A1DA 3EZNA 4L5AA 4QFDA 2EF0A 1JJBA 3RM3A 3OQIB 2JS7A 5AHOA 4YCCA 4RTPA 4ENWA 3IL2A 1O03A 3V8EA 1N6IA 1GQEA 3GUHA 4COOA 1YQ9A 3ANNA 2N8XA 4B3RE 3DEJA 2IXBA 2NN3C 3P5BA 2PZEA 1PJ8A 1RXCA 2ATEA 2C2BA 2PX2A 3BWYA 4B4KA 4BRWA 3C8HA 1JU3A 5IF9A 2ZTSA 1QRDA 3MGKA 2W2NA 4J0JA 2C3OA 1BRMA 3CLKA 4H3HB 3U3XA 1T2DA 2NV6A 4QPDA 5FLEX 2LUQA 2PR7A 1QCYA 1MOSA 3JR3A 4WLVA 4EG3A 4YIHA 3IJ5A 1NC1A 4G8CA 4WY8A 5D1HA 3IUSA 1Q0RA 5IASA 3LQQA 2GRAA 1UXOA 2YX1A 2IBSA 3M6AA 4DR4B 4RF3A 1MZPA 1YFZA 4MTLA 1JDVA 2EGGA 1Q57A 4DLWA 3VI4B 3T1YE 4B5KA 5K8TA 1QE0A 2F3PA 2QK4A 3CO5A 4TT3D 3MQ2A 2B92A 4B3SE 1HEIA 4DMIA 4YUVA 4J1TA 3KJFA 1L3CA 4R2PA 1H42A 1PT5A 1SWWA 2AQHA 3A7EA 4EW2A 2R1ZA 4IDAA 3WOVA 4WYQB 2B7VA 1X7XA 2QUBA 4KMRA 5FOUA 3FDJA 1T1RA 4Q3BA 4F4FA 4JI6E 1MABB 1IM8A 4FI3C 5CT4A 3FTDA 5CVUA 3EE6A 3TSZA 4JYAE 1DIOB 3AV3A 4BBYA 5DHQA 3RS5A 1CVLA 3LJKA 5B2ZA 5H3HA 5EN4A 2HA3A 3U4IA 5E1MA 3EMKA 1Y9ZA 4YO7A 2JIZD 4BGUA 4MMZB 2BFOA 2O2EA 2F3TA 1Z2DA 1CJSA 2I9PA 2VNSA 4O4JA 3VR6A 1OT3A 1V7QA 3HZZA 4XUEA 4W9RA 5DW0A 3LAWA 2FB9A 3RVKA 4PSKA 2X0NA 1TZMA 3AHEA 4PF1A 5BOSB 4ALIA 5LP6F 3O73A 4CW7A 2AZ4A 2GFHA 4ZCIA 2IS6A 3E3NA 4D56A 2EOYA 1P2VA 1AZLA 3B6ZA 3LDUA 5LU9A 3PHBE 4IWNA 4PZZA 1I7QB 4B3TB 2HT1A 4ZVRA 4XRRA 3WLTA 4EF6A 4WN9A 2J7PA 3OM1A 2AIRA 5CCXA 2GKOA 1KMMA 4IFBA 3R7FA 4CTJA 4K5QA 1XCPA 3WGGA 4EUFA 3RH0A 2W2TA 4C06A 1L7BA 1YQDA 2XJ9A 2QY9A 4NZ9A 3VHTB 4NOMA 4CRWB 1O9GA 5K9ZA 2HR1A 5A3JA 2OV2A 2H5IA 3HCNA 3OIFA 4NF2A 2H51A 2DUMA 1I9CA 3DXZA 2R8EA 4HWTA 4LHZA 5ERYA 4LF8E 1YDFA 2JD1A 3OUZA 1V45E 2DP4E 4N8SA 4AG6A 2IDJA 3AY0A 3OOEA 1VCOA 5FTNA 3GZNA 3WMWA 1YXMA 1RS0A 1K8QA 3GJ0A 4R5HA 3OE5A 5DF1A 1J8FA 5G4LA 5J40A 4JI5B 1MQ9A 3ZWQA 1CF4A 2WWFA 2O2JA 3KWMA 5EE1A 3Q1KA 1MVNA 1OX4B 1HY3A 3DMGA 3QLVC 5H7XA 1SKMA 1KYTA 4NYJQ 1U7WA 4OFZA 2FWMX 3SFVA 1L9KA 4N5MA 3PENA 5TGZA 2ZE5A 5D3ZA 2V97A 3ES9A 2R1TA 2FZEA 4MI1A 2R4QA 3VH1A 2AFIE 3EW9A 3ICCA 4NU0A 1KAOA 1XC7A 2GBCA 1NW6A 1C7QA 4KJZA 2A5JA 2NVOA 4H59A 4Q7LA 5A0FA 1X1RA 4ZQFA 1M6EX 5GGYA 1T25A 1L5OA 3ZE1B 2NWQA 3GLGE 1IHPA 5EUBA 5CM9C 3T3EA 3KR1A 3FYUB 1RLMA 2RAPA 1JQ3A 4DEYA 2EGHA 2G77B 2VP5A 4ZYEA 2XHZA 3DKIA 3ULKA 2MDTA 4F1JA 3O1HB 4A0SA 1J6UA 1I7PA 4ZV4A 2EC5A 5I8PA 1UZLA 1KC3A 3AUUA 1RXWA 1CWUA 4NBWA 4DPLA 2BH2A 2FP3A 5BQOA 3FSGA 2LIPA 3IULA 1TM3E 5B37A 2V0NA 4YTEA 3UKJA 4CMKA 2NUGA 1QDLB 1WZNA 4H1HA 5C46F 5MN6A 4ZTUB 4PAMA 4Q9IA 1GTJ1 4RTNA 3N39C 4FW9A 3P1XA 3QPUA 1WETA 1NSTA 2IEBA 5INTA 2GYUA 1DC3A 2JVIA 4JLPA 2W2KA 1V7CA 2X8WA 4L4UA 1T29A 2QD2A 2GTHA 1VL0A 4DANA 1KQGA 1X3CA 1RQ2A 3ZDCA 2VATA 1NPDA 4ARZB 1MA0A 5FLXA 3E18A 4DY4A 2GVZC 3KOYA 1QVWA 4JLJA 4OQFA 5I7FA 4RTMA 2OBYA 5BPFA 2Q9UA 4EA9A 4KCGA 2BGGA 4XYMA 4DW8A 2QTTA 3QSGA 4X20A 2TMKA 5B58T 4ALJA 4EDFA 4ZI7F 1CJTC 4TS1A 4BVGA 1Z33A 2IF2A 3SSNA 1NOJA 3WDKA 4YRPA 4WPYA 1OD6A 3NORA 4FK5C 1XXHA 2C1ZA 5HZGA 4MV8A 1CTQA 3F6GA 4RZ2A 4UCXA 2YSOA 4B0OA 3IURA 5J2UF 1LV8A 3FIUA 1NFRA 3OCYA 3FRIA 1W2WB 3C6BA 3IS3A 3NHSA 3WAGA 5CYOA 4MV9A 3LQKA 4C4OA 1JLKA 4DYHA 3UB3A 1SQ5A 1QH0A 5DBGA 5F33A 1YFJA 3J81k 5CM8B 5IJ0A 3D0QA 5A6SA 1NBMD 3C15C 2FR1A 3DBLB 1FP7A 2XVYA 5FNVF 4KFSA 1OPRA 2OBLA 3WZLA 4V24A 2F1RA 3DDCA 4MGYR 3UTCA 1XD2B 3HVKA 5AKXA 1DHTA 2C57A 4L02A 4F8YA 9LDBA 1W6RA 2ZYHA 3ZEIA 1JYFA 3R6GA 3R6LA 2CPNA 1NJ2A 2EFEB 3QWFA 1CZKA 1SNYA 4GBMA 3MCAA 4MMXB 4G24A 1BC5A 1C9EA 2QAGC 1TA4A 4YJGA 5J9FA 3ZV3A 1Y42X 4HWRA 1MF7A 4OM8A 4PHHA 4KG7A 3SR3A 3NAGA 3TIFA 2AMJA 3ZXSA 4CF6A 2YFHA 2Y0CA 2V4MA 1JK1A 2BMAA 4U5QA 4CIAA 1XQYA 2QV0A 3E8XA 4PNPA 2ZP1A 3S99A 3WXMA 3H9GA 1IOZA 4GZLA 2ORVA 4JQSA 1YGYA 2H16A 4KIWA 4R1QA 5T7BA 4BN0A 1QE5A 5E7JA 1P1IA 3CH4B 3NANA 1YNSA 1ZMBA 2BUCA 4QLBA 4W5OA 4XDHA 1ICEA 4XWTA 3GX1A 2I2XB 4R2DA 1YZYA 1F8XA 4U7FA 3B9BA 2H63A 1QGOA 3ZTWA 2O3QA 1T9ZA 2FFQA 4C0BA 5I5EA 1DJNA 3ANMA 1WDLA 5JFTA 2EOZA 4EEZA 1FDRA 1LLMC 1XHEA 3PB3A 3R77A 1G2FC 4B3SB 5WRFA 2WFAA 2ZU6A 3PUWA 4FPXA 4B31A 4MQMA 5C8VA 1E6EA 1X2BA 1KSFX 5B2FA 5BR8B 4IFEA 1SR9A 1GHTA 2Z2IA 4FILA 2WAXA 1YZHA 2YNMD 5DYWA 1Z2NX 4B35A 4ZHQB 5HYVA 4DV7B 1T8WA 1QKJA 4QOIA 1NXOA 4D4HA 3JPYA 4BZPA 4NZVA 1AUQA 1WXWA 3AJEA 4B8YA 3LHDA 2MT9A 2XTZA 5ENVA 3GEPA 3R0QA 3O7MA 4PGGA 3IOCA 4MKXA 1T1JA 2AEEA 1H2BA 2EWWA 5J23A 2H11A 1TTPB 2LV8A 3B3AA 4G97A 1KP9A 3CEAA 1H23A 1S2IA 1EM8B 3PFIA 2OTCA 1ZIOA 4JWTA 4RANA 1IN1A 1NWHA 1T91A 3K05A 1H6CA 2FUEA 3M0EA 3N87A 3OMWA 3PDIA 4NEQA 5K0SA 3H2HA 3I4CA 1L5RA 5GOTA 4MGIR 2WINI 4MYCA 3FVVA 4F38A 4OSEA 3Q11A 3HUDA 3ZGVA 2BFFA 1MEEA 1JECA 1PIWA 4MVJH 3SF8B 2OBFA 3R8FA 2M1ZA 2HLNA 2OZEA 1HV8A 2J0EA 4Y9RA 5EKXA 3GNTA 4AJPA 1Z8FA 1P6QA 3TN7A 5IZCC 2HHAA 1R3UA 4FIDA 2EM8A 1PVVA 2GFIA 1SWVA 1KDRA 3PHIA 2QV7A 3VR3A 1KDTA 2QRKA 4ENSA 2O6LA 4JROA 1FE8A 2CYBA 2KBFA 4FCCA 3CF4G 2B99A 4AJ1A 1CY2A 3FWYA 2IKSA 4WUTA 4KN5A 1T6NA 4IDPA 5DYGA 4HNTA 2ZBEA 5FOTA 1UANA 2H31A 3Q3IA 4M89A 2PNJA 3BWDD 4OJKA 4QBIA 1TPYA 4MS1B 5TT1A 1R6AA 2DFKB 3DLPX 4PONA 1OI3A 3A6DA 4U7PB 3SQMA 2G71A 1ATZA 1CUJA 1H9BA 4R2MA 3SU8A 1HDOA 3IX7A 4A8JC 4Z54A 4HX2A 3KETA 4QUGA 5EJ9A 2PSSA 5A2QC 3CEMA 3BJEA 4F9AB 1RYDA 3ESBA 4HD8A 3PVSA 2VJCA 4KP7A 4E88A 4Y2RA 4N65A 1L3BA 4CM6A 4DLVA 5B6PA 1K0FA 2ADOA 3P4UA 5G4KB 5D01A 5AVSA 2GEDA 1P8JA 4CETA 3NGMA 1ORRA 2UXBB 2YSPA 3ET5A 3GLQA 4OOFA 3UH0A 3FTEA 3I5UA 2P0YA 1T9KA 4UU0A 3EGIA 4ZOQI 3A1VA 4D45A 3HA2A 4Q1AA 1CUVA 3R3WA 4OMCA 3PGMA 1Z4OA 4LMAA 4CM3A 1U3VA 1QSGA 2DCMA 4HQRA 3MB8A 3FJYA 1KWKA 4KXXA 3LGSA 2G8NA 3OOWA 4Z1MD 3P27A 3UMBA 1HNWB 3S1SA 2JOXA 3LI2A 2FEKA 2IGTA 2VK2A 2ZKIA 2R11A 3QEKA 2ODAA 4UASA 2YASA 5DE3A 5EP2A 1W19A 1G66A 1NP3A 3FKSD 1BEZA 3NRBA 4RCZA 2E1PA 2H5EA 2DQYA 1Z2EA 4QWMA 2PJDA 1NUHA 4LDNA 1KVUA 1NNUA 1PF7E 2I1WA 3EDMA 1E69A 2IYWA 3CKYA 4KE9A 4KQJA 3N76A 1UH5A 4C2AA 3BD8A 4WCDA 3TS1A 1KBQA 1D0SA 1M7HA 1MUUA 3I0ZA 4E6PA 5I4CA 2ORYA 3M9XA 3P7MA 3AK4A 3NG1A 1LI4A 3K15A 2ISQA 5FUYA 3S70A 5BN4A 3G9UA 1RMDA 1MC5A 2PLNA 3GRRA 3U4QB 1YUBA 5AJWA 5KWSA 5B55A 4ZVOA 5BQPA 2PH3A 1L5HA 1DWQA 3K96A 5FOSA 1WXEA 1REQB 1GPBA 4GYKA 4BB9A 4X65E 4W4TA 3JAMA 1RC8A 1RWVA 1Z7GA 3PCXA 2OILA 2IEIA 4ZKEA 3NHKA 5AO9A 3B13B 3SE7A 4DNQA 2ZE8A 1TJNA 1Q91A 1DO2A 4GS5A 2UVQA 3WK7A 1Z6TA 1J9EA 1Y1KE 1TUBB 4JENA 4MKHA 5DHFA 3TLEA 2Y6UA 5H4GA 3VH2A 3T9BA 2OT3B 1ODCA 4AKHA 1SXJB 3FGPA 1KEKA 1TN9A 4ZXFA 5JNTA 2ZJFA 1NSYA 3OKAA 3H5VA 2GVNA 2EMIA 4P0TA 5BUCA 4IBOA 4YA6A 1DEAA 3ZWWA 3HJRA 3SYNA 3W0LB 3PC2A 2VZLA 3TQQA 1AGXA 3V1LA 4RDCA 1NY5A 4JI8E 4MW5A 4WZAA 1M8JA 3SHQA 4E32A 1D9XA 2PV0A 2PX5A 3JQBC 3ACBA 1FMFA 3U7QA 3CCFA 2EOQA 1N3YA 2FG6C 1AVTA 4E1BA 1LFAA 1CNFA 2WHRA 4QYIB 1KGSA 5EMKA 5E6RA 3DOFA 3DSRA 4C4ZA 3CF0A 1CQWA 3KALA 4RLSA 4CEJA 4RZ3A 5EZ6B 3DT8A 1NXTA 1TC1A 3MJCA 1RYBA 2QL6A 4R51A 1P1RA 2L6MA 1JDBB 2KJQA 2YWDA 5FPSA 3TSAA 4A0RA 4IFTA 5EVCA 5BWLA 5L3SB 4HEJA 3T35A 8AT1A 5EIAA 3B6IA 2FRDA 4KSYA 4WFTA 4AS3A 3LUHA 2FN4A 2PR2A 1FFGA 1USGA 4WK6A 4FFRA 3EF1A 5FI1B 1MC8A 5FOVA 2GNAA 3QNWA 4XXHA 3OZEA 5JCZA 5G41A 3S0JA 4HEQA 4IIJA 5ESXA 4GP9A 2O54A 4Y9SA 1WHSA 3GCDA 2JI4A 1VMEA 2UUCE 4AM8A 2GD0A 2P62A 4BNLA 4AN0A 1XVUA 2ZYVX 4MUMA 5K0FA 1M74A 1H3EA 2YU5A 3ESYA 4CL0A 4C4RA 2ZBVA 3CKLA 1WUIS 2FZVA 2MSWA 2Y1DA 1DG1G 1KJJA 2A5FA 3G6KA 4GKVA 2OHFA 1E2HA 4DRZA 5C8YF 2FCAA 2PKEA 4TKUB 4RSHA 1ESCA 1XE3A 2YCLA 1RJDA 3M4ZA 2NO4A 5LZ5A 4UHEA 4TX1A 3N58A 1O58A 2AFRA 1DXQA 1Y3FE 2YVUA 3KPUA 3GLSA 4PIVA 4MYTA 5GQSA 1MC1A 2AR0A 2BCEA 3VR2D 1OH5A 2O8DA 3I1JA 2GK3A 2JG3A 2Q9AA 1JEAA 4CKYA 1UBEA 2NO1A 3NPAA 4GXNA 2LJHA 2FQYA 1PJQA 2WWHA 4EI2A 5C53B 2EBUA 1QE3A 3G1UA 4WOKA 1PJAA 1A2OA 5A06A 2JH9A 1SIUA 4KXUA 3ZE6A 1CQIB 1CEQA 1HG0A 2NV0A 2PAAA 1O96B 1IJBA 2QROA 1T0BA 4TTQA 3MCUA 4HV4A 5CDFE 1T4DA 3R5XA 3E3AA 3K72B 4RNCA 1XMSA 2HSJA 1RE0A 3IAEA 4OHUA 1C81A 4HEA1 4QJ5A 4QO7A 4TKZA 1NXWA 1FKAE 1C30B 5JOQA 1BYUA 3H3XA 4MR9A 3TL2A 4AX8A 2IV3A 3ORHA 3LUDA 3AIMA 3GLHE 5A2QA 4YRQA 1L4MA 2C0QA 5ANRB 4FD2A 5BWNA 3U6KA 1CUAA 4GC5A 4X1KB 1LZKA 2D1YA 3UXMA 2P8SA 1C9KA 2WWTA 3EXFA 3H0KA 4DLSA 5B6JA 5C7LO 3QM1A 3L04A 3QWIA 1R5JA 1DBIA 3O2NA 2VSYA 1H1LB 2BEUB 1C2TA 1M33A 4QPPA 1JTFA 5LA6F 4CM5A 1JHPA 1NW5A 5DOVA 1DO8A 4L22A 1DDIA 2JW5A 2Q8QA 3HNPA 1C7JA 1A97A 2ZVDA 3DQZA 1F6BA 3E3OA 3IOBA 3OMLA 3LWNA 2AW5A 2G07A 5LQMA 4AF7A 2BHNA 4ABYA 4OGGA 1LNSA 3Q9SA 3CBQA 3HCBA 2VJNA 4C07A 4HGNA 1T8SA 3JQ9C 3FHOA 2HGHA 1WVMA 4FNMA 2C9DA 3LU1A 1XZDA 2JDIA 3BRWA 2D1FA 4GYWA 3OE7A 4MO9A 4K9PA 4NI5A 1E61A 4Q1FA 1XRQA 2BRUA 3AWIA 2SKEA 2XXBA 1H5QA 5DEOA 1GV1A 3G8AA 1O9HA 1NBAA 3G17A 3L18A 3NH9A 1PAUA 2JIQA 3ZOKA 3OLVA 1Q7RA 2CLLB 2CXSA 2WUWE 1FVHA 1HT1E 2Z2KA 4LRXA 4Z1MA 1BW9B 1AV6A 2V9ZA 3NDPA 3QE4A 4RX1A 5EPUA 2GXSA 3VNRA 2XBLA 1UK6A 2B35A 4I4NA 5CFOA 3CT4A 1FP2A 5F7OA 5DM4A 3AWDA 1XWIA 5AVOA 1JHAA 3GFQA 2W00A 5BW5A 3KPWA 1YDEA 4J3JA 1E96A 1KVSA 1BXRA 2PT6A 3HG7A 1XEAA 3UMSA 3OX3A 1ID8A 1NUSA 4MZDA 1AK9A 1II8B 2X8LA 3HMKA 3P97A 5ICSA 3GLHA 3M49A 3ICPA 3TZBA 5IK2D 3U5ZB 2X15A 2RGXA 3WOHA 4YJDA 2HXYA 4LYHA 1HSZA 2BW0A 2B5OA 1L4KA 3OJXA 5AUNB 1XRSB 1NR7A 2EN8A 4EI7A 1A5SB 2CC2A 2RKBA 5JS2A 1P29A 3A2NA 3CXRA 3EZFA 3QVVA 3ZLVA 4Q82A 4NSNA 1NQTA 1U2GC 1NJ8A 4XQCA 1NXVA 3PITA 1AB5A 2BLNA 1TKCA 3RGGA 3SK0A 2O0HA 2XD4A 1TF7A 4DMGA 3TQMA 3AEKA 2ZB3A 3F6SA 4ZI5A 5KO2A 5JBQA 6ADHA 3Q8KA 2QDKA 1KRHA 5IKXA 4Z8YA 4HQ0A 1F1JA 3OJCA 1BN6A 4RENA 3G5MA 3GRZA 2RGRA 1RW4A 3LVBA 1JSRA 1HDRA 2ZYUX 3FYUA 4JVSB 1T3GA 4LY3A 5DTEA 3UJBA 3D3KA 3QKSA 2GXAA 2GARA 1P1HA 4IV0A 3BICA 5JMWA 3I4LA 2G7HA 2FEAA 4CEIB 1A0OA 2ONYA 4WL0A 1T4MA 2LNDA 3T8YA 4QC2A 3WQRA 2UZIR 4BAZA 5JNRA 4QJ3A 3H2ZA 1HRDA 4JI4B 2PUGA 1LRKA 1MKYA 2QL9A 1R12A 1Z0FA 2PGJA 4Z9FA 4R2KA 1G59A 2Q1SA 4H4CA 2QAGA 4Q9LA 1SMKA 1N5RA 3WGIA 2BAGA 4EG0A 3AI7A 3UCFA 3CUVA 4TXHA 3B51X 5ALYA 4DMKA 1I7NA 3CRMA 4Q0MA 2FEPA 4LVUA 4PO9A 3JQAB 2A0UA 4YI5A 4RTKA 4GKJB 2V7BA 3NRCA 3IDOA 1BD4A 4ZMRA 4L7QA 4OGWA 4ZOLB 4JJGA 5FV7A 2HIHA 4OQPA 1RYYA 2W2LA 3BGOS 4HTFA 1DJPA 2H1VA 2V03A 3CHYA 2GO7A 3E5MA 1GP2A 1NW4A 1NXSA 1XP8A 3IQGX 3WB0A 3ZOZA 2EOJA 1PN3A 2X23A 1W2HA 4RV4A 1ADJA 1LJLA 1L5WA 1YS2X 3AEXA 2Q4RA 2HBQA 4MIKA 3ZHRA 4ZEMA 5E2IA 3LC0A 3T3PB 4C4XA 2Y0PA 4BXOB 4Z4QA 5JYBA 5H8WA 3CF2A 1FFXB 3HFRA 3HUUA 4A82A 1YDHA 3A11A 3SC6A 2BFCB 2ZRHA 4JLSA 4UC0A 4IGFA 1EUQA 1V6CA 2JK1A 4TUYB 1WXDA 4UAVA 2A9JA 4GWKA 4KQKA 1G0OA 3FKSA 2VYQA 3H4TA 1JAHA 5JSZA 3ANTA 3MRTA 1RHUA 1IFXA 3A10A 1ZNXA 3QPDA 4JUBA 3HB0A 4NONA 4M76B 5KWJA 1B2RA 4KI7A 4I50A 4ZGGA 3AHDA 1HZZA 1RQNA 2IZ6A 1JIKA 2V65A 2FPKA 4IXWA 3KKKA 4B7AA 4TS9A 1BKYA 3Q2OA 4Q3DA 5CGZA 3TIXB 4BVHA 4LZAA 1J97A 4PX9A 2PX8A 2WHPB 5AVVA 1YACA 4M55A 2LIVA 1KY4A 4P3NA 5KOHB 1EB9A 2NSHA 3L4EA 4GPAA 4PSDA 1JSXA 1IWPB 5EMNA 1QLHA 1M72A 1NULA 3DZHA 5DTJA 3A6PC 1U2PA 1EX6A 3KEOA 3L7KA 2FSVC 2JYAA 4Q1DA 3ZGNA 2IUTA 4CR6A 1XZFA 1JEQA 5B7QA 1GCAA 5E4YA 3A6HA 1ZC4A 4G3XA 3ZZ1A 1JPNA 2BY4A 2OO5A 4US0R 3LH5A 1DG3A 1A1LA 1IG0A 2A94A 4ZT5A 3QF4A 4KQ2A 2YWGA 1GAEO 3BIDA 5AI5A 1ML3A 3SMQA 4C5AA 5JHHB 5JJLA 2V7TA 3O75A 4H1TA 2FWPA 2Y0EA 4DDWA 3LT1A 3KT6A 1XVTA 3PUIA 2J3QA 4R5MA 2FJPA 3BRWD 2ATXA 3H19A 2MSCB 5G3ZA 2G67A 2XCTB 3L4BA 1K8RA 5LNK6 3KTAA 3GVCA 3RU9A 3SN6A 2YHSA 4REQA 3QVGB 4EATA 4JUIA 1XCLA 4K81B 4DSOA 1Q15A 1O4WA 4B33A 1XJQA 2O2IA 2PN1A 1N9GB 4ZZ0A 4K88A 3FUCA 1JPUA 5LN1A 1IDN1 2CHVA 3ZH2A 5J58A 1FTYA 1H6AA 2VHCA 2NTEA 1F60A 4PG4A 4U6QA 4QGBA 1ESMA 1YUJA 4U0JA 5JLJA 1W7AA 3NS7A 1U4SA 1QGUA 1UOPA 1V5EA 3OOSA 2B5WA 2EIHA 4JT9A 2B2NA 4BJ1A 1SC9A 1C4WA 2I54A 1W85A 5ALIA 1U7HA 4JKOA 1O8CA 4LNUA 1W0KA 4HSGA 3JWIA 4D9BA 3W3AH 3A0RB 1ZD4A 2F4NA 3AV0B 4P0QB 4UHHA 3UAWA 2AFHE 3CE6A 4ID3A 1RWBA 3JRXA 4K9RA 2I8CA 2ISSD 3E5RA 2HI0A 3K0KA 4FCWA 2FEXA 3PHJA 4KR0A 5AW3A 1XVLA 3VR1A 4DYDA 5DMXA 1SU6A 1Q0TA 2VK8A 1CJMA 3O93A 4TV8B 2ZBFA 3LHSA 1R4AA 3TAUA 5CVEA 4ESVA 2XNJA 4K9LA 1UJNA 1UPTA 2WHEA 1QKKA 5A04A 1TYBE 3M6WA 5DH9A 4X6UA 1RWQA 1PQPA 1S5PA 1ZVMA 1P33A 2CSUA 3LQRA 3EQ1A 5BP7A 5FX2A 1AGPA 1VG0B 4ZI3A 1GPWB 4OL0A 1PQYA 4YMVA 2I66A 5L51A 2Q27A 4DRYA 1SCUA 1W94A 2QUZA 4MNTA 4QXOA 2K2WA 3A1NA 1G3QA 3MJSA 1YVRA 3ASZA 2OORC 3VA7A 1YK1A 3QYAA 5DP1A 4EF5A 2ZWAA 2BFDB 3DE6X 3A3OA 3IIJA 1MJGM 5DHUA 3Q7TA 5ESWA 1A72A 1SKQA 2F1KA 4G85A 3OTHA 4BB0A 3LT5A 1ZR4A 2YFYA 2IS1A 3K35A 4F8EA 1ONOA 1EWKA 1TQ2A 4H35A 4OHRA 3PC6A 2W71A 2VRNA 1KORA 2KX7A 3ZLUA 3I5YA 2HCTA 4J3FA 1P2BA 3U7FB 2FE4A 3RUAA 2L8TA 1I7DA 2LVHA 1K5HA 1PV1A 1ZXXA 2ZBRA 2J31A 1H6DA 4BYGA 3CV3A 3GLGB 2YWBA 1USKA 5IM4A 1BE6A 2ZAGA 1NEIA 4MR7B 4LF9B 2RBKA 3K70B 1YDWA 2VNHA 4P5DA 1WB5A 2Q1XA 1UJMA 1KEWA 2BM9A 3UJ7A 1N3GA 1A77A 4LDPA 1UDCA 3PQFA 3TFWA 4CCYA 1HL7A 1MIHA 4H7PA 5G4KA 3UG7A 4FN4A 2FG5A 2PT5A 2X0KA 3GD5A 4LRUA 4ZJPA 2YTZA 1IIBA 4I5EA 4TTTS 2H1LA 2A3RA 2X1VA 4IS2A 4TT3A 2IITA 4H3VA 5EQDA 5J4VA 3E0QA 4PC3A 3KP1A 4CN9A 1E3WB 1L7OA 2UXCB 3SF0A 5GZ6A 1YKGA 2VK1A 3VPDA 2XHEA 1CDZA 4BNUA 4N3GA 1DC4A 4NC9A 5HKKD 2XH8A 1VIDA 5IYZB 3OFND 3RSQA 5EZYF 4FZVA 2GJ8A 5CLJA 3PSAA 1UZNA 3BMOA 3LP8A 4RV5A 1W30A 4EITA 2FRVA 3A2KA 2O14A 3UO8B 3GEMA 3GY0A 2NUEA 3BWEA 2W48A 3DC7A 1A04A 3NWJA 4R8KA 4AMGA 2WD7B 1EJ2A 1UZUA 1MHPA 3F67A 4P84A 3IPYA 3UNXA 1Z82A 4G0VA 5KNCA 4JC4A 1DKPA 1FRVA 2XMZA 4LOHA 5HJ7A 4NMHA 1SN7A 2G3YA 2VSFA 1LSUA 4MHSA 3KTFA 4CLDA 2R66A 3LNCA 3U1TA 4F71A 2K87A 2WA1A 1YDGA 2VHJA 4C0QC 5I45A 2EZUA 1N2BA 2HBRA 2WE7A 3D1JA 3KB6A 4J90A 2IZZA 1OWLA 4A2WA 1V71A 2CL6X 3H5IA 4KN8A 1UP4A 2UYHA 2LCQA 5BYBA 3MINA 2V8BA 4F60A 1D4FA 4Q02A 5AW0A 2E5LB 2XRYA 3LXMA 4JYAB 1TU0A 1Y1RA 1HKHA 5CR9A 2DY1A 1BQ3A 3OEYA 5JR3A 4HDNB 4TKMA