1GZ6A

(3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
301
structure length
301
Chain Sequence
SPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGSRMTETVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binary Structure of the Two-Domain (3R)-Hydroxyacyl-Coa Dehydrogenase from Rat Peroxisomal Multifunctional Enzyme Type 2 at 2.38 A Resolution
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dehydrogenase
molecule keywords ESTRADIOL 17 BETA-DEHYDROGENASE 4
total genus 101
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1gz6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gz6A01
3PFWO 2NADA 3ZW9A 2EERA 2J8ZA 2X9NA 2JKVA 4AJHA 1FDSA 5BT9A 2VRBA 1I36A 1JVSA 4FD3A 4NG5A 5DOZA 1N9GB 4U0JA 1DJNA 4PLGA 1NPTO 2TMDA 5I9LA 2AQKA 1H6AA 4NBVA 3LZ6A 4EEXA 1W8DA 1EVZA 1ZEMA 3MOGA 4YAIA 2YJZA 4C7JA 5B1YA 4OOEA 3ZWVA 5L51A 2D3TA 3HADA 3CUKA 3L4SO 1UXHA 2ZYGA 3PLNA 3ABIA 2ZQYA 2IZ1A 4BGIA 4S3MA 2TMGA 1WDKA 5T8KC 4EUFA 4HUJA 1CWUA 3K2BA 4BNLA 4R9SA 4XCVA 3JQ7B 3KRTA 1E6UA 3VVBA 2NU7A 4IPTA 4RPLA 2O23A 3LYLA 4XYEA 3DTYA 3E8XA 3OJLA 2WE7A 1Q0HA 3NTRA 1P33A 4W9NA 4CQMB 3FR7A 4CM9D 5J23A 3GFGA 5KWEA 3VOSA 3TJRA 3GMDA 3E5MA 1XLTA 4ND3A 4DUPA 5G0TA 4KTVE 2DTXA 4DL9A 3SC4A 4HNHA 3VH4A 4Z6KA 3NEPX 1U7TA 2O2SA 3A4VA 5KKAA 4B8WA 4FC7A 3AU9A 3LQFA 1KERA 1PSDA 2GPTA 1T25A 4R5MA 1FDWA 2I76A 2O4UX 3CE6A 2DVMA 3OIDA 4BNKA 4MVJM 3E9MA 3RKUA 2OBNA 4YAEA 4YYZA 3LK7A 4AJ2A 1TT5B 4GLLA 3F47A 4GMGA 3H8VA 1T1SA 1T2EA 3Q2IA 5GZ3A 4ZRMA 1MGOA 1MV8A 3U9LA 4A7PA 1P1KA 3AI1A 3DZBA 1GV1A 3CMMA 5ENDA 1M66A 1K5HA 2OZPA 2EP7A 1EBFA 4JXKA 1P44A 4K6CA 4IGEA 3FI9A 4PZCA 3RQSA 2Q1WA 3PIIA 3SLKA 2CNBA 4DC1A 2VHZA 2B4QA 3PYLA 2ZK7A 1GU7A 1HE2A 4H15A 4R5HA 2PY6A 1WDMA 5ADHA 1EUCA 2D4AA 4PLZA 1R66A 4A2CA 2BKAA 3CZMA 1M6WA 1BHSA 3E9QA 5DP2A 3L6DA 3DAGA 3G1UA 2OOSA 3VHRA 1R12A 1NR7A 3MOIA 4DQXA 2R6JA 3GHYA 4HY3A 3UUWA 4R9RA 4TSKA 5IFLA 5A1TA 3VZRA 1H9AA 1XSEA 3K30A 4W7HA 4IQGA 4BMVA 5A9SA 2IYOA 2VOEA 5IZCC 1E7QA 2AG5A 2OHXA 1KY4A 4NBUA 1Z7BA 1KEPA 4YQYA 2HLPA 2J6IA 3ETEA 3CXRA 1IL0A 4P4NA 2Q50A 1I8TA 4RV9A 4CV3A 4B8ZA 3JYLA 1C0PA 3HE3A 1WMAA 2RH4A 3ZU2A 3KHUA 3JQ9C 4PZEA 5IDYA 5F3RA 1M6HA 4XKJA 5A3JA 1D3AA 4Y6RA 1MX3A 3NT5A 2Z1NA 1CQJA 4DBZA 1H6BA 2IZZA 2UUPA 1R4NA 1B14A 1LDGA 2O3RA 4PLVA 2YHIB 2H9IA 1WZIA 2W2KB 5F21A 2EF1A 4F45A 1P1FA 2VHWA 3I1JA 1LC0A 4K6FA 5EQDA 3V2HA 1LXCA 3TOXA 4BOYA 3GH3A 1OOEA 2FHSA 4GX5A 1YOVA 4WJZA 4IDDA 2FR0A 4EJ6A 3GMSA 1SMKA 5EIOA 2EKQA 5CG2A 5DBIA 4UVIA 3ORFA 5DT9A 4KUHA 3E03A 3I3OA 4GGOA 1ZK0A 4PG4A 4E30A 4WASA 1FJHA 1X15A 2B4TO 3T7CA 4XB2A 3C8MA 4L4RA 2Q2WA 4M1QA 4BNIA 2X0IA 4OO3A 3U4DA 4ALMA 4D3SA 5JS6A 4ZQFA 5BNIA 3L07A 3H5AA 1GTMA 4CV2A 3GR6A 3PDUA 3QA9A 5JPIA 4PG5A 2J3IA 1T4BA 3CTMA 1ZK2A 1ZSYA 1KY5A 4NJMA 4PRKA 3K6JA 3F5QA 4RGBA 4XGKA 1H94A 5B37A 2GNAA 4BL5A 2O7QA 3AUTA 2JFGA 1E7SA 4J7UA 4EBFA 4MP8A 4DC0A 3EZLA 5DBFA 4TMFA 5FF9A 1I3NA 2FP4A 3GLQA 4LMPA 4YVFA 3Q11A 4FC6A 3QVOA 1E5QA 1SAYA 2D5AA 3DAFA 1YJQA 4FOSA 4HWKA 3F4BA 1W0CA 3DDNA 5G4KA 2CUKA 4FOOA 2GN9A 3L9XA 3NDJA 1RM5A 4RVSA 2X5OA 1SO8A 4FFMA 6ADHA 5KTKA 2B69A 3B1FA 3C7DB 3WGZA 1O95A 2PD3A 5FI3A 4D46A 3HJAA 3GAZA 3GAFA 5C5IA 3MJ4A 1C1XB 3GZ4A 1UAGA 3JQFC 4ALJA 4DREA 5HTOA 1T4DA 4R01A 3WGGA 4BO7A 2O2YA 4AL4A 1C3VA 3H9EO 1GZ4A 4L4SA 1EUDA 4W99A 4BIIA 2NTJA 1TT5A 1IZ9A 3RJ9A 1MC5A 2V6BA 3BTVA 3WTCA 4CMCA 3HNPA 3ASUA 4WE3A 1L7DA 2VTDA 2WE8A 4R1UA 1GY8A 3WSVA 1Z73A 4OKIA 1K6JA 2Q1TA 4GSKA 1DFIA 1HDGO 2PH3A 3HDHA 3TL3A 1HDOA 1GQ2A 5BSHA 2C59A 4KP7A 2AXQA 3D3EA 4YWJA 5TT0A 1YS4A 4H7PA 4BQPA 2A94A 3AUSA 1ULUA 4MJLA 3A9WA 4KWHA 4UVEA 4NFHA 4MO2A 3MJEA 4BNTA 2VQ3A 3D3WB 4QFDA 3DB2A 4XYMA 2NACA 3OFSA 1UZMA 5IN4A 2UAGA 3ZW8A 5A3VA 3SXPA 1PZHA 4YJGB 1YL7A 1FDTA 3OEWA 3GZNA 2QX7A 1ORRA 2RH8A 3NDRA 3JD4A 1Q7CA 3ENNA 5EERA 3PRJA 1OBFO 3ICCA 4UVHA 4XX0A 5FEUA 2DBQA 2D1YA 4E31A 1ADGA 4HV4A 1GD1O 3VZPA 3K31A 3D0OA 1B2LA 3BMOA 1I3KA 3JYNA 3DBVO 2VN8A 3N74A 4NJMB 2YQ4A 3JCZA 1R16A 3FNFA 3K73O 3KOUA 4DLBA 5JFOA 3WMWA 2VWQA 4BNNA 1XKQA 4JBGA 3ITDA 2D5CA 4PLCA 4XB1A 3WQRA 2OP0A 1H0KA 4NMHA 1CF2O 4IZIA 1E3WA 2V65A 1DRWA 2A4KA 3UXYA 4BNXA 3IKVA 3PXXA 1VKNA 3QE3A 3C7CB 2Q1UA 1JKIA 2Y1OA 2EP5A 3FBGA 3KEQA 2ILTA 1PZFA 1P0CA 1QSGA 3B20A 4XWYA 4J3FA 4A27A 4P4LA 1KVTA 1SEVA 1PL6A 3F3SA 1NVTA 4E4YA 2OUIA 2FRDA 3BMNB 4WOKA 2YW9A 3LF2A 4OAQA 4TVOA 3PJDA 1ONPA 2PD6A 5K9ZA 1GCOA 1Y8QA 2J3KA 5ER9A 3JD0A 3IMFA 4IJWA 5CPBA 2VRCD 3QSGA 1PGJA 2IXAA 1GAEO 2P2SA 5C7OO 1SB8A 5CHEA 2NQ8A 4JBIA 1GUYA 4IJKA 3SJ7A 1U9JA 3AOEA 1H9BA 4EJ0A 3TL2A 3QHAA 3LLSA 3IUSA 3GNTA 1R4NB 4R51A 1ENOA 3B6ZA 5CP8A 4J4TA 3VPSA 4CMEA 1Q7BA 1VI2A 3QWBA 4RVGA 4AG3A 1IZ0A 3BHMA 1U8XX 2ZB7A 1P0FA 3TDKA 3W8FA 4DIBA 4TKLA 3RBVA 3HSKA 2EW2A 1IYZA 2VCYA 4MVJG 2AEMA 2YZ7A 1BRMA 3UW3A 5KJFA 4FBGA 1QKIA 1B8VA 4KUGA 2HDHA 3HDQA 3GY0A 2WTBA 2HJSA 3TSCA 2BI7A 3JQEA 3MJCA 4NFSA 4BO8A 1EE9A 1LBEA 1P1IA 3GUYA 3GVPA 4W82A 5L4SA 1CDOA 4OYRA 3RROA 4DVJA 3UFXA 4BO4A 2HMTA 1OFGA 4ZHSA 2X1HA 2ZCUA 4NK5A 2WMDA 1Y8RA 4R16A 3RBXA 2D59A 3MTJA 1E5LA 1WW8A 1Z6ZA 4CMEC 4RO0A 1LSJA 5TC4A 1R37A 4NI5A 3WFIA 3ANLA 5A4DA 3AY6A 3VH3A 1GADO 2HRZA 1ZK1A 2GZ1A 2I66A 1WPQA 4IQ8A 1MB4A 5TQVA 3UCFA 4GPD1 4BNYA 1XDWA 4R3WA 4M54A 1NFQA 5A9RA 3GG2A 3ZWBA 2G82A 5JE8A 4UREA 4RPHA 2I67A 2QIOA 1NPYA 4EITA 5EQFA 4LN1A 4CUKA 4CODB 1KETA 2FSSA 1I3MA 3PQEA 1E3WB 3CPSA 4IS2A 3R1IA 4TKMA 4ND5A 3K2EA 4DPKA 3V1YA 1E7WA 4D0RA 2HMWA 3VTFA 2JHGA 5F1OA 4B3JA 3H65A 3JQGA 4R54A 2CDCA 2HMSA 2JJYA 4HFRA 5IDQA 1JU9A 2WD8A 1EBUA 4P38A 1PEDA 1RWBA 2DUWA 3FR8A 4JX8A 3AY7A 4EZBA 1DLIA 1YL6A 4WGGA 4YTEA 2Q45A 1BXZA 1T2CA 2CSUA 2FPIA 3LLVA 4M49A 4EUHA 4UUMA 2WSBA 1A72A 4O63O 4HFNA 3PJGA 5GY7A 6LDHA 3O8QA 5L3ZA 4XDYA 1VM6A 3KSUA 2VOJA 3IP3A 1QLJA 4WLFA 1ZVMA 1DRVA 2RHCA 1YQGA 3S2EA 5KJ1A 4IDAA 4AJJA 4JJGA 1V3TA 4WEOA 1DOHA 4CMHA 4ID9A 4E6PA 4XZ3A 9LDTA 4XYBA 1NYTA 1CERA 2QHXA 4AJOA 2HJRA 5FI5A 3RUFA 2W90A 3KVOA 5JO9A 4Z3KA 1K6IA 3PWKA 2X5KO 3FPLA 3P19A 4WLEA 1LRJA 4B3IA 9LDBA 1ENYA 1R4MB 2DPGA 4GBJA 1GFSA 1X14A 2VZ9A 4A26A 4XD2A 1SOWA 3F5SA 5JCJA 3JD2A 1C0LA 1E6WA 3H2ZA 4GWGA 1YJ8A 1GYPA 4FIZA 2Y1CA 3IOYA 1U3WA 7MDHA 4BKQA 1JAXA 1XYGA 4BV9A 2Y0DA 2GZ2A 5JDCC 5L7YA 5CDGA 3COSA 3WLFA 4OXNA 3DZGA 3BIOA 2GASA 3GRPA 3GVHA 3U09A 1S6YA 3S1LA 3D1LA 4MIOA 4WNIA 5JAIA 2WEKA 1GUFA 1QMGA 4U0KA 1XGKA 4OJNA 1QYWA 4LRSB 3I9OA 4TRMA 1VJ1A 1B0AA 5TT1A 2PGLA 2X0JA 3E6AA 1FF9A 2O3UA 2X7HA 4PLHA 1T26A 2QYSA 4WOJA 1WVGA 4MVJF 2IXBA 4BHTA 5KVCA 1LDNA 1HTBA 3BMCA 4RLSA 3Q0EA 2HU2A 5COBA 1M67A 1HEUA 2HCTA 3DTTA 3K96A 1U8FO 1XG5A 5TF4A 3GN2A 4RVHA 4L73A 3AM4A 3T7EA 1SB9A 1JVBA 4MIYA 4PGFA 2BGMA 1VC2A 4CMIA 2GYYA 4F3YA 3KETA 3WGOA 3LSYA 4W4TA 4DWVA 3LC1O 4EDFA 3QIVA 3E82A 4LCJA 3OQBA 4IBOA 1DAPA 5KIAA 1PQUA 2DKNA 2BFAA 5ICSA 1VRWA 5JYDA 1HZJA 2E82A 3ZDFA 1TLTA 4BGEA 2Q2VA 2VHVA 3LC7O 3RC1A 4MDHA 3GPIA 2DM6A 2WYWA 4AJNA 4OOFA 3EYWA 1B16A 3EVNA 3I23A 1JKJA 4GX0A 5LDHA 5ITVA 3G79A 3I6QA 3QVTA 5CG1A 1YRLA 4W9NC 4WEQA 5A04A 1T2FA 2VT3A 1HLPA 4DIFA 4DPMA 4E2YA 1YBAA 4YPOA 2BMAA 5ITWA 3JQDA 4J43A 3GRKA 3FTNA 1DFHA 1WXDA 2GERA 3BHJA 3GEDA 4AICA 1ZJZA 2J3HA 3W4KA 3QWIA 1BG6A 4GI2A 1U28A 4KQWA 4FB5A 1CJCA 4A10A 2OL4A 4IINA 3PEFA 3OIGA 1LDYA 4DLLA 2RAFA 1X7DA 1F12A 1LRLA 4INAA 3KV3O 2EKLA 5L9AA 1QORA 1I2ZA 2AW5A 1SEPA 2AEFA 4GVLA 4WLNA 1WAMA 2CVQA 3QY9A 4C4OA 4GVXA 3ON5A 5TIIA 2NU8A 1XHLA 1Z74A 2GN4A 4W7IA 5JAQA 3QVXA 3PDJA 2HSDA 1C1XA 1UP6A 1Y1PA 5G0VA 1YBMA 4B4UA 5HM8A 1JWBB 2I99A 3HDYA 4R1TA 4YEDA 2POQX 1VL0A 2YUTA 5DN9A 5JDCA 1U2DA 2P91A 1DSSG 5LC1A 4FJ1A 1TEHA 1I0ZA 1BMDA 2DC1A 4NFYA 4EI2A 2E49A 4IDEA 1NQAO 1E3EA 4BQRA 3WJ7A 3IKTA 3RUAA 1Y6JA 1HL3A 2DQ4A 2Y05A 1AHHA 4MVJP 3ZU4A 1LTHR 3VZSA 5JY6A 3JYPA 1UH5A 3OIFA 4ZA2A 1P45A 4UAGA 1DAOA 4GX2A 5BSFA 3CINA 1JW9B 2H5LA 5U1PA 1LX6A 5AXDA 3DZJA 4Z9YA 1NQOA 4TZTA 1QXSA 4OQZA 3FSRA 1FMCA 4PG8A 1RM3A 1IY8A 5JC8A 3A06A 3SVTA 4XEHA 3U62A 2NNLD 2I9PA 1V35A 5L40A 2YV3A 1BVRA 4OIMA 3I4CA 1UXGA 5CAEA 1H5QA 2NVBA 4GKBA 1ISMA 1JN0A 4KUEA 4LVUA 2R00C 4TVBA 4FPXA 2J3JA 2GSDA 3MWEB 2NUAA 3WLEA 3EC7A 1EK6A 1TXGA 3OH8A 5BNFA 3WNQA 4Q3DA 4HP8A 4FFRA 4LK3A 3SJUA 1E1LA 1SC6A 1T2AA 3BMQB 4LISA 1O5IA 1ZEJA 2CF5A 2OO5A 5BSGA 4XYGA 4CMGA 3M2PA 2AEJA 1PJ4A 4IDCA 3GDOA 3NTOA 2V6GA 4XR9A 1RKXA 2A92A 2ZIZA 4S1VA 3ROQA 3BTSA 3JQAA 1QP8A 1E92A 1HWYA 4J91A 4CM8A 5KOIA 4R68A 4O6VA 2B35A 2OXIA 2BFOA 4R3NA 4M86A 1JAYA 1QLHA 4FR5A 4Y98A 3UH1A 1PIWA 2YV2A 4WLOA 1UZNA 3RJ5A 3W8DA 3NDIA 1PS0A 1YB1A 3BTOA 5DP1A 4CUJA 3GEGA 3ZNOA 1K89A 1I33A 2PNFA 3NV9A 1W6UA 1XR3A 2ZYDA 4C7KA 3A1NA 2D8AA 3P5SA 5U4QA 1UUFA 4M8SA 3RU9A 2AE1A 4UUPA 4U5QA 2VWPA 4YJGA 5H83A 3INGA 3BMCB 1EQ2A 3AW9A 4FFNA 5IXSA 3HB4X 3PHLA 3TPCA 1Y8QB 4CLRA 3ZV3A 2X23A 3LVFO 1QV7A 3ZH2A 4L9RA 3Q3CA 4J1TA 1I5RA 1KVRA 4NBRA 3JQAB 8ADHA 2F1KA 4KZPA 5GMOA 3RUCA 2IEBA 1NASA 1Q1NA 5THKA 1ISFA 3E1KA 3F9IA 5L4NA 3VDQA 1LA2A 2OP1A 5L53A 4AJKA 2BGKA 4LGVA 3ZWXA 3AFMA 4AVYA 3A28A 4JN6B 4QFCA 1CIVA 2EEZA 1HLDA 3KYDB 2GCGA 1HYHA 3L9WA 4BNHA 4PVDA 4GH5A 1EVJA 2EGGA 1N2SA 3WGTA 2W2LD 3OBBA 4NH4A 3K5PA 2E48A 3ONDA 1HYEA 1PR9A 2QG4A 4XJTA 3EVTA 5BNTA 2XAAA 3KO8A 2FMUA 4K1LA 5G0UA 2HUNA 4G2NA 1MP0A 4CQLB 2BLLA 1R4MA 2VHXA 4E2XA 1C1DB 1WDLA 4IDFA 1LLUA 2G1UA 3G3EA 1IHXA 3QWFA 4BGVA 4F6CA 2VT2A 1E3SA 3OICA 3OA0A 3M6IA 3R3SA 5CFZA 1N8KA 4N5LA 3BYZA 2HK9A 2EV9A 3WTBA 3C3XA 1DIRA 5F1KA 1WWKA 1XIVA 1DC6A 2C7VA 4DXHA 4QTZA 4Z0HO 3PJFA 3O26A 5JCXA 4M87A 3PIDA 1A9ZA 3TFOA 3C7AA 3SEFA 1PJBA 1PWZA 3JQ6A 1VJ0A 1MFPA 2O3SA 4J1QA 4ESOA 2E6UX 4J16A 3AI3A 3U0BA 3WGQA 3O8QB 5JDIA 1GEGA 1CQIA 3MZ0A 5TS3A 3W8EA 1EMDA 1CETA 2IODA 2I65A 1O0SA 2NM0A 2ZKLA 3DMYA 3GGOA 4YAJA 4MINA 4MKXA 4XGIA 3ZV4A 3UAGA 2CY0A 3BTUA 4B7XA 3WG9A 2Y1EA 3DBHA 3I5MA 2B4RO 3D5QA 2PGDA 5EL0A 3ZU5A 4ILKA 4OXYA 1PL7A 1G1AA 4J49A 1ZO8A 3VAZA 2QZZA 4IS3A 4ALKA 2CDAA 1T24A 3PFFA 2H1SA 3NRCA 3ONEA 4OKNA 1DHTA 3RIHA 2P9EA 3OEYA 4NBTA 4ZRNA 2JFHA 2VZ8A 3CSDA 5IZ4A 2PZMA 3ENKA 4MVJA 3OSUA 4DTIA 1A7KA 1HT0A 5JCJD 2GLXA 3JQGB 4FDAA 4RORA 3AJRA 5LDGA 5K6AA 3NAQA 3PI7A 5IJZA 2SCUA 1ZUD1 3WB9A 4MVJE 2QYTA 3I9JA 1DDOA 2Q99A 4I8XA 3PJEA 3G17A 4CMJA 5T64A 4FJ0A 4NZ9A 2Y0CA 4A0SA 1BXGA 2UV8A 5A06A 2PV7A 1TT7A 2NLOA 1ZNQO 2VYND 5I7FA 1DB3A 3IL2A 2JAHA 1QRRA 2G17A 3MCVA 3EUWA 4KWIA 2VWGA 2BH9A 2C54A 2EKPA 3L6OO 3PHGA 4P4GA 4QUKA 3WGIA 4ZU3A 1MG5A 3EDMA 3PHHA 4KQXA 3V2GA 3TQHA 1OC2A 5B4UA 2FZWA 3OA2A 1D4FA 3BHIA 5A9TA 1QR6A 2ZB8A 4BO3A 3B1JA 3HUDA 1DC5A 4P8RA 3U3XA 2Q2QA 3L77A 4DBVO 4CQMD 1U4SA 3K8ZA 2ZB3A 4CLOA 1A7AA 3M1AA 2IZ0A 1EZ4A 4AJEA 1UP4A 3ZWPA 4XQCA 4BMNA 4NJOA 4FFPA 3HHPA 4E5MA 1O89A 3VPXA 1Y9EA 1C1DA 4RQUA 2B5VA 4BMSA 2FZEA 1GPDG 3W4IA 2X8LA 3EMKA 4I1IA 4YT5A 3ZWAA 5DDIP 1WZEA 1OI7A 1P1JA 1KEWA 2ZATA 1F8GA 1NFRA 3H9QA 4P22A 4CMIB 3QLJA 4BGUA 4PRLA 2UVDA 2H6EA 1ZIDA 2Y1DA 4IQ0A 1NVMB 1YOVB 1YL5A 2O50A 2Y93A 3QWHA 1LRKA 4YRAA 3KEOA 5H81A 1I01A 4E2ZA 3KYBA 4YT4A 3QVWA 1ISGA 5JSFA 3U5TA 3BAZA 4HX5A 3C1OA 4I9HA 4DQVA 3ZU3A 2J5RA 1I2CA 1QG6A 4BB5A 3PTZA 2FWMX 1O6ZA 5G4LA 1GZ6A 4Z0TA 5CEJA 1P1HA 4IIVA 4II2A 2VYVA 2CD9A 3ROPA 3WBFA 4BKRA 4MP6A 3ZWMA 2QRLA 4GLOA 1KVSA 2R2GA 5B12A 3T4EA 2X6TA 1EFKA 1FXSA 1MG0A 3NUGA 4Q9NA 4Y8VA 3GHHA 3KM0A 1X7GA 4NK4A 2G76A 1UXJA 2EW8A 3OQ6A 1K6XA 1KEVA 5T5QA 1YQXA 4NBWA 3F6YA 1GQYA 2O48X 3CH6A 3RC7A 2CF6A 3AI2A 4CL3A 3AWDA 4E0BA 2CFCA 3PGXA 3OJFA 3W6UA 1S7CA 1U2GA 3QWAA 5F5LA 3WOHA 3PZRA 4D41A 1DC4A 3M1LA 5CDYA 4L74A 2WYVA 2W98A 3RUHA 3MJSA 2P4QA 1IOLA 3DQPA 2WD7B 4Y67A 4I08A 2CDBA 3E9NA 5KJCA 2NSDA 2VNSA 1U1IA 3PLRA 5AOVA 1YGYA 3D3WA 3I52A 3RSHA 1F0YA 1B7GO 2OMEA 3B1KA 4ALNA 5TLSA 1J5PA 1ID1A 1DEHA 1XELA 5JMWA 4CPDA 2PZKA 5JC1A 5FYDA 2X0RA 5G0WA 1XCBA 4N54A 1PJ2A 3DHNA 5GZ6A 3FD8A 4YJHA 3OP4A 3I6IA 3AK4A 1A9YA 1KYQA 3ZGYA 3FRJA 1GEEA 1HF3A 5L7WA 2PK3A 2X0NA 3R0IA 3VKUA 3G1TA 4CR8A 4D79A 1EE2A 1FDUA 3X2FA 2X9GA 2Z5LA 5DULA 4QX6A 5EESA 2D2IA 4L76A 4WUVA 3CMCO 3RU7A 1VPDA 4IXTA 3TWOA 4CM9A 3ADOA 3KLPX 2PH5A 3WYBA 3L4BC 2VNAA 2X22A 4OHUA 3F46A 5ER6A 3JD3A 1O8CA 4YQZA 4BO2A 3ASVA 2PLAA 5IDWA 3LT1A 3LF1A 1B8PA 3DZKA 5A5EA 1H93A 3I9NA 3UOGA 2YHUA 4UEKA 1E3JA 1NHGA 3ZWOA 4N5NA 5TX7A 1DBVO 1R6DA 4YRDA 3DOCA 5T67A 2Q4EA 2G0TA 4CM4B 2WM3A 2DU8A 4BO0A 2WDZA 5C7LO 2GUGA 1NR1A 1NTOA 3GQVA 4QT0A 5JDIC 3QJ5A 2V6MA 1ZK3A 2DTEA 7ADHA 4BKOA 1DIBA 4MOWA 1BW9B 2AQ8A 4XRGA 1ZK4A 2VYNA 3MTGA 3INTA 2P5YA 1HRDA 1A71A 5I7VA 4BNUA 1DPGA 1BGVA 4IM7A 1MA0A 3WMXA 5EN4A 3VDRA 3L4BA 4W6ZA 2ZTVA 1DFGA 4CLRB 4DLAA 1JKFA 1VJTA 3UVEA 3NKLA 1P31A 3OECA 4BNJA 1N7GA 3WWZA 1WMBA 2DLDA 1P3DA 4RF3A 2J5KA 1ISJA 4D43A 3JQ8B 4EEZA 5CEFA 2EJWA 2O4CA 2QW8A 4BO5A 3GT0A 3S2FA 2PZJA 5AXCA 4GAEA 1N1EA 1PQPA 4D44A 3DAPA 3ZN2A 5C7IO 3CZRA 4PZDA 4LVCA 5KVVA 2JD1A 1NFFA 1H2BA 5T6BA 1NWCA 1Z82A 1VE9A 1GYRA 4Q39A 1M76A 3DO5A 4FQ8A 2NTVA 1LLCA 3AY3A 3QV1A 4EW6A 1X1TA 5DZSA 4FGSA 4AJ1A 4XJSA 4PLPA 4D42A 4YXFA 5AQ1A 3H4VA 1EDOA 4IJVA 4FW8A 2P68A 4DIOA 5DOVA 4IUYA 1ZKMA 4JGBA 4EUEA 2AMFA 1TI7A 2R00A 2FSVA 3RD5A 3GG9A 3O03A 4RF4A 5DBGA 3ZNPA 4EJMA 3H9GA 1PWXA 1HE3A 1BTOA 2Y67A 4F46A 1LDBA 3L6EA 2JL1A 1F14A 2Q49A 3ROMA 1X1EA 4N18A 1I32A 5ILGA 5DNAA 3BZUA 3D4NA 4J9VA 4OMUA 3ZV6A 1OC4A 3LDHA 4UULA 3C1AA 4Z9XA 4II3A 2DPHA 1I2BA 2Z95A 4CLOB 2Q46A 3PP8A 3ZHYA 4WLUA 4RZIA 3RFTA 1LQTA 1PX0A 1D8AA 4PLFA 4N7RA 2EJVA 3R6DA 2P9GA 1F06A 3U49A 5BQFA 2FR1A 4GMFA 3F1LA 2NV6A 3QP9A 1ZW1A 2EHDA 2BD0A 3K92A 4HFMA 1QYDA 5TJHA 3GGGA 2X58A 4G5HA 3JQ8A 4O1MA 1RM0A 1A5ZA 1G6KA 5CPFA 3HFSA 1DIGA 3Q6IA 1I24A 2JD2A 3GVCA 1D1TA 1LC3A 3H2SA 4A5OA 3WS7A 2P5UA 2I6TA 3GNQA 2HRBA 3PPIA 5KJEA 4PG6A 1YO6A 3Q2KA 4GWKA 5KKCA 1MXHA 4CM4A 1AE1A 1UXKA 3ZV5A 1BW9A 2C29D 3NT2A 5AXAA 2CZCA 3DFZA 5C3MA 3GN1A 2BGLA 3FN4A 2C07A 2DT5A 2X9VA 2FY8A 4J2OA 3TZQA 3WQQA 1A27A 4DYDA 1Z45A 4J4HA 3NGXA 3VH2A 1ADBA 4LW8A 2B36A 4FGWA 4RVDA 4IY1A 2Y68A 1NX6A 1V3UA 4Y9DA 4Z9FA 1EVIA 3CIFA 3DWFA 2JFFA 1ISIA 2VWHA 3GPDG 1XWFA 3DBRA 3PK0A 4G81A 4PFJA 3WICA 4L0QA 3VPHA 2RBEA 1M2WA 2YDYA 4ZQGA 4MVJD 4D0SA 4RVUA 1LDMA 4NU6A 4YA6A 1LNQA 1B8UA 3UKOA 3RASA 4M89A 1PJSA 1YXMA 2Q1SA 4OM8A 5IG2A 3KSDO 1HYGA 3O4RA 2JCXA 3DMTC 3VPGA 2I3AA 1KC3A 2FPGA 3AM3A 4MKRA 4YBZA 5H82A 3UGKA 3H5NA 1ULSA 1PZGA 1VSVA 5IZCA 1E1MA 4IIUA 1NQ5A 4BKUA 1V9LA 3JQBA 4YJHB 5COQA 3EK2A 1EDZA 5G4KB 2BFPA 1H6CA 5I8WA 1ML3A 3L0DA 3DONA 1B3RA 3WXBA 1Y7TA 2O3TA 2VUUA 4RQTA 4B7UA 1N5DA 3FPCA 3ST7A 4A03A 4R4JA 1SCUA 1N9GA 4LCEA 4B4VA 1YBVA 1ZH8A 3DBRB 2RCYA 3NJ4A 4Y6PA 3IDSA 3WIEA 1LU9A 1Z75A 3O9ZA 3U4HA 3GVXA 3ZWNA 1ARZA 1SNYA 1E0DA 3FNGA 3JQBC 3HB5X 3LT2A 2YYYA 1YDWA 3EW7A 1J0XO 5IN5A 5B4TA 5KVSA 1N7HA 1KIFA 2C5AA 1MUUA 1UDAA 4BS9A 5DCWA 4J0EA 4XRRA 4NR0A 2HAEA 4BB6A 2Q3EA 4F6LA 5LCXA 1NXQA 5F5NA 3ZCXA 2WJPA 3BA1A 4GL4A 2Z1MA 2VZ0A 1PU2A 3BMQA 3VH1A 4AJLA 1ZXLA 1RYDA 1PR3A 4IGFA 2RIRA 3WGHA 5KVQA 1O9BA 1SZJG 4IDBA 1IB6A 3MJTA 1UDBA 1I30A 1HDYA 3FWNA 4Z0PA 2W2KA 2E4AA 4XDZA 3RFXA 4NU5A 3V2UA 4FFLA 4UVGA 1XQ6A 3ROKA 5KJ6A 1PL8A 2UYYA 4BNWA 1WLYA 4D3DA 3UN1A 2XF8A 1FDVA 1VSUA 3ZHXA 3HN7A 3D64A 2B37A 1R0KA 5T8KA 1BDBA 1KC1A 2V7PA 3E5RA 5ES3A 4ND2A 4CLHA 3DHEA 4LSWA 4WLVA 4CJXA 2EIHA 4ZN6A 4E12A 4JIGA 1DO8A 1P77A 1RYEA 2PWZA 3PGJA 3SC6A 1SPXA 4JBHA 4Y6SA 4CMKA 2W8ZA 5B4VA 3EAGA 2Y0EA 2O3JA 1T1RA 1U3TA 1KEUA 3CKYA 3V5NA 4CM7A 2RHRA 1AXEA 5KCZA 1ZJYA 3DZFA 1PZEA 3RC9A 1ZSVA 3FNEA 4YT8A 3A14A 4BNZA 4AJIA 5C37A 1ZSNA 1HZZA 1Y9AA 3OQ1A 4JJFA 1ADCA 3H5RA 1JA9A 3O38A 4BV8A 1WNTA 4EGFA 1CRWG 1LSSA 3KZVA 2LDXA 1DHRA 3ETGA 2IRWA 4NPCA 5COAA 3PYXA 1C0KA 4ALIA 1ADFA 4E5PA 4ND4A 1E7RA 3DEYX 3DMTA 1DIHA 2ZCVA 2GF2A 1IPFA 2ZJ0A 4UEOA 2Y1GA 3WGYA 1Q0QA 2PFGA 1D1SA 2YV1A 2PR2A 3SX2A 3OJOA 1EK5A 1SBYA 3GNSA 1PJ3A 1U5CA 3DBLB 2C82A 5EPOA 3WIDA 1KS9A 4HFJA 4RDIA 1MLDA 1YQDA 3LT0A 5G0SA 2OFPA 3W1VA 4J4BA 3E48A 2WWRA 4YJDA 1CYDA 4MIEA 3BMOB 4KTTE 5DF1A 3K9QO 4Q3EA 2W4QA 1UR5A 3ZNNA 4B7CA 5A9SB 1YONA 1N1GA 4U6QA 3H3FA 1BDMA 4YB8A 2FR8A 4GGPA 3RC2A 4WPGA 1X0XA 1P9LA 2NVUA 3ICPA 3GZNB 3JYQA 4OSPA 1LJ8A 2W2LA 3RUDA 3W6ZA 4YR9A 1V6AA 4WCFA 2VTEA 3IQDB 3IUPA 1U7HA 2B83A 3V1TC 2ET6A 3UICA 5JBIA 2NU6A 5FWNA 3AUAA 5L7TA 4KMSA 4MVJH 5JNLA 1GDHA 2I5PO 4Q3AA 5IF3A 4YJFB 1NAHA 3IC5A 1T2DA 1LDEA 2D0IA 5ILOA 2A9FA 1Q0LA 3OF2A 4OSOA 1RJWA 2GDZA 3KB6A 5I7SA 1SOVA 5CDTA 3N7UA 4FJ2A 4MVJI 3NGLA 2PKRA 4QEDA 1X7HA 4ZVVA 4BKPA 4MPDA 1JDJA 2WD7A 4J2HA 3JQ9A 1PGOA 2DBRA 4J90A 4CV0A 4JCOA 2FOIA 4E5KA 4H16A 3AOEC 4D45A 4I5GA 4WECA 1IHYA 3GF4A 5HBRA 3KTDA 3OHSX 1HE5A 2JCYA 1PGNA 3TZ6A 2OORA 3P2YA 2P9CA 1PJQA 5L45A 4CV1A 5HS6A 5MGBA 5JMPA 4DGSA 1IUKA 4CQLA 2A35A 2E37A 1YH3A 1K3TA 4RPKA 4JK3A 4OXKA 2EXXA 3WR5A 5AYVA 2CMDA 3X2EA 3GVIA 4FN4A 4E5YA 2IE0A 2NQTA 4YCAA 3TFQA 1W73A 4ZQEA 3OJEA 1U5AA 4B4WA 1HXHA 4FCCA 3VZQA 3WYCA 5IDXA 3EY4A 3KYDA 4PG7A 4NHEA 3KLMX 4RL6A 4ZQBA 1PTJA 3GC6A 3ITKA 1XA0A 4XQ9A 4O5OA 3S2IA 1VL8A 2HK8A 1LSUA 1QYCA 2AG8A 1EVYA 3WWYA 2BELA 1W4ZA 1HDRA 4IDGA 4WK6A 1H2HA 4XR4A 3JQ7A 4NQZA 4DYVA 2JAPA 3W4JA 4B3HA 4DMLA 1IE3A 4O0LA 1LSOA 1F17A 2C20A 2BI8A 3UCEA 8LDHA 3OETA 3Q9NA 4TRRA 1YDEA 5BR7A 3IS3A 2HMVA 4M55A 3TNLA 3PWZA 3D5TA 3EGOA 5I8ZA 4FFOA 1PQWA 4OH1A 2AHRA 3ANNA 2AA3A 4PVCA 4OQYA 3ZWYA 1P1RA 1V8BA 1ISHA 4YACA 4IMRA 2O3QA 1UP7A 2O7SA 4RCVA 4LMRA 3ZWWA 1NBOA 2JHFA 5GZ1A 1E77A 3HQ4O 3UHAA 1Y5MA 3I9MA 5HA5A 1GZ3A 4FSHA 1GV0A 1VKOA 1CEQA 5L4LA 1OMOA 2CVOA 3GDGA 4PLWA 4WKGA 1KBZA 4CR7A 4WCFB 1DIAA 3N58A 4LSMA 3NX4A 1MXFA 3DFUA 4CM3A 1GQQA 5A05A 4E13A 5CDSA 1XQ1A 3BXXA 4QO8A 3KBOA 1H6DA 3G49A 3NJ8A 1RM4A 1PGPA 4D3FA 1AGNA 1J6UA 2C2XA 3FF4A 3NT4A 5I9NA 1I3LA 4JQCA 1P74A 4URFA 3GOHA 4R41A 3STHA 2HKIA 3JYOA 2GGSA 2P4HX 2GRAA 1V3VA 2FN7A 4QSMA 3F4LA 1BXGB 1C0IA 1IPEA 3OJ0A 5IXYA 3P7MA 3S55A 4TQGA 4I9NA 4IXWA 2DFDA 2QRKA 3LC2O 5JYEA 3C85A 4K26A 1DJQA 1G0NA 1LQUA 1U3VA 3H7AA 2YFHA 3JQAD 5F1PA 3VTZA 2GO1A 2GN6A 2DBVO 5JY1A 3DL2A 1GYQA 1ZXBA 3D7LA 3HFGA 3NYWA 4R69A 3H6KA 3DR3A 2NU9A 1HE4A 1AN9A 4ONEA 5JXWA 1E1NA 4ZGWA 4BO6A 1OAAA 2GD1O 1UZLA 4E33A 4HXYA 4HADA 1PJCA 5EJ2A 4CLXA 1NVGA 3C1TA 2QRJA 5T57A 3DOJA 5HS4A 3ULKA 1Y8RB 1G0OA 3TN7A 4XGNA 4Q3CA 4K28A 4RLHA 4E5NA 4J7CA 2NVUB 4K9DA 2B0JA 1V0JA 3GGPA 1ZBQA 3ZHZA 1NHWA 3H9UA 4DQUA 5MDHA 2ZJ1A 4R1NA 3QQPA 4I5DA 4BNGA 3ZZNA 1E1KA 1QV6A 3RUEA 1AUPA 3CEAA 4PLTA 5TJ9A 2X5JO 1M75A 4JP3A 1HSOA 4L4XA 3ETDA 3DZHA 3RKRA 4WNCA 1YKFA 4KDEA 4XQGA 3Q1LA 3D4PA 2HK7A 3PQFA 2OGUA 3M2TA 1ONOA 3GFBA 4FS3A 2NTNA 4WCFC 3ZNQA 4CM5A 3JD1A 4OL9A 1HSZA 3JQFA 4RVFA 2AQIA 2NVWA 3MEQA 1GCUA 3AOGA 4B4OA 3GUCA 1PGQA 1DXYA 3WDSA 4NDNE 1NP3A 4N5MA 5JO0A 1KVUA 3WX0A 4BO1A 3IJPA 2EGHA 4DPLA 3MJVA 4H3VA 5JLAA 4IMPA 3TZKA 2PZLA 1LUAA 2QQ5A 1N92A 5TRTA 3WQSB 4I9UA 1UJMA 4PIVA 1ZCJA 1ZMOA 1EEHA 1ENZA 3BMNA 4QECA 3PWSA 3QRWA 1JQBA 1JTVA 1Y81A 3TF5A 1UAYA 1L7EA 2DUUA 4YDRA 1R0LA 2XXJA 1K2WA 1ONNA 2BRUA 4I5FA 2PGJA 2CVZA 2ZQZA 1U4OA 3FTPA 4JJIA 1F8FA 1YWGO 2VRCA 1WP4A 3KXDA 3I4FA 2G5CA 4Z3DA 3VPFA 3AU8A 2YQ5A 2PTGA 4I5EA 1E6EA 4Q3NA 4GKVA 1MFZA 2BHLA 1KVQA 3EHEA 4ND1A 1EUZA 5JAZA 4BO9A 3MWDB 3S8MA 4AJ4A 4PLYA 1DRUA 3JTMA 2ZTUA 1NAIA 4JROA 3TRIA 1PJTA 1X0VA 1EFLA 4BNVA 1QYXA 4QXMA 1K0UA 3IIEA 3GA0A 5A02A 3UF0A 1C14A 3U4IA 4J1SA 4RDHA 3VKVA 2C0CA 4LRTB 4RJTA 5A5FA 3QVSA 4KDFA 4ZICA 2WYUA 3ZHBA 4CM1A 2I3GA 3WSWA 5L95A 4XQEA 3GEMA 2LDBA 3GDFA 4J1NA 2X4GA 4UUNA 3P2OA 1HETA 2Y1FA 4TWRA 4A73A 4D7AA 3ZI0A 1E3LA 4CM8B 4WCDA 4YRBA 3IJRA 2UUOA 4GQAA 4YAGA 4RF5A 4J0FA 1EQUA 4CR6A 4RPGA 5HRUA 4RPJA 3DC2A 1GUZA 3PQDA 3B70A 3HN2A 3FNHA 4RF2A 4TRNA 4UUOA 1XEAA 4HKTA 4J6FA 2ZTMA 2DBZA 2HO5A 2ZYAA 1XU7A 1PS9A 1FK8A 3NTQA 2VUSA 1YB4A 1HDXA 1PJLA 3ADPA 4O59O 2OBYA 1DC3A 2IDZA 4UVDA 5EMHA 4DA9A 1YB5A 5CDUA 1VLLA 2B5WA 3Q9UA 5ENVA 2J5QA 2XOXA 2PD4A 4U8GA 2JCVA 2C5EA 4IJUA 4CL8A 3IP1A 3AUUA 4ALLA 3VVCA 4PN3A 3U4CA 4CM6A 1KOLA 4XIJA 2BFMA 3R3JA 1XU9A 2PKQO 4L8VA 3TZHA 4UEJA 2PKQP 3F1KA 4JLWA 5FFFA 5K6AC 4QQRA 2DTDA 5TSDA 3C24A 4CLDA 1LI4A 2VUTA 2H63A 1NNUA 4J9UE 1LLDA 5AXBA 4CQMA 3FWZA 3IAHA 4GX1A 4YAKA 3UCXA 4YJFA 2EWMA 3DHYA 4XIYA 3RVDA 5BSEA 1Q7GA 4YT2A 2FPPA 4XYLA 3QW2A 5DCYA 4E3ZA 5JW6A 2DFVA 2GZ3A 1A4IA 4X54A 1HDCA 4Q3BA 4E2WA 4BNMA 1R15A 2DAPA 3I9KA 3JQCA 4U6SA 3E18A 4ROSA 2BF7A 4G65A 1IULA 1NPDA 5IAAA 4DMMA 4GSLA 5DCUA 1TB4A 4R1SA 3TZCA 3INRA 4BVAA 4U7WA 5TGDA 1BSVA 4DRYA 2X86A 1UXIA 3RBZA 2Y99A 1YVEI 4AFNA 4TROA 4TRJA 3AM5A 3ANMA 1B3BA 1Q2XA 3FHLA 4ITUA 3SLGA 3HG7A 1UDCA 1GL3A 2HMUA 1Z7EA 1AXGA 2XXBA 4KOAA 2C2YA 3D4OA 1HKUA 1TVEA 1LEHA 2QZ9A 5KNLA 3PHJA 3PVZA 3KYCB 4HNGA 3RWBA 1Y5RA 1NWHA 1NQTA 1TA4A 2HQ1A 3S2GA 5ICMA 3LT4A 1E7YA 1JWAB 3DBLA 3H3JA 4IZHA 5EINA 4EYEA 2JD0A 3WJAA 1X13A 1DLJA 1HDZA 1U3UA 1ZMTA 4ZQHA 3TOZA 3WFJA 1BWSA 2GN8A 3KSZO 3EZYA 2YY7A 1J4AA 1BXKA 1AHIA 1ZZEA 3V1UA 4AJPA 4PCVA 3DBHB 4JNKA 3WNVA 3ZWCA 1J49A 2YDXA 5A03A 5U9CA 4CLEA 1VL6A 2AE2A 3RUIA 3KUXA 4MKZA 1D7OA 1ZFNA 4J7XA 1B26A 4ZD6A 2YFQA 3DOOA 4E21A 3VC7A 4RZHA 3FCOA 4B79A 2C7GA 2GR9A 5TNXA 3WYEA 5CEEA 4OGWA 3DZIA 2V6FA 3PZBA 1JLLA 4CMAA 3WBBA 4MP3A 3H9JA 3PHIA 3T4XA 4JP2A 3OM9A 5HWSA 3G0OA 1GR0A 2IYPA 2VYVD 1O94A 2AQHA 2XPCA 3LU1A 1NM5A 1GPJA 4CMBA 2IEDA 1ENPA 1RPNA 4E32A 5G2OA 1R0SA 2UDPA 3PYMA 4XA8A 3AFNA 1QYVA 2ZB4A 5THQA 1B15A 3RI3A 3JV7A 2NWQA 4HBGA 4BUCA 4CUZA 3I83A 1I10A 4NIMA 3RAJA 1YE3A 1BVUA 5K0ZA 3DXFA 4ZJUA 3ONFA 3OMLA 2VHYA 2EG9A 2YHIA 3HDJA 1E7MA 1E3IA 4NNJA 3I9LA 4TZKA 2ZTLA 3SBOA 3RFVA 5JAMA 4BNFA 3HWRA 3RCBA 3V8BA 5AVOA 1PS8A 2Y66A 3HZZA 2PA3A 3JSAA 4L75A 1LLQA 2Q4BA 1MC4A 3FBTA 5I9MA 4QO7A 1L1FA 3GK3A 5I7EA 3KYCA 1A4UA 2F00A 1OZAA
chains in the Genus database with same CATH superfamily
3VO8A 3PFWO 1L3IA 5A0TA 1KNXA 1ACJA 4V24A 2HFKA 2JKVA 4AJHA 1FDSA 1JIXA 3C41J 3HO6A 4OVKA 5HIAA 1GNLA 2VRBA 4JBWA 1RLIA 4FHCA 4GI5A 2SECE 2GS9A 1X7YB 5DOZA 1Q0TA 5AE1A 1N9GB 1YUMA 4Q1BA 4PLGA 1RI1A 5I9LA 1DAGA 2AQKA 2G0NA 2HJVA 2JCBA 3O4IA 4NBVA 1RXIA 1WHSA 2FMKA 3N3BC 5J5AA 5LIRA 2YCBA 1H8ED 2GN1A 3SHTA 3UB3A 2O8FA 4XTRA 3Q3VA 4KE6A 3HYSA 4UHEA 1DUSA 4OOEA 4CKWB 2CNWD 5F3DA 3N07A 1KFKB 2JIBA 4PIPA 1HNZE 1KJZA 2KLBA 3SQDA 3UC5A 4PSVA 1E8DA 1KAQA 2RGXA 2QRMA 4HYYA 5IBPA 3PLNA 5LBTA 3ABIA 1OYOA 2FLVA 4KQFA 1D7AA 4LZJA 2ZQYA 2IZ1A 4D57A 5TMPA 1WE2A 1U8EA 1E8MA 3DXYA 2UU9B 2D1TA 4F9BB 3CUEF 3K2BA 4HUJA 4I1VA 2WILA 3H2BA 3REFA 1U1EA 1E1QA 2EOEA 5EMNA 2Q6IA 1DMRA 2NU7A 3LYLA 1GCAA 3CO0S 3OWHA 4POOA 1U2ZA 4AF7A 3OJLA 1Q0HA 3LO8A 1UM9A 3NTRA 2GHFA 3OT1A 3PUZA 4EHKA 4ND8A 3RVOA 1JK2A 1VHWA 3KQLA 2FRVA 1W4AA 4ND3A 2ZRJA 4DQDA 3AWIA 1YF3A 1Q0SA 4WNAA 1SH7A 2C5FA 4EY8A 2OFXA 4BTVA 1IBCA 1YRAA 2JGJA 2MU1A 4KK4A 4URHA 3SC4A 3VH4A 1QF6A 2VYQA 4CF3A 4MGEA 3A4VA 3LBHA 1EAYA 1QHNA 1QHFA 3GJ4A 3AH8A 2IU3A 5HTKA 1ESCA 2M7QA 3V8RA 1TTQB 3LQFA 3U1TA 1PSDA 1QNTA 1T25A 2YINC 3KKZA 3U7QA 3IP7A 5BW6B 2Q2OA 4MVJM 2QAGB 3E9MA 4P3NA 1KZ6A 2NUFA 2PZAA 5KPDA 2AB0A 3LCUA 4PQFA 4GMGA 4H4CA 3RT7A 3NVMB 3JRXA 4DQKA 1PWYE 3FMOB 3HVKA 2H8KA 4MNTA 3NEJA 4Q3KA 5JBQA 1MGOA 2ODRC 1WUIS 4XQ0A 3A70A 1P1KA 1ZD3A 3DLIA 3DZBA 3KAQA 5GOZA 3R76A 4A7PA 1JHXA 1K5HA 5I3ZA 5MGNA 2EP7A 1JDBB 3OOJA 5FTNA 3PIIA 1ACMA 4IIJA 1REQA 5LNK1 1E1RA 1YMUA 2AVDA 2I7DA 2ZK7A 5CNJA 1GU7A 3E05A 1DS6A 1GFZA 1Z9BA 2Q4RA 2PY6A 4PPNA 4Q18A 5FB3A 3VZCA 3DMPA 1CTQA 1E1DA 1YDGA 3G2PA 3ESQA 3PT9A 2O8BA 4CKCA 1O4VA 2GKGA 4JVSB 2BKAA 1M6WA 5FLEX 3FYDA 3GLFA 4F85A 2EPXA 4BFCA 2MINB 3LQ2A 2UVPA 3E9QA 3HKEA 4L22A 5DP2A 4ZVMA 1NUAA 4X62B 1F4LA 4D9BA 2GJSA 3VGPA 4QM6A 1E63A 3O1HB 1XD2A 1UK7A 1A1JA 5U4XA 1MJGA 3C3DA 1M10A 2JGNA 1F6WA 2I7TA 5AJHA 4IQGA 1E89A 1JXOA 4HUQA 3RM3A 3WLHA 4B34A 3W06A 1ZBDA 2FAXA 2AG5A 1I6WA 2AI3A 1XNQB 3LDAA 1VXRA 3UH0A 2J0UA 3ETEA 1Q3KA 2JAXA 1T3TA 3GXBA 1N5KA 1EJ2A 4LFAE 2BFFB 4KXNA 1C0PA 5DM60 3QIAA 3RTCA 1S3GA 3KHUA 1FLNA 3I9V1 3B6JA 2VPWA 4L95C 4R2KA 4XKJA 5FADA 2BV3A 1TM2A 4Y6RA 1MX3A 1YB7A 5ICGA 3MAJA 5L6LB 1CQJA 4GPEA 4I55F 1A9QA 1H6BA 2IZZA 2UUPA 3M33A 4YUVA 5BV0A 5HKKA 3KQNA 1R4NA 5JG7A 3SBXA 5I6DA 1NC1A 2O3RA 2QM8A 3HN6A 2JDIA 2ZE7A 2HIAA 2BR5A 3DL4A 3QX8A 1WZIA 2JA1A 2W2KB 1IVYA 1JR4A 2NNWB 2R6CA 3SF0A 2ZDHA 1M8GA 3UV3A 3II6X 3CVYA 1F20A 4REQB 3KYJB 2FN8A 5CRIA 3T41A 2IYYA 1QO7A 1UT8A 1PZNA 5LA6A 2FR0A 3EIHA 1PZMA 3GO4A 4ZAGA 1JG1A 4YIKA 1D2GA 1GKYA 3GMSA 3EDOA 4EJ6A 4DT1B 2I6GA 1JVNA 3O5AA 3O94A 5AK4A 2EKQA 2B94A 4LTMA 3V8MA 3QE4A 2OKCA 1F0NA 1R6TA 4GGOA 2EOZA 1ZK0A 3E23A 3N6XA 3K09C 4WZAA 2C2WA 4LXYA 4WASA 5I9SA 2ODTX 3CKMA 3OZBA 4XB2A 3C8MA 3T3OA 2XH8A 2Q2WA 3MERA 3HCRA 4OPMA 4ZVQA 3WGUA 2NZWA 3U7IA 3ZXSA 2EN8A 2Y9MB 4I6EA 1II0A 2HA0A 2HZBA 4LA4A 4Q03A 4ZQFA 4YPFA 4YRSA 5BNIA 3H5AA 4MV9A 3HBJA 1RADA 1PJZA 3KOWA 5H8WA 4LOAA 1SR9A 2XTZA 1ELOA 3PDUA 2GEJA 5JPIA 1W7AA 1SQ0A 2J3IA 2GM5A 1T4BA 1VPLA 4JI4E 1RVDA 3CTMA 2FOXA 4G0WA 2XRZA 4ZT5A 1NY5A 3NEAA 4RGBA 4JI7B 3BZBA 3CGWA 4PHCA 1H94A 3K1TA 1UQUA 3LUBA 5TSEA 3U7HB 1IZZA 2LV8A 4J7UA 2Z83A 4MP8A 1JRLA 4OUDA 2PU7A 1XN4A 3QX9A 4FZVA 4ZYUA 3DYVA 2VDNB 3TPFA 4EHNA 3NRJA 4X41A 4B3TB 4FC6A 4KV9A 2APJA 3K70B 1J8FA 3IUEA 2G77B 4B46A 4H27A 4D9NA 1TC1A 2Y0PA 3TRHA 4HWKA 3F4BA 5LMNE 1W0CA 4E14A 4EY5A 4QJBA 5GTDA 3IEVA 4CRWB 2CD7A 1A9SA 2RK3A 1RM5A 1NJ5A 3EVGA 4WTOA 1SO8A 1LPMA 5H9WA 1T3SA 3D6TB 4D4GA 5CLLA 4UE3S 5KTKA 4BVEA 4JBLA 1O95A 1MABA 4JMPA 4D46A 3M6FA 5LYJF 4HYEA 1K3FA 4IIJB 5FOSA 5INTA 3GZ4A 4PSDA 4R2IA 3K6QA 3JQFC 1P7VA 1JHYA 4MLPA 1S2DA 1ZCFA 3K2IA 4PWZA 3HGTA 4ALJA 1SGWA 4G25A 4BO7A 2O2YA 3KR0A 4CT4B 2B0CA 4HDSA 2LUQA 3T6KA 1G3UA 3L1IA 4F86A 5ITZA 4BIIA 1MGTA 1B1AA 1GTZA 2Q0HA 3I1FA 2NTJA 2W6MA 1TT5A 2AOVA 3IHWA 2AOWA 4OU4A 1HH4A 2HF2A 2V6BA 4GE3A 2PS9A 1RACA 3R0XA 4GYWA 2GM3A 3QW4B 3AO0B 5DVZA 2VTDA 1NJ8A 2WE8A 5FX2A 5A7FA 5KWVA 5KPJA 3ENQA 4RXMA 3P9SA 2WWXA 4OYHA 1ZMBA 3OT5A 3OE1A 1D2EA 4X8OA 3E9CA 3HA5A 3K2QA 2VJBA 3PEVA 3AYZB 3I9FA 5BSHA 4V1CA 2C59A 2GVDC 2VSQA 4TMVA 2WT9A 3NU1A 2BEKA 5TF0A 3E3AA 4F11A 4MJLA 3I2IA 4BVBA 1Q74A 2WPDA 1VI5A 2Q8UA 4TUYA 2SICE 4ZALA 3R7WA 3ADBA 4QFDA 4X3CA 2AOTA 3FAKA 2VJAA 2WINI 2UYOA 3OFSA 1UZMA 4ZVUA 1XTUA 2ZJ4A 3HM2A 1Y6RA 4UM7A 3LXUX 3ZW8A 4G07A 2BH2A 3EEOA 5LQUA 3W5AA 1BD3A 1GTKA 1YL7A 1U04A 3QHPA 1FDTA 1I4OA 2RH8A 4ML3A 2VSFA 1Q7CA 4MV6A 1LPBB 1WMEA 3BE5A 1OBFO 3GZJA 4O4LA 3LPNA 4LI3X 1TU4A 2HGHA 1VYHA 4XX0A 5FEUA 1JBQA 2GXSA 2HIHA 4HV4A 2WP0A 2HGZA 3AEZA 4PONA 3W1EA 3W2HA 2A14A 4ASUA 4YAUA 3I5XA 3EGDB 2VT6A 2F3QA 2YNMC 4J16C 5KYWA 5LJLA 4PR0A 3ML1A 1ZRSA 4XE5A 1LWOA 2YQ4A 4D3XA 3L49A 5IEJA 1YTUA 2OHHA 4DLBA 5JFOA 3WMWA 1J2RA 4YJ2B 4TYQA 4DEYA 4CT5A 4XSGA 1LY1A 1RNLA 1XKQA 4JBGA 3ITDA 2D5CA 2WU0A 4OHXA 1W4CA 2OP0A 4ZU6X 1H0KA 3SSMA 1JYEA 3WQRA 3ZJYA 4B71A 3PD0A 2MSEB 3LDGA 4K9KA 5D5HA 1MOPA 1JR3D 1N1MA 4KC0A 1Y9ZA 2YH2A 3BRWA 4R7TA 2DMYA 1HUQA 5LWQA 3PDHA 1JKIA 1HQDA 3KKKA 1NTRA 1DKRA 2XTNA 3KEQA 4JS0A 1P0CA 4XWYA 1QP4A 3RYTC 1KVTA 1SEVA 2Y1XA 3SHVA 2BAGA 1NVTA 4E4YA 2OUIA 2BBGA 4GFDA 4O4JB 1TIPA 4WOKA 1BDIA 2YW9A 1T43A 1Z7WA 1KQGA 3MRTA 4IV0A 2HYIC 2YXDA 1RR6A 1XJ5A 2PD6A 3A6FA 4CU2A 3AHJA 4UM9D 3FDZA 2VRCD 5ALOA 1PGJA 5C7OO 2JI4A 2I78A 1SCAA 5HRCA 3DF9A 5CHEA 2Z6VA 2IUTA 4BCDA 1GUYA 1A1VA 3SJ7A 4JVLA 1IBRA 3OQOA 1GPMA 1BHQ1 2Y1LA 3LLSA 3A4YA 3QHAA 4X7MA 4UUQA 1BKDR 4J4TA 2ZUDA 4MW4A 3I30X 1I3OA 5K0EA 1NLFA 1UKAA 1VI2A 4JEUA 3T8YA 4NWIA 4RVGA 3L6RA 2ENCA 1QRAA 1NBMD 4YDHB 4GLBA 3EIQA 2XBLA 5EVJA 3TDKA 3MHSC 3WWOA 3I6MA 2V7TA 4TXHA 3RBVA 1V6CA 1LZLA 3HCCA 3BERA 2ACWA 4KN9S 1QZXA 4IR7A 3PC7A 4P6VF 1ZC4A 2YZ7A 3V80A 2CMFA 3AVXA 4FBGA 3E3OA 3RSGA 2XMGA 3IRVA 4NICA 4KUGA 5FUQA 3QOFA 2AOXA 1PDAA 4W1PA 3G2LA 4Z49A 4RZXA 3TSCA 1PYOA 1ECBA 4GEKA 4F9AB 2QENA 4B3DA 5BP7A 1XTPA 1EE9A 2C1EA 3T4PA 3IQZA 4BO8A 3GVPA 2KLHA 3PE3A 2QL6A 3VNSA 2R1TA 1SCQA 2VHCA 3ADKA 2I7XA 3MJHA 3AV0A 5IM5A 1P2SA 3VKWA 4BO4A 2H1HA 2X1HA 3IT0A 3OU2A 2WMDA 1EP1B 5E0OA 4GM0A 4IRXA 3SS9X 4DYHA 3MTJA 3VR3D 1E5LA 5C1PA 4TVSA 4Y6OA 3CB4A 3HWWA 4LMAA 2EJUA 1E98A 2ZJ3A 1SJ9A 1T4CA 2G1KA 1EH6A 2H2AA 2PX3A 4Y2UA 5A4DA 2QZSA 1MIOB 2HRZA 3ECRA 1T39A 2GZ1A 3HLYA 4HNSA 4D97A 3UWMA 1RE0A 4C7BA 4X62E 3P2MA 3HU1A 1T5BA 3DVRX 1G17A 2BMEA 4MQLA 2M9AA 3JU0A 3EPLA 2DUJA 3OZCA 4FFBB 2DGDA 5E6SA 4KHZA 4A3SA 4PYOA 5JE8A 4S04A 3ZJTA 1X6EA 4RPHA 4UNQA 1M2FA 2I67A 3A4NA 1QVVA 3RTEA 13PKA 1Z0FA 4FIDA 1GN9A 3K09A 2QTNA 4CUKA 4EITA 2IBSA 3EGCA 4GNRA 5GP1A 3SYKA 4CODB 5KX5A 4RJKA 1I3MA 3MCAA 3CPSA 3OPNA 4XCXA 1LB1B 4RSMA 2EC5A 4TKMA 3W9UA 3T1HB 1OLXB 1EB8A 4M0EA 4JJEA 2WJ4A 3V1YA 4D0RA 4EJFA 5F1OA 2HJGA 4EUKA 4BC0A 4Q7KA 4K03A 2CDCA 2Z58A 4N4AA 4R40A 1FFGA 2CHFA 2JJYA 4XWGA 2ZJBA 3BC1A 4M9RA 5IDQA 4CU5A 2AHOA 2WD8A 4E7PA 4JX8A 2DUWA 2H1WA 3UYLA 3AY7A 3HSSA 3B51X 4B3RB 3EF0A 1MIOA 1IG0A 1DLIA 4NCNA 4WGGA 2I22A 1RXEA 4ZOQI 5JRZA 4RS4A 1BXZA 1N1DA 1T2CA 4M49A 3E5NA 3TM5A 4UUMA 4C0QC 2VK8A 3JARB 3T1YB 4IHJF 4ANFA 3PJGA 4EKDA 4XDYA 5TMEA 1KDRA 4WLFA 1DRVA 1YQGA 3S2EA 5KJ1A 2QV7A 1E5VA 4Y1GA 2P77A 2E1MA 3RV4A 4R1QA 4JJGA 3JXEA 2C78A 2F1JA 2NSHA 2WPDD 4LG1A 1B73A 2X77A 3GT3A 3H2KA 4F4DA 3WQBA 3T0FA 1ADJA 2M1XA 2PANA 4N8SA 3KVOA 1VA4A 3G7SA 3S44A 4Z3KA 1SCJA 2X5KO 4KXQA 4OB8A 1IN5A 4WGFA 3ET4A 2W93A 5DHQA 5GQSA 4WLEA 2QRHA 2ZI6A 4MZDA 2E1RA 3EQ9A 3KYIB 3JY6A 9LDBA 3NBYC 2EZ6A 4GBJA 3WDLA 3U3MA 1URPA 1U0SY 2VZ9A 3MB8A 1PI3A 3ND8A 4IFTA 3VYUB 1XAIA 3V42A 4CHGA 1C0LA 1E6WA 1E4EA 3IUNA 2RBKA 2ZJAA 4GWGA 4EG3A 1OXBB 3M1IA 5DXAA 7MDHA 1QGUA 4HPJB 2LCFA 3ILSA 2Y0DA 3QLTA 4E12A 3OTIA 3COSA 2CW5A 5BQPA 4Z7OB 5GGXA 1K98A 3HPQA 4LRXA 5JJBA 1KYIA 1HFWA 5A6VA 3EMDA 2Z57A 3GT4A 1N6HA 4D4HA 3ROGA 1T36B 1WD7A 2QAJA 2ZR7A 1SBHA 3Q1KA 3W5VA 2OHVA 4C22A 3DNFA 4KQ6A 4HOYA 1UBHS 1DDGA 1FSSA 1PDOA 3DCYA 3KXLA 1EJ0A 2OBLA 2R4UA 2VPPA 4NSNA 4OJNA 3A37A 5IYZA 4DNOA 2BEJA 5AVVA 3L6UA 4LZWA 2RJ3A 3FUWA 1SWWA 1KY3A 2X0JA 2YS6A 1FF9A 3E6AA 4JUBA 1C7JA 2G9UA 2RSIA 1J21A 2HRCA 2QYSA 1T3HA 5LMNB 1BU8A 2XTAA 3F6RA 3KKPA 3ITEA 1WVGA 4I66A 4CL0A 2EMHA 1GVHA 4BHTA 1IBME 5JS2A 2P8SA 1HTBA 3BMCA 1A0OA 3G6KA 2WD9A 1QANA 1MAUA 1N2BA 3Q0EA 2HU2A 4AIRA 1VHDA 2AMVA 2ZS7A 3EWSA 1OIXA 1XG5A 5TF4A 1O8BA 2ZZKA 4RVHA 5IKOA 1I94B 2RB4A 3R3HA 4C4RA 3NKVA 4C6TB 3OQNA 1SB9A 4UC0A 3OUUA 2JI7A 1D4ZA 2XB8A 4C78A 3RYCA 3S40A 4WESB 4LBVA 4S1WA 4B9AA 5KYWB 5LMZA 3KETA 2CTDA 3UMCA 3LSYA 1USGA 4I4IA 4W4TA 5G53C 2ZTHA 1SXJA 2EM5A 4A1OA 4EDFA 5FFNA 4ZI2A 4MPRA 4I8IA 4LCJA 4C6RA 5JNVA 1TTHA 5TEVA 4B3FX 3N0VA 2BI4A 1J7JA 2QVLA 1PHRA 3G1WA 1NW6A 2C77A 2FRXA 5DBHX 4F2GA 1MB2A 2IK8A 5ICSA 3ANYB 2XGSA 1HZJA 2CBGA 2PL9A 1TLTA 2G40A 4RMJA 3ZDFA 3L06A 5AKLA 4X7RA 5LP6F 4F6MA 1WBJB 2EMBA 4AJNA 4OOFA 2HLDA 4GBED 1DBIA 2H1CA 5ICMA 1FP4A 5KMGA 5CFFE 3I23A 4GX0A 1EDDA 3EEYA 5ITVA 1VE6A 3E4DA 3G79A 1P2BA 3I6QA 3KCNA 5HUQA 4WEQA 4F8EA 2WAAA 2FPWA 3N28A 4Q19A 4E2YA 3ESAA 3QU7A 4YPOA 4YRKA 5ITWA 2UZ1A 1XD8A 4Q1CA 3OT4A 2XDWA 3GEEA 3U3KA 1WLSA 1NP7A 1L5LA 2Q1XA 2H36X 3N8NA 1BG6A 5IKXA 3LH5A 2YXPX 4KQWA 4FB5A 4I5IA 1WOMA 2FZVA 4IINA 2PAAA 1D09A 3DPSA 5AW8A 1Y3HA 3OIGA 5FUMA 1TW2A 3UYKA 3CLRC 3ZE7A 3GCZA 1XHFA 4G26A 4INAA 2EWLA 3I01A 1BQ4A 4I4LA 3KZKA 4G86A 4INOA 4M2LA 3WFZA 1N36B 2AEFA 2BEVA 4NEHB 1SIUA 1YIAA 2A30A 4X60A 5DMHA 1WAMA 4LQDA 5EP2A 3CH4B 3EW9A 5AHOA 4ZCSA 5KYGA 4ZOBA 3PDWA 3EJ6A 1Z74A 2FJ0A 2OTCA 4DLRA 4D25A 2GN4A 5DWVA 3QVXA 4H1VA 3EA0A 4TTJA 1XI2A 2HSDA 4MYDA 4BN5A 4KK3A 1C1XA 1JHAA 1UP6A 3ERCA 4Y0AA 4M1MA 1YBMA 4B4UA 1JWBB 1KI6A 2WPNA 2JAQA 3DEAA 3OOWA 1A95A 4MCHA 1FQKA 1FJ2A 5EFOA 3HV2A 3NH9A 4LNUA 2XUDA 4M46A 4NDZA 3SK0A 3G9TA 2J07A 2GILA 1JFSA 2OHIA 2RE8A 1YZVA 3ABSB 1ES9A 1H3NA 2YUTA 3QBVA 4Q4HA 5JNWA 3THXA 5JDCA 4ESVA 1HQYE 1JPJA 1OXVA 1DSSG 1VSBA 2P65A 1JHQA 2YJGA 3LWNA 3PX3A 1QUFA 4FJ1A 2HBRA 4GR5A 5LC1A 4JI8B 4ILEA 4ED9A 1DXHA 4PTYA 1M1YB 4TXLA 4YP1A 4LRUA 3TX6A 3SQMA 2IUYA 3OTGA 1VSTA 3ESCA 2XB4A 3VSCA 2B7BA 2IHUA 4YBRA 3ZU4A 1H1DA 4G0ZA 1MDBA 4D81A 5AUPB 3WWPA 2HA3A 1VDZA 3FCCA 4MQ4A 4LTNA 3WLRA 4XW2A 1PJ8A 1JW9B 3KZCA 5HK8A 3MLEA 1JBEA 2ZUVA 4CIWA 5CXXA 4EJ2A 3FMGA 3N1UA 5HKKD 1S02A 3FLAA 5JNUA 3L7MA 3FSRA 5LYJA 3CVJA 1FMCA 5DTRA 2MMGA 1EESA 3WDKA 5ARCA 4OFBA 1IQRA 1IRXA 2CXXA 3UV6A 5JC8A 3SVTA 1OE0A 1Q2UA 5L40A 2I8AA 2YV3A 3OWXA 2HWWA 3LXXA 2ZE8A 3RTBA 5CBPA 1ZQ9A 5K8LA 2JJ8A 4XFJA 3RUPA 5TR9A 2NSYA 3PNBA 1SVOA 1XTZA 4II7A 4PX2A 2XCOA 1H5QA 4HNQA 3MA0A 3OD5A 1I0LA 1O6FA 2H52A 3FFWA 4Q66C 4IJ5A 3S29A 4BE9A 4DLTA 5JVDF 4LXTA 1MO5A 5LKAA 2ZT7A 1J56A 1AQLA 1FUKA 2J3JA 3AERB 3T4UA 3FFTA 4EQ6A 1PT7A 1OA1A 1XZCA 1TXGA 1RQ2A 4O25A 5BNFA 2VP0A 3R7SA 5EWLA 3HJGA 3VHXB 3RVNA 2ZZMA 1GTVA 5AJUA 4LISA 4DLWA 3ZUGA 1M34B 1ZEJA 2CF5A 3PUJA 3AGPA 2CLDX 5KYUA 3ZHRA 1M2KA 4XYGA 5CA0F 3F71A 1NN1A 2O1EA 1V4NA 4WBNF 2PKEA 3RSOA 2AEJA 5KC8A 4IDCA 1X9GA 4MHTA 2W4IA 3NTOA 2YWEA 4K46A 3B36A 1DAKA 4RE5A 4YV0A 3TQIA 3VM6A 2L2QA 2ECQA 4X8LA 2OAGA 1QP8A 1E92A 4Y1FA 1YHYA 4J91A 3C74A 4CM8A 5IDVA 3ND5A 2B35A 4O6VA 2OXIA 3MINB 3G89A 2GCOB 4NONA 4OREX 4P98A 2ZSHA 3A25A 1SD1A 2PMEA 1Q1EA 5DFAA 2P2GA 1SXJB 4Q02A 1K92A 1UZNA 4ZT6A 3T7IA 1M83A 3QYJA 3TDNA 3FZQA 4MICA 5DP1A 1M2EA 4QELA 3CW9A 5B64A 3NHKA 4TYNA 3ISJA 1BBOA 1WUYA 1Z2AA 5HILA 4EY3A 1QU6A 1X42A 1Y34E 2JH9A 4IL5A 3A1NA 4OFZA 1L7AA 4X45A 5U4QA 3ECCA 1UUFA 5LNK6 4MYCA 4C01A 1IN1A 2A9OA 4JLVA 2A0UA 2ON6A 4UUPA 3HEMA 2VWPA 2ZBFA 5H83A 2WVJA 1F6DA 2AYYA 4B0OA 2BW0A 3H04A 1WHTA 2KBFA 4HQ6A 5IXSA 1JEJA 4N01A 1QHSA 2PX2A 3AP1A 1Y8QB 2GK3A 4TN5A 1ZCBA 2D13A 4A8PA 5IWAB 3LVFO 3M4ZA 5C53B 1QV7A 4G4IA 1GG5A 2C5SA 4ENRA 1VIVA 4W5TA 4FMCB 1D2HA 3H17A 3FIJA 1XJ0A 2N3ZA 2X4LA 4GPZA 2ODEA 3B8HA 3DUFB 3JQPA 3KZOA 1AG9A 3FKSD 2JGIA 4OXXA 4HVTA 4QZVA 2NUEA 2PV0A 1NASA 1Q1NA 5THKA 2QLMA 5L53A 5IAJA 4M76B 4AVYA 3C16C 3NXSA 1EX7A 1XMPA 3DV0A 2QMEA 5I4IA 2PEZA 1K06A 2TMYA 3B3QA 4ZT2A 8MHTA 2GCGA 1DZ3A 1HYHA 1XKLA 2POCA 5H5JA 4PVDA 4BNHA 4BPBA 2EGGA 2X4IA 3IE0A 2PZFA 4R2PA 3L8YA 4D4KA 5BNTA 2QG4A 2EMCA 1LBQA 1ZUWA 2FMUA 1VLMA 5EXTA 4BLPA 3B85A 5DI9A 5TS2A 4G2NA 4KIJA 4EM6A 4BQNA 3C3KA 5DW0A 1ZM9A 4UNNA 4DDMA 4O4IA 2Q28A 1TN9A 4RC9A 5MN4A 1UKYA 2VHXA 1QIDA 1WDLA 3FVRA 4YX9A 2DKFA 1PNQA 2OFFA 5C9ZA 5LDDC 1ZHHA 4I7EA 1NMXA 5HQ3B 1IHXA 3D3NA 3QWFA 4BGVA 3W2GA 4JL5A 3OQHA 2GDJA 3OA0A 2H2HA 2R8ZA 1C8BA 1N8KA 4N5LA 3BYZA 1A9PA 3WTBA 2XXAA 5F1KA 4AZVA 1WWKA 5M7EA 1DC6A 4DXHA 3UHOA 4WFIA 3N86A 3F90A 3T7TA 4LWQA 3SR3A 4MDEA 1YSAC 1P73A 3C7AA 3FSGD 3JQ6A 2JWOA 1VJ0A 2J32A 4AQYB 3TTTA 2OCAA 2A5JA 2EKDA 4WWHA 4J16A 2RG7A 4XWAA 4NMMA 3R9KA 1CQIA 5JCZA 1U9ZA 3QFCA 5TS3A 3W8EA 2IODA 5BUZA 3U4QA 1BQEA 3QMVA 2NM0A 2P69A 2VDOB 1RMTA 3KFLA 3E7FA 1P5FA 4YRGA 1TTTA 1GR1A 3DMYA 3I8OA 2ZSDA 4MKXA 3ZV4A 2F8BA 3AX6A 1XQXA 4B7XA 3EUAA 1M0TA 3BS4A 2EJTA 3FTCA 1K08A 4XOUA 4D2IA 1NG1A 3O47A 4M1EA 1ZO8A 4W5HA 4X20B 3EQ2A 3UXMA 1Z38A 2CDAA 2CSXA 1PFYA 3P5BA 5CLHA 1ONSA 1DHTA 2IVZA 2J08A 1CY2A 1FDOA 1X7YA 4ZRNA 3VR2D 2VZ8A 4ZCIA 2Y2UA 3ENKA 1GAWA 5ADVA 3C15C 4DTIA 2OR3A 2VF5X 1HT0A 1KR2A 4H35A 2QTZA 2C8KA 5FFMA 5JCJD 5LDGA 3V32A 4MK4A 4COOA 4UCFA 5E6SB 2V5VA 1XL0A 2GHRA 2R6HA 1Z22A 2Y27A 3E9YA 2QYTA 3FCSB 4NCIA 4QYIA 5CFNA 1G8JA 5KQLA 1ZJ6A 3HJNA 3PJEA 4D1YA 3KB2A 5DNEA 1V47A 5T64A 4NZ9A 2Y0CA 3B1VA 1BXGA 4MLDA 5FBKA 4C20A 1W88A 3LP8A 4TLBA 2VYND 2ZAMA 4QQFA 1U0LA 5I7FA 3IL2A 3HR7A 3VV2A 2LTSA 3MCVA 3EUWA 4J94A 2YRKA 1W5TA 4REQA 3M5DA 2YICA 3SR0A 1FFEA 2Q3FA 1VKRA 1SQ5A 2C54A 4S12A 1YULA 3L6OO 3PS9A 4E11A 3D8NA 3IHLA 4P93A 4RD1A 3F7MA 2WNIA 4JL6A 4ZU3A 4UFOA 2GPYA 3LVBA 5AFSA 1NG9A 1L5RA 3OCZA 5FWAA 3A6GA 1ZIOA 1N2CA 5DB4A 4PYJA 2W2XA 1OC2A 3TQHA 5B4UA 2RGGA 1IDOA 4FZRA 3OA2A 1D4FA 3GI1A 1G4AE 1ICIA 1R4AA 4X61A 4AB1A 1D6MA 2C2MA 4PV7A 3WBKA 3PXGA 3C7KA 3AFOA 3QMPA 5JSZB 4NXMB 2XCLA 3G5LA 4G1VA 3L8CA 4MVYA 5KYXA 1L7OA 1QB7A 2L69A 5TPZA 3UM9A 4OB6A 4BFYA 3DFFA 2Z0MA 1TKCA 4ZVPA 1K9SA 4EFMA 3IIJA 5ALVA 4B81A 5JRJA 2A67A 2WA1A 3Q5GA 4AW9A 1JR2A 1ABFA 2XQKA 3THOA 1CUXA 1O89A 3IIIA 4HQOA 1Y9EA 4TVKA 5E6UB 2ZJOA 3G2IA 1Z6YA 4TN1A 2JFNA 2FZEA 1GPDG 3CLSC 4EFNA 3W4IA 4RKEA 2WJ3A 4YT5A 3ZWAA 4IHJA 1U2QA 5DDIP 1G98A 1JSXA 2EFEB 2RBGA 3LT5A 4P9NA 1JDBC 1G8MA 2WZBA 1A1SA 2ZWIA 4PRLA 4GUDA 1GKIA 1NVMB 2GBLC 3BWYA 3OZVA 1YOVB 1U9YA 4CKCB 4D9MA 1LRKA 1KFEB 2R6AA 1OREA 5JSFA 5DN6D 3KYBA 1P0MA 4ETWA 1ISGA 5DX8A 2YRWA 4M6WA 5JSYA 4UM9B 1ZVQA 2IOQA 3SHFA 4DQVA 2PUHA 4F06A 1QG6A 2ZIXA 1SCBA 3IAM6 3JWIA 3QLVC 5ESWA 3ZE9A 1IXZA 4AD8A 2VQEB 2XMSA 1GVNB 3WL6A 3MBIA 1D9ZA 4E70A 4MKHA 2H5IA 1E66A 2VYVA 4GI1A 5KTTA 1R3DA 4I36A 5EJ8A 2AL7A 2GVZC 2ZP1A 3ADJA 5HCNA 2ZJ6A 3TBFA 3QVUA 1WMDA 5FLYA 2QRLA 5M34A 1OXSC 1C4XA 2R2GA 1IU9A 3EGEA 3VHTB 1X6HA 3VJLA 3T4EA 4M30A 4A82A 3GHHA 1CHNA 3JQQA 1I4LD 4YI3A 4P36A 4QUAA 3CW2A 4NK4A 4ZGBA 5J2UA 2AV6A 4B3BA 2IVFA 4FHGA 5KTNA 1YA4A 4XLLA 2LVHA 4CL2A 1JJ7A 1GG2A 4O2AA 3PB3A 1XVAA 1YQXA 4I8DA 3C6QA 1GQYA 2O48X 2Z5VA 2OWDA 5KHLB 2CF6A 2I4RA 3AI2A 3CWZA 4O4LB 3V1KA 4MYSA 1Y6QA 5ES4B 3KJZA 1CLUA 1BXRB 1T1GA 1E1YA 3DOFA 3LECA 5AOAA 4MRVA 3VOTA 5EQJB 4CF5A 2H3EA 2FEOA 5CDYA 3TK1A 1WXRA 1SZPA 3MJSA 4V0ME 4YUAA 2P4QA 1UODA 5JIBA 1IOLA 4HATA 4Z4FA 1AV6A 4KPEC 2CDBA 1Q50A 2Z1DA 2VJMB 4YREA 4ZDKA 1NUHA 4OMCA 3PT5A 3PLRA 4OHWA 5AOVA 1VGRA 4BXOA 1T0HB 2W2TA 2OMEA 3K9BA 4R2MA 8OHMA 4GECA 1J5PA 1RHRA 1P6QA 2LD4A 4CPDA 1WCXA 5JC1A 4J2TA 1UPBA 3MWKA 2FW0A 2IEGA 2HHCA 4N54A 4E51A 1PJ2A 3V1NA 3FD8A 2BGTA 3B9RA 3A31A 1V2GA 4QPZA 4FOTA 4P3XA 1KYQA 4UW9A 3ZGYA 1NRIA 3AUXA 4E5VA 1GEEA 1CDEA 5I7WA 3R0IA 1FP7A 1XZHA 1WRJA 4MW1A 1EE2A 4EMTA 4EKGA 2P4UA 4QX6A 2V7QA 5AM2A 4U1RA 4WUVA 5AVQA 1J5XA 4IXTA 3LM8A 4PPGA 3LAWA 3OEEA 4KRFA 5ELLA 3ADOA 1YJXA 3RSLA 2WVHA 2XYQA 2K2WA 4MW9A 2L82A 4R98A 4IFIA 2FPOA 4UASA 1MC8A 3EPHA 2A9KA 4LBWA 3FF1A 2JPDA 3UA3A 1TCBA 1V5GA 1VFPA 4OUKX 1ZI6A 1I1QB 3DZKA 4YV1A 4ZPJA 5A5EA 2FOLA 1JIKA 1NXOA 2A86A 3HUTA 1KQOA 2YHUA 3UOGA 1TJNA 5BR8B 2IX3A 3OSZA 2Z6QA 4LZPA 3H16A 1NHGA 2I3DA 1AO3A 1RZUA 4KN8A 3ZWOA 1R6DA 1FX0B 1WCYA 2F43B 3DOCA 2WUFA 4RJ2A 4A0HA 1AK9A 4B6RA 2DU8A 4RTSA 2WDZA 2JVJA 3TFWA 1M2GA 1NUSA 3GGJA 5HE9A 4EATA 1NR1A 3KTFA 1NTOA 1GGVA 2I03A 3LPMA 2VDWA 4MPJA 1HO3A 3UGQA 5C5DA 2ONJA 5DYNA 3ORRA 2OD2A 1PVDA 3MSXA 2ZIXB 4JI5E 5IK2D 5L3VA 1BW9B 1KNQA 3MTGA 4TKZA 1JSLA 4EA8A 2R1VA 3GJTA 1R10A 5G1NA 5LJIA 3WB2A 1ICEA 2C5LA 5J47A 3L4BA 3WGMA 3RRMA 3K70D 3UTCA 4DLAA 5GGYA 1KHTA 1DAEA 2LKDA 1N7JA 2XQGA 4GZ3A 3QE9Y 1DC7A 1EX9A 2JLRA 2VA8A 4N12A 4I4CA 4D3YA 4IHJB 3R5FA 1KJWA 4I4TF 3GPLA 3EMBA 1XEFA 1N7GA 2QZ4A 3FMIA 4A9AA 2DLDA 1AMNA 3V7YA 4OQDA 1ZXXA 3U61B 4ZT3A 1A2OA 3KQOA 5JQGA 1QIFA 4EEZA 4LZLA 3OESA 4NQRA 1ZN9A 4UARA 2QLTA 2I7CA 4U7FA 4ZVTA 2VBGA 4U4AA 2EJWA 2QW8A 2X8JA 1AQNA 2FUG1 1KH2A 2YTEA 1KPHA 5AXCA 3RWMB 4ZANA 3RREA 3HKDA 5KL2A 3ZN2A 2XD9A 5C7IO 3NORA 2ZYTX 5DO9A 3ER9A 4PZDA 4LVCA 1XRQA 3RJMA 5KVVA 2XDQA 5LN1A 1JDZA 1I1NA 4IWXA 3OPQA 3M49A 1ILEA 4B17A 1ZINA 1YMQA 4IVPA 4MUKA 3UBTA 5T6BA 3LXRA 1GYRA 1UJCA 3HABA 4GKKB 3DO5A 2G4VA 2QG9A 1YZTA 3QV1A 4EW6A 5DZSA 1N9KA 2P1ZA 4LGYA 4AJ1A 4Z7JA 4Q9DA 2G6BA 3H4VA 4XM1A 3TTSA 2H4XA 3TD2A 1D6JA 1JB1A 2P68A 4X94A 2IH5A 5DOVA 4PNPA 2ORWA 2L2NA 4EUEA 2UZIR 4CG0A 2N3HA 1NBAA 4P31A 2FSVA 2B9VA 3QU9A 1ZESA 2IOHA 1UMCB 3JW8A 1UN6B 1P6XA 2FPUA 2NXNA 2AEEA 2PJUA 2YYSA 2H57A 1DTWA 2Z43A 1OA0A 1U3CA 3EG9A 4WXMA 1E59A 2XKKA 4AMVA 2NZVG 3WK6A 2EN3A 5BR4A 5GM1A 4K6GA 1WB5A 1MRZA 2Q5LA 3L6EA 4JC5A 1HURA 3V1LA 1X1EA 5E8RA 1XNHA 2R1ZA 5KOHA 3TGWA 5ILGA 1G38A 5DNAA 4ZJYA 3PNVA 4C5AA 3VMFA 5BSVA 3ZV6A 1OC4A 2PS3A 2Q2NA 4FLMA 4UULA 2OBBA 3C1AA 3KB8A 2VXYA 3U80A 2DPHA 3KWJA 5E3JA 3PP8A 2AZ4A 4R8RA 3ZHYA 4QYWA 4FFWA 4GKAA 1QONA 4RZIA 1IEVA 2R44A 1LQTA 3Q2OA 5KTRA 1PX0A 1U90A 5DK4A 1GARA 4BBYA 4PLFA 1HR0B 3R6DA 4EP1A 2GM4A 3I34X 4TT3A 4GMFA 3LTEA 4HT3B 3ADIA 2NV6A 1QBKC 3AVQA 3BBLA 4KQGA 3VA7A 4KMRA 4N7MA 3G13A 3F2IA 4RV4A 1QYDA 3D4BA 4KO3S 2OC4A 2ZTSA 4Z53A 1T0IA 1XRSB 3WRWA 1OXMA 4G9BA 1RM0A 3WI7A 1E6CA 1U0BB 3IQEA 1QFYA 3MWFA 1YFZA 1EHYA 2Y3IA 2LBSB 3KEFA 4WDRA 3CUUA 1DIGA 2QKYA 4B6GA 4KITB 3Q6IA 4MV3A 3GVCA 1LC3A 2WAMA 4GOKA 1FTQA 4TV8F 3I92A 5AKZA 5BRAA 2GAAA 2P5UA 1ZGGA 5EZYF 4XX1A 1ZQ1A 5FYQA 5EMKA 3LKZA 3C3BA 1R8JA 2C42A 3CT6A 3WL8A 2G1JA 4NAUA 2YXEA 1JJAA 3Q2KA 4GWKA 2R4QA 4L5YA 1MXHA 3BH6A 4G1BA 3GEIA 4CM4A 3FYTA 2ZAYA 1ULHA 4JODA 1F9AA 1ECPA 2C29D 5AXAA 3HWSA 4EYGA 4Z7NB 2R86A 4IUCS 1IC6A 2Z2JA 3GN1A 2BZ0A 1GLVA 1X7WB 3FN4A 4GBGA 4BZPA 1EWKA 4C03A 1L0BA 5B3JC 3IOMA 3QKRB 1KRHA 1NMEA 1CF9A 2GA9A 1YHZA 1YZQA 2E7ZA 3BXFA 2LJHA 2VRNA 1PLJA 5FUWA 1TYZA 2XHZA 4JSTA 2C3UA 4LJ6A 4RYLA 2ZDGA 2IEIA 4Z4IA 2CYCA 2XNKA 1QIGA 2QR5A 1SA0B 6Q21A 2CV1A 4OK5A 2F1IA 4Q37A 1JTEA 4B75A 2CMHA 4RU1A 4DF3A 1IQSA 1NX6A 4BRSA 1L1EA 4XSHA 1JZQA 5B2ZA 1EVIA 2YSOA 3DEJA 4ZO7A 3CIFA 3KOMA 5B58C 2ZYHA 2XLCA 2L6MA 1VB3A 3B3JA 4I1RA 5DNUA 1XWFA 5EZYB 1GL7A 3W2FA 1FLAA 2RBEA 2VAMA 2YDYA 2XZOA 1TQHA 4ZQGA 1UBDC 2O6LA 4D0SA 3ESDA 4G9EA 3Q87B 4NU6A 4QNMA 2C95A 3HZHA 2G9VA 4RVUA 3HBAA 1LNQA 1RJFA 1FRFS 3BGOS 2FX5A 2C0PA 4LRWA 4G41A 3RASA 1YXMA 2JB9A 1G8PA 3AR8A 1JG4A 3BM5A 4FHFA 4G67A 4OM8A 2O7VA 2RAVA 1XT6A 1Z2PX 2GFIA 4RW0A 2ODAA 5BN4B 1L5FA 1MW9X 4ZXFA