1GZ9A

High-resolution crystal structure of erythrina cristagalli lectin in complex with 2'-alpha-l-fucosyllactose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHMWDSTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDAPSKILHVVLVYPSSGAIYTIAEIVDVKQVLPDWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Crystal Structures of Erythrina Cristagalli Lectin in Complex with Lactose and 2'-Alpha-L-Fucosyllactose and Correlation with Thermodynamic Binding Data
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords ERYTHRINA CRISTA-GALLI LECTIN
total genus 53
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2002-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1gz9A00
2DVBA 1DHKB 2P2KA 1KRIA 1Y7BA 2PHUA 2WQZC 3V0BB 1SLBA 4JCKA 3QCWA 4KBBA 4GXLA 1WBFA 1UZYA 4Q8LA 1ENRA 4Y1ZA 1QOSA 2R0FA 2SLIA 1ULDA 2YY1A 5GZGA 3GNEA 1DLLA 2PHTA 1WCSA 1AJKA 2E51A 2ZGNA 1IKQA 4W65A 1DYPA 1DQ0A 1KJLA 4FPYA 1SBEA 4RA0A 3WG4A 5CNAA 5DUXA 1AF9A 2E53A 4UW4A 5CA6A 1LHUA 4PF5A 4XIOA 2D7FA 3B69A 3M3CA 5JDBA 1AZDA 2A71A 3O0VA 3ZXEA 2YXSA 5KXDA 2ZGOA 1QDCA 3H0OA 3HN1A 2GN3A 3APBA 3TAYA 5DG2A 1GYKA 1AXYA 4FOVA 2ZACA 4YLZA 4HL0A 5E8AA 4XMAA 1WW6A 4R9AA 3FUQA 1LOGA 2ZZJA 2B7YA 2XB6C 4IQPA 4YG6A 3RMXA 3ZSLA 4AGVA 5CBLA 4TZDA 2CNAA 1QF3A 1DFQA 1RINA 2ZGKA 1MS5A 4Y20B 4YGDA 1GZWB 1WLWA 3OBTA 3SNMA 3OY8A 4CZSA 1Q8VA 4YGEA 5IK8A 4GA9A 4XZPA 1MVQA 5E88A 1LOFC 2ZKNA 4YG0A 3ZXKA 4FPCA 3ZVXA 1PZ8A 1UL9A 1ZM1A 3SITA 3WV6A 4M3CF 4FOYA 4XJAA 1MS1A 4XMIA 4ZXKA 2EALA 4Y1YA 1SBFA 1JOJA 2E7QA 2VXRA 5GLUA 1JHNA 2C9AA 1CESA 2ARBA 1MS0A 3W58A 3WDUA 3ZXFA 4XJUA 4XTMA 2OUJA 4DPNA 4PQ9A 4LBOA 4BOWA 4CTEA 2I2SA 4XXPA 2A3WA 1SLCA 3N7KA 5T55A 1DQ6A 1W6OA 3QLQA 1JXNA 3NWKA 4GWNA 4H55A 4XBLA 3USUA 3OPZA 1V00A 1UPSA 3JUUA 4GKYA 3AP4A 3AP5A 3N7JA 3WUDA 2OVUA 1UAIA 5DUUA 3I8TA 2CWSA 2DV9A 1A8DA 3ILNA 4YW2A 2DVDA 3VKMA 4BLIA 4GALA 1LU1A 3M1HA 2ZGQA 5DZEA 1W6MA 3WNXA 4YW3A 2VH9A 4XXAA 3Q9OA 2XG3A 3IPVB 3SLIA 1DQ5A 4M3CA 3V0AB 3WG1A 2NP0A 3AYDA 3A0KA 1LGNA 2JJ6A 3SISA 5EXOA 1V6NA 1F9KA 1SBDA 2ZHNA 1DIWA 2C5DA 2EAKA 1WBLA 1YXWA 2ES3A 1LGCA 1G9AA 4L8QA 2E7TA 3WDYA 1JYIA 4P9YA 1IS3A 3ENRA 1IS4A 1UN1A 4FPJA 1LOEA 5GLTA 1DQ2A 1U0AA 3B3QE 2GNTA 3POYA 3D4KA 3ILRA 4YFZA 1ULCA 1MZ5A 1N3PA 4ASMB 5GLVA 2EXJA 2BQPA 3PVOA 1D0HA 3AP9A 3BIWE 1Z78A 2D6NA 4M00A 4Q26A 3O12A 4YW1A 2JD4A 5CAZA 3RG0A 1I3HA 2GNBA 4FQ4A 3N7MA 4YZ3A 2WKKA 5DXDA 5GZEA 1BJQA 4DRVA 1DQ4A 1WW5A 1WLDA 3VKFC 1G9FA 2KM2A 3UK9A 2NMOA 1RIRA 3RMYA 4C1WA 4DQAA 4LBLA 2YMZA 4I30A 3AYEA 4XJZA 2DWRA 2DUPA 3CNAA 4BM8A 1SLIA 1GZWA 1D2SA 4YGBA 3VUOA 4M3CB 2GMEA 2EF6A 2D6OX 5F9TA 1N1VA 1MZ6A 1VAVA 2ERFA 1Q8SA 2ZBJA 3C2UA 1CVNA 5T5OA 4LBMA 4BMEA 1GBGA 2A7AA 2ZGMA 1LECA 4JC1A 4Q8KA 1HLCA 1FNYA 1LHNA 2DUOA 3VKLA 3PJQA 3V0BA 5EWSA 4AGRA 1FATA 1G8WA 1WLCA 1DZQA 1O4YA 2A70A 2VW1A 1QNWA 4Q27A 3LCPA 3VKNA 1GNZA 1SCRA 3JU9A 2W68A 4LBJA 4AGGA 3WHTA 5F5QA 5H9QA 2ENRA 3IM0A 3WUCA 1XQNA 5GLZA 3LSDA 5T5JA 1LEDA 4WVVA 1V6OA 2UWAA 4WVWA 4ISRA 1KQRA 4YM0A 5HCFA 1LULA 2AH2A 1QOOA 4YGCA 5T5PA 1IKPA 1FV2A 5AVAA 4R9CA 1LHWA 5KXEA 4YM2A 5EYXA 1MVEA 1S0IA 4XJWA 3USUB 2VUAA 2A6WA 4P14A 1SLTA 3DGTA 3OGGA 4UW5A 1BQPA 1JYCA 1W6QB 4XTPA 5HCBA 2UURA 1GICA 1LENA 4XE9A 4NOTA 3WHUA 3AJZA 5GM0A 4Y22B 3ASIA 2P3JA 1CQ9A 5SV8A 1QU0A 1G86A 4AVTA 2VW0A 5T54A 1MACA 2DTYA 4Y1VA 1KDMA 4YW4A 3N7LA 4BQ1A 5IUQA 3SH3A 2VU9A 3A0NA 5T5LA 1CJPA 1RITA 2D6KA 2TEPA 4PBPA 2DU0A 4CRQA 1Z0HA 1W6OB 1S0CA 3D6EA 3N3HA 1H30A 1ENQA 1YI7A 1LODA 4DFSA 5HCAA 3WDXA 3T2TA 3U4XA 4YM3A 3BTAA 1W6PB 5KXCA 1G9CA 1EPWA 3WDWA 1SACA 1LOAA 1N1SA 1QDOA 3V0AA 1JBCA 1ULFA 2EXHA 3RS6A 1IS5A 4AYUA 1UMZA 4FPKA 3TB0A 2R16A 1Q8QA 2A6VA 2UWCA 2YROA 2DVGA 1OKQA 2FHRA 2NYYA 3POWA 3A4UA 1IOAA 1LCLA 3L2YA 3R05A 1SFYA 3AK0A 4FOWA 4XHBA 1GZCA 2ZA9A 3B01A 3FLRA 1CR7A 5EYYA 1CN1A 1UZZA 2D6PA 3AZVA 3B00A 4YZ4A 4U2AA 2CWMA 2G4IA 2V5YA 4U36A 2A75A 2RHPA 1ULGA 3BOPA 3ZXLA 1AJOA 2GNMA 4WZFA 1N3QA 1QOTA 4BPZA 2R49A 1MS3A 1Q8PA 1TEIA 3AZXA 2WNEA 3OJBA 1LOFA 3ZYPA 1AX2A 1NLSA 2WLQA 3AXEA 2WJSA 1JN2P 1LOCA 1MS4A 4XBNA 5IK4A 2ZGUA 3AP6A 2Q5TA 3O0XA 3T1LA 1CPNA 5JLVA 2ZGLA 2D3RA 4LBQA 4YM1A 1S0JA 3MEPA 2ZGRA 5DZGA 1KJRA 1LESA 2ZHLA 3OYWA 2DVFA 1G7YA 3AYCA 3PVEA 3INAA 5IK7A 5JMCA 5GZCA 4FPOB 1FAYA 5KXBA 4Y1XA 4GKXA 4DS0A 1I1EA 1BYHA 3GALA 1W6PA 2ZAAA 3MW2A 3R4UA 5LK5A 1AVBA 2AREA 1FV3A 1A3KA 4FPEA 2GDFA 4D69A 1APNA 2A3YA 4Y24A 3ZSJA 3ATGA 3SH4A 3NV4A 1KDKA 4FPHA 2AYHA 2P3KA 1DGLA 4K1YA 2AR6A 3FLPA 4UW3A 5IT6A 2A3XA 3M3EA 4MYEA 1FX5A 5E89A 1F31A 1LTEA 1B09A 2CL2A 2OW4A 2ZGTA 3I4IA 1KITA 1X50A 2NM1A 1WUVA 1VAMA 2DTWA 3AXDA 4WV8A 1PZ7A 3KM5A 4XDQA 4FQZA 4YZ1A 2CTVA 4UW6A 2NZ9A 1H9PA 1SCSA 1V6LA 1LOBA 1BZWA 1V6IA 3MW3A 1W6NB 1LU2A 1O4ZA 2UU8A 1GLHA 3DUIA 1AX1A 3O0WA 2EIGA 1R1ZA 1FNZA 1HDKA 1GANA 2A6XA 2LTNA 3V65A 5H9SA 2PHXA 2ZMNA 4Q1PA 1N3OA 2EXKA 3FLTA 3ZXJA 2GALA 2VY0A 3HMYA 3IKWA 2EXIA 4LBQD 4TYSA 4YW5A 3ZSMA 2NN8A 5JOWA 1MS9A 4K21A 4OZXA 4XOGA 2D44A 1AXKA 1QNYA 2W39A 2YZ4A 2ZGSA 3B9CA 3M3OA 5L73A 2UWBA 4Q2FA 3N36A 4FP3A 1GV9A 5JOXA 1C57A 4LBKA 4Y22A 1ULEA 4XILA 2OUHA 1IS6A 5GJ6A 3WCSA 4Z8BA 4FPGA 2HYKA 4R9BA 3D5OA 3ZPYA 2JKBA 1FYUA 1OFSA 1UKGA 3FUOA 5JOYA 4M3CE 3UL2A 5T50A 2DYCA 1Q8OA 1LJ7A 1WD4A 3VV1A 3O5SA 1C4RA 5IK5A 1JUIA 3ZSKA 5DUVA 1N1TA 1A78A 5JVVA 3MPPG 2ZHKA 1V6KA 1HKDA 4AVSA 3WCRA 2A5ZA 3FFZA 1LEMA 3RSJA 2DU1A 1PZ9A 4RL7A 4BLJA 4C1XA 2ARXA 2D6MA 2AENA 2DURA 4XJ9A 1DYKA 1W6QA 1WD3A 1N1YA 2ZMLA 2SBAA 1W6NA 3VKOA 2PELA 3SH5A 4DRRA 1AXZA 1Q56A 2DVAA 4XIKA 4ATEA 4K1ZA 1J1TA 1W0OA 2ZABA 4P9WA 5H9RA 4P9XA 1G9BA 1MS8A 1VALA 5DZFA 3WG3A 5GZDA 2JECA 1W0PA 1V6JA 2GMMA 5GZFA 2VW2A 2ZGPA 1G9DA 3IMNA 4SLIA 5BYNA 1MR5A 1HQLA 2JE7A 4XYXA 1S0FA 3M2MA 3WZ1A 3KQRA 3OYWB 3ZYRA 4FPFA 1S0BA 1ZA4A 3WG2A 2YV8A 4LBQB 4BMBA 3HR9A 2ZHMA 1VIWB 1WW4A 4YZ2A 4K20A 2CY6A 2PHRA 2P37A 1GNHA 5GLWA 3UJOA 3NV3A 2AGSA 2R1DA 4ATFA 2NMNA 2JDZA 1QMJA 1JW6A 2P34A 3AZZA 1GKBA 3LSEA 2A6YA 1URXA 3PMEA 3AX4A 2DUQA 4YFWA 2PHFA 2LALA 3POSA 2ZMKA 4FVVA 2PHWA 4R9DA 1YO8A 3WVJA 1QGLA 3V64A 4JRAA 1SLAA 1NXD1 1S1AA 4FOQA 1DQ1A 1H9WA 4LBNA 1HQWA 1N47A 1GZ9A 1BXHA 4FP2A 1CPMA 1QKQA 5T52A 4XJ8A 3WDTA 5JOZA 1DBNA 3AZYA 1F5FA 3N35A 1SLLA 4Y20A 2A6ZA 4Y26A 1S0DA 3FBYA 2V73A 3NV2A 4FPLA 2WSUA 5FREA 5CB7A 3RQ0A 1ONAA 4GWMA 1S0EA 1AX0A 1UX6A 1VLNA 2WSVA 1CIWA 2Z42A 3AFKA 3NV1A 4ISQA 4XHXA 3WOGA 1YYNA 3AYAA 4PBOA 2R1BA 1YIFA 3UJQA 4F83A 2WT0A 5H9PA 1LGBA 3OBRA 3PVNA 3IN9A 5DG1A 1BKZA 2GNDA 3RRDA 3M3QA 2W08A 1ENSA 3WDVA 2D6LX 2D3SA 2W52A 4AVVA 2D3PA 3W59A 3OY8B 2P3IA 2GMPA 3IPVA 3AJYA 3MW4A 1LHVA 2GN7A 1C1LA 1W6MB 2JE9A 3AP7A 2AUYA 3ILFA 3R4SA 4ITCA 3T1MA 2WT2A 3AZWA 4ZKTB 5FRAA 2FMDA 5DUWA 2E6VA 2R0HA 3WLUA 2CYFA 1CONA 1LHOA 4XBQA 4Q1RA 4HANA 5GALA 1V6MA 1WW7A 4PCRA 4YZ5A 2WT1A 4M01A 2H0BA 4NO4A 1OQ1A 1C1FA 4Y1UA 1S0GA 2D43A 4YG3A 1YRZA 3BODA 4AWDA 1GSLA
chains in the Genus database with same CATH superfamily
2PHLA 3I59B 4ONUA 1AYM3 2WQ4A 2FCTA 3V0BB 3HWJA 5HCHA 2XKOA 4KNCA 2WC2A 5CIRA 2R061 1WBFA 1UZYA 4Q8LA 1ENRA 5CFCC 2VMDA 2R0FA 4Y1ZA 1RUNA 4XFCA 1W3VA 1DLLA 1NQDA 1QJX2 1WCSA 2ZGNA 3WW3A 4CDQA 4E8CA 3NQHA 3N9OA 4LORA 4OFGA 1IZ3A 1ULPA 1BMV1 3VHRA 1NKGA 2JDMA 5J3UA 5A80A 3SEPA 3VZJA 1O3RA 5CA6A 1QXPA 1AYN1 1PMIA 4A42A 4QDQA 3ZFGA 1STMA 5CFDB 1RUE3 2DCKA 2HWC1 2YFZA 3JQXA 4GJYA 1QDCA 1US2A 1QQP3 3NL1A 5JIAA 4AEDB 1UY2A 3I7DA 1ZYBA 5FBZA 2ZACA 4YLZA 1R093 3ZKYA 1WW6A 4UOJA 5K0UC 4XFHA 2ZZJA 2B7YA 1DZTA 1COV2 3FHQA 4YG6A 1W8FA 5CBLA 1W9WA 3A22A 5DAVA 5A6XA 2ZGKA 1HRV3 4B1MA 4TSVA 1IG3A 1WLWA 1NE4A 1LB2A 3AKQA 3H50A 4HBNA 3CQOA 4WVZA 1SQ4A 1W9TA 5EIYB 4IW3A 4IGQA 3KV9A 2PAKA 1LOFC 4E4ZA 3Q8AA 1CD3G 1VBA3 1OA4A 3NNJA 3O7OA 4FPCA 4JGZB 4JHTA 4QX8A 4XF1A 3ZVXA 1FOD2 3SITA 2K9ZA 4W6YA 4QGLA 4QKBA 4FO9A 1MS1A 4XMIA 3WSOA 2WO3A 5C8CB 4QM9A 2VXRA 3VBRA 2QQVA 4AHXA 3O1RA 1HXS2 4XJUA 3ZXDA 1DCSA 1PNGA 4LBOA 2VZOA 2QQJA 3MIHA 4CTEA 4IEVA 3MI8A 2JB4A 2RJ2A 1IPSA 4URTA 1JXNA 2ZX3A 4GWNA 3BCWA 5CKMA 3USUA 1UPSA 4XCBA 1IPKA 5FK7A 2WN2A 1WLTA 2BDRA 3AP5A 4IE4A 5C7GA 1GP5A 4IDZA 2AEZA 3GZUC 5LY2A 4BCUA 5FP7A 2QQOA 3I8TA 4JQTA 4PI0A 1HW5A 2H6BA 4I3PA 2OYZA 1EYBA 4DXZA 4CCCA 4IGPA 2VZSA 5AC93 3IIAA 4QQOA 3UESA 5DZEA 3MV01 1AR62 2VH9A 5EV7A 4CCOA 3IPVB 3H3UA 5FUPA 4JAAA 4M3CA 5A6YA 1ST8A 2NP0A 2R073 2XJPA 4IEYA 1H6XA 1LGNA 2VMCA 1AUYA 1UNBA 5FP9A 1LGCA 5FYMA 5FXZA 3J8F2 3OTFA 2C24A 3N9NA 2B45X 4AEDA 1WZXA 3FE5A 3OCPA 2VZTA 5FO7B 1X9PA 3S5QA 5GLTA 5FY1A 2YBPA 4QT6A 3ZFEC 1E5SA 4ZONA 2Y6JA 1U0AA 3VHOA 3S0MA 4PJYA 3B3QE 4X8NA 5J7MA 1VP6A 1W9FA 4L9BA 2JXAA 5C9AC 2RS11 1PVC3 1XBFA 3ILRA 4HT1T 4LHKA 2HKXA 3U11A 5DAXA 2K46A 3TBDA 1VBD3 2WABA 4COZA 3ZFGB 3PVOA 4TN7A 4Q26A 2WNUA 1AR81 4YW1A 2JD4A 2OPWA 3HT2A 4AI8A 4B8EA 2GNBA 5JR2A 5C9AA 4G3YC 2CHHA 4YZ3A 3VZLA 1WCUA 1AR92 3N9PA 4ORFA 4DRVA 3NJXA 1UPIA 1WLDA 2WZEA 2P4EA 2KM2A 3VKFC 1RIRA 3CHXA 1ZZCA 1PO21 4RFT0 2YMZA 4XJZA 2BEOA 3CNAA 4BM8A 1PO12 4NPMA 4UI9L 4YGBA 1CAUA 2VMHA 5C4WC 3D0SA 1NA1C 2Y6FA 2D6OX 3TN91 1H6YA 3CU7A 4KWJA 5ISLA 1D4M1 4LXLA 4CDXB 4Q0PA 5TSWA 5J98B 4Z2WA 5C5TA 3RVHA 3ELNA 3RYKA 5JMOA 2IXLA 1UKRA 2JWPA 2XUEA 3VBOB 2ZGMA 2VMEA 1FATA 1UOFA 3I2FA 3GF6A 5A7SA 1O4YA 5GKAC 1F5JA 4Q4X3 3VKNA 3Q8BA 3ACLA 4AQ6A 2WYFA 2Y6LA 1K5MA 2VZ1A 3WHTA 2B8MA 5F5QA 4RR3B 1O3QA 2IWGB 2ENRA 3BTXA 4QX3A 1C5HA 3LSDA 4QWNA 1UQXA 5HCFA 5I0RA 1FMD1 1QHDA 1E5RA 2AH2A 1QOOA 4Y5TA 3THCA 3T2QA 3KMHA 4LT5A 2VAUA 4CYDA 2WO1A 1LHWA 1RUI3 1MVEA 2R041 3ITQA 4AFBA 2VUAA 1W04A 2A6WA 3DN7A 3HNMA 1BQPA 4XTPA 4WVMB 2VVFA 4XVHA 5HCBA 5IHRA 1GP4A 1GICA 2VGDA 1TQ5A 3AJZA 1PX4A 5KR7A 5GM0A 5FCCA 1JH5A 1OOPA 4K8FA 3ASIA 5SV8A 4NRMA 4AVTA 4MXWA 4QM8A 5J48A 3FN9A 3N7LA 5CISA 2VU9A 1XYNA 4IXLA 5T5LA 3RFRA 1RITA 5HPOA 4PBPA 2W2IA 3D6EA 1Z7S2 2JB8A 3HAGA 4IEUA 4OHVA 1NCRB 3CJIB 4X8PA 3RWNA 5C9AB 5HCAA 2P6HA 3T2TA 3WF1A 3BTAA 1W6PB 4B29A 5KWRA 2FQPA 5K0UA 1EPWA 4OI1A 3WDWA 1G9CA 1N1SA 1QDOA 5JSPA 2EXHA 3EMRA 4EROA 1UMZA 1Q8QA 2B4KA 2A6VA 4L92A 1Z7S3 4COWA 2NYYA 4ZHNA 1W03A 4CDUA 5FZLA 1PX3A 1YNAA 4RYDA 2JDHA 1GZCA 2LROA 2ZA9A 4P9JA 3VN4A 2X5IC 3FLRA 1PGL2 5EYYA 3HNYM 5CZKA 4P9LA 4U2AA 3W5MA 2CWMA 2PLV3 2BNNA 2OZ6A 3HBKA 4NHLA 3WF2A 2WO7A 1OD5A 1L7LA 3N9LA 1COV3 1DG6A 2VC9A 3ZXLA 5BNNB 2GNMA 4WZFA 3QH7A 1W9YA 2YC4A 4MGQA 4BPZA 2QQIA 3ZYPA 4D7YA 1OLRA 2IVIB 3AXEA 1JN2P 4XBNA 1MS4A 3MBWA 4KGGA 2VCBA 3N9MA 4DXRA 5LBBA 2FZ2A 3ZXGA 1VBC3 4N90A 2BTVC 5FZ1A 4YM1A 5LATA 4NIDA 3MEPA 5LEJA 2CGPA 2HWD2 3OUJA 3I2HA 2RR13 1KJRA 3OYWA 4CUGA 5JPNB 2QQWA 3LIHA 3KV5A 5IVBA 4NAMA 1BVVA 1NCRC 3CJIC 5IK7A 1L7RA 5KXBA 4IE5A 1UCXA 2QBXA 4GKXA 4Y1XA 3GM8A 3GALA 2WFF3 4KL1A 2QNKA 1FI2A 2ZAAA 3MW2A 4N43B 3K77A 4QPYA 1AVBA 4DIQA 2AREA 1K5MB 2G9FA 2JDUA 2IZWA 3HVDA 1VE0A 3J8F1 3LDKA 1HJFA 2WIIB 4Q4V2 1VRH3 3FHAA 4LULA 4Y24A 5FPBA 5CYYA 3WR0A 1KDKA 1V9U2 4AEKA 3BPSA 2P3KA 5M0TA 4DUXA 3FLPA 4HK8A 1WA6X 3LB9A 4IEWA 5FDBA 2G9ZA 4OQ8A 5AC92 1BLZA 1ND2A 4Q4V3 1TMF3 5A1AA 3VBFC 2Z5WA 2P1BA 4N53C 4I09A 3AXDA 3N9QA 5DN2A 1PZ7A 1K5JA 4IUGA 4UW6A 2HWB1 2Z69A 1V6LA 1BZWA 5FXVA 4CP9B 3V56A 2VOTA 2QQUA 2UU8A 1GLHA 3DUIA 1AX1A 1UY4A 3O0WA 4M4PA 5EQUA 4CUCA 1R1ZA 2LTNA 1YEWA 2FMYA 4PDWA 4H7MA 2YBSA 1N3OA 4MSVA 2EXKA 3M3IA 2V5DA 1NX9A 3MIGA 5JZGC 4AK3A 5LBEA 3IKWA 2VOWA 2Q8OA 4TYSA 5CU1A 3U10A 2NN8A 1MS9A 4OZXA 4LLOA 1AXKA 1RHI2 3C7HA 4DXSA 1L7QA 4Q2FA 3ZYFA 1ALYA 5FY7A 4FP3A 4NMIA 4Q0QA 3RZZA 4QPWA 1C57A 2VOKA 4LBKA 4A6SA 2E9QA 2Y26A 1DU3D 2ZPXA 5D2AA 4XFAA 4HFSA 3BALA 3H42B 4FPGA 2DCZA 3AVRA 2VZPA 4LOTA 4S2FA 3SCGA 5T50A 4K6BA 1JZ7A 3BU0A 3NAPC 2OZJA 3T0BA 3UYJA 5BNQA 1JUIA 4S2HA 4CEYC 2XLAA 1IGOA 3OEAA 4IE6A 1RUG1 1HKDA 1Y3TA 4QDSA 4XCAA 3MLJA 1RUJ1 4Z07A 3RSJA 1RC6A 1H2MA 5FMCA 4BLJA 4RL7A 1EV12 1OD3A 4OCTA 5FJHA 5C8WA 2PLV2 4XQWA 2D6MA 2AENA 1V70A 2DURA 3DYMA 1RMU2 1PGW1 3H7YA 4LEJA 5FZ6A 4YYOA 5KC5A 4N43C 2WO2A 2XPJA 1UZWA 1W6NA 2SBAA 3VKOA 3SH5A 1NUKA 3U75A 2ARCA 4LPLA 5A3LA 1Q56A 2DVAA 1VBE2 2Y6HA 4ATEA 4K1ZA 2ZABA 4P9WA 1EPZA 2E33A 4D94A 4P9XA 1RMU3 1AR71 1UYXA 4OZOA 1GOHA 1ND2B 3AFGA 2JECA 5GZDA 1V6JA 5GZFA 1QJX1 1PM7A 1RUD2 4BQ5A 1HQLA 2JE7A 3TNPB 4B7KA 1O8SA 4YW7A 4MUVA 4BQXA 1H8TB 3PLQA 4MG2A 1UU6A 2WWSA 3KQRA 1UZ0A 3ZOIA 1VBE1 3RGBA 4DEVA 2J1TA 4E4HA 4BMBA 3I3QA 4PDWB 3QOPA 3KT4A 5A6ZA 4XW3A 4YZ2A 1JZ2A 2PHRA 4IERA 2ET1A 5JPMB 1GNHA 2YG0A 2XL9A 1AR73 4JV4A 1RMU1 4CDWB 3UETA 5HV4A 2JG9A 1XNTA 4HKOA 5IWFA 5K4LA 5IFPA 1EV11 1J83A 1RVF2 2BJSA 4B3NA 1V9U3 3GBFA 2QVSB 4AHZA 1GKBA 4OLLA 2A6YA 1URXA 4YFWA 3AX4A 3HT1A 2PHFA 2XKPA 3DECA 3ACFA 2LALA 2XHKA 2XR4A 4HN0A 4MVTA 4P9GA 4CPBD 1JYWA 2P17A 1QQP2 1QGLA 4AZZA 1ND3B 1S1AA 2XBO2 5FZ9A 4JDMA 2AEYA 3K2OA 3UKNA 3VBHC 4ET7A 4JGZA 1RUJ3 1N47A 1GZ9A 2GC0A 5L9VA 3SXWA 1YWKA 4XJ8A 1HRI3 1DBNA 1W8WA 2VO5A 1AL21 2BYVE 5FV3A 4CCDA 3LA7A 4QD2A 3NV2A 2FDJA 4IEXA 1VBA2 1OC1A 1ONAA 1RXGA 1VLNA 2PYTA 2WSVA 4A2UA 5IATA 1QJZA 4NROA 4PIYA 2J1UA 4EN6B 2EAAA 1I5PA 3H9AA 4S2GA 1JZ8A 2R1BA 3JXSA 4F83A 5C6CA 3K48A 4A4AA 5J96B 3CJXA 4HKWA 3CF6E 1MEC3 1UMIA 3OBRA 4K9SA 5DAWA 4OHZA 3IDCB 5FPXA 3PTYA 4XUTA 1AR93 3WDVA 2D6LX 1PNFA 3I2GA 1PK6A 1NE6A 4JZRA 1GWMA 2GMPA 3IPVA 4D7TA 5AFBA 3AJYA 3LPFA 1W6MB 3B5LB 3KB5A 3R4SA 1XRUA 3G7DA 1W2OA 4CPBA 1XU2A 2Q30A 1VRH2 5DAQA 1CGPA 3KVAA 2WS92 1D0GA 3MF9A 4INDA 5EJZB 1CWPA 1RUH1 3Q8EA 3VBHB 2QJVA 1CONA 4XBQA 1KFXL 1Q3EA 3POEA 4Q4V1 5GALA 4PCRA 3ZR6A 4BQ4A 4YZ5A 1OQ1A 4BK5A 4BQYA 1C1FA 4Y1UA 1KEXA 4YG3A 3UGGA 4OULA 1RUC1 1ODMA 2VQUA 5JXJA 1DHKB 1SDDB 2P2KA 1KRIA 1VRH1 2PHUA 4Q0SA 2QDNA 1ZNPA 1SLBA 3J8F3 3OEBA 4KBBA 3MUY1 5FZIA 1BEV3 5J37A 2IXIA 4M4RA 4CEYA 3L2HA 1VBB3 4RR3C 5EZWA 5A1FA 1H0BA 1WMEA 1ULDA 4AG4A 1TME3 3GNEA 3WF3A 4DY3A 4GULA 2E51A 1MZFA 1TMF2 1JU3A 4GMP1 1DYPA 1PVC2 2RR11 2ZTNA 1KJLA 3K3NA 5FZKA 3URFA 1SG3A 3D3AA 1C8M3 2JDAA 1RYYA 3ZLIA 1SBEA 4RA0A 1EP0A 5D21A 4CCKA 5CNAA 5DUXA 1AF9A 3U4SA 2E53A 4UW4A 1Y9MA 1H4GA 4Q4Y2 4IE7A 4HPKA 3ZXEA 2YXSA 3ZYHA 3HN1A 2ZCWA 2GN3A 3APBA 3T08A 5DG2A 4CU7A 2Q1MA 4CDWC 4RS5A 4FOVA 4CVUA 2JENA 3ROUA 1WMDA 5E8AA 1K12A 4P5YA 2QQLA 2WAAA 4R9AA 3VDBA 1RXFA 4PDWC 3MZHA 4AAXA 4AGVA 4XUOA 4P00B 1OUSA 3MIEA 5FZMA 4OQ9A 4CEWA 2W9XA 2CNAA 2XBO3 1RINA 1OHFA 3OF1A 2ORZA 1XPWA 5FY9A 1Q8VA 1NZIA 5FZ7A 2PFWA 2XBO1 1OF4A 1HV0A 4GA9A 3HQUA 1MVQA 2YB7A 4XZPA 2ZKNA 1Z7S1 2ZEXA 3K3OA 4C0HA 2BGCA 1OF3A 1YJLA 3A21A 4FOYA 4XJAA 3JB8A 4Y1YA 3VDDB 4AI3A 1HJGA 1JOJA 4IV1C 4YVWC 4ZS3A 1JHNA 3VBHA 1MS0A 2ARBA 1RVF1 3KV4A 4UXAA 2CDPA 4J25A 3C7OA 5ERLA 3OBAA 4BOWA 3I49A 5LB6A 1CJDA 2BVBA 2BWCA 2XUMA 4X6RB 1H2NA 4IV3A 1SLCA 3E6BA 3N7KA 4JDNA 5FZOB 1W6OA 3NWKA 2MEV3 4H55A 1OOPB 3CKHA 2H6CA 1NLRA 4GMP3 2ZX1A 3GGLA 3AP4A 4ZZ8A 3AB0A 2JD9A 5FYCA 1FMD2 2VM9A 1HXS3 4DEQA 3NNMA 2DV9A 3O1UA 4YW2A 2DVDA 3VBFA 3AMNA 4GALA 4JTNA 4NHKA 2XGXA 3U07A 1BEV1 4K8RB 3T4HB 2ZGQA 3BI3A 1ENXA 2QQMA 4WM8C 3W21A 2GP3A 1AR72 2WAOA 3H8RA 5FY8A 2XG3A 3WQBA 1DQ5A 5C4WB 3PNAA 3AMHA 4H3WA 3LE0A 2JJ6A 1VR3A 4TTGA 2HBUA 2QZ3A 4OI2A 5FKCA 3E5UA 1LAJA 4AW7A 2ADDA 4DO0A 4KWKA 2W1UA 3C7FA 4UWDA 3WNLA 5LA0A 4L8QA 3WDYA 5LWBA 4NWWA 1JYIA 2GC1A 1D4M2 1UF2C 3PMSA 1IS3A 1UN1A 5EFUA 2X5IA 1LOEA 3HQRA 1IQAA 3OD0A 3O1TA 1H1MA 4Q0UA 1ZZ8A 1CAXB 1XSQA 5HXVA 5FP3A 3K75B 3U14A 4MGTA 2YBKA 4AFMA 4Q4W3 4MHUA 2XVLA 2VZVA 3KQ4B 2RE9A 1TE1B 1TME2 1ULCA 3VHNA 3ZMOA 2JG9C 4HMZA 1AR91 5HBAA 5GLVA 2EXJA 2BQPA 5BUVA 1JYXA 2XWBB 1O91A 2D6NA 3O12A 2HEWF 4P02B 1MEC1 3S57A 4EN8B 3E6DA 2ID4A 4HETA 4FQ4A 5A32B 5LA1A 2EIDA 2WKKA 5DXDA 5GZEA 1BJQA 4ES8A 1DQ4A 1WW5A 2DBIA 2GC3A 2VXJA 5BY5A 3UK9A 2NMOA 1DYOA 3RMYA 4C1WA 4D0QA 5A3PA 4KMQA 3BN6A 1OA3A 5KHKA 1RJ8A 5JWPA 3WNKA 3VBRC 3WXPA 2E31A 2OXBA 2VVDA 2W94A 4N43A 4PHZA 1VBD1 1AR63 2HH9A 2W47A 4M3CB 4Y3OA 4CP0A 5F9TA 3VUOA 3PL0A 5I8SA 2BUKA 1AL23 2QFEA 5CFDC 4EWDA 5K8SA 1CVNA 2ATFA 2CV6A 5FAXA 3HJRA 3KF3A 3LEGA 4HZFA 1LECA 1UY3A 3V0BA 1HLCA 1JTZX 3PJQA 5EWSA 4DY5A 1G8WA 4K40A 3WQ1A 3KWVA 4GZ9A 3VD3A 5ANNA 3DPRA 4XF9A 5FQ0B 1ND3C 3MPBA 3B94A 4P08A 1HN1A 4Q27A 3LCPA 3BYWA 4LBJA 5FZ8A 1SHWB 3UNPA 5EJ3A 5FY4A 1ODNA 1UIJA 2VPVA 1V9U1 5FXWA 5H9QA 3KD4A 2WR9A 3IM0A 3VDDC 4OYUA 3WUCA 1XQNA 1JU4A 2X29A 3LEIA 1Y4WA 2UWAA 3I59A 4ISRA 1KQRA 3VLBB 3N4MA 5F37A 2WINB 1LULA 4NE9A 3T2PA 1NCQC 2IXCA 4UBGA 2WBKA 3PTRB 4YGCA 2WNUB 1FV2A 5AVAA 4CXWA 5EYXA 5CFDA 3POJA 3AL5A 3DV8A 1S0IA 4XJWA 2JKXA 5LEKA 3HD8B 1YQ2A 3DGTA 3OGGA 3KS7A 1JYCA 2HWE2 4ARXA 1W8HA 1ZRRA 2HWD1 2UURA 3NW4A 5CG9A 4AQTA 2XH6A 1TNRA 4KU8A 2P3JA 4D8MA 3NJYA 1NCQB 1BHGA 4Y1VA 1KDMA 3LA2A 1K3IA 1R1A1 2A73B 4BQ1A 5IUQA 1BEV2 1RUOA 4QU2A 1FOD1 4TWTA 2D6KA 2TEPA 5A3NA 4D6QA 1RJ7A 2Z2SB 1Z0HA 3ZN6B 1W3XA 2Q1FA 3U4XA 3GBGA 4D7SA 1DGWX 3ORJA 4FTSA 3RNSA 4QXHA 1JBCA 1ULFA 1IS5A 2W3JA 4XAAA 4A3ZA 1KD7A 4FPKA 4JDOA 3TB0A 1F2NA 2R16A 1XNCA 2TBVA 5L36A 1XE8A 3MDPA 1HB3A 1QJU2 2DVGA 2FHRA 3THPA 3HN3A 4LUKA 3A4UA 4A7YA 5KHIA 1LCLA 1UYZA 4Y4RA 3AK0A 4XHBA 1NLQA 3B01A 4O9GA 3UT0A 2JX9A 1CN1A 3A23A 5BNNC 2HWC2 2V5YA 2G4IA 4QHOA 2J1EA 2XXZA 4U36A 1QJY2 2FCUA 2A75A 2W1SA 4QMAA 4LIVA 4QX1A 2RS31 3CL1A 4C8DA 3J7HA 3RWKX 1AJOA 2WYSA 1HN0A 1HRI2 1QOTA 3ZSEA 4L11A 2R49A 5FY0A 1Q8PA 1TEIA 3OJBA 5FQ0A 3PUIA 1POQA 1RUE1 2HWC3 4QX2A 4N9IA 1LOCA 4CXXA 3LIGA 2ZGUA 3AP6A 1CPNA 1YFXA 3J26N 5JLVA 2OQ6A 2D3RA 2ZX0A 1S2BA 5FPZA 1BVP1 1S0JA 1ZREA 4QQHA 2Y33A 4CCLA 3GZTB 1NT0A 4NHMA 3PVEA 1Y9QA 1JHJA 4OHWA 4AEDC 5JMCA 3LOIA 3B93A 4GMP0 1BYHA 3B7MA 2WZ8A 1W6PA 2F4LA 3R4UA 5EP9A 2HWB3 1CAWB 3BIEA 4S2DA 1APNA 3DXUA 4XDOA 3ZSJA 1AYM1 3S30A 3K4DA 4XF3A 1T2XA 1TMF1 3J4UH 4E2GA 2N7GA 4H2AA 3SCHA 1DGLA 1XYOA 2VQAA 3FBMA 4K1YA 4J1WA 5L7OA 1VBC2 2A3XA 3M3EA 4MYEA 2PN5A 3IWZA 1LTEA 1GU3A 4HXCA 4OMDA 2ZGTA 4BISA 1T6BX 1KITA 1X50A 1VB4A 2QUOA 1U5IA 4NUBA 3I3MA 4WM7C 3TWIA 3WQ7A 3WY6A 1YHFA 3K51A 2CTVA 3UGFA 2RS33 1W2TA 2B9UA 1ZZ9A 2J1AA 3MW3A 3POFA 5DPNA 1SPPB 1FNZA 1GANA 1UOBA 1PIV3 2R32A 3DKWA 4AEMA 3F95A 1GOFA 1UZVA 3FFQA 1CAUB 1RUH2 2BP6A 3ZXJA 5FR3A 3PUAA 3VBUB 2VY0A 1RUF3 4LBQD 5CFCB 3ZN6A 5F3GA 4XETA 4AQSA 2X10A 4NPRA 3E5XA 1OOPC 3M3OA 5JR7B 4OUEA 1PIV2 3H1MA 4JHZA 4DZGA 4Y22A 1ULEA 4CDXC 4XILA 1C8M2 1IS6A 2OUHA 4FFIA 5GJ6A 4LHNA 4FXGB 5HXMA 1VB2A 5A3UA 4FAHA 4B1LA 4R9BA 5FJKA 3ZPYA 4IE0A 1EAH2 1FOD3 1UY1A 3R4DB 4HN1A 4IV1B 4YVWB 5JOYA 3AC0A 1QH6A 1R1A3 4M3CE 3UL2A 4MGSA 3VV1A 3O1VA 1LJ7A 3JD72 3R0RA 5IK5A 5F3EA 4DB5A 3OBZA 2NLRA 1NG0A 4CSWA 2ZHKA 5F7UA 1OSGA 4AVSA 1UWWA 2QKDA 4A3XA 1MQTB 5JXHA 1EAH3 3FFZA 1WKYA 3NMBA 4PT6A 4LK7A 2DU1A 1ND2C 5L19A 4C1XA 3OGVA 3PJYA 4TXWA 5LBFA 5K7PA 1UD1A 3UV9A 4XAEA 1DYKA 4WVMA 4A44A 1N1YA 2JG8C 3RZMA 2PAMA 2ZMLA 2BNMA 4QPIA 2PELA 4N8MA 4LO5B 4W4ZA 1AXZA 3SHRA 2V4VA 4UYBA 4MXWB 1KGYA 4ARYA 1MS8A 4CCNA 1G9BA 1W2UA 1X82A 4YRDA 1W0PA 1LNSA 5JI7A 4BIFA 3WF4A 2VTXA 4ZU5A 4RQPA 2BOJA 2VW2A 4E4DX 2ZGPA 1NCRA 3CJIA 1MQTC 1G9DA 4R52A 4EWEA 5BYNA 1AYM2 1PK6C 2Y60A 3NNGA 1DGWA 5FP4A 2ZXQA 2LM3A 1PMHX 2OX0A 3UKTA 1NQJA 1VBB2 1W8TA 1QY4A 4CU8A 3NRUA 1ZA4A 2YV8A 4KH9A 3CEWA 3HR9A 2Z79A 2ZHMA 1VIWB 4KBZA 4YWAA 3NJVA 4IGOA 1JZ6A 4RGAA 5L7OB 4BQ2A 1YQCA 4CDUB 2P37A 2GAUA 1XOYA 2GH8A 1JYTA 2R1DA 3BTZA 4QPGB 3BUCA 1JW6A 2P34A 3AZZA 4CEWB 4I0AA 2VD7A 5FZAA 5A3OA 3VZMA 3P3NA 5A1LA 1RUD1 1XNAA 3MFAA 5C3RA 3ZFEA 1W06A 3POSA 2ZMKA 4Q4X1 4R9DA 1O8PA 3NNFA 3WVJA 1QJU3 3VBUC 2A1XA 1SLAA 2ZZQA 2VCMA 4O61A 4LBNA 5FWJA 3IDAA 3LA3A 4EWAA 1QJY1 1BXHA 4OMCA 1QKQA 3DF0A 3OGJA 5T52A 3U1XA 2J42A 4K7JA 3VDDA 1QIQA 2KXLA 5JOZA 3RZHA 1BBT1 4Q4W1 1D4M3 3AZYA 3N35A 2XJSA 3HNBM 5FLHA 4Y20A 2A6ZA 3CIHA 5IW0A 4BH9A 3ZYJB 2V73A 3X29B 1JS9A 5FYUA 2WSUA 2Q8DA 3VBRB 4W6XA 5FREA 3RQ0A 5FZOA 1QJU1 1AX0A 1OFNA 1UX6A 3LEKA 1BBT2 2J7MA 2Z42A 3SKVA 3ZYBA 3WOGA 3JB4C 4N53B 3USSA 3TEWA 5K9YA 1OH3A 1NXMA 1RUD3 2HJIA 1L3JA 3UJQA 1DF0A 1JI6A 1ULOA 3PVNA 3DPRC 1XU1A 2ADEA 2GC2A 2OPKA 5DG1A 4AHWA 2VQTA 1Q5OA 2R7EB 4ASKA 1REDA 2XOMA 4META 2D3SA 3GCWA 4LO7A 2D3PA 2MEV2 3KHBA 4GH4A 4QKDA 4XABA 4IESA 1X7NA 2BPA2 1LHVA 1XE7A 1F8VA 2RDSA 3AP7A 2VNVA 3WP5A 4KI5M 3CBNA 3ILFA 4NVPA 2PA7A 4R4XA 4ZKTB 2EIBA 2MNGA 1VMHA 1UXXX 5FRAA 3ZXKA 3ZIWA 3GDBA 4CP9A 1PGW2 1YCIA 3DYOA 1W8OA 3H1WA 5FYHA 4CCMA 4HANA 3MFCA 5I8TA 5FXXA 1V6MA 5F5AA 2WT1A 4LQRA 1JZ5A 4NO4A 2IUWA 2LW8A 4XC9A 5JUVA 4RQPB 2ZX4A 1TG7A 2RDRA 3AKRA 2CU5A 1REFA 1RVF3 2DVBA 5HV0A 5IVEA 2RV9A 5L7OC 4JCKA 3QCWA 2J22A 3HIFA 5FZ0A 1A34A 4O65A 4E2SA 5AC91 1SEFA 1W99A 2R072 3RYPA 5F2SA 5I93A 4FTBA 5BPXA 2ARAA 2YY1A 5G04L 1W9SA 1H8VA 2XQXA 4CDQC 1AJKA 2OIIA 1XXNA 3RZJA 2LUWA 4QB1A 1DQ0A 4C91A 5BNOA 4FPYA 3MF6A 5LZ6A 4COUA 2CGNA 2XDVA 1XB9A 2O8OA 4UAPA 3WG4A 4EV0A 4FBFA 3AMPA 2WZR3 2ZS6B 5FMOS 3VBOA 5FPUA 5LW9A 2XHNA 1UY0A 1VBD2 4NWVA 3RJRA 1LHUA 4XIOA 2D7FA 2J1VA 3B69A 3M3CA 4W50A 4BJ0A 1AZDA 5KHJA 3O0VA 3AVSA 3CLPA 1DDLA 3S5AA 3JD71 3TAYA 2B5HA 3VBSB 5I91A 4NAOA 3ETQA 3VD4A 2VMIA 4ASLA 5FLJA 3IMMA 2F6BA 4R4ZA 1LOGA 4F7ZA 4IQPA 3J7LA 4M0NA 5E16A 4TZDA 1C8M1 1DFQA 3DPRB 4Y20B 1MS5A 1C3HA 3OBTA 3SNMA 2FDFA 2BBVA 1PIV1 2VNGA 4GH4B 4YGEA 3SMHA 5AVPA 1TME1 4NHXA 5ANQA 5FZEA 2VBBA 2EIEA 4EZ4A 2VCCA 2QTWB 3MLLA 4Y33A 3VHPA 4YG0A 3H3LA 1HX6A 4I0WB 1R091 3KLSA 4NRQA 1NA1B 3PUHA 3WV6A 3FL7A 3CMGA 2RVAA 3PU8A 1SBFA 1ASJ2 3P6BA 2E7QA 2VCAA 3ZXFA 3UKVA 1CZSA 4LO8A 1RUC3 4A41A 1B35A 1OUXA 1JYNA 4DPNA 1ZA7A 3AMMA 2I2SA 2XJTA 4XXPA 3KHCA 2BZDA 5T55A 5KBFA 1OLME 5DABA 1R082 2FDHA 4SBVA 1OPOA 5A3MA 3NKTA 3C7EA 2CAUA 1V00A 2EVXA 4MV2A 1RUH3 3JUUA 4QU1A 4GKYA 4CUAA 3VL9A 3U37A 5BNPC 5FZ4A 3WUDA 2QDRA 4LKDA 2OVUA 1UAIA 1SMVA 5ABJA 4LJHA 2D93A 3ILNA 4PQQA 3VKMA 4BA6A 4BLIA 2O1QA 3HPNA 5FMOL 2R063 1LRHA 2HWE3 1ZRDA 1PHMA 2QQNA 1OXCA 2YGMA 4I3GA 4XQDA 4YW3A 5JSRA 2GZWA 4JKMA 3ZDVA 1Y9GA 2DFCA 3BB6A 5FPAA 3WG1A 3WNPA 3O1SA 2Y38A 5A7QA 3SISA 4FI9A 1RUI2 1SFNA 3FWEA 5EXOA 3ZFFC 4GH4C 4XUNA 1POV0 1V6NA 3JCIA 1F9KA 1SBDA 5E1RA 2R042 2DBNA 2W46A 3WT3A 4QX7A 1WBLA 1YXWA 4DMIA 1NOVA 2W1QA 1D2QA 4BWOA 1G9AA 1PGL1 2VOXA 1AL0G 3FZ3A 1QEXA 3KT7A 4P9YA 3ZO0B 4OUMA 4FPJA 1YI9A 4PLMA 3RZLA 3RYRA 4AFDA 5A6QA 5BNOB 4P5HA 1RUE2 2GNTA 5FFOC 3VBSC 3POYA 1HRI1 1HB4A 2G9GA 1DP0A 1MZ5A 2B9VA 1LKNA 3D8CA 2PTMA 5ABJC 4WM7A 2WLPA 1D0HA 1Z78A 5DMYA 2RMU2 2BGOA 2VECA 5CAZA 3RG0A 1J1LA 1I3HA 3VBSA 1KFUL 3DCQA 2WNVB 4Z92B 1NA1A 3ZN5A 2JE8A 1QXRA 4XFFA 3THTA 1G9FA 2VG9A 2VNRA 2X53S 4DQAA 4LBLA 3T3YA 2XVGA 3AYEA 3LEMA 4I30A 2DWRA 1EV13 2VJXA 1GZTA 2Y0OA 4N7IA 4ZU7A 4L2NA 2GMEA 2EF6A 5C4WA 1MZ6A 2ERFA 5T3NA 1IG0A 1T6GC 1Q8SA 2RDQA 1W2AX 4BDVB 5T5OA 4V2VA 4LBMA 4BMEA 3DYPA 2HWD3 1GQGA 1GBGA 1VBE3 4M0HA 1U5XA 4UFKA 2A7AA 5L9BA 1R1A2 3OUIA 1FNYA 2C1FA 1X33A 2FBEA 3ACGA 3AL6A 4FXKB 4KU7A 4WBBA 4AGRA 1XNKA 2HLEA 4YVSB 3CZJA 2I74A 1WLCA 1DZQA 1QJX3 2UYBA 2C6SA 2VMGA 1QNWA 2VW1A 3HBZA 3JU9A 2W68A 4AGGA 4JKKA 2PQQA 3D82A 5B2GB 1YQ8A 3MICA 1FXZA 2RG4A 1BCXA 4WVVA 2WFF2 4AEJA 4WVWA 5C3SA 1OQEA 3LKJA 2O0OA 4KWLA 2KA3A 1X8EA 1ZBA1 4JGZC 2CDOA 5C8CC 3WNNA 4XF0A 5T5PA 1ASJ1 1IKPA 2D40A 5B4XA 5KXEA 2BBAA 1HQNA 4YM2A 1PO11 1UOJA 2PQSA 2R30A 1ZX5A 1YIPA 3LAGA 3USUB 3QACA 4UW5A 2VNOA 4RN5A 1W6QB 2BVVA 2LRPA 1LENA 3VGIA 4WM8A 1RUG3 3WHUA 1K42A 4Y22B 3TOJA 5CG8A 3EYPA 1ZBA2 1OVSA 3NAPB 4IEQA 1ZZ7A 4QHZA 5T54A 1AR61 1MACA 1PVXA 3H1YA 4E2QA 2W1WA 4Y5Z0 3PU3A 3SH3A 3P5BA 1W90A 2QQKA 2EA7A 2DU0A 1S0CA 3N3HA 1I9RA 4HPKB 1H30A 1YI7A 5FIXA 1WA4A 3WDXA 4YM3A 1HB1A 1SACA 1YQ6A 5LA9A 3KCCA 5IYYA 2IVJA 3V0AA 4PIXA 3RS6A 1W8ZA 3GCXA 1AHSA 4J1XA 1O3SA 1ACCA 3JBG3 2UWCA 3HOBA 2FDKA 4AFCA 2DCJA 3POWA 1RHI3 4QB2A 4XF4A 3R05A 2YYOA 2Q8EA 5FZHA 3MIFA 2DCTA 5F3CA 1CR7A 4B4QA 2JDYA 1UZZA 2D6PA 1MEC2 5ACA3 1AL22 4Q0VA 2JG8A 2ZJCA 1UX7A 2YC0A 4LIUA 4LA2A 2RHPA 4NHYA 1MPXA 2G1MA 1X36A 3AZXA 4AI1A 1LOFA 1AX2A 1GP6A 2CAVA 2XMLA 3GYDA 4I0BA 3E6CC 2WJSA 2ZEYA 2RMU1 5IK4A 3O0XA 4LUMA 3TYJA 1YC61 3T1LA 4EJRA 2ZGLA 4MGKE 3LZZA 2K0GA 2BV4A 4PI2A 2D98A 4XQ4A 5DZGA 2ZHLA 2WFPA 1G7YA 2C26A 3INAA 3ACHA 3AKPA 4FPOB 1FAYA 5FYVA 3WX5A 5GZCA 5J09A 4DS0A 1GOGA 1AYN2 1QXJA 1I1EA 5DQ0A 4ZU4A 4OHYA 5FPLA 3W20A 1HXS1 5LK5A 1KXGA 3JZVA 1HV1A 4FPEA 1A3KA 4XEZA 4GIQA 1OURA 2A3YA 5FPVA 4B4PA 3SH4A 3NV4A 1EY2A 2MEV1 4JGYB 4QXCA 2JEMA 4FPHA 4LK6A 3WINE 4A6OA 4YVSC 3LFIA 2VZ3A 4HOOA 4UW3A 3SCFA 3C7GA 1FX5A 1RGSA 5E89A 1B09A 1CZTA 1I5ZA 2OW4A 3E5QA 1YFUA 2XJUA 3PUQA 1WUVA 1VAMA 4RR3A 4RFRB 5C3OA 3I2OA 4RGKA 3KM5A 4XDQA 4FQZA 4E8DA 4YZ1A 3LPGA 5JZGA 1GQHA 1W8NA 2GH2A 1COV1 3OD4A 2NZ9A 4JKLA 4WM8B 1H9PA 1SCSA 1LOBA 3KT1A 1V6IA 1VPHA 2OQ7A 2BOIA 3I3BA 3OSDA 2AC1A 1O4ZA 2PLV1 3J7MA 3MGUA 3NAPA 4O7XA 3VDAA 2A6XA 3M70A 3V65A 1H2KA 2XQRA 1ZRCA 5H9SA 2PHXA 1RUJ2 2ZMNA 1W0NA 3T30A 1ZZBA 3VB9A 2VMFA 2GALA 5D8AB 2V4AA 2EXIA 3MYXA 3ALQA 1OI6A 1YLLA 4K21A 4XOGA 4Q8KA 5FO9B 5JOWA 1QNYA 4LHSA 3MHZA 3B9IA 2BNOA 2VBDA 2X8KA 1I6XA 3KVBA 2VZUA 4AQ2A 1LR5A 3H8XA 4W8JA 1XYPA 1EUTA 3J9SA 3VZOA 1JYVA 2DCYA 3D5OA 3DXTA 2JKBA 1OFSA 3FUOA 1UKGA 3IAPA 4QPIC 5A33A 1Y43B 2IFWA 2R062 2F17A 4CCEA 2FZ1A 1W28A 4UT5A 2RM21 4GB33 2VTXJ 1OQDA 2DYCA 4FT8A 1WD4A 1C4RA 5JIUA 1QWRA 5FK8A 5DUVA 5DDJ1 2IXHA 1H4HA 2WWUA 3MIDA 3MPPG 4Q4Y1 5JVVA 2HEYF 1V6KA 4AVAA 2A5ZA 1PMJX 4LO4B 3EQEA 3C3VA 3LGRA 5FOJB 3EBRA 1ZBE1 4E4SA 1LEMA 1VBB1 4J6GA 4LE4A 2R043 2ARXA 3WF0A 3ZM8A 3THDA 4QDRA 2E7AA 2XJVA 1WCDJ 4DOUA 5K0UB 1FMD3 1WD3A 2DFBA 3AKTA 2WQ8A 2E32A 2WUHA 5F1RA 3KCXA 4D6RA 4NRPA 1O6UA 3MIBA 1J1TA 1W0OA 2WN3A 3EXUA 4OHXA 5H9RA 1VMFA 5F3IA 5DZFA 1OH4A 3KGLA 2WS93 2PXJA 3D0JA 2XJQA 1R64A 2Y6KA 4CU9A 5IVJA 4HSLA 5LBCA 4FFGA 2D5HA 1RTVA 3MUZ1 4OUSA 4XYXA 5E6HA 3WZ1A 1E57A 5C8CA 2JIGA 3OYWB 5I0UA 3WW2A 1W2NA 3U0ZA 2IXJA 4FPFA 1S0BA 5LCWL 3T0DA 3B02A 3ZN4A 1HIXA 3WG2A 4LBQB 3ZFFB 4BB3A 4AHYA 4ZZ5A 1J3QA 1OT5A 4K20A 4UFHA 5C71A 2CY6A 1FPN1 2W91A 3VD7A 4BIOA 2WS91 2OT7A 4CP1A 3KZ4C 5GLWA 4QKNA 2DF7A 3RI8A 3NV3A 4BE3A 4ATFA 2NMNA 4DXTA 4EZHA 3LSEA 1UW8A 3KGZA 4CUBA 4QQPA 5CEHA 4E27A 2P5BA 3ACIA 5A70A 4GQ7A 5CKQA 4FVVA 4PIZA 2PHWA 1YO8A 3JBG2 5IAXA 2KD7A 5DDJ2 2UY8A 2VE1A 3MLKA 5FZBA 3V64A 5IAVA 4MZUA 1J59A 4Z1VA 1NXD1 5I0DA 1AR83 3PVBB 4JQRA 1K45A 1DQ1A 1ZBE3 4H14A 5D8AC 3TEYA 2YPJA 5D8AA 3Q8FA 1CPMA 4ZS2A 3WDTA 1CX4A 1OKOA 1W05A 5DDJ3 5LASA 3W9AA 1QH7A 3FBYA 1O3TA 4MLOA 2RDNA 5CB7A 3VBFB 4GWMA 5J36A 4IEPA 1W8UA 1UU4A 2YUEA 3AFKA 5FUIA 2B46X 4CXYA 4JX0A 4E9KA 3QH6A 4GJZA 1CAWA 3AYAA 2FD8A 1X8MA 1YIFA 2HBTA 4CDQB 2YU1A 1QJFA 2PAEA 3AM2A 2WT0A 5ACA2 3VDCA 1B35C 3SC7X 1BKZA 4ZPIA 3DEMA 4RD7A 1RL3A 3M3QA 4JGYC 1CAVB 1OLQA 4A7KA 5C3PA 5EPAA 3ZFGC 4Q4W2 1CX1A 2W52A 1A6CA 3IB3A 3OY8B 3TRSB 4QPGA 2XONA 2MPFA 3E1F1 1F35A 3J7NA 2XVKA 2JE9A 4NIHA 1XE0A 4QQLA 3T1MA 5JSOA 4MX3A 3VZNA 4QAWA 3ZFEB 2FMDA 3I54A 3WW4A 2E6VA 1POV1 2R0HA 4HVRA 4Q4X2 3ZFFA 2IXKA 3P1IA 1U5ZA 2FDIA 4QXBA 3BKZA 1SPPA 1D7PM 1JOPA 3EJKA 4MGIE 3VD9A 1WW7A 2Z4FA 4M01A 4AR2A 5KHHA 3O1OA 1S0GA 2D43A 1YRZA 3IDBB 4AWDA 4I2OA 1GSLA 4C0BA 1Y7BA 3IIIA 2WQZC 5C3QA 4UBHA 3M7AA 1CAXA 2B42B 2H0VA 2X05A 1XJAA 1VMJA 4LKFA 4QXKA 3PUSA 5BNPA 3O1PA 4NR1A 4WM7B 4GXLA 4OI4A 2RS32 2I07B 4EN0A 2IC1A 4N53A 2HYXA 1QOSA 1J84A 4LITA 2SLIA 5FYTA 2Y8KA 5GZGA 1J3PA 1WGPA 4CE8A 2PHTA 1WCQA 4W65A 1IKQA 4FFFA 1ZVFA 2E26A 4Z82A 3CDZB 5IVFA 1M4WA 4KWUA 1XNDA 3H7JA 4I02A 5EJ1B 1F4AA 4AVCA 2C9KA 1W39A 5KHGA 4DUWA 1UIKA 2DDUA 1EUUA 1H1IA 1GWKA 4IETA 2CGOA 4MH0E 4PF5A 1IPJA 5FWEA 5FYIA 2V09A 5JDBA 2A71A 2RJLA 5KC6A 5KXDA 2RS52 2ZGOA 3H0OA 3P3PA 3EO6A 3GHMA 1GYKA 2ET7A 2Y34A 3POIA 1AXYA 1AYN3 4RS5C 4HL0A 1H8TA 1UMHA 4XMAA 3FUQA 4TLGA 4UFMA 4UF0B 3OPTA 2XB6C 1GWLA 4QB6A 3RMXA 5F6KA 3ABZA 3ZSLA 1AR82 1QF3A 1CAVA 4YGDA 1F4HA 4HONA 2WZPP 3H8UA 2VBPA 1TNFA 1GZWB 1UYPA 3L9JT 4Q5OA 3OY8A 4LHLA 4QX5A 1MQTA 3WP3A 4CZSA 4CDWA 5IK8A 1RHI1 3ZIXA 5F5CA 4BQ3A 3Q8CA 5EHDA 5E88A 2B39A 1OPMA 3JBG1 2Q0AA 3NO8A 1PZ8A 1UL9A 1ZM1A 3LQCA 4JRLA 1HB2A 4IV3C 4M3CF 5FMDA 4ZXKA 4BXSV 1IQDC 1SFPA 2EALA 2O8QA 5GLUA 2E63A 3W58A 2C9AA 1CESA 3WDUA 4L99A 1O59A 1VAKA 2OUJA 2VUCA 4PQ9A 4P9IA 4XTMA 1UU5A 5LY1A 4GWIA 2HWB2 4AF9A 1JUHA 2ZAHA 5FUNA 2A3WA 2Q8CA 3ZX7A 4F3JA 1DQ6A 3QLQA 2QZ2A 2GP5A 1D4VB 4XBLA 3OPZA 4KG8A 4PF1A 3N7JA 2UYAA 2WZR2 5DUUA 3O1MA 2CWSA 1F15A 2WFF1 4QGMA 2BFUS 1A8DA 4PLNA 3U78A 1LU1A 3M1HA 4CEWC 1REEA 3WNXA 1W6MA 5LK7B 1NY71 3WNOA 1ASJ3 4XXAA 4MXVA 1YFWA 4NIAA 4AOCA 2ETEA 3Q9OA 1JZ3A 3SLIA 3V0AB 3AYDA 4AI9A 1VBC1 1JOBA 3A0KA 2LS6A 5L9RA 4CDXA 3BVCA 2W87A 3ES4A 3S7IA 4GB32 4C90A 2XLGA 1ZZ6A 2X09A 2ZHNA 1DIWA 1UOGA 4A7ZA 2C5DA 2EAKA 4DNYA 5BNPB 1O7FA 2ES3A 2ORXA 4B7EA 2WL1A 2E7TA 2G19A 1BK1A 1POV3 1US3A 5FY5A 5D1IA 1ZBE2 2YC2A 1IS4A 3ENRA 4ZXEA 3SEEA 1K5MC 4BU2A 4BK4A 3QBQA 5F32A 4Y4YA 1DQ2A 1OMIA 2BW8A 3E97A 3WD5A 4ES9A 4EYUA 1XNBA 1YUDA 5J1XA 3D4KA 4BHPA 5B4NA 4YFZA 4JVAA 4UFJA 1TVGA 1N3PA 1MZEA 4V2WA 4ASMB 3ZXAC 3AP9A 3BIWE 3PHMA 4M00A 5C5UA 1PM4A 3K46A 3GZEA 3N7MA 3LDRA 4MADA 3ZR5A 3ECQA 3GJBA 1UO9A 4UF0A 3SQOA 4KGQA 5CVRA 3RJ2X 3FX3A 1GNYA 5F39A 2DUPA 2OKXA 1SLIA 1GZWA 2L9LA 1D2SA 1XSRA 3HEIA 3FMGA 3BU7A 4QKFA 3LF7A 1N1VA 1VAVA 3F2ZA 3AMQA 4HVOA 4XURA 3MO4A 2ZEWA 2ZBJA 1V0AA 3C2UA 5F5IA 2VUDA 3G6JB 3OG2A 4KG0A 5JXIA 3OOXA 4EN9B 5HI0A 2YFUA 2K2SA 4MHRA 3QD6A 4JC1A 3VKLA 1LHNA 2DUOA 2JDKA 3K4AA 4GAZA 1RUI1 1WCKA 3NKGA 4XZUG 1C8NA 4V1PA 1VJ2A 2A70A 5A7NA 4LKEA 3H8OA 3I2DA 1GNZA 1SCRA 5JZGB 3KSCA 4CP2A 3M4FA 4OVEA 4LA3A 5GLZA 5T5JA 1KS4A 1LEDA 3RZGA 1V6OA 1XC6A 2I45A 4YM0A 2PMWB 4COYA 1FPN3 4HLTA 4F8AA 2C0ZA 3ON7A 4G9SB 4IV3B 5A7OA 2IFRA 2NQYA 5BNNA 4R9CA 2HWE1 2EICA 2W5FA 3GBWA 4RQPC 4LKSA 3LD8A 2NPIA 1R081 3POBA 4P14A 1SLTA 1H2LA 4IV1A 4Y5SA 4YVWA 5FZDA 4GWJA 1WMFA 4XE9A 5APAA 2VTFA 4NOTA 4Q29A 4FSJA 4LO6B 1NAEA 4UFLA 5LRSA 4FAGA 2XJRA 1CQ9A 1YQ5A 1QU0A 1G86A 4AFAA 2WDBA 1WWYA 2VW0A 1NY72 2JICA 2DTYA 2W92A 5FYSA 4IEZA 4YW4A 3TN93 3O14A 3A0NA 5A33B 2JG9B 1R092 3T4VA 1CJPA 4CRQA 4DINB 1RUF2 3NSTA 1PO23 1W6OB 5JAXA 1ENQA 1LODA 3KCYA 4DFSA 2ZKLA 2RJKA 5KXCA 4MGZE 2WA4A 3LWCA 3TN92 3WP4A 1LOAA 2YHJA 4CU6A 4YW6A 4XDPA 4YVSA 4AYUA 3FC0A 4MGYE 2VR4A 3HQXA 1PO22 2BWAA 2WRAA 2YROA 4AI2A 1OKQA 4ZY9A 3S7EA 5A7WB 1IOAA 4LR4A 3L2YA 5IVVA 1SFYA 4FOWA 4Q4Y3 1M06G 2OS2A 3PDQA 1QJEA 4CA9A 2FDGA 3TEZA 1PVC1 2RR12 2RS13 3ES1A 3OUHA 4PLOA 3AZVA 3B00A 4YZ4A 5F2WA 5I0TA 5FTTC 4BXFA 2RM23 4GB31 3KF5A 3NNLA 3C8XA 1H1AA 4QPIB 1ULGA 5FKBA 3BOPA 4EQVA 1N3QA 1MS3A 3JD73 2RS12 2WNEA 5C70A 1NLSA 1B35B 1A8MA 3ZYGA 4YSFA 2WLQA 3A7QA 1H8TC 2HWF1 2WWJA 2X5IB 3NJZA 4TLFA 2Q5TA 1C5IA 4UFIA 2WZR1 4RHV3 2R071 2F4PA 5FOBB 5BV6A 4YARA 4LBQA 2JIJA 3LDBA 2BU9A 2ZGRA 2ZX2A 4N9HA 1LESA 2DVFA 3AYCA 5JXGA 2RS51 4AAPA 1GQPA 2MHFA 5ABJB 5JI9A 5I0SA 2VL4A 4X6QB 1BK0A 3IT8A 3WP6A 2VQ0A 3PIGA 1OA2A 3MV11 2ZOEB 1J58A 1FV3A 2RS53 3I2IA 1TZOA 2GDFA 5IVYA 4D69A 3ATGA 3I3EA 4XPVA 1JZ4A 1C28A 1S2KA 3FHIB 2AYHA 4RHV1 1GFF2 3W5NA 2JDNA 2Y64A 4EN7B 2AR6A 2Y6GA 5IT6A 1S55A 1PK6B 1F31A 2HWF3 2CL2A 4XUQA 3I4IA 1Q43A 2NM1A 4QX0A 5CFCA 2DTWA 4WV8A 1CIYA 4LE3A 2WNVA 1NYWA 2TNFA 1VBA1 3GHNA 4L97A 1W6NB 1JODA 1LU2A 3DL3A 3AKSA 3CO2A 4FFHA 3KV6A 2VUJA 2EIGA 4B4RA 1HDKA 2TUNA 5A7WA 2VVEA 4Q1PA 1HRV1 3FLTA 3T09A 2D5FA 2CSGA 3HMYA 2J1RA 3RZKA 4YW5A 3ZSMA 2GSYA 3ME2A 4AXOA 2D44A 2W39A 2YZ4A 2ZGSA 3B9CA 5L73A 4JTOA 2UWBA 2QQPA 1NCQA 2RMU3 2WNOA 3T0AA 4K3UA 3N36A 4XFIA 3OPWA 1GV9A 3POGA 4HSJA 5JOXA 1QQP1 3VBOC 2ILMA 4CEYB 5FZCA 1SDWA 3WCSA 4Z8BA 4IL7A 4QPGC 2HYKA 4R8HA 4XUPA 1FYUA 3TNQA 2AACA 4NJ4A 4CDUC 5ACA1 1Q8OA 2V72A 2YPDA 4JGYA 3O5SA 4GD4A 1NZCA 3ZSKA 5A3TA 2ZEZA 1BBT3 4XFGA 1N1TA 4L0PA 4YPJA 2YU2A 1A78A 2O14A 5FZGA 1QJY3 3WCRA 2WNVC 1HRV2 3I2JA 5FYYA 2BERA 3VL8A 5AFEA 1VRBA 5FYZA 5CADA 3CZUA 5FLIA 1R083 5F8PA 4URAA 1ND3A 1PZ9A 2YGLA 1RB8G 1BMV2 4NN0A 3BOWA 5JCTA 1JMUB 2UY9A 4QQ2A 4RS5B 4XJ9A 3EB7A 5I8YA 3R6SA 1W6QA 5FYBA 3ZMNA 1OLMA 4MO3M 3TEXA 4DRRA 5BNOC 4HKLA 3RDIA 4IEOA 4XIKA 5FP8A 2XL7A 3OB8A 1KS5A 5IVCA 1GR3A 4NPLA 3ZYIB 1S4CA 1VALA 3WG3A 2VZRA 4LOSA 5FO8B 4G4FA 4KQ7A 5SV5A 2C4XA 1DLCA 1DZRA 2GMMA 3GJAA 4LMFA 2W0XA 2QE3A 1SZBA 4RHV2 5A3WA 3IMNA 4SLIA 3PURA 5CKNA 1MR5A 4H7LA 4HVQA 3ZDSA 5FMBA 1S0FA 3DKQA 3M2MA 2BFUL 3WQ0A 3WNMA 4RSUA 3S6PA 3ZYRA 4LNVA 1PO13 4I01A 2D97A 2QCSB 4FTEA 1RUG2 1WW4A 3K4ZA 3BGAA 2Q4SA 4NIIA 2VZQA 1RUC2 1ZBA3 1YJKA 4WZCA 1G6NA 3UJOA 2FCVA 2AGSA 1IHMA 1S2EA 4AVBA 2BGPA 2JDZA 5IFTA 1QMJA 3RPQA 3LOBA 3IDEA 3PMEA 2KR2A 2DUQA 2PHDA 3EHKA 5F6LB 4OI0A 3M8LA 3UGHA 4QHBA 4BZ4A 2OA2A 3GZAA 2HWF2 4YNIA 2JDPA 1P8JA 4JRAA 3FJSA 4LTAA 4FOQA 2YDEA 3H3ZA 4MOAA 4AI0A 2WA3A 3VZKA 1H9WA 4AE2A 2WNUC 1HQWA 1EAH1 3OGRA 5IJRA 4D6SA 4FP2A 3VD5A 3I2KA 3JQWA 4LLFA 1WMXA 3I3DA 4D3WA 1F5FA 1FT9A 1SLLA 2JG8B 4Y26A 1S0DA 2HEVF 2VULA 3IZOA 4FPLA 4HG6B 1UXZA 3GXUA 4BQWA 2BRTA 5BXXA 1S0EA 2Q1ZB 4AL9A 1CIWA 4ISQA 5G05L 1FPN2 2XWJB 3NV1A 4O9EA 1YYNA 4XHXA 3T2OA 4BYYA 1E5IA 1U12A 3LFMA 5FBJA 4PBOA 3SKJE 4A45A 5LA2A 2P3YA 5FZFA 2XLFA 3NVCA 1DGRA 2P6CA 5H9PA 2W95A 5FZ3A 2RM22 1LGBA 4HK9A 4Z2AA 1CZVA 3IN9A 4DUVA 3OGSA 4FCAA 2GNDA 5A7PA 1DGRN 1UYYA 3RRDA 2W08A 1RUF1 1ENSA 1O4TA 3ZKUA 1OBNA 4AVVA 4COVA 1OVPA 1E5HA 3W59A 2P3IA 4EE2A 3MW4A 3VBUA 2GN7A 2Y0IA 1YFYA 1ZRIA 4QGNA 1C1LA 3BTYA 1U5YA 5A32A 3IBMA 2AUYA 3ETPA 4ITCA 2WT2A 3AZWA 5DAPA 3WW1A 3ZPOA 4W6WA 4XACA 5C33A 5LRRA 1J3RA 3BPZA 3RI9A 5DUWA 2GU9A 3IAQA 2J1SA 1O5UA 4N7UA 3WLUA 4NIGA 1GUIA 2CYFA 1LHOA 3PIJA 1GMMA 4Q1RA 3I97A 1X9TA 4RGGA 1ZRFA 2H0BA 2R6QA 3ST7A 1PGSA 3WEZA 3BODA 2AZ5A 4XFBA 4CCJA 2VOVA 1O5LA
chains in the Genus database with same CATH topology
2PHLA 3I59B 4ONUA 1AYM3 2WQ4A 3V0BB 3HWJA 2XKOA 4KNCA 2WC2A 5CIRA 2R061 1WBFA 1UZYA 4Q8LA 1ENRA 5CFCC 4Y1ZA 2R0FA 1RUNA 4XFCA 1DLLA 1NQDA 1QJX2 1WCSA 2ZGNA 3WW3A 4CDQA 4OFGA 1IZ3A 1BMV1 3VHRA 5J3UA 1O3RA 3VZJA 5CA6A 1QXPA 1AYN1 1PMIA 3ZFGA 5CFDB 1RUE3 2DCKA 2HWC1 3JQXA 1QDCA 1QQP3 3NL1A 5JIAA 4AEDB 3I7DA 1ZYBA 5FBZA 2ZACA 4YLZA 1R093 1WW6A 5K0UC 4XFHA 2ZZJA 2B7YA 1DZTA 1COV2 4YG6A 5CBLA 2ZGKA 1HRV3 4TSVA 1WLWA 1NE4A 1LB2A 3AKQA 3H50A 4HBNA 4WVZA 1SQ4A 2PAKA 1LOFC 4E4ZA 1CD3G 1VBA3 1OA4A 4FPCA 3O7OA 4XF1A 4JGZB 3ZVXA 3ZXKA 1FOD2 3SITA 2K9ZA 4W6YA 4QGLA 4FO9A 1MS1A 4XMIA 5C8CB 4QM9A 2VXRA 3VBRA 4AHXA 1HXS2 4XJUA 3ZXDA 1PNGA 4LBOA 3MIHA 4CTEA 4IEVA 3MI8A 4URTA 1JXNA 2ZX3A 4GWNA 3BCWA 3USUA 1UPSA 1IPKA 1WLTA 3AP5A 3GZUC 4BCUA 3I8TA 1HW5A 2H6BA 4I3PA 2OYZA 1EYBA 4DXZA 5AC93 3IIAA 4QQOA 5DZEA 1AR62 2VH9A 5EV7A 3IPVB 3H3UA 4JAAA 4M3CA 2NP0A 2R073 2XJPA 4IEYA 1LGNA 1AUYA 1LGCA 3J8F2 3OTFA 2B45X 4AEDA 3FE5A 3OCPA 5FO7B 5GLTA 4QT6A 3ZFEC 3VHOA 1U0AA 3S0MA 4PJYA 3B3QE 4X8NA 5J7MA 1VP6A 4L9BA 5C9AC 2JXAA 2RS11 1PVC3 3ILRA 4HT1T 4LHKA 2HKXA 3U11A 3TBDA 1VBD3 4COZA 3ZFGB 3PVOA 4Q26A 2WNUA 1AR81 4YW1A 2JD4A 3HT2A 4B8EA 4AI8A 2GNBA 5C9AA 4G3YC 4YZ3A 3VZLA 4DRVA 1AR92 4ORFA 1UPIA 1WLDA 3VKFC 2KM2A 1RIRA 1ZZCA 1PO21 4RFT0 2YMZA 4XJZA 2BEOA 3CNAA 4BM8A 1PO12 4YGBA 5C4WC 1CAUA 2VMHA 3D0SA 1NA1C 3TN91 2D6OX 4KWJA 3CU7A 1D4M1 4CDXB 4Q0PA 5TSWA 5J98B 4Z2WA 3ELNA 3RYKA 2IXLA 1UKRA 3VBOB 2ZGMA 1FATA 3GF6A 1O4YA 5GKAC 1F5JA 4Q4X3 3VKNA 3ACLA 4AQ6A 1K5MA 3WHTA 2B8MA 5F5QA 4RR3B 1O3QA 2IWGB 2ENRA 1C5HA 3LSDA 5HCFA 5I0RA 1FMD1 1QHDA 2AH2A 1QOOA 3KMHA 4CYDA 1LHWA 1RUI3 1MVEA 2R041 4AFBA 2VUAA 2A6WA 3DN7A 5HCBA 1BQPA 4XTPA 4WVMB 2VVFA 1GICA 2VGDA 1TQ5A 3AJZA 5GM0A 5FCCA 1JH5A 1OOPA 4K8FA 3ASIA 5SV8A 4AVTA 4MXWA 4QM8A 5J48A 3N7LA 2VU9A 1XYNA 4IXLA 5T5LA 1RITA 4PBPA 3D6EA 1Z7S2 3HAGA 4IEUA 4OHVA 5C8WA 1NCRB 3CJIB 4X8PA 3RWNA 5C9AB 5HCAA 3T2TA 5KWRA 3BTAA 1W6PB 4B29A 2FQPA 5K0UA 1EPWA 4OI1A 3WDWA 1G9CA 1N1SA 1QDOA 5JSPA 2EXHA 4EROA 1UMZA 1Q8QA 4L92A 2A6VA 1Z7S3 4COWA 2NYYA 4CDUA 1YNAA 1GZCA 2ZA9A 4P9JA 3VN4A 2X5IC 3FLRA 1PGL2 5EYYA 4P9LA 4U2AA 2CWMA 2PLV3 2BNNA 2OZ6A 4NHLA 1OD5A 1COV3 1DG6A 3ZXLA 5BNNB 2GNMA 4WZFA 3QH7A 4BPZA 3ZYPA 4D7YA 1OLRA 3AXEA 1JN2P 4XBNA 1MS4A 4KGGA 2FZ2A 3ZXGA 1VBC3 4N90A 2BTVC 4YM1A 3MEPA 5LEJA 2CGPA 2HWD2 2RR13 1KJRA 3OYWA 5JPNB 1BVVA 1NCRC 3CJIC 5IK7A 5KXBA 4Y1XA 1UCXA 4GKXA 3GALA 2WFF3 4KL1A 2QNKA 1FI2A 2ZAAA 3MW2A 4N43B 4QPYA 1AVBA 2AREA 1K5MB 2G9FA 2IZWA 3J8F1 4Q4V2 4Y24A 2WIIB 1VRH3 4LULA 3WR0A 1KDKA 1V9U2 4AEKA 2P3KA 3FLPA 4HK8A 4IEWA 3LB9A 5FDBA 5AC92 1ND2A 4Q4V3 1TMF3 3VBFC 2Z5WA 4N53C 4I09A 3AXDA 1PZ7A 4UW6A 2HWB1 2Z69A 1V6LA 1BZWA 3V56A 2UU8A 3DUIA 1GLHA 3O0WA 1AX1A 1R1ZA 2LTNA 4PDWA 2FMYA 4H7MA 1N3OA 4MSVA 2EXKA 3M3IA 3MIGA 5JZGC 4AK3A 3IKWA 2VOWA 2Q8OA 4TYSA 5CU1A 3U10A 2NN8A 1MS9A 4OZXA 4LLOA 1AXKA 1RHI2 4Q2FA 1ALYA 4FP3A 3RZZA 4Q0QA 1C57A 2VOKA 4LBKA 2E9QA 2Y26A 1DU3D 2ZPXA 4XFAA 4HFSA 3BALA 4FPGA 2DCZA 3SCGA 4S2FA 5T50A 4K6BA 3NAPC 2OZJA 5BNQA 1JUIA 4S2HA 4CEYC 2XLAA 1IGOA 1RUG1 1HKDA 1Y3TA 3MLJA 1RUJ1 4Z07A 3RSJA 1RC6A 1H2MA 4BLJA 4RL7A 1EV12 2PLV2 4XQWA 2D6MA 2AENA 1V70A 2DURA 4YYOA 1RMU2 1PGW1 3H7YA 4LEJA 5KC5A 4N43C 2XPJA 2SBAA 1W6NA 3VKOA 3SH5A 1Q56A 2DVAA 1VBE2 4ATEA 4K1ZA 2ZABA 4P9WA 1EPZA 4D94A 4P9XA 1RMU3 1AR71 5GZDA 1ND2B 3AFGA 2JECA 1V6JA 5GZFA 1QJX1 1PM7A 1RUD2 1HQLA 2JE7A 3TNPB 4B7KA 4MUVA 1H8TB 3PLQA 1UU6A 2WWSA 3KQRA 1VBE1 4BMBA 4PDWB 3QOPA 3KT4A 4XW3A 4YZ2A 2PHRA 4IERA 2ET1A 5JPMB 1GNHA 2XL9A 1AR73 4JV4A 1RMU1 4CDWB 2JG9A 4HKOA 1EV11 1RVF2 4B3NA 1V9U3 3GBFA 2QVSB 4AHZA 1GKBA 4OLLA 2A6YA 1URXA 4YFWA 3AX4A 3HT1A 2PHFA 2XKPA 2LALA 2XHKA 4HN0A 4MVTA 4P9GA 2P17A 1QQP2 1QGLA 1ND3B 1S1AA 2XBO2 4JDMA 3UKNA 3VBHC 4JGZA 1RUJ3 1N47A 1GZ9A 2GC0A 3SXWA 1YWKA 4XJ8A 1HRI3 1DBNA 1AL21 2BYVE 3LA7A 4QD2A 3NV2A 4IEXA 1VBA2 1ONAA 1VLNA 2PYTA 2WSVA 4A2UA 1QJZA 4PIYA 4EN6B 2EAAA 3H9AA 4S2GA 2R1BA 4F83A 5C6CA 3K48A 5J96B 3CJXA 4HKWA 3CF6E 1MEC3 3OBRA 4K9SA 4OHZA 3IDCB 5FPXA 3PTYA 1AR93 3WDVA 2D6LX 1PNFA 1PK6A 1NE6A 2GMPA 3IPVA 4D7TA 5AFBA 3AJYA 1W6MB 3B5LB 3KB5A 3R4SA 1XRUA 3G7DA 1XU2A 2Q30A 1VRH2 1CGPA 2WS92 1D0GA 3MF9A 4INDA 1RUH1 3VBHB 2QJVA 1CONA 4XBQA 1KFXL 1Q3EA 4Q4V1 5GALA 4PCRA 4YZ5A 1OQ1A 1C1FA 4Y1UA 4YG3A 4OULA 1RUC1 1DHKB 2P2KA 1KRIA 1VRH1 2PHUA 4Q0SA 2QDNA 1ZNPA 1SLBA 3J8F3 4KBBA 5J37A 1BEV3 2IXIA 4CEYA 3L2HA 1VBB3 4RR3C 5EZWA 1H0BA 1WMEA 1ULDA 4AG4A 1TME3 3GNEA 4DY3A 4GULA 2E51A 1MZFA 1TMF2 4GMP1 1DYPA 1PVC2 2RR11 2ZTNA 1KJLA 3URFA 1C8M3 1SBEA 4RA0A 1EP0A 5CNAA 5DUXA 1AF9A 2E53A 4UW4A 1H4GA 4Q4Y2 4HPKA 3ZXEA 2YXSA 3HN1A 2ZCWA 2GN3A 3APBA 5DG2A 2Q1MA 4CDWC 4RS5A 4FOVA 2JENA 3ROUA 1WMDA 5E8AA 4R9AA 4PDWC 3MZHA 4AGVA 3MIEA 4CEWA 2CNAA 2XBO3 1RINA 1OHFA 3OF1A 1Q8VA 2PFWA 2XBO1 1HV0A 4GA9A 4XZPA 1MVQA 2ZKNA 1Z7S1 4C0HA 2BGCA 1YJLA 4FOYA 4XJAA 3JB8A 4Y1YA 3VDDB 4AI3A 1JOJA 4IV1C 4YVWC 1JHNA 3VBHA 1MS0A 2ARBA 1RVF1 4UXAA 4BOWA 1CJDA 2BVBA 2BWCA 2XUMA 4X6RB 1H2NA 4IV3A 1SLCA 3E6BA 3N7KA 4JDNA 1W6OA 3NWKA 2MEV3 4H55A 1OOPB 2H6CA 1NLRA 4GMP3 2ZX1A 3AP4A 3AB0A 1FMD2 1HXS3 2DV9A 4YW2A 2DVDA 3VBFA 3AMNA 4GALA 4JTNA 4NHKA 2XGXA 3U07A 1BEV1 2ZGQA 1ENXA 4WM8C 1AR72 2XG3A 1DQ5A 5C4WB 3PNAA 3AMHA 4H3WA 2JJ6A 1VR3A 2QZ3A 4OI2A 3E5UA 4AW7A 4KWKA 4L8QA 3WDYA 4NWWA 1JYIA 2GC1A 1D4M2 1UF2C 3PMSA 1IS3A 1UN1A 5EFUA 2X5IA 1LOEA 1IQAA 3OD0A 1H1MA 4Q0UA 1ZZ8A 1CAXB 5HXVA 4AFMA 4Q4W3 2XVLA 2RE9A 1TE1B 1TME2 1ULCA 3VHNA 3ZMOA 2JG9C 4HMZA 1AR91 5HBAA 5GLVA 2EXJA 2BQPA 5BUVA 2XWBB 1O91A 2D6NA 3O12A 2HEWF 1MEC1 4EN8B 3E6DA 4HETA 4FQ4A 5A32B 2WKKA 4ES8A 5DXDA 5GZEA 1BJQA 1DQ4A 1WW5A 2GC3A 5BY5A 3UK9A 2NMOA 4C1WA 3RMYA 1OA3A 5KHKA 1RJ8A 5JWPA 3VBRC 3WXPA 2VVDA 4N43A 4DOUA 1VBD1 1AR63 4M3CB 4CP0A 3VUOA 5F9TA 5I8SA 2BUKA 1AL23 2QFEA 5CFDC 4EWDA 5K8SA 1CVNA 2ATFA 2CV6A 5FAXA 4HZFA 1LECA 3V0BA 1HLCA 1JTZX 3PJQA 5EWSA 4DY5A 1G8WA 4K40A 3WQ1A 3DPRA 4XF9A 5FQ0B 1ND3C 3MPBA 3B94A 4Q27A 3LCPA 4LBJA 5EJ3A 1UIJA 2VPVA 5H9QA 1V9U1 5CFCB 3KD4A 3IM0A 3VDDC 3WUCA 1XQNA 2X29A 2UWAA 3I59A 4ISRA 1KQRA 3VLBB 3N4MA 2WINB 1LULA 1NCQC 2IXCA 4UBGA 4YGCA 2WNUB 1FV2A 5AVAA 5EYXA 5CFDA 3DV8A 1S0IA 4XJWA 5LEKA 3HD8B 3DGTA 3OGGA 3KS7A 1JYCA 2HWE2 1ZRRA 2HWD1 2UURA 3NW4A 5CG9A 4AQTA 2XH6A 1TNRA 4KU8A 2P3JA 1NCQB 4Y1VA 1KDMA 3LA2A 1R1A1 1RUOA 2A73B 4BQ1A 5IUQA 1BEV2 4QU2A 1FOD1 4TWTA 2D6KA 2TEPA 1RJ7A 2Z2SB 1Z0HA 3ZN6B 3U4XA 3GBGA 4D7SA 1DGWX 4FTSA 3RNSA 1JBCA 1ULFA 1IS5A 1KD7A 4FPKA 4JDOA 3TB0A 1F2NA 2R16A 1XNCA 2TBVA 5L36A 1XE8A 3MDPA 1QJU2 2DVGA 3THPA 2FHRA 4A7YA 4LUKA 3A4UA 5KHIA 1LCLA 3AK0A 4XHBA 3B01A 4O9GA 2JX9A 1CN1A 5BNNC 2HWC2 2V5YA 2G4IA 4U36A 1QJY2 2A75A 4QMAA 2RS31 3CL1A 1AJOA 1HRI2 1QOTA 3ZSEA 4L11A 2R49A 1Q8PA 1TEIA 3OJBA 5FQ0A 1RUE1 2HWC3 4N9IA 1LOCA 2ZGUA 3AP6A 1CPNA 1YFXA 3J26N 5JLVA 2D3RA 2ZX0A 1S2BA 5FPZA 1BVP1 1S0JA 1ZREA 4QQHA 3GZTB 4NHMA 3PVEA 1Y9QA 4OHWA 4AEDC 5JMCA 3LOIA 3B93A 4GMP0 1BYHA 3B7MA 1W6PA 3R4UA 2HWB3 1CAWB 4S2DA 1APNA 3ZSJA 1AYM1 3S30A 4XF3A 1TMF1 3J4UH 4E2GA 2N7GA 3SCHA 1DGLA 1XYOA 2VQAA 3FBMA 4K1YA 4J1WA 5L7OA 1VBC2 2A3XA 3M3EA 4MYEA 2PN5A 3IWZA 1LTEA 2ZGTA 1KITA 1X50A 1VB4A 2QUOA 1U5IA 4WM7C 3TWIA 3WQ7A 3WY6A 1YHFA 3K51A 2CTVA 2RS33 2B9UA 1ZZ9A 3MW3A 1FNZA 1GANA 1PIV3 2R32A 3DKWA 4AEMA 3FFQA 1CAUB 1RUH2 3ZXJA 3VBUB 2VY0A 1RUF3 4LBQD 3ZN6A 4XETA 4AQSA 4NPRA 3E5XA 1OOPC 3M3OA 5JR7B 1PIV2 3H1MA 4DZGA 4Y22A 1ULEA 4CDXC 4XILA 1C8M2 1IS6A 2OUHA 5GJ6A 4LHNA 4FXGB 1VB2A 4R9BA 3ZPYA 1EAH2 1FOD3 3R4DB 4HN1A 4IV1B 4YVWB 5JOYA 1QH6A 1R1A3 4M3CE 3UL2A 3VV1A 1LJ7A 3JD72 3R0RA 5IK5A 4DB5A 2NLRA 1NG0A 2ZHKA 1OSGA 4AVSA 2QKDA 4A3XA 1MQTB 1EAH3 3FFZA 2DU1A 1ND2C 5L19A 4C1XA 3PJYA 5K7PA 1UD1A 3UV9A 1DYKA 4WVMA 1N1YA 2JG8C