1GZ9A

High-resolution crystal structure of erythrina cristagalli lectin in complex with 2'-alpha-l-fucosyllactose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHMWDSTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDAPSKILHVVLVYPSSGAIYTIAEIVDVKQVLPDWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERYTHRINA CRISTA-GALLI LECTIN
publication title High-Resolution Crystal Structures of Erythrina Cristagalli Lectin in Complex with Lactose and 2'-Alpha-L-Fucosyllactose and Correlation with Thermodynamic Binding Data
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 53
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2002-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1gz9A00
3OYWB 3M3CA 2VXRA 5L73A 1O4YA 2E6VA 1YO8A 1SLAA 1DYPA 3O5SA 1GICA 1GBGA 3N35A 5DG1A 5IUQA 4JC1A 4BPZA 1KDMA 1KJLA 2NMNA 4CRQA 4DRRA 1MZ5A 2ES3A 2R16A 1WBLA 4FP2A 4XIKA 2CWSA 1KRIA 5GLTA 3M3QA 3LSEA 1F31A 5GLWA 3POWA 4FOVA 1H9PA 2D43A 3ILRA 3WDUA 1LEDA 2R1BA 3IPVB 4ZKTB 2YZ4A 4UW6A 1G9AA 1BJQA 1S0EA 4D69A 3APBA 3ILFA 1EPWA 1O4ZA 5JOYA 4XMAA 3POYA 4BQ1A 1CIWA 3MEPA 4MYEA 3ZVXA 1IOAA 3R05A 4R9DA 4YZ1A 3B9CA 2DWRA 1I1EA 1PZ9A 1YI7A 1QU0A 2ZGRA 1UPSA 2W08A 4UW5A 1C1FA 3IKWA 2WJSA 1LU1A 1UAIA 1V6OA 1WCSA 3GNEA 1G9DA 3UJQA 4NO4A 4C1XA 1A3KA 3AX4A 1D0HA 1CR7A 1LJ7A 4M3CA 1A78A 4XBNA 3O0XA 2ZHLA 1MS3A 1QOTA 4PQ9A 1AXZA 1DFQA 4Y1UA 4XYXA 3BTAA 2A6XA 5GJ6A 3ZXKA 4XTPA 4H55A 1Q56A 3PJQA 1WD4A 2P3IA 2ZAAA 5HCAA 1AXYA 1X50A 4XIOA 4BOWA 3NWKA 2ZKNA 4XOGA 1FX5A 4GWNA 1RIRA 5H9QA 5KXBA 3JUUA 1TEIA 1URXA 1LOFA 2WSUA 3POSA 4R9BA 3ZXEA 5GZGA 4BMEA 3N3HA 1GYKA 4WVVA 4PF5A 5GZCA 5DG2A 4Y1YA 4FPJA 3ZSMA 2A70A 1AZDA 2E53A 2NM1A 4YG3A 3A0KA 4XJAA 1XQNA 2D6KA 4FP3A 1WLDA 5DUXA 1QDCA 4GKXA 1IKQA 1UX6A 2ZGTA 3UK9A 1IS3A 4Y22B 1MVQA 3NV3A 1DQ0A 1RINA 1KJRA 1F5FA 3OY8B 4YZ3A 1BXHA 4LBKA 2ARXA 2OVUA 1ULDA 2V5YA 2OUJA 5KXDA 1SACA 3I8TA 1N1YA 1MS4A 2WLQA 2ZA9A 4FOYA 1DQ2A 2DVGA 3WNXA 2DUPA 4DPNA 5DZGA 2EXJA 1YXWA 2CY6A 1AXKA 1DGLA 4LBQB 1Q8PA 3WG1A 1WLCA 5CBLA 2ZMLA 1W6NA 4UW3A 2ZGKA 1V6IA 2DYCA 3V65A 3Q9OA 2A3YA 1JYCA 5AVAA 1ULEA 3WDYA 1HQWA 4RL7A 1B09A 1BYHA 3INAA 3OBRA 1W6MA 2EXIA 4Y20B 3D5OA 3RMYA 2B7YA 2UWBA 1DQ6A 2A3XA 3V64A 1VLNA 4YFZA 1LOAA 2GDFA 1LOEA 1N3QA 3VV1A 1GLHA 3WDVA 1W6PA 4ATFA 3RRDA 3AK0A 4WVWA 1OKQA 4FPYA 4UW4A 2JE7A 5KXEA 2C5DA 1F9KA 2D44A 1Q8SA 5EXOA 1LCLA 1HQLA 3ZSKA 4P14A 5GZDA 1MZ6A 5CAZA 2DURA 4R9CA 3MW4A 1GZ9A 2DVFA 4ISRA 4XTMA 1AX1A 5DZFA 1LTEA 3AZXA 1W6OB 5JLVA 1UKGA 1KDKA 4XZPA 4KBBA 1GNHA 4YM0A 1DLLA 1W6QA 3FBYA 3GALA 5JMCA 4ITCA 1FAYA 4YZ4A 2V73A 3VKMA 2UWCA 1IS6A 2EF6A 2VU9A 1FV2A 2VY0A 1AX0A 3OYWA 4XJUA 1DHKB 2ERFA 1FV3A 1G86A 1ULCA 1S0FA 1YRZA 2D6NA 2AH2A 2Q5TA 2R0FA 2Z42A 2UU8A 4GALA 3SH4A 1JN2P 1VALA 2AREA 4WV8A 3M1HA 3WV6A 4P9WA 3AP9A 1DQ1A 1YIFA 5CA6A 3FLRA 4LBNA 3FUOA 4XDQA 2PHTA 1BQPA 2ZGUA 2DU0A 4AVVA 2DTWA 4Y1VA 1LESA 3L2YA 1N3OA 1DZQA 3AYEA 5GZEA 1Y7BA 3IPVA 2CTVA 1OQ1A 3AP6A 4L8QA 5T5PA 3O0WA 3SLIA 2OW4A 4TYSA 4AGVA 2A7AA 2GN3A 1LECA 5DXDA 3WCSA 3C2UA 4Q1RA 4XBLA 4DRVA 2XB6C 4XBQA 2GNMA 4XXPA 2JJ6A 2E7TA 3WG4A 5E88A 2DVDA 1CQ9A 3WUDA 1MS5A 3H0OA 3UJOA 2DUQA 4SLIA 1G7YA 3WHTA 1H30A 1ZA4A 3WDXA 5GLZA 4M3CF 2LALA 2WSVA 4GXLA 3AFKA 4Q26A 5T54A 3T1LA 2DU1A 3ZSJA 5KXCA 4M00A 4NOTA 2ZGLA 3VKOA 3VKFC 1MS0A 1LOGA 1IS4A 2D3RA 1ENQA 1C1LA 1QDOA 3WLUA 2YY1A 2C9AA 1CN1A 1ONAA 2A6WA 5HCFA 3ZYRA 3VKNA 1QOSA 2ZMNA 1ULGA 4Z8BA 1WUVA 2FHRA 1LHVA 3USUA 1CESA 1Q8VA 2W39A 1PZ8A 2D6OX 2ZHKA 5IT6A 1S0GA 1LGCA 1HLCA 1LODA 4YZ5A 2VUAA 1DQ4A 1KITA 5JOXA 2P3KA 4Q8KA 1JW6A 2EXKA 3B69A 4DQAA 1W0PA 2ZMKA 5BYNA 2GNTA 3KQRA 1WLWA 2A75A 3O0VA 4IQPA 3LCPA 1CONA 4GKYA 5DUUA 2WT0A 5LK5A 1S0BA 2OUHA 2BQPA 1LHNA 1C4RA 4LBJA 1AF9A 2SBAA 5DUWA 2ZGQA 5JVVA 5T5JA 4HL0A 4P9YA 1V6KA 2G4IA 2PHRA 3KM5A 4YG6A 3M3OA 3M3EA 4YGBA 4AVSA 3D4KA 4AGGA 3OY8A 1Q8QA 5JOWA 4BLJA 5T50A 1MR5A 3OBTA 1KQRA 1QKQA 3AJZA 3BODA 5GLUA 3ZXLA 1GZWB 4K21A 3ZSLA 3A0NA 5SV8A 4LBMA 2R49A 3BIWE 3BOPA 3HR9A 1V6NA 4LBQA 1SBDA 4AWDA 2EALA 3B00A 5CNAA 2KM2A 1MS8A 4YGDA 1Q8OA 3ASIA 2E7QA 4PBPA 5DUVA 3MW2A 3N7MA 3QCWA 1VIWB 2CYFA 1ZM1A 1UMZA 5H9SA 2AGSA 2GN7A 3PMEA 2A5ZA 2WT1A 1SLTA 1A8DA 4Y20A 1R1ZA 5T52A 3I4IA 4I30A 1WW6A 2YV8A 2ZGOA 4RA0A 5JDBA 4K20A 1LHOA 2NN8A 2D6MA 1C57A 2E51A 2JD4A 2ZZJA 4XJWA 3W59A 1WBFA 1LULA 2NZ9A 1G9CA 5FRAA 3N7JA 1JXNA 1UL9A 3WOGA 3N7LA 2WNEA 3DGTA 4YW4A 3TB0A 1JYIA 4C1WA 3AZVA 5GALA 1WW7A 1RITA 2P34A 3WDTA 1LOBA 5GLVA 1MACA 1AVBA 1N47A 3FUQA 4YM3A 5T5OA 4ATEA 2FMDA 1W6OA 1VAMA 4LBOA 1DIWA 1Z78A 2PHXA 4U2AA 3V0AB 4XE9A 5CB7A 4FPOB 3AYCA 3N7KA 1ENSA 2YMZA 2JKBA 4XILA 1UZZA 1SCSA 1DBNA 3AJYA 3R4SA 4YW3A 3SH5A 3SNMA 5IK5A 1W0OA 1ENRA 3AP7A 1LOCA 3V0BB 1FNYA 1BKZA 2YXSA 4XMIA 5E89A 3RMXA 2GMPA 2JE9A 3FLPA 3HN1A 3VKLA 2NP0A 1G9BA 1S0CA 2AR6A 1GSLA 1FYUA 2R0HA 3FLTA 1HKDA 3ZXJA 1SLBA 3AYAA 3AXDA 3IMNA 3OGGA 4YW5A 2W68A 2PELA 4AVTA 4U36A 1MS1A 3AP5A 1FNZA 1LGNA 4YLZA 2I2SA 3B01A 1V00A 4YG0A 4AYUA 2WKKA 1S0DA 2R1DA 4PCRA 1LEMA 1AJKA 5T55A 1JHNA 3TAYA 5E8AA 1N3PA 1SBEA 4P9XA 4Q8LA 5EYXA 3AP4A 4XXAA 2H0BA 4TZDA 3SH3A 1LOFC 4FPGA 3QLQA 3UL2A 1UZYA 3M2MA 5H9RA 1SLCA 2EIGA 3WZ1A 5F9TA 2CNAA 1PZ7A 4FQZA 4M3CE 2NYYA 1QF3A 1IKPA 4F83A 1FATA 1LGBA 5IK4A 2JDZA 2P37A 2ZBJA 1MVEA 5DZEA 4YM1A 4FOWA 4FPHA 4ZXKA 1NLSA 4BMBA 1QNWA 4W65A 2EXHA 1IS5A 1UN1A 3NV1A 2CL2A 2VW1A 4M3CB 1SBFA 2ENRA 2WT2A 5EWSA 2ZGSA 3ENRA 4CTEA 3NV2A 3MW3A 1QGLA 2TEPA 1MS9A 5H9PA 4CZSA 3FFZA 2AENA 2ZHNA 3MPPG 3O12A 1NXD1 2ZGNA 1LHUA 2YROA 3WCRA 4PBOA 4BM8A 3WVJA 1JBCA 3RSJA 1GZCA 1SLIA 3R4UA 3T2TA 3WG3A 4ASMB 1D2SA 1QNYA 1WW5A 2VW2A 4Y22A 4LBLA 1SFYA 3USUB 3B3QE 1LENA 5JOZA 1J1TA 2PHFA 2W52A 1S0JA 2ZGPA 2GMMA 1GZWA 1YYNA 5GZFA 2D6LX 3ZXFA 2ARBA 3OJBA 2DVBA 2PHWA 4YGCA 1CJPA 3WUCA 2A3WA 2NMOA 4BLIA 3U4XA 1JOJA 5IK8A 2LTNA 3AZZA 3RS6A 4Y1XA 5F5QA 1DQ5A 5EYYA 1CVNA 4YFWA 2P2KA 4XJ8A 1N1TA 4Q27A 2A71A 4FPCA 3WDWA 1Z0HA 3NV4A 3ATGA 2VW0A 2SLIA 4FVVA 1GV9A 3HMYA 2D3PA 2GALA 3D6EA 3OPZA 2AUYA 4ISQA 3W58A 3ILNA 2GMEA 1HDKA 4JCKA 4FPKA 4FQ4A 4Q1PA 2ZHMA 3CNAA 2ZGMA 1G9FA 4AGRA 3IN9A 4XJ9A 4Q2FA 3VUOA 1GNZA 3N36A 4M01A 4YM2A 3ZYPA 5T5LA 3JU9A 2UURA 4FPFA 4YW2A 1U0AA 1SCRA 1N1VA 2ZABA 4DFSA 5GM0A 2A6VA 1APNA 1LU2A 1JUIA 1G8WA 1WW4A 3PVNA 2DTYA 2WQZC 3DUIA 4GWMA 2CWMA 3AYDA 3IM0A 1W6NB 1H9WA 4Y1ZA 1GKBA 1QOOA 1V6MA 1V6LA 2PHUA 2VH9A 1ULFA 1WD3A 4XHBA 3ZPYA 1AJOA 1BZWA 4R9AA 2HYKA 2P3JA 1W6MB 2DVAA 3PVOA 3V0AA 3AZWA 1N1SA 3AZYA 4YW1A 5FREA 1V6JA 5HCBA 2DV9A 2DUOA 3T1MA 3WG2A 2ZACA 2AYHA 4GA9A 2A6ZA 2GNDA 2XG3A 2GNBA 3RQ0A 4OZXA 1AX2A 1CPNA 1OFSA 1W6PB 3SISA 4FPLA 3WHUA 4JRAA 3V0BA 4WZFA 4YZ2A 4YGEA 4XJZA 1SLLA 2D3SA 1LHWA 2JECA 2A6YA 1QMJA 2EAKA 2RHPA 2UWAA 4FPEA 4XHXA 4FOQA 4LBQD 2D7FA 1DYKA 4K1YA 1S1AA 5IK7A 3A4UA 4DS0A 1I3HA 3AXEA 3RG0A 1W6QB 1S0IA 3SITA 4HANA 1CPMA 1GANA 4K1ZA 4Y26A 4Y24A 3LSDA 2D6PA 1VAVA 3PVEA
chains in the Genus database with same CATH superfamily
3FC0A 2EVXA 2JB8A 3H42B 3J7HA 5CIRA 1RUD3 4D7TA 4RS5B 1JODA 5BNPC 3RZMA 2VNGA 1O4YA 2XJVA 3I59B 4JKLA 1DYPA 2VMIA 3HQUA 4CXXA 5F5AA 3N35A 4QX3A 4UXAA 4XUNA 1KDMA 1KJLA 3NJVA 1QJU1 1MZ5A 1PX4A 4FP2A 1WBLA 5A3LA 1R082 3M3QA 4RGGA 4JGYB 3PU8A 4BB3A 4Y3OA 3T0AA 4KWKA 1POV1 4ZKTB 1AR71 1XYPA 1G9AA 1GP5A 1BJQA 1EPWA 3M8LA 5JOYA 1CIWA 3MEPA 1KS4A 3H8OA 3R05A 2IFWA 2WZR3 3KT1A 1WKYA 1PZ9A 3F2ZA 2ZGRA 4ZXEA 1O59A 2O0OA 2W1UA 4L0PA 5L7OC 2JIJA 2WJSA 1LU1A 5FYUA 1VE0A 2DFCA 2OQ6A 1B35B 4NO4A 5ISLA 1C5HA 3NKTA 4Q4Y3 3LA2A 5CKMA 3AX4A 4CDUA 1ODNA 1QJZA 2BVBA 3KSCA 4M3CA 4X8PA 1ZRIA 3ZDSA 4YARA 4XBNA 1O91A 2VTXJ 3O0XA 5FBZA 2IXKA 3B7MA 4XYXA 5EIYB 5A3WA 4I3GA 1QJX1 1A6CA 2RS32 3UNPA 1Q56A 1JOBA 5HCAA 3W5MA 2VMCA 2IXLA 3LIGA 4NHMA 3C7GA 4Z1VA 1AXYA 2RR12 3JQWA 1TMF1 4XIOA 4A45A 3Q8EA 3WW2A 2ZKNA 1GWLA 1RIRA 4W6YA 5H9QA 4EN7B 3JUUA 3T2OA 2WNUC 2WSUA 2VO5A 4D6RA 1L3JA 1PIV3 2JEMA 3LA7A 4N43A 4BMEA 3MICA 2RJ2A 3THPA 4PHZA 5DG2A 3U0ZA 3CJIC 1BLZA 4KWJA 2BERA 1IPKA 3VBFA 3DXTA 2E53A 3K46A 1XQNA 4XJAA 5ANQA 4AFCA 1XNCA 1K5MA 4IE4A 2BP6A 3MIFA 4YNIA 1UX6A 2AEYA 3HPNA 1PK6C 3ZKUA 4EE2A 2AACA 3NV3A 1FT9A 2VNOA 3VHOA 3T4VA 4QX0A 4DOUA 1ULDA 2V5YA 5KXDA 1SACA 1N1YA 3MIHA 2WLQA 5IVYA 1QH6A 3WNXA 3VD7A 4BE3A 4B1MA 2VZSA 2YUEA 4XAEA 1CZSA 4KNCA 4OLLA 4XF0A 5A80A 5JZGC 4LBQB 4XEZA 4DXRA 4BDVB 4RQPB 4JTOA 1WLCA 1IPSA 1X7NA 5CBLA 4M0HA 5FZMA 2ZGKA 4URAA 4LT5A 2WC2A 4CU6A 2A3YA 1FOD1 2CV6A 4WVMA 1EUTA 1OT5A 1ULEA 5EJZB 2E63A 2JG9C 1HQWA 2BDRA 5BNNC 3KLSA 5FZ4A 3OBRA 3ROUA 3PTYA 1JS9A 3R0RA 4Y20B 3D5OA 5LZ6A 3VBOC 5ACA2 2HWD3 1X9TA 1PGL1 2C0ZA 1JZ8A 2A3XA 3LF7A 3SC7X 4ZU4A 3WQ1A 4ATFA 1HRI1 3NAPB 2LRPA 2VQTA 1EY2A 3AK0A 5IHRA 2WZ8A 4UW4A 2JE7A 4B8EA 3FWEA 2YGMA 3GBFA 3KHCA 1F9KA 2D44A 4QDRA 4F3JA 1VB4A 4Y5SA 5FUPA 3KD4A 5HI0A 5CAZA 4AI0A 2WAAA 3VBSC 2DURA 4QKDA 1X8EA 1J1LA 5J48A 3LDBA 4ISRA 5KHIA 2Y26A 2VCBA 1LTEA 2J7MA 3ZMNA 5A7PA 5J37A 3O1SA 1Z7S2 1W6OB 1KDKA 4XZPA 4YM0A 2XH6A 4ITCA 4YZ4A 4CCCA 1PVC3 2QDNA 2RJLA 1IS6A 2UWCA 1RVF2 2EF6A 4HZFA 5A3UA 4RR3B 1VBB3 2VU9A 2P6CA 3OYWA 2ERFA 1NZIA 1STMA 2ID4A 4AVCA 4CDXA 5EJ3A 1FV3A 1R64A 1ULCA 1CAVB 2R32A 2D6NA 4IXLA 4QHZA 1SZBA 4GALA 5BXXA 3ZYHA 1GQHA 5F5CA 4CEYA 4DY5A 1RJ8A 3VBRB 4CXYA 2WWSA 2ZZQA 4Q4X1 1DQ1A 3Q8CA 1YIFA 2X5IA 1RHI2 3KT7A 1TNRA 2QQOA 4BA6A 4MXWA 4LBNA 4EYUA 4XDQA 1SEFA 2VCAA 4JZRA 3MF9A 3H1MA 1RUE2 1XE8A 1R092 2ADDA 2EIDA 5AC91 4HOOA 1C28A 5CG9A 2XDVA 3SLIA 4CDQB 2XKOA 1RYYA 2GN3A 3HQRA 3VD4A 2WWJA 3OUJA 4URTA 3K48A 3C2UA 4RFT0 4XBQA 1QHDA 1YQ5A 1AYM3 1XSQA 3VD9A 3HBKA 2JJ6A 5E88A 3VZOA 2XVLA 3WUDA 3MLLA 4XF9A 4DUVA 3DEMA 4Q4V1 1ZX5A 3WDXA 3WHTA 2OYZA 1AR73 4JDMA 3S5QA 5KXCA 4RD7A 4AEKA 1W9YA 4NOTA 3O1OA 2D98A 1F4HA 1CJDA 1C1LA 1QDOA 4Q0UA 5JSOA 2YY1A 3IB3A 2C9AA 2VECA 1CAWA 1HB2A 3VBUA 4B4RA 5JPNB 1ONAA 5F2WA 5FYCA 3MYXA 1W9WA 5BNPA 1RMU3 1W90A 1ULGA 1LHVA 1SPPB 4CU7A 3FMGA 3POFA 2D6OX 2ZHKA 5IT6A 1LGCA 3RNSA 4LUKA 4A3ZA 1W2AX 4XQDA 5D8AC 3ECQA 1XXNA 2P3KA 2JWPA 3RI8A 3SCGA 3UESA 5BYNA 2GNTA 1QJX3 2NPIA 2HWF2 3BTXA 1WLWA 2A75A 3J8F2 4GKYA 4AFAA 2R041 5KBFA 1XNKA 2BQPA 4XF4A 4BIOA 1MZFA 1TMF3 1AF9A 4WVZA 5DUWA 2ZGQA 4CEWC 5JR2A 4HL0A 4IEZA 1CAXA 1F15A 3O14A 3U4SA 4QX1A 2G4IA 5L7OA 1OSGA 3M3OA 5LRRA 1W9SA 3NRUA 3TN91 4AVSA 1MR5A 2UYAA 1UXXX 2VOVA 1QKQA 4DZGA 4KU8A 2HWC2 2W5FA 1VBE2 5I8YA 3M7AA 3MGUA 3CBNA 5SV8A 4E9KA 4NE9A 3IWZA 2PA7A 3VZMA 5HXVA 3HR9A 1SBDA 2WS93 4AWDA 4A6OA 4FFHA 1REEA 3THCA 4CSWA 1Q8OA 4ASLA 2VUJA 4PBPA 4I09A 2VOWA 2R072 4N53C 1VJ2A 2AGSA 5CFDB 1O3SA 3PMEA 3LDKA 1SLTA 2B42B 2BFUL 3TEXA 2WNUA 4DY3A 3ZYBA 2G1MA 5A3PA 2F6BA 1ASJ2 4I30A 3SKJE 3KF3A 4GMP0 1UIJA 1LHOA 2JD4A 3W59A 4IGQA 4KWLA 4JAAA 3CJIA 2JDAA 2XVKA 4HN0A 1W8WA 5IJRA 3GHMA 1JXNA 1UL9A 2G9ZA 1UY4A 3VBHB 1FOD3 1XRUA 2P6HA 4C1WA 1NA1C 3FL7A 2BTVC 1PK6A 2P34A 4KGGA 2GP3A 2PLV1 4MXVA 5GLVA 4DINB 2B46X 4QX5A 1TVGA 5ERLA 2OS2A 1EV11 5FZOA 2K9ZA 1OI6A 4R4XA 2OPWA 5FP8A 2XQXA 1XE0A 4FPOB 1RUI1 1RL3A 3N7KA 4A2UA 2XXZA 2YMZA 2AEZA 5I0DA 1AR93 4QHOA 4YW3A 1RMU2 4WM7C 1EUUA 1LRHA 2ZJCA 4AEDB 5JZGA 1ENRA 4K8FA 2RM21 4OI2A 3R6SA 3V0BB 4DEQA 1JYVA 1FNYA 1BKZA 2JB4A 2YXSA 3DCQA 4X8NA 1SG3A 4HT1T 2RE9A 2GMPA 1VRH1 3X29B 1J58A 5A32A 1G9BA 1S0CA 4FO9A 4LA3A 2AR6A 1GSLA 1FYUA 2Y38A 4R4ZA 1JI6A 2JG9A 2XWBB 4C90A 3IMNA 4E4DX 4YW5A 1RB8G 5BNNA 4AVTA 4IE0A 4IV3C 4MV2A 1D4M1 1ZZCA 3VBOA 2QQNA 1PMHX 1FNZA 2XBO1 1JZ6A 1U5IA 3GZTB 5IATA 1RUC2 1BBT1 2VE1A 3B01A 4YG0A 3I3MA 2DBNA 5FPLA 3ZN6A 1S0DA 3LPGA 4KU7A 3D3AA 5A7QA 2RS51 4YYOA 4BXFA 1N3PA 5J96B 5FZHA 4GH4B 4BZ4A 2WNOA 3ZFFB 1UY1A 4FXGB 3VBSA 5M0TA 2RMU2 3HNMA 1LOFC 2RDRA 2F4LA 5AC93 4YVSC 3AC0A 2WFF1 2XPJA 1UOBA 2BPA2 2FDIA 3PUIA 5IAVA 4UBHA 4E2QA 3PURA 5J3UA 2EIGA 2CNAA 2DCJA 3AM2A 4IEQA 4Z82A 1F2NA 5FPUA 2FDHA 3IDAA 2B9VA 4F83A 1FATA 1LGBA 1OKOA 2P37A 1CWPA 2ZBJA 4Q4W3 1MVEA 4FOWA 1BVVA 1COV3 4ZXKA 3MUY1 2BVVA 1QNWA 2D5FA 1BMV1 3AL6A 1C8M1 4Q4V3 3PU3A 5LY1A 2P17A 2P1BA 2YBPA 4AL9A 1HRV3 1K42A 1VR3A 1IS5A 2FDJA 4J1WA 4AQSA 4KGQA 3WT3A 1SBFA 2PMWB 1BEV2 4CTEA 4X6QB 2JG8C 1R081 2TEPA 3BTYA 1F5JA 2AENA 3MPPG 5FXVA 5K0UC 5KHHA 2Y6JA 1VBA2 3OSDA 3WCRA 3N9PA 4E2SA 4DRVA 1GZCA 2VAUA 3T2TA 1D2SA 1QNYA 1WW5A 4Y22A 4NUBA 5IFPA 3USUB 2JDYA 3TNQA 2X53S 3DYOA 2Q0AA 3GF6A 4Z2AA 3S0MA 4UFHA 3K75B 3E5QA 1OBNA 1PGSA 2ZGPA 2ZX3A 2BZDA 5KHJA 1YYNA 2B5HA 2R063 2R043 2D6LX 2Y64A 4I0AA 5FQ0B 4AQ6A 2YHJA 2CAVA 4YGCA 4CU9A 2HEYF 2NMOA 1UY3A 4N90A 3RS6A 5F5QA 4XABA 1CVNA 5DPNA 4Q27A 2EA7A 2WNVC 3RZJA 4FPCA 3WDWA 4CCEA 3PIJA 5DAQA 5CVRA 1GUIA 4XC9A 5I0RA 1GV9A 1RGSA 3KV5A 4TN7A 4FPKA 1ND3C 1TME3 1RUJ1 2ZHMA 3CNAA 3T09A 5D8AA 1M4WA 2FZ1A 2QCSB 1ST8A 3I2JA 4Q2FA 5F8PA 3N36A 5FO9B 1HB1A 2IC1A 2YU1A 3GXUA 3ZYPA 3ACIA 3KV4A 4PJYA 5ABJC 3JU9A 5FYMA 5FUNA 4BIFA 1N1VA 4RS5C 3MLKA 2QVSB 2VG9A 1E57A 3I3EA 3KZ4C 3SEPA 1OUXA 4CEWA 3I2HA 4GWMA 2CWMA 2PQQA 3IM0A 3LGRA 4NROA 5FOJB 2J1AA 1QOOA 1V6MA 3W21A 2PHUA 2TUNA 2BOJA 2OXBA 5JPMB 5DQ0A 5EHDA 5FMDA 4R9AA 2VC9A 5JCTA 4RSUA 2B45X 2P3JA 1W6MB 4NPRA 1N1SA 1NUKA 4YRDA 2DV9A 4LKFA 2EICA 1VBC3 3O1VA 4NIIA 2GNDA 4OZXA 1AX2A 4LE3A 1Y3TA 4HVOA 3J26N 3SISA 4IUGA 1D2QA 4B3NA 4FSJA 4QQPA 3JB8A 2PLV3 1O3QA 2QBXA 4YGEA 4OI4A 4NAOA 5FXWA 1S2EA 2A6YA 2UWAA 2RHPA 1EV13 1B35C 1RUD1 2BJSA 4LKEA 4N53A 3FJSA 1DYKA 1XC6A 2WL1A 4EN0A 1IHMA 4GAZA 5IK7A 1A34A 3POJA 3VDCA 1RUI3 3A4UA 4DS0A 1SQ4A 1W6QB 1RJ7A 1XJAA 2IFRA 2VVDA 1FMD2 4Y24A 3LSDA 5ACA1 1AHSA 3PVEA 2ET7A 3KHBA 4E4SA 1W9TA 1OH4A 3O5SA 3EB7A 4IW3A 4QU2A 1NA1A 3KCYA 1GBGA 2WZR1 2PAMA 1X82A 3NMBA 4MGZE 4BPZA 4CU8A 3SEEA 3C7OA 4BQ3A 2R16A 4DRRA 3QH7A 1D4M3 4XIKA 1O3TA 4WM8C 1NKGA 1KRIA 2XBO3 4FT8A 4GWIA 5GLTA 2MNGA 4Q4Y1 5GLWA 1HB4A 4IEXA 4FOVA 4R52A 2HEVF 2JDPA 3WDUA 4NIGA 1S0EA 1WWYA 4H7MA 3IIIA 2RS53 1I9RA 4OHWA 4MYEA 1UO9A 4WM7A 1I1EA 4YZ1A 3TEYA 2W87A 3B9CA 4BQ5A 1YI7A 3V56A 3IDCB 3N9LA 4A7ZA 1NCQB 5FMOS 1UPSA 5FZEA 3WDYA 3IKWA 3GNEA 2V4VA 4AHZA 4CP1A 5CG8A 1JTZX 3WF2A 4Z92B 1D0HA 2Q1FA 5EJ1B 2YFZA 1CR7A 1LJ7A 4RFRB 4NIDA 4IV3A 1OPOA 1MS3A 1QOTA 2TBVA 2UYBA 2WAOA 3IBMA 4IESA 4Y1UA 1PIV1 3O1MA 2VTFA 2VVFA 3BTAA 5A7WA 1UWWA 2WO1A 5GJ6A 5B4XA 2VZUA 4XTPA 2QUOA 1RUE1 1R091 2NQYA 1C8M3 2XWJB 1NY72 1NCRB 2BOIA 1LNSA 2VMDA 5IAXA 4V1PA 3RI9A 3NWKA 4BHPA 4FAHA 5KXBA 1URXA 1LOFA 4R9BA 4XUQA 3ZXEA 3H9AA 4GJZA 3I3QA 4YVSA 4EZHA 4JDNA 4D0QA 2CGPA 3N3HA 1VBC2 3GM8A 1R083 1UOFA 4PF5A 4B4PA 4E4HA 4K8RB 3NAPC 1S2BA 5DAXA 3CDZB 4Y1YA 2R7EB 2CGNA 1Y9QA 3WNPA 1ZZ9A 1IPJA 2NM1A 1YEWA 1ZVFA 2F4PA 2G19A 3PMSA 4XF3A 4YG3A 4YVWB 3PL0A 5DUXA 1O4TA 1H1IA 1XPWA 5K8SA 3UK9A 3RYPA 3AMHA 3K77A 4LEJA 4D7SA 5JI7A 5GKAC 1DQ0A 1RINA 1F5FA 2GH8A 1BXHA 2ZTNA 4LHLA 3I8TA 2I74A 2FMYA 1DGWA 1MS4A 2X10A 4FOYA 5F3GA 4C8DA 3POEA 2DVGA 4UF0A 5LA9A 3RVHA 4RR3C 2EXJA 2HWD1 4N8MA 2JG8A 1YXWA 4IV1C 2VUCA 1AXKA 4I0WB 5K0UA 2W9XA 3WG1A 2HWF1 1VBD2 2RS33 4LKSA 1O7FA 1X9PA 3QH6A 4ZPIA 3VB9A 5BY5A 3I97A 1QJFA 2DYCA 3JD72 3D8CA 5D1IA 1JYCA 2RR13 4INDA 2DDUA 1BYHA 2FDKA 3INAA 2KXLA 2EXIA 1TNFA 2XLAA 4IEOA 2Q8DA 2UWBA 3RMYA 3E97A 3V64A 4CDQC 4YFZA 1LOAA 3VV1A 1GLHA 4WVWA 1W8FA 1OKQA 4QWNA 4QGNA 5FLJA 4AG4A 2Y6GA 2C5DA 1H6YA 1W8UA 2WNVA 3WEZA 1Q8SA 5DAWA 5IVCA 1LCLA 1HQLA 4NHLA 4R9CA 3MW4A 4GWJA 1GZ9A 3HBZA 1PM7A 1W2NA 4HVRA 2QQMA 4EN6B 5DZFA 2Y0OA 3AZXA 3N4MA 1ND3A 2LROA 3J9SA 2ORXA 4FTEA 5FFOC 4KBBA 4MLOA 2WO3A 1DLLA 5B2GB 3GALA 1WA6X 5JXHA 1HJGA 4HK8A 4ASKA 2HLEA 1UF2C 1R1A2 3KF5A 1O8PA 3VKMA 1GOFA 2PFWA 4XCBA 5ABJA 5FR3A 1FV2A 4AW7A 1ASJ1 1AX0A 4XJUA 1DHKB 2J1UA 4RS5A 3UKVA 3A21A 1G86A 1S0FA 2R0FA 2Z42A 4W4ZA 3I59A 4OMDA 3AKRA 2ZEZA 4A3XA 1OH3A 3SH4A 5FZLA 2K2SA 2RDSA 2Y34A 1AYM1 3FLRA 1H8TB 5FKCA 4AQTA 5FJHA 3WP6A 1BQPA 2DU0A 5CEHA 4EZ4A 4J1XA 3L2YA 1N3OA 3U14A 2GSYA 2WRAA 5FZAA 2CTVA 1OQ1A 5ACA3 2W0XA 5T5PA 1PNFA 3O0WA 2OW4A 4LHSA 2E26A 2CHHA 2A7AA 2Y0IA 3D0SA 3PIGA 5FTTC 4AGVA 5DXDA 2CAUA 3WCSA 3MZHA 2YC2A 4XQWA 4AI9A 2XL9A 2VBPA 2VZQA 1ZBE2 2E7TA 3BN6A 3WG4A 2Y60A 1CQ9A 4AEJA 2MPFA 1B35A 1OA3A 1MS5A 1RMU1 3F95A 3H0OA 3LEIA 4QMAA 1G7YA 3ETQA 3UJOA 4CA9A 4UYBA 1H30A 1ZA4A 1ULOA 2WZEA 1KFUL 2O14A 3LWCA 4GQ7A 3AFKA 4Q26A 3O1PA 4BYYA 1NAEA 1Z7S3 4PI0A 1H1AA 4Y4YA 1ZRRA 3QOPA 1IS4A 3LEMA 5FDBA 4K9SA 1NT0A 4PQQA 2VUDA 3DPRB 1RVF3 4OQ9A 1QY4A 1U5YA 3H8XA 5F6LB 3HT2A 3U1XA 2ZMNA 1WUVA 1RUC1 2O8OA 3MI8A 3Q8AA 1DF0A 5FY7A 1PZ8A 3GCWA 1GOHA 3GZEA 1S0GA 1LODA 3WP4A 1PMJX 4A4AA 1OA2A 2J22A 2WYFA 5JOXA 4Q8KA 1JW6A 2EXKA 3B69A 4WM8A 4AEMA 1RHI3 4DQAA 2JDUA 1W0PA 3K4ZA 2RMU1 3KQRA 5I0SA 2VBBA 3O0VA 5DUUA 3VD3A 1S2KA 2C4XA 1RUE3 3MDPA 1OURA 1R093 2IUWA 2WT0A 3LA3A 3NKGA 4QXKA 5LK5A 4MG2A 1C4RA 1TQ5A 2WDBA 3IMMA 4LBJA 3VBHC 1OLRA 3WNLA 5JVVA 4QPGC 3MFAA 1YQ8A 2MEV2 2WS91 5FY0A 3LAGA 3ZR5A 1T6BX 2Z5WA 3JBG2 3M3EA 4YGBA 2JDKA 3ACHA 4QQOA 1XB9A 3CF6E 4AGGA 2OX0A 4BLJA 5JOWA 1KQRA 4HPKB 4QB6A 1HXS2 3AJZA 3EMRA 3MIDA 3OUIA 5GLUA 3DKWA 4NPLA 1GZWB 4K21A 3ZXAC 3A0NA 4OUMA 2Z69A 4AQ2A 4LBMA 1VMFA 3BPSA 3S30A 3TOJA 4AEDC 4LBQA 4LO4B 3AKPA 2LUWA 3B00A 1FPN2 1LKNA 1BEV1 1US3A 4IGPA 1U5ZA 3KCCA 3KCXA 1GMMA 1Y9MA 3EYPA 4TLGA 1W8TA 3WW4A 2HH9A 4QQLA 2BUKA 3GJBA 1UMZA 1UD1A 1VBA1 2VTXA 2ZX2A 5H9SA 4GB32 1H2KA 2QQKA 2R6QA 4Y20A 1OHFA 2QQLA 2HWB2 4RA0A 3B5LB 4FAGA 1D4VB 1AL0G 2E51A 2ZZJA 3NAPA 4P9JA 4XJWA 1ALYA 1WBFA 5FYVA 1POV0 3P1IA 2HWF3 3AMPA 3J8F3 5LCWL 3N7JA 2YFUA 3IT8A 4MHUA 1CX1A 4CCJA 4MGKE 4QQHA 4GH4C 1AR91 3ZFFC 3DGTA 4YW4A 3TB0A 1ZRDA 2VD7A 3OUHA 5GALA 1WW7A 4IDZA 1X33A 2P4EA 4CDWB 4NRMA 2XKPA 3LKJA 1XNAA 4ES8A 1AVBA 4YM3A 4ATEA 4QPIB 4H3WA 3PDQA 4LK7A 1W6OA 4QPYA 1RTVA 4LBOA 5FV3A 4OQ8A 5I0TA 5HPOA 2A73B 3U11A 3HOBA 2XUMA 1V70A 2W46A 2HWC3 3AYCA 1VBE3 2JKBA 2VZOA 3BVCA 4WZCA 4XVHA 4E2GA 3WQ0A 3R4SA 1C3HA 3OGJA 2GC1A 4IV1A 3SH5A 1O3RA 1W0OA 2WA3A 1CAVA 2CGOA 2WABA 1CZVA 4CP0A 5ANNA 3KS7A 4ARYA 4YW6A 5A3TA 1DGRA 5FK7A 4CUBA 3E6CC 3I2OA 2R0HA 2R073 3DXUA 1UNBA 3AVRA 3U78A 2RV9A 3AXDA 2PELA 2ATFA 5CKNA 3LEGA 4BJ0A 3B93A 5LY2A 1BK1A 1ASJ3 1ZZ8A 5FYHA 4CDQA 3ZIWA 1WA4A 3FZ3A 4YLZA 4LMFA 4AI8A 4AYUA 2XGXA 3SKVA 2J1EA 2WKKA 4HONA 5K7PA 5FZBA 4PCRA 4JV4A 3R4DB 5FO8B 5FZ1A 3RWNA 1HV0A 5E1RA 3ZSEA 1AL22 4QU1A 3BI3A 4Q4W1 2ZS6B 2VQUA 1COV1 4QB1A 5FXXA 2VZPA 2FCVA 3C8XA 3RPQA 3VLBB 4FBFA 3O7OA 4IL7A 1UYPA 2ZEWA 2RS12 4NWWA 5H9RA 3ZFEC 3AB0A 1HRV1 1K12A 4HMZA 3J7NA 1RUF2 4HG6B 5F3IA 3H8UA 4Y4RA 4CCDA 4DUXA 4IE7A 3FN9A 4KH9A 3VDDC 4AAPA 3SXWA 2JDZA 4JDOA 4F7ZA 3BIEA 4C91A 5LATA 4YM1A 5E16A 4FPHA 1NLSA 3RGBA 1SPPA 2OQ7A 3CIHA 4QX2A 4P5HA 5C3PA 5FIXA 1KGYA 1YC61 2EXHA 2UY8A 1NZCA 2JE8A 4RHV2 1UKRA 1QQP2 1DP0A 5FCCA 4HVQA 4Z2WA 2VW1A 2ADEA 2ENRA 5JWPA 2WT2A 4QXBA 3ENRA 3OCPA 5A3OA 3H1WA 4EJRA 3MW3A 4JGZC 4AFBA 3B94A 2R061 5A3NA 1K3IA 2XR4A 3NNMA 4IEPA 3VN4A 4BXSV 1JMUB 4Y33A 2WUHA 2XJUA 3WXPA 1LHUA 1Y9GA 1RUC3 1OOPB 2YROA 1PGW1 3ZM8A 2FQPA 5FPBA 2V09A 1SLIA 5HBAA 5BNPB 5A6YA 2VW2A 4BCUA 5HXMA 1GP6A 3PLQA 5LK7B 2PHFA 3DF0A 4NPMA 4QB2A 2WBKA 3CQOA 2Q8OA 2RMU3 3E1F1 4F8AA 4BQWA 2BV4A 5LRSA 1TME1 5J09A 5BPXA 3GYDA 2QNKA 5C8WA 2DVBA 2PHWA 2E33A 3EBRA 3LPFA 5LASA 2YB7A 5IK8A 2LTNA 3AZZA 4H7LA 4Y1XA 1XU2A 4YFWA 2P2KA 2Q1MA 3K4DA 4LHKA 5JIAA 2VQAA 2ZAHA 5DN2A 1VMHA 3ZFGB 3NV4A 5I0UA 2GH2A 2VW0A 3T4HB 3POBA 4AZZA 5SV5A 2D3PA 2GALA 4ISQA 5I8TA 3W58A 3ILNA 3ZYGA 2ZX0A 1HDKA 1YJLA 2Q4SA 4FQ4A 4QX8A 1NY71 3WP3A 4AF9A 4AVBA 4K3UA 4QGMA 1DGWX 5FBJA 1AR62 5FY1A 4AVAA 3KV9A 4M01A 3WNNA 4YM2A 5F6KA 2BNMA 3N9MA 4JQRA 2XJRA 1BEV3 5T5LA 2ZXQA 3H3LA 2C1FA 3VHNA 4A41A 5C8CC 1XOYA 1VBC1 2ZABA 3VBHA 3PTRB 1LU2A 3OF1A 5FO7B 1JUIA 3ZLIA 2GAUA 3PVNA 1VBA3 2WQZC 2XVGA 1CAUB 3DUIA 3I2FA 1MZEA 1W6NB 4QPGA 2E32A 4AFMA 1GKBA 2VH9A 4L92A 3GZUC 2FCUA 3ZPYA 2ZEXA 1AJOA 2HYKA 3QBQA 5F39A 2DVAA 2LM3A 1GZTA 1US2A 3AZYA 3AZWA 5HCBA 1V6JA 4W50A 1OVSA 2ZACA 2IXHA 2YBSA 1NQJA 2DFBA 2QKDA 2VNRA 1JYXA 1W6PB 2X09A 4OFGA 2WR9A 4AEDA 1W9FA 1RUG2 2YPJA 3V0BA 1QJU2 1NCQC 2RVAA 1UZVA 2XJPA 1RC6A 3RZLA 2JECA 1QMJA 2BU9A 3AL5A 3HVDA 4FPEA 4HSJA 1PK6B 2D7FA 3WW1A 4MGTA 4QKBA 1VBD1 2BNNA 4Y5Z0 3TWIA 4MSVA 3AXEA 1WMFA 2I07B 3JD71 5FZIA 3RG0A 5CYYA 1AYN2 1CPMA 1GANA 2OKXA 3RYKA 4Y26A 1Q5OA 4COYA 3CLPA 2ZCWA 1PVXA 1W2OA 1NCRC 1OQDA 3I3DA 4ES9A 4PF1A 1W03A 2XLFA 2E6VA 3OBZA 4GH4A 4CP9B 3ZFFA 5C33A 5FXZA 4LLOA 1L7RA 1GICA 3JQXA 2TNFA 5DG1A 4UT5A 5F2SA 5A32B 2ZEYA 4CRQA 4XPVA 4O9EA 2JG9B 3TRSB 4OHXA 4YWAA 2BWAA 4QAWA 2IZWA 4JX0A 3VZNA 4PDWC 1W28A 1H9PA 2D43A 3ILRA 1LEDA 1Y43B 2R1BA 3IPVB 5F5IA 5LBEA 4ZHNA 4D69A 3APBA 1DDLA 1O4ZA 4YVWC 4XMAA 4BQ1A 3ZVXA 4IEYA 3PUQA 1R1A1 5F3CA 3NJZA 2WO2A 1CZTA 1QU0A 1XNDA 2HYXA 4UFJA 4ZS2A 1UXZA 2JDMA 4MUVA 2J42A 4META 1G9DA 3UJQA 4LITA 4GMP3 3GHNA 3BB6A 3SQOA 1A3KA 3I2DA 5A7SA 4A44A 3POGA 3RZKA 1SDDB 1HX6A 4E8DA 3AMMA 4FTBA 3ETPA 3E6BA 1DGRN 4QPWA 2VL4A 3GBWA 4HN1A 1AXZA 4LNVA 4JKMA 2YC0A 1HN0A 4A42A 1NE4A 2WLPA 4AI1A 4H55A 2ZOEB 3UKNA 3PJQA 1WD4A 2P3IA 2ZAAA 4AI3A 5LW9A 1FMD3 1WLTA 1BK0A 3S5AA 1BVP1 2KD7A 1X50A 1X8MA 2VM9A 3E5UA 1W8ZA 5FYSA 4EWAA 5CFCC 5CKQA 1JZ4A 1FX5A 3H3ZA 3C7EA 1DZRA 3CJXA 1TEIA 2B8MA 4AFDA 4UFIA 1REDA 1VMJA 3MLJA 3ZFEA 1ZBE1 3OEAA 4WVVA 4AI2A 4BK4A 4IE6A 1YLLA 1UU4A 3RYRA 4S2DA 3MIGA 2B39A 3ZSMA 3O1UA 1AZDA 3B9IA 4AHXA 3VDDA 3FFQA 5J36A 3I3BA 1T2XA 2BGPA 2BYVE 4GKXA 2ZGTA 1MQTB 3LOIA 4Y22B 1QXJA 2NLRA 4DB5A 2Z2SB 2RS31 3LOBA 3OY8B 5A6XA 1HRI2 3CHXA 2OVUA 4I02A 1ZBA2 2RR11 2OUJA 3NVCA 2W2IA 4W6WA 2ZA9A 5F7UA 5A6ZA 2QQPA 2W3JA 2QQWA 1PO22 3LD8A 1T6GC 3LEKA 4LORA 4OUSA 4PIXA 5DZGA 4L9BA 4JGZA 3NJXA 5FP3A 5A6QA 1FXZA 3LDRA 4UOJA 3UGGA 4BQ2A 3WNOA 4PLMA 4QKFA 3O1TA 2ZMLA 5LEJA 1S4CA 1CD3G 4UW3A 5D21A 2YYOA 4LULA 2PXJA 3ZX7A 4JQTA 3LIHA 3V65A 3Q9OA 5AVAA 4RL7A 4LHNA 1B09A 1KXGA 3U75A 4JGYC 5LA2A 4HKOA 1W6MA 2DCTA 5D8AB 2WN3A 5JSPA 4TWTA 2CU5A 1DQ6A 2P5BA 2GP5A 1H6XA 4L11A 4EQVA 4E4ZA 1VLNA 5FY4A 4YPJA 1ZRFA 2GDFA 4HKWA 1LOEA 1N3QA 2WN2A 2XLGA 3WDVA 5JMOA 4XCAA 1J3QA 3DECA 3RRDA 5L19A 4FPYA 4GJYA 4Q4X2 2RG4A 4LKDA 2C26A 4B29A 4CEWB 5BV6A 1ZZ6A 3ZSKA 1EAH2 2PAKA 1MZ6A 5GZDA 4A6SA 4PI2A 1FPN1 4XTMA 1AX1A 1GOGA 1MEC2 1UYYA 4A7KA 1NX9A 5JLVA 1VPHA 4BU2A 3S57A 4B4QA 1W6QA 3FBYA 2PN5A 1I5ZA 2VMEA 3DV8A 5JMCA 4B1LA 1FAYA 1YQ6A 1GP4A 2V5DA 4GB31 2V73A 2FDFA 3DPRC 2VY0A 2ARCA 2HWB1 3ES4A 5C8CA 2LW8A 4OHZA 3K51A 3MHZA 1YRZA 5IVJA 2JX9A 1JN2P 1VALA 2K0GA 1KD7A 2AREA 1VBD3 4QX7A 3M1HA 3WV6A 1YJKA 2VQ0A 1C8NA 1U5XA 3AP9A 3IAPA 1XNTA 4HLTA 2WINB 3JD73 5C4WB 3I2IA 4UFLA 2WIIB 2PHTA 4RGAA 2ZGUA 4D8MA 1JYNA 1DZQA 1DYOA 3AYEA 5C3SA 3C7FA 1UZWA 4NHYA 5GZEA 3AP6A 4GULA 4L8QA 3LB9A 2VNVA 1HW5A 4MGQA 1Z7S1 4LO6B 3PUHA 1H8VA 4Q1RA 4XBLA 2JDNA 1PX3A 4XACA 4LIVA 2IXIA 3WW3A 1NCQA 1RVF1 1WCQA 4XXPA 1IZ3A 2DVDA 2WWUA 5K4LA 4LXLA 4SLIA 4Y5TA 4LO7A 5FAXA 4M3CF 2WSVA 5AFEA 1P8JA 5T54A 4FFIA 3ZSJA 3VZKA 4X6RB 4FTSA 2W1QA 5J7MA 3VKFC 1MS0A 1LOGA 2D3RA 3ON7A 3VHPA 1RHI1 1ND2B 3WLUA 4ET7A 1R1A3 4RQPC 1CN1A 3I49A 3NNGA 3TN92 5FZ9A 3BTZA 4UAPA 5HCFA 3ZYRA 5A33B 4S2GA 1NCRA 3BYWA 2XL7A 4O9GA 1K45A 2VZ1A 3OGRA 2FHRA 2VMFA 1CESA 3KB5A 5FMOL 2W39A 4OI0A 4XUPA 1HLCA 4YZ5A 5IVVA 3ZYJB 1DQ4A 3BGAA 5B4NA 1JZ5A 3OTFA 3OPWA 3UKTA 3OGVA 4TLFA 4CE8A 5FK8A 4LO5B 3GZAA 2ZMKA 5KHKA 3MV01 4IV3B 4PDWA 2W92A 1WZXA 5JIUA 1CONA 2WYSA 4KL1A 1ZRCA 4IGOA 1SMVA 2OUHA 1OLQA 2XHNA 4YVWA 2SBAA 1VAKA 1RUF1 1UYZA 2QQIA 5A7OA 3ZXGA 3HIFA 4CDWC 4D6QA 1V6KA 2BGCA 4YG6A 3KM5A 4CCNA 4QPIC 1GWMA 3D4KA 1XSRA 1RUH2 1Q8QA 3CMGA 1ZBE3 1MPXA 2OPKA 4FFGA 1M06G 2K46A 4C0BA 3BODA 3SCFA 3FHAA 3ZSLA 4NR1A 3MBWA 4OI1A 4I0BA 4Q0VA 1NYWA 3ZDVA 2V72A 3MFCA 3H8RA 3K3NA 4ORFA 4RHV1 3BIWE 3BOPA 4RYDA 4YW7A 1QQP1 1UIKA 1V6NA 3RJ2X 3S7IA 3GGLA 1CGPA 4BQ4A 2IVJA 2EALA 1MS8A 4FCAA 4YGDA 3J8F1 1I5PA 3ASIA 2E7QA 3VBRC 5C3OA 3N7MA 4LK6A 3N9OA 4JHTA 5CFCA 3PJYA 3KQ4B 2A5ZA 2WT1A 3WINE 5C71A 1R1ZA 5T52A 1K5JA 4RGKA 3U07A 1WW6A 2YV8A 5JDBA 4K20A 2RM22 4ZZ8A 1C57A 4UF0B 3U10A 2E9QA 4S2HA 3TBDA 1RXGA 1UW8A 1VRH2 1G9CA 4AXOA 2HWC1 2VVEA 1VBE1 4V2WA 3HNBM 4MHRA 3FHQA 2X05A 1PO12 2WNEA 4DO0A 4BH9A 1JYIA 1RITA 2MEV3 4UFKA 2ZPXA 5DAPA 1LOBA 3WDTA 3WNKA 3FUQA 5T5OA 2WQ4A 3JBG3 5JAXA 1BBT2 1VAMA 5CADA 2HWE2 1DIWA 5FZDA 3ZMOA 1WMEA 2PHXA 2R071 3V0AB 1HXS3 5BNOB 3N9QA 4XE9A 2YGLA 5FPVA 1JYWA 2BBAA 4S2FA 1ENSA 5FLHA 5A1FA 1UZZA 1AR61 3AJYA 4ZONA 1V0AA 3SNMA 3DL3A 3HD8B 1RUNA 3AP7A 4P08A 1NLRA 2WFF2 1FPN3 4K7JA 1JZ3A 2WZPP 1OFNA 2KA3A 5FYYA 4YSFA 2QQUA 2YG0A 1ZZBA 3FLTA 3PNAA 1SLBA 3AYAA 4MH0E 5C6CA 1ND3B 2W68A 4GB33 2JENA 4JGYA 5C9AB 3AFGA 1MS1A 3VL9A 3S7EA 3WY6A 3HWJA 2JICA 4LLFA 4QM8A 2HWB3 3W20A 4NRQA 5AVPA 1BMV2 1YHFA 1OOPC 5FMCA 3ZO0B 2R1DA 4CUGA 5G05L 5F37A 1J83A 1LEMA 1AJKA 3EJKA 4IETA 1S55A 1XYNA 3TEZA 3CKHA 1H2MA 2PHDA 1UU5A 2XQRA 4NIHA 1C5IA 4WBBA 5EYXA 2VBDA 3AP4A 4XXAA 3S6PA 3IAQA 1ACCA 2H0BA 1RUG1 4HKLA 1AR82 4TZDA 4FPGA 5KC5A 1E5HA 3QLQA 1ENXA 3UL2A 2ILMA 3M2MA 4HFSA 1GFF2 1OC1A 3VHRA 1JYTA 3WF1A 5HV0A 2Q8EA 3WZ1A 5F9TA 4M3CE 2HKXA 2VZVA 1QF3A 3DPRA 3NO8A 4XFCA 2GC0A 3ZFGC 4JHZA 3ME2A 4FI9A 5LBFA 3MO4A 5LA0A 1AYN1 1HV1A 3ZN4A 4BMBA 5DAVA 3UETA 4AHYA 1WMDA 3WR0A 5L9BA 4AHWA 5DDJ2 3BCWA 5CFDC 1JZ7A 2V4AA 4EWEA 5IVBA 2B4KA 4K40A 2ORZA 1HN1A 5IVEA 1UN1A 3WD5A 4CDUB 1YNAA 2CL2A 2CDOA 4M3CB 4KG8A 1L7QA 3W5NA 2I45A 4JRLA 2FD8A 1V9U2 2ZGSA 1QGLA 3WF0A 1Q3EA 1QJY2 2EIEA 1NG0A 1MS9A 4MX3A 4AAXA 3FFZA 3O12A 2ZHNA 3NL1A 4CZSA 1NXD1 2ZGNA 1W99A 3M70A 5K9YA 4LOTA 4XFIA 2HJIA 2F17A 2ZX4A 4XW3A 4XDPA 1RUJ2 4BM8A 3WVJA 2YPDA 1YIPA 2Z4FA 3GBGA 3MV11 3R4UA 3U37A 4ASMB 2D40A 3HAGA 3PUSA 4LBLA 4LO8A 4QM9A 3D0JA 3B3QE 5CZKA 1LENA 1E5IA 4XFHA 3C3VA 2W52A 3AKQA 4HPKA 1AL23 5FZGA 2W47A 4DPNA 4EROA 2GMMA 1GZWA 4WM8B 5GZFA 2XOMA 4N43B 4Q0QA 3B02A 3ZXFA 4NJ4A 2RS13 3OJBA 4BLIA 1OLME 1JU4A 5IW0A 2A3WA 2DF7A 3TYJA 1W05A 4M4PA 1WCKA 1RUF3 4QXCA 5EYYA 2J1SA 1SFNA 4RQPA 4XJ8A 3VBFB 2A71A 2OZJA 4OZOA 3OG2A 3P3NA 4MADA 3TNPB 4CCMA 1K5MB 4FVVA 3HMYA 4TTGA 3D6EA 2Z79A 2RDQA 5EZWA 2GMEA 4CUCA 4JCKA 4QKNA 2JDHA 4XDOA 1OLMA 3ELNA 2VR4A 5KWRA 3VUOA 4RHV3 1GNZA 3NSTA 1QQP3 5T3NA 2BGOA 4QDQA 4DXSA 2HEWF 1TE1B 3G6JB 4FPFA 1X36A 1RUD2 3L2HA 4BQXA 4I3PA 1W06A 3H7JA 5JXGA 5GM0A 4NRPA 3RDIA 2QTWB 1G8WA 5I91A 1WW4A 4D7YA 3AYDA 1H9WA 2MHFA 3KGLA 4Y1ZA 4CDWA 3GJAA 1DG6A 3E6DA 4JVAA 1UOGA 4I01A 4QPIA 4WVMB 4AK3A 1ODMA 3ITQA 1NOVA 1J59A 4CXWA 2YC4A 4OCTA 4XFGA 2QDRA 4LUMA 5FPAA 3UYJA 4AR2A 5HCHA 5FREA 2DUOA 3QD6A 1UOJA 2AYHA 3ZKYA 1G6NA 2YU2A 2XG3A 3ACFA 2GNBA 4RR3A 3RQ0A 3WF4A 1ZBA1 4EWDA 4FXKB 1YFUA 2WZR2 4FPLA 4H2AA 3WQBA 4ONUA 3CZJA 1WCDJ 4WZFA 4YZ2A 1GWKA 4CCKA 5DMYA 1PO21 4XJZA 3A23A 1SLLA 4G4FA 2D5HA 1LHWA 3VBRA 1OXCA 4OVEA 4Q4Y2 4XHXA 3H3UA 4FOQA 5C3RA 4LBQD 5D2AA 4K1YA 3VL8A 1UCXA 3IIAA 2Q8CA 1IQDC 1REFA 2G9FA 1AUYA 1I3HA 4XFBA 1S0IA 3SITA 1AR63 4FFFA 1GQGA 3NNLA 4HANA 2J1TA 3VZJA 4NVPA 4E27A 2JIGA 2D6PA 1VAVA 4IQPA 1QEXA 3OYWB 4IV1B 3M3CA 2VXRA 5IYYA 4G9SB 5L73A 4CDXB 1YO8A 1SLAA 2WQ8A 2O1QA 4XUOA 4CEYB 5FP7A 5IUQA 4JC1A 5EV7A 2NMNA 4COVA 1PIV2 4DUWA 2ES3A 2X5IB 1W0NA 5FY9A 5C70A 2CWSA 4NWVA 1PMIA 3AMNA 4MXWB 3OPTA 1EAH1 2WA4A 4GMP1 1DZTA 1PNGA 1F31A 3LSEA 3POWA 4R8HA 1LAJA 1MEC1 3PUAA 1F4AA 2YZ4A 4UW6A 4L97A 5FWEA 4CCLA 5LBBA 3ILFA 4OUEA 4ZZ5A 3POYA 1XU1A 4PIYA 1IOAA 4R9DA 4ZU5A 1IG0A 2DWRA 5CISA 5J1XA 1MQTC 1RUG3 1ZZ7A 1QJU3 1UY0A 4Q5OA 2W08A 2C24A 1C1FA 4UW5A 3WF3A 1FMD1 1UAIA 1V6OA 1WCSA 3EQEA 4CCOA 3RZHA 1D0GA 2OA2A 4QGLA 4OHYA 3HJRA 4C1XA 2IXCA 2QQJA 5LB6A 3M4FA 1POV3 5HV4A 4NHKA 3C7HA 2VOKA 1A78A 3CU7A 2ZHLA 2H6BA 4M0NA 4PQ9A 1DFQA 4LTAA 2YBKA 3AVSA 2DCKA 4CYDA 2A6XA 2LS6A 1AYN3 4IE5A 2L9LA 3HQXA 1UQXA 4IEVA 3ZXKA 3ST7A 1OOPA 1CAWB 1H1MA 3KWVA 3VBUB 4CPBA 1HB3A 4COUA 4LQRA 4XFFA 4KQ7A 1HIXA 1VRBA 4BOWA 2WO7A 3CO2A 1O8SA 4XOGA 4GWNA 2W1WA 3POSA 2HWD2 1H0BA 5GZGA 2FZ2A 5JUVA 1BHGA 1GYKA 5GZCA 2N7GA 3EXUA 2GU9A 2IVIB 4L2NA 2A1XA 4FPJA 1KEXA 2A70A 2B9UA 1OQEA 3A0KA 3I7DA 2D6KA 2QZ3A 4XAAA 4FP3A 3ZFGA 1IGOA 1WLDA 1OA4A 4P02B 1QDCA 1IKQA 1CAXB 1IS3A 1JOPA 1A8MA 2UY9A 3BPZA 4ZY9A 4KBZA 1MVQA 5FPZA 5IFTA 4XFAA 5L7OB 5CFDA 1KJRA 2BFUS 4YZ3A 4LBKA 2ARXA 3D82A 3MIBA 1JUHA 1IG3A 1PVC2 3WQ7A 3AMQA 2VOTA 3T0BA 1DQ2A 1VBB2 4HSLA 5FLIA 2DUPA 3BALA 2W1SA 1F35A 4M4RA 4NN0A 2CY6A 1DGLA 2KR2A 2WFPA 1Q8PA 2XJTA 3KT4A 3FHIB 1CAUA 1W6NA 5JSRA 1V6IA 1UY2A 1O5LA 1UYXA 5C5TA 4OULA 1EPZA 2W94A 4UWDA 2Y6FA 4LPLA 5F32A 5C4WC 1QXRA 2FDGA 4CPBD 1H4HA 2PAEA 4W8JA 4H14A 2WNUB 2J1VA 1KFXL 1W8NA 4MGIE 2B7YA 5FY8A 4EN9B 5C7GA 1WGPA 1YI9A 2QJVA 4KI5M 3T30A 5JXJA 1RUH1 1RUOA 3CJIB 1W6PA 5LBCA 2XONA 5L9VA 5FWJA 3ZYFA 1AYM2 5A3MA 2VULA 5KXEA 2HBTA 5EXOA 4MVTA 4ARXA 4QPGB 2VXJA 4P14A 3IDBB 3THDA 3HNYM 4G3YC 3J4UH 1SFPA 2DVFA 4J25A 1AR72 1YQ2A 2H0VA 1NE6A 2C6SA 3ZXDA 3HEIA 2PQSA 1UKGA 5FZOB 1GNHA 4D94A 1HRI3 1UZ0A 2VOXA 3DYPA 1JU3A 1ZBA3 3UT0A 2IWGB 1ND2C 3WX5A 2OZ6A 4XQ4A 3ALQA 1PO23 2VPVA 5F3EA 3ACLA 3BU0A 2JKXA 4XUTA 4N7UA 2E7AA 4D6SA 5JZGB 3UV9A 3N7LA 3G7DA 2AH2A 2Q5TA 4QD2A 3UGFA 2UU8A 4CP9A 3KGZA 4OYUA 4WV8A 4DXTA 1KS5A 4P9WA 2Y33A 3OGSA 1VP6A 3DKQA 5CA6A 4RN5A 1PO11 3FUOA 4AVVA 1QJX2 5BNNB 1POQA 2DTWA 4Y1VA 1LESA 2X8KA 5FUIA 4I2OA 2ZX1A 3H50A 1CX4A 2Y6LA 4P00B 3VBOB 1Y7BA 4P9IA 3IPVA 5I8SA 5BNQA 1TMF2 2VGDA 3PHMA 2HWE1 4N9HA 4TYSA 1W8HA 1LECA 2BNOA 1UPIA 2QFEA 3ZN6B 1ZNPA 2XB6C 2GNMA 4Q4X3 2GC2A 3KMHA 2VZRA 1SHWB 1YCIA 3VD5A 3OD0A 2VMGA 3GCXA 2QQVA 3VBSB 2CSGA 4MZUA 1EAH3 4QT6A 2DUQA 2DBIA 5GLZA 1MEC3 1QJEA 1UMHA 2LALA 3QACA 2FCTA 4GXLA 3T1LA 3ZYIB 3H7YA 2DU1A 1OD3A 2EIBA 4M00A 5JR7B 2QE3A 3MIEA 2ZGLA 3VKOA 1XNBA 3LFMA 1ENQA 2HBUA 2WS92 3JCIA 1LB2A 1J84A 3LFIA 1H4GA 5FZFA 3FBMA 5A70A 2A6WA 4MGSA 2Q30A 1W2UA 3VKNA 1QOSA 1YWKA 1GR3A 4Z8BA 3USUA 1EP0A 1Q8VA 3E5XA 4UBGA 1RXFA 2VUAA 3P5BA 5FZ0A 3CZUA 1KITA 4K6BA 3WP5A 4DNYA 1UX7A 1GQPA 5FQ0A 2ARAA 3URFA 2BWCA 5J98B 3SMHA 5AFBA 2VMHA 1AR81 1VB2A 1Y4WA 3LCPA 4P9LA 4PT6A 1S0BA 1LHNA 1FOD2 3I2KA 3VZLA 3BU7A 4LE4A 1OVPA 4DIQA 2Y6HA 5T5JA 2JD9A 4P9YA 1MQTA 3IZOA 2ZKLA 2O8QA 2PHRA 3KV6A 1W8OA 3FE5A 3GDBA 4XZUG 1PGL2 3UGHA 3OY8A 5FYBA 5T50A 3I2GA 3OBTA 2ET1A 2EAAA 4Q0PA 3OBAA 5JI9A 3ZXLA 5BNOC 3L9JT 2PYTA 1U12A 2P3YA 3Q8FA 5DABA 5DDJ1 3W9AA 3ZFEB 4CVUA 2AZ5A 1GNYA 5EQUA 1AR92 3KVAA 4O61A 1E5RA 2R49A 2W91A 4TSVA 3VDDB 5CNAA 2KM2A 4COZA 5FKBA 4J6GA 1Q43A 1V9U1 4EN8B 3TN93 1QH7A 1QJY1 3MW2A 1XYOA 4LA2A 5DUVA 4BK5A 1BCXA 3QCWA 1UMIA 1VIWB 2CYFA 1ZM1A 5FYTA 4DMIA 1H8TC 4QHBA 2GN7A 3HT1A 4N9IA 1A8DA 3WSOA 2MEV1 5C9AC 5FPXA 1OD5A 3I4IA 3LZZA 2ZGOA 3T0DA 3JBG1 5KR7A 3O1RA 2D97A 3TEWA 2GZWA 2NN8A 2D6MA 3A7QA 3T2PA 5LEKA 1TG7A 1LULA 2AC1A 1HXS1 2NZ9A 4JGZB 4GD4A 5FRAA 4SBVA 4L99A 1J3PA 2IXJA 3ORJA 3WOGA 4COWA 3MF6A 3AZVA 4OHVA 4NIAA 1NQDA 1UU6A 5AC92 4ZS3A 2Y8KA 1MACA 1N47A 4O7XA 5C5UA 1QXPA 4XURA 2DCZA 1L7LA 2FMDA 3ZOIA 1RUH3 3ABZA 1Z78A 2RDNA 3AKTA 4U2AA 1OMIA 1W3XA 4W6XA 5CB7A 2VCCA 3POIA 2VZ3A 3OEBA 2R30A 1WMXA 4XILA 1NLQA 1SCSA 1HQNA 1DBNA 4Q4W2 1COV2 3VGIA 5IK5A 4P9GA 1LOCA 1LR5A 1D7PM 3FX3A 4Q4V2 4TXWA 4XMIA 5E89A 5E6HA 3RMXA 3NQHA 5EFUA 1HRV2 2JE9A 3FLPA 3HN1A 1W39A 2BRTA 3LQCA 5CU1A 3VKLA 2NP0A 1O6UA 4N53B 4IEUA 1DCSA 5C4WA 3I54A 1HKDA 3ZXJA 4CDUC 3OGGA 1J3RA 3EO6A 3THTA 4LOSA 4U36A 3SCHA 3OD4A 3RJRA 3AP5A 3K3OA 1XBFA 1OF3A 1LGNA 1NXMA 5LA1A 2OT7A 4CUAA 1WCUA 2I2SA 2RM23 1V00A 2YDEA 2QZ2A 1ULPA 4MOAA 5KHGA 4LJHA 3H1YA 1OF4A 1VRH3 3JB4C 5C8CB 2GC3A 3A22A 5T55A 3CEWA 1JHNA 3TAYA 2VCMA 1IQAA 5E8AA 1SBEA 4P9XA 3CL1A 4Q8LA 4UI9L 1PO13 1NA1B 5LWBA 3SH3A 2ETEA 4PLOA 2R062 2R042 3M3IA 1UZYA 3ES1A 4E8CA 4N43C 1ZYBA 3Q8BA 1ZA7A 4DEVA 5FY5A 4C0HA 1F8VA 1BBT3 4LR4A 1PGW2 2HWE3 1SLCA 4AOCA 2DCYA 1ND2A 5FZKA 4FQZA 1PZ7A 3T2QA 4CP2A 1HJFA 2NYYA 3VBFC 3IDEA 1IKPA 3OB8A 3N9NA 5A33A 5IK4A 4JKKA 1K5MC 4WM7B 2XMLA 4Q0SA 5IWFA 4UFMA 5A1LA 4O65A 4IEWA 4W65A 1TME2 2JXAA 2WFF3 4NMIA 1YFYA 3T08A 3NNJA 5A7NA 3J7MA 2FBEA 4Q29A 5FYIA 3RWKX 5FZCA 4JTNA 1JHJA 1QIQA 3NV1A 5EP9A 5BUVA 5KC6A 5FZ6A 3P6BA 1PM4A 1AL21 5FOBB 1XE7A 2VZTA 3LE0A 1JH5A 4IERA 5EWSA 4HXCA 5G04L 2RJKA 2VJXA 3NV2A 2J1RA 3PVBB 3RZZA 3BKZA 2BW8A 5H9PA 1QWRA 1I6XA 2RS11 5A7WB 1OUSA 4ZU7A 4PBOA 5FZ3A 1JBCA 3RSJA 3WG3A 1O5UA 3ZR6A 1SFYA 5I93A 5C3QA 5JOZA 1J1TA 3NJYA 3JZVA 3NW4A 5FP9A 5FJKA 2D93A 1S0JA 4HK9A 4EV0A 1AR83 2BBVA 4YVSB 4BISA 4HBNA 1JZ2A 2ARBA 1CJPA 2BEOA 4PDWB 4XF1A 5FP4A 3WUCA 1JOJA 2G9GA 3U4XA 1YFXA 1H2NA 1DQ5A 2PLV2 1N1TA 1EYBA 1Z0HA 3OOXA 4XETA 1EV12 3ATGA 5EPAA 4B7KA 2SLIA 1YQCA 5APAA 4A7YA 2E31A 3OPZA 2AUYA 1FI2A 2XHKA 2XUEA 5FMBA 3T3YA 3USSA 1W04A 1DLCA 5L36A 1RUI2 4NAMA 5DDJ3 4Q1PA 3ZIXA 1PHMA 2ZGMA 3WNMA 1G9FA 1W3VA 3KVBA 3IN9A 4XJ9A 5FYZA 5TSWA 4PIZA 3VDAA 4AGRA 4V2VA 4N7IA 4KMQA 4MO3M 2UURA 2Y6KA 1V9U3 3K2OA 1U0AA 2JG8B 2PHLA 1SCRA 3AKSA 3BOWA 4YW2A 1QJY3 4BQYA 4CDXC 4DFSA 4DXZA 5K0UB 2A6VA 1APNA 2C9KA 2XJSA 1W2TA 4Z07A 1DU3D 3J7LA 2DTYA 4CEYC 1RUJ3 1V6LA 1D4M2 1ULFA 2X5IC 1OPMA 5CFCB 1WD3A 3ACGA 2XBO2 4XHBA 4PLNA 4QXHA 3RZGA 1CIYA 1BZWA 2OIIA 1TZOA 1GU3A 3V0AA 3HN3A 3PVOA 5BNOA 4P5YA 1YUDA 4YW1A 3ZN5A 2W95A 3T1MA 3WG2A 2RS52 4GA9A 1SDWA 2A6ZA 3K4AA 2CDPA 3ZPOA 4B7EA 4KWUA 1CPNA 1OFSA 3DYMA 1PVC1 5L9RA 3RFRA 5A1AA 3WHUA 4JRAA 4LIUA 1VBB1 3JXSA 4NHXA 2H6CA 2WNVB 1YFWA 4QDSA 4QQ2A 2D3SA 4BWOA 4HETA 3P3PA 2EAKA 5F1RA 3DN7A 4MGYE 2X29A 3NNFA 3MUZ1 5JXIA 5FZ7A 1H8TA 3VDBA 3EHKA 1S1AA 1H2LA 5C9AA 2PTMA 3BUCA 2Q1ZB 4D3WA 4AE2A 3SHRA 4KG0A 1ZREA 3MPBA 5FZ8A 4K1ZA 4OMCA 5ABJB 4GIQA 1C8M2 3VBUC 5IVFA 2XJQA 1E5SA 5DZEA 4GZ9A
chains in the Genus database with same CATH topology
3FC0A 2EVXA 5CIRA 4D7TA 1RUD3 5BNPC 4RS5B 2VNGA 1O4YA 2XJVA 3I59B 1DYPA 2VMIA 3N35A 4UXAA 1KDMA 1KJLA 1QJU1 1MZ5A 4FP2A 5A3LA 1WBLA 1R082 3M3QA 4RGGA 4JGYB 4KWKA 1POV1 4ZKTB 1AR71 1XYPA 1G9AA 1BJQA 1EPWA 3M8LA 5JOYA 1CIWA 3MEPA 1KS4A 3R05A 2IFWA 2WZR3 3KT1A 1PZ9A 2ZGRA 2O0OA 5L7OC 2WJSA 1LU1A 2DFCA 1B35B 4NO4A 1C5HA 3NKTA 4Q4Y3 3LA2A 3AX4A 4CDUA 1QJZA 2BVBA 3KSCA 4M3CA 4X8PA 3ZDSA 4YARA 4XBNA 1O91A 3O0XA 5FBZA 2IXKA 3B7MA 4XYXA 4I3GA 1QJX1 1A6CA 2RS32 1Q56A 5HCAA 2IXLA 4NHMA 4Z1VA 1AXYA 2RR12 3JQWA 1TMF1 4XIOA 3WW2A 2ZKNA 1RIRA 4W6YA 5H9QA 4EN7B 3JUUA 2WNUC 2WSUA 1L3JA 1PIV3 2JEMA 3LA7A 4N43A 4BMEA 3MICA 3THPA 5DG2A 3U0ZA 3CJIC 4KWJA 1IPKA 3VBFA 2E53A 4XJAA 1XQNA 4AFCA 1XNCA 1K5MA 3MIFA 4YNIA 1UX6A 1PK6C 3NV3A 1FT9A 2VNOA 3VHOA 4DOUA 1ULDA 2V5YA 5KXDA 1SACA 1N1YA 3MIHA 2WLQA 1QH6A 3WNXA 4BE3A 2YUEA 4XF0A 4KNCA 4OLLA 5JZGC 4LBQB 4XEZA 4RQPB 4JTOA 1WLCA 1X7NA 5CBLA 4M0HA 2ZGKA 4LT5A 2WC2A 2A3YA 1FOD1 2CV6A 4WVMA 1ULEA 2E63A 2JG9C 1HQWA 5BNNC 3KLSA 3OBRA 3ROUA 3PTYA 3R0RA 4Y20B 3D5OA 3VBOC 5ACA2 2HWD3 1PGL1 2C0ZA 2A3XA 4ZU4A 3WQ1A 4ATFA 1HRI1 3NAPB 1EY2A 3AK0A 4UW4A 2JE7A 4B8EA 3FWEA 2YGMA 3GBFA 1F9KA 2D44A 4F3JA 1VB4A 3KD4A 5HI0A 5CAZA 4AI0A 3VBSC 2DURA 1X8EA 1J1LA 5J48A 4ISRA 5KHIA 2Y26A 1LTEA 3ZMNA 5J37A 1Z7S2 1W6OB 1KDKA 4XZPA 4YM0A 2XH6A 4ITCA 4YZ4A 1PVC3 2QDNA 2RJLA 1IS6A 2UWCA 1RVF2 2EF6A 4HZFA 4RR3B 1VBB3 2VU9A 3OYWA 2ERFA 4AVCA 4CDXA 5EJ3A 1FV3A 1ULCA 2R32A 1CAVB 4IXLA 2D6NA 5BXXA 4GALA 1GQHA 4CEYA 4DY5A 1RJ8A 3VBRB 2WWSA 2ZZQA 4Q4X1 1DQ1A 1YIFA 2X5IA 1RHI2 3KT7A 1TNRA 4BA6A 4MXWA 4LBNA 4XDQA 1SEFA 3MF9A 3H1MA 1RUE2 1XE8A 1R092 5AC91 1C28A 5CG9A 3SLIA 4CDQB 2XKOA 2GN3A 4URTA 3K48A 3C2UA 4RFT0 4XBQA 1QHDA 1AYM3 2JJ6A 5E88A 3VZOA 2XVLA 3WUDA 3MLLA 4XF9A 3WHTA 4Q4V1 1ZX5A 3WDXA 2OYZA 1AR73 4JDMA 5KXCA 4RD7A 4AEKA 4NOTA 2D98A 1CJDA 1C1LA 1QDOA 4Q0UA 5JSOA 2YY1A 2C9AA 2VECA 1CAWA 3VBUA 4B4RA 5JPNB 1ONAA 3MYXA 5BNPA 1RMU3 1ULGA 1LHVA 3FMGA 2D6OX 2ZHKA 5IT6A 1LGCA 3RNSA 4LUKA 4XQDA 5D8AC 3ECQA 1XXNA 2P3KA 3RI8A 3SCGA 5BYNA 2GNTA 1QJX3 2NPIA 2HWF2 1WLWA 2A75A 3J8F2 4GKYA 4AFAA 2R041 5KBFA 1XNKA 2BQPA 4XF4A 4BIOA 1MZFA 1TMF3 1AF9A 4WVZA 5DUWA 2ZGQA 4CEWC 4HL0A 4IEZA 1CAXA 3O14A 2G4IA 5L7OA 1OSGA 3M3OA 5LRRA 3TN91 4AVSA 1MR5A 2UYAA 2VOVA 1QKQA 4DZGA 4KU8A 2HWC2 1VBE2 5I8YA 3M7AA 3MGUA 4E9KA 5SV8A 3IWZA 2PA7A 3VZMA 5HXVA 3HR9A 1SBDA 2WS93 4AWDA 1REEA 1Q8OA 4ASLA 2VUJA 4PBPA 4I09A 2VOWA 2R072 4N53C 1VJ2A 2AGSA 5CFDB 1O3SA 3PMEA 1SLTA 2B42B 2BFUL 2WNUA 4DY3A 2F6BA 1ASJ2 4I30A 4GMP0 1UIJA 1LHOA 2JD4A 3W59A 4KWLA 4JAAA 3CJIA 2XVKA 4HN0A 3GHMA 1JXNA 1UL9A 3VBHB 1FOD3 1XRUA 4C1WA 1NA1C 2BTVC 1PK6A 2P34A 4KGGA 4DINB 2PLV1 4MXVA 5GLVA 2B46X 4QX5A 1EV11 2K9ZA 1OI6A 4R4XA 4FPOB 1RUI1 1RL3A 3N7KA 4A2UA 2YMZA 1AR93 4YW3A 1RMU2 4WM7C 1LRHA 2ZJCA 4AEDB 5JZGA 1ENRA 4K8FA 2RM21 4OI2A 3R6SA 3V0BB 1FNYA 1BKZA 2YXSA 4X8NA 4HT1T 2RE9A 2GMPA 1VRH1 3X29B 1J58A 5A32A 1G9BA 1S0CA 4FO9A 4LA3A 2AR6A 1GSLA 1FYUA 2Y38A 4R4ZA 4C90A 2JG9A 2XWBB 4E4DX 3IMNA 1RB8G 4YW5A 5BNNA 4AVTA 4IV3C 4MV2A 1D4M1 1ZZCA 3VBOA 1FNZA 2XBO1 1U5IA 3GZTB 1RUC2 1BBT1 3B01A 4YG0A 3ZN6A 1S0DA 4KU7A 4YYOA 2RS51 1N3PA 5J96B 4GH4B 4BZ4A 3ZFFB 4FXGB 3VBSA 2RMU2 1LOFC 5AC93 4YVSC 2WFF1 2XPJA 2BPA2 4UBHA 4E2QA 5J3UA 2EIGA 2CNAA 2DCJA 3AM2A 4IEQA 4Z82A 1F2NA 4F83A 1FATA 1LGBA 2P37A 2ZBJA 4Q4W3 1MVEA 4FOWA 1BVVA 1COV3 4ZXKA 2BVVA 1QNWA 2D5FA 1BMV1 1C8M1 4Q4V3 2P17A 1HRV3 1VR3A 1IS5A 4AQSA 4J1WA 4KGQA 3WT3A 1SBFA 1BEV2 4CTEA 4X6QB 2JG8C 1R081 2TEPA 1F5JA 2AENA 3MPPG 5K0UC 5KHHA 1VBA2 3WCRA 4E2SA 4DRVA 1GZCA 3T2TA 1D2SA 1QNYA 1WW5A 4Y22A 3USUB 3TNQA 2X53S 3GF6A 2Q0AA 3S0MA 3E5QA 1PGSA 2ZGPA 2ZX3A 5KHJA 1YYNA 2B5HA 2R063 2R043 2D6LX 5FQ0B 4I0AA 4AQ6A 2YHJA 2CAVA 4YGCA 2HEYF 2NMOA 4N90A 3RS6A 5F5QA 1CVNA 4Q27A 2EA7A 2WNVC 4FPCA 3WDWA 5CVRA 5I0RA 1GV9A 1RGSA 4FPKA 1ND3C 1TME3 1RUJ1 2ZHMA 3CNAA 5D8AA 1M4WA 2FZ1A 2QCSB 4Q2FA 3N36A 5FO9B 2IC1A 3ZYPA 5ABJC 4PJYA 3JU9A 4BIFA 1N1VA 4RS5C 3MLKA 2QVSB 2VG9A 1E57A 3KZ4C 4CEWA 4GWMA 2CWMA 2PQQA 3IM0A 3LGRA 5FOJB 1QOOA 1V6MA 2PHUA 2TUNA 5JPMB 4R9AA 5JCTA 4RSUA 2B45X 2P3JA 1W6MB 4NPRA 1N1SA 4YRDA 2DV9A 1VBC3 2GNDA 4OZXA 1AX2A 4LE3A 1Y3TA 4HVOA 3J26N 3SISA 1D2QA 4B3NA 4FSJA 4QQPA 3JB8A 2PLV3 1O3QA 4YGEA 4OI4A 2A6YA 2UWAA 4XF1A 2RHPA 1EV13 1B35C 1RUD1 4N53A 3FJSA 1DYKA 2WL1A 4EN0A 1IHMA 5IK7A 1RUI3 3A4UA 4DS0A 1SQ4A 1W6QB 1RJ7A 2IFRA 2VVDA 1FMD2 4Y24A 3LSDA 5ACA1 1AHSA 3PVEA 2ET7A 4E4SA 3O5SA 4QU2A 1NA1A 3KCYA 1GBGA 2WZR1 2PAMA 1X82A 4MGZE 4BPZA 4DRRA 2R16A 3QH7A 1D4M3 4XIKA 1O3TA 4WM8C 1KRIA 2XBO3 4FT8A 5GLTA 2MNGA 4Q4Y1 5GLWA 4IEXA 4FOVA 4R52A 2HEVF 3WDUA 1S0EA 4H7MA 2RS53 1I9RA 4OHWA 4MYEA 4WM7A 1I1EA 4YZ1A 3B9CA 1YI7A 3V56A 3IDCB 4A7ZA 1NCQB 5FMOS 1UPSA 3WDYA 3IKWA 3GNEA 4AHZA 4CP1A 5CG8A 1JTZX 4Z92B 1D0HA 1CR7A 1LJ7A 4IV3A 1OPOA 1MS3A 1QOTA 2TBVA 2UYBA 3IBMA 4IESA 4Y1UA 1PIV1 2VVFA 3BTAA 5GJ6A 4XTPA 2QUOA 1RUE1 1R091 2NQYA 1C8M3 2XWJB 1NY72 1NCRB 4V1PA 3RI9A 3NWKA 4BHPA 4FAHA 5KXBA 1URXA 1LOFA 4R9BA 3ZXEA 3H9AA 4YVSA 4JDNA 2CGPA 3N3HA 1VBC2 4B4PA 1R083 4PF5A 3NAPC 1S2BA 4Y1YA 2CGNA 1Y9QA 1ZZ9A 1IPJA 2NM1A 3PMSA 1ZVFA 2F4PA 4XF3A 4YG3A 4YVWB 5DUXA 1O4TA 1H1IA 5K8SA 3UK9A 3RYPA 3AMHA 4LEJA 4D7SA 5JI7A 5GKAC 1DQ0A 1RINA 1F5FA 2GH8A 1BXHA 2ZTNA 4LHLA 3I8TA 2I74A 2FMYA 1DGWA 1MS4A 4FOYA 2DVGA 4RR3C 2EXJA 2HWD1 2JG8A 1YXWA 4IV1C 1AXKA 4I0WB 5K0UA 3WG1A 2HWF1 1VBD2 2RS33 1O7FA 3QH6A 5BY5A 5D1IA 2DYCA 3JD72 3D8CA 1JYCA 2RR13 4INDA 1BYHA 3INAA 2KXLA 2EXIA 1TNFA 2XLAA 4IEOA 3RMYA 2UWBA 3E97A 3V64A 4CDQC 4YFZA 1LOAA 3VV1A 1GLHA 4WVWA 1OKQA 4QGNA 5FLJA 4AG4A 2C5DA 2WNVA 1Q8SA 1LCLA 1HQLA 4NHLA 4R9CA 3MW4A 1GZ9A 3HBZA 1PM7A 4HVRA 4EN6B 5DZFA 2Y0OA 3AZXA 3N4MA 1ND3A 3J9SA 4FTEA 5FFOC 4KBBA 4MLOA 5B2GB 1DLLA 3GALA 4HK8A 1UF2C 1R1A2 3VKMA 5ABJA 2PFWA 1FV2A 4AW7A 1ASJ1 1AX0A 4XJUA 1DHKB 4RS5A 3UKVA 1G86A 1S0FA 2R0FA 2Z42A 3I59A 4A3XA 3AKRA 3SH4A 2K2SA 1AYM1 3FLRA 1H8TB 4AQTA 3WP6A 1BQPA 2DU0A 4J1XA 3L2YA 1N3OA 2GSYA 2CTVA 1OQ1A 5ACA3 2W0XA 5T5PA 1PNFA 3O0WA 2OW4A 3D0SA 2Y0IA 2A7AA 5FTTC 4AGVA 5DXDA 2CAUA 3WCSA 3MZHA 4XQWA 2XL9A 1ZBE2 2E7TA 3WG4A 1CQ9A 4AEJA 2MPFA 1B35A 1OA3A 1MS5A 1RMU1 3H0OA 4Y5Z0 4QMAA 3UJOA 1G7YA 3ETQA 1H30A 1ZA4A 1KFUL 3LWCA 4GQ7A 3AFKA 4Q26A 4BYYA 1Z7S3 1H1AA 4Y4YA 1ZRRA 3QOPA 1IS4A 5FDBA 4K9SA 3DPRB 1RVF3 1QY4A 1U5YA 5F6LB 3HT2A 2ZMNA 1WUVA 1RUC1 2O8OA 3MI8A 1DF0A 1PZ8A 1S0GA 1LODA 3WP4A 1OA2A 5JOXA 4Q8KA 1JW6A 2EXKA 3B69A 4WM8A 4AEMA 1RHI3 4DQAA 1W0PA 2RMU1 3KQRA 5I0SA 3O0VA 5DUUA 1S2KA 3MDPA 1RUE3 1R093 2WT0A 4QXKA 3LA3A 5LK5A 3NKGA 1C4RA 1TQ5A 3VBHC 4LBJA 1OLRA 5JVVA 4QPGC 3MFAA 2MEV2 2WS91 3LAGA 2Z5WA 3JBG2 3M3EA 4YGBA 4QQOA 4AGGA 5JOWA 3CF6E 4BLJA 1KQRA 4HPKB 1HXS2 3AJZA 3MIDA 5GLUA 3DKWA 1GZWB 4K21A 3ZXAC 3A0NA 4OUMA 2Z69A 4AQ2A 4LBMA 3S30A 3TOJA 4AEDC 4LBQA 4LO4B 3AKPA 2LUWA 3B00A 1FPN2 1LKNA 1BEV1 1U5ZA 3KCCA 3KCXA 3WW4A 4QQLA 2BUKA 1UMZA 1UD1A 1VBA1 2ZX2A 5H9SA 4GB32 1H2KA 2R6QA 4Y20A 1OHFA 2HWB2 4RA0A 3B5LB 4FAGA 1D4VB 1AL0G 2E51A 2ZZJA 3NAPA 4P9JA 4XJWA 1ALYA 1WBFA 5JI9A 1POV0 2HWF3 3AMPA 3J8F3 3N7JA 3IT8A 4MGKE 4QQHA 4GH4C 1AR91 3ZFFC 3DGTA 4YW4A 3TB0A 1ZRDA 5GALA 1WW7A 1X33A 4CDWB 2XKPA 3LKJA 4ES8A 1AVBA 4YM3A 4ATEA 4QPIB 4H3WA 4QPYA 1W6OA 1RTVA 4LBOA 5I0TA 2A73B 3U11A 2XUMA 1V70A 2HWC3 3AYCA 1VBE3 2JKBA 4WZCA 4E2GA 3WQ0A 3R4SA 1C3HA 3OGJA 2GC1A 4IV1A 3SH5A 1O3RA 1W0OA 2WA3A 1CAVA 2CGOA 4CP0A 3KS7A 1DGRA 3E6CC 2R0HA 2R073 3AXDA 2PELA 2ATFA 3B93A 1BK1A 1ASJ3 1ZZ8A 4CDQA 3ZIWA 1WA4A 3FZ3A 4YLZA 4AI8A 4AYUA 2XGXA 2WKKA 5K7PA 4PCRA 4JV4A 3R4DB 5FO8B 3RWNA 1HV0A 5E1RA 3ZSEA 1AL22 4Q4W1 2ZS6B 1COV1 3RPQA 4FBFA 3VLBB 3O7OA 4IL7A 4NWWA 2RS12 5H9RA 3ZFEC 3AB0A 1HRV1 4HMZA 1RUF2 3H8UA 4KH9A 3VDDC 3SXWA 2JDZA 4JDO