1GZ9A

High-resolution crystal structure of erythrina cristagalli lectin in complex with 2'-alpha-l-fucosyllactose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHMWDSTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDAPSKILHVVLVYPSSGAIYTIAEIVDVKQVLPDWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERYTHRINA CRISTA-GALLI LECTIN
publication title High-Resolution Crystal Structures of Erythrina Cristagalli Lectin in Complex with Lactose and 2'-Alpha-L-Fucosyllactose and Correlation with Thermodynamic Binding Data
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 53
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2002-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1gz9A00
4XTPA 1WCSA 1HDKA 2WNEA 4FPCA 4Y22A 4LBJA 3OY8B 1LGCA 2A6WA 3ZXLA 2XB6C 2E7QA 1ENQA 4YFWA 1QOOA 2GDFA 3T2TA 1LHUA 2AYHA 1X50A 1MS1A 4FQZA 1CPNA 1RITA 3OGGA 1LEMA 4P14A 4ZXKA 2ZGOA 1MACA 2CWSA 2ZGTA 3ATGA 4GKYA 4JRAA 5GLZA 4BQ1A 3T1LA 1WW6A 1BXHA 2VUAA 1ULCA 3IMNA 3WNXA 2ZGPA 4BMBA 2EAKA 1GANA 2CTVA 4YG3A 1MVEA 1AXKA 3POSA 1OFSA 2NMOA 2D6NA 1FATA 5T54A 4UW6A 4D69A 3FUOA 1NXD1 2PHXA 3R4UA 4ITCA 4IQPA 2I2SA 2ZGQA 1HQLA 1AZDA 4WVVA 2LALA 4CTEA 1G9BA 3SLIA 1G86A 1LOGA 3JUUA 3TAYA 1W6PA 2D3SA 4Y1VA 2CYFA 3FBYA 5HCBA 5T55A 2JE9A 1V00A 4L8QA 4Q2FA 5IUQA 1QGLA 3UK9A 1IS5A 3ILNA 1GV9A 1F9KA 1ENRA 2EIGA 2D6MA 4LBOA 5H9PA 2ARBA 1RIRA 5H9QA 3VKNA 4FOQA 4BPZA 2OW4A 2XG3A 4C1WA 1G8WA 1FNZA 4YM0A 4XILA 3INAA 3N7MA 4W65A 1R1ZA 3A0NA 2A6ZA 1LESA 1FAYA 3FLRA 1DHKB 3D6EA 3AX4A 2YROA 3WV6A 1G9AA 2DU0A 5GLTA 1FX5A 1CESA 4AVVA 1Q8VA 5GZGA 4YW3A 2DYCA 4XJ9A 1S0IA 3M3QA 4LBLA 5KXBA 5FRAA 1HLCA 1HKDA 3IPVB 4XHBA 2GN3A 2V5YA 2SBAA 3PVNA 3AZXA 4Y1ZA 2ZGSA 4XBLA 3MW2A 1W0PA 4DRRA 1JXNA 1SLLA 4Q1PA 5DG2A 5KXDA 4GA9A 2LTNA 3AP7A 1QKQA 1CR7A 1Y7BA 5JMCA 5GZDA 3IM0A 3O0WA 4HL0A 3NV2A 5KXCA 1I3HA 1PZ7A 2E6VA 4WVWA 5T52A 3B00A 2DTYA 3WDTA 1OKQA 1GZWB 4ATEA 3ZSMA 3VUOA 1KDKA 1DZQA 1FV3A 1QOTA 2P3KA 1CONA 1YIFA 2ZGRA 1AXZA 2P3JA 2R0HA 4XIKA 1H9WA 1GBGA 4R9DA 1QOSA 1DBNA 2EF6A 2NMNA 1WD3A 2CY6A 2NN8A 1LOBA 1YXWA 2VU9A 2SLIA 4FOWA 5DUVA 4BLJA 5CA6A 2OUHA 4P9XA 3ZXJA 2JE7A 2R16A 1FV2A 1HQWA 2A7AA 3FLPA 1SBFA 3LCPA 4XHXA 3AYCA 1LHOA 2DUQA 2GNDA 1S1AA 3OBTA 4Y1UA 5E89A 4AWDA 5F5QA 4FOYA 4PQ9A 4BOWA 1WW5A 4AGRA 2W39A 3ZXEA 1N1SA 4RA0A 3ZPYA 3WUDA 1GLHA 1SBDA 1MS5A 3SITA 4BLIA 2ZKNA 4XYXA 3AZWA 1UX6A 2A3XA 3UL2A 1Z0HA 4FPGA 4WZFA 1GNZA 4LBNA 1MS4A 4DRVA 4K20A 4XJ8A 3B01A 3Q9OA 2WKKA 1IS4A 4DS0A 1LULA 1SLIA 4FPFA 2CWMA 4PCRA 3APBA 4LBQA 1YO8A 3RSJA 4PBPA 2P2KA 3O5SA 4YGBA 2Z42A 4YZ3A 5CAZA 2P3IA 3WG4A 3JU9A 2UU8A 4XBNA 3WDXA 1N1YA 4XZPA 2AH2A 2CNAA 1W6OA 3W58A 1DQ0A 2A71A 3HN1A 1ENSA 2G4IA 5GJ6A 1A8DA 4YW2A 3WDWA 1DLLA 1MVQA 2E51A 3N36A 3N35A 4KBBA 4XOGA 1DQ2A 3RRDA 2ERFA 3RG0A 4Y1XA 1DQ4A 5GZFA 3M1HA 2D6KA 2VY0A 4FPEA 5T50A 3VKOA 4OZXA 5GLVA 1O4ZA 5EWSA 3ZXKA 4CRQA 2R49A 1URXA 3V65A 1MR5A 1KJLA 5JDBA 2E7TA 1W0OA 5CB7A 4U2AA 4YFZA 1LEDA 4YM1A 1QF3A 1U0AA 1S0EA 2DV9A 2DVBA 3W59A 2DVFA 2ZBJA 2FMDA 1SLCA 4YZ2A 2YMZA 3ENRA 1UMZA 1UN1A 2W08A 2JD4A 4HANA 1MS3A 1SFYA 2OVUA 3NWKA 2HYKA 2D6OX 4LBQB 2ZHLA 1EPWA 1MS0A 1UAIA 5IK8A 4FQ4A 1V6OA 1IS6A 3L2YA 5DUWA 1Q8PA 4UW5A 2JDZA 2GN7A 2WT1A 2UWCA 1AXYA 1N47A 4P9YA 3M3EA 2VH9A 4Y22B 2UWAA 4DPNA 1A78A 1IKQA 1WLWA 1DGLA 1DYKA 3ZVXA 3DGTA 3VKLA 1B09A 3POYA 2NYYA 1W6NA 5JLVA 1G9CA 5FREA 3ZYRA 2OUJA 3D5OA 2PHWA 2UWBA 3MEPA 4Y26A 1MS8A 5DUUA 2VW0A 1AX2A 4YZ4A 3R4SA 4ATFA 4AGGA 1JYCA 2YV8A 1W6MA 4BM8A 5DZGA 1H9PA 3ZSKA 3AXDA 3O0XA 4ZKTB 3BOPA 5GLWA 1N1TA 3AZZA 2H0BA 4R9AA 3MPPG 1N1VA 2EALA 2VW1A 2WT2A 1O4YA 3AP9A 3FUQA 3OJBA 1BZWA 3QCWA 2W52A 4ASMB 1CQ9A 2JECA 4YW5A 1V6LA 2ZGMA 2V73A 2ZMKA 5JOYA 1W6PB 1DQ1A 1JW6A 3ZYPA 1SLBA 4F83A 1VAMA 2VW2A 5GZEA 2FHRA 2ZHNA 3RS6A 4AVSA 1XQNA 2R1DA 3OYWA 4SLIA 2A75A 3AP4A 3FFZA 4M3CF 1ULDA 2ZMNA 5H9RA 1SACA 2WSUA 1QMJA 1WD4A 1AX1A 1LJ7A 4M3CA 1AX0A 4ISRA 3UJQA 1GZ9A 1LHVA 4Y20A 3MW4A 3BTAA 1C57A 1ULEA 2UURA 2A6VA 4NO4A 4YG6A 3SH4A 3CNAA 1LOEA 2ZGLA 5DG1A 3WDVA 1A3KA 1AVBA 4YGDA 3WZ1A 3V0AA 1W6NB 1JOJA 3B9CA 4U36A 1DQ5A 1I1EA 4XDQA 3WG2A 2NM1A 3OY8A 2KM2A 1YRZA 1V6IA 2WT0A 5T5JA 2A6XA 2ZABA 3WUCA 4RL7A 3ZSJA 3AYAA 2B7YA 4YW4A 3V0BA 4TZDA 4YM2A 5DZFA 5F9TA 4GKXA 3ZXFA 2DUPA 3VV1A 1QU0A 2ZGUA 3HR9A 3WG3A 3VKMA 5L73A 4BMEA 1KQRA 5E8AA 1Q56A 4DFSA 1LOCA 3AZYA 4XJAA 1GICA 3KM5A 2WJSA 3AZVA 3KQRA 1LOFA 1N3OA 1VIWB 5AVAA 3WG1A 1LODA 1LTEA 2ARXA 1WBLA 4NOTA 1S0CA 4AVTA 1G9DA 3N7LA 1KDMA 5EXOA 1QDCA 1JBCA 2DTWA 4Q27A 3BIWE 1C1LA 1UZYA 1GKBA 3IN9A 4YZ1A 2ZGKA 1QDOA 4Q8LA 1UPSA 2D6LX 2PHRA 4C1XA 1VLNA 1FYUA 2R1BA 2DURA 2EXKA 3O12A 1LOFC 3NV1A 1WLDA 4I30A 1V6KA 3WDYA 1AJOA 1DYPA 4FP2A 1LU2A 4Z8BA 3WHUA 1APNA 3LSEA 2PHTA 3VKFC 5JOZA 1DQ6A 1ONAA 3A0KA 4Q1RA 1FNYA 1LGNA 2YY1A 1S0FA 4FP3A 5DUXA 2ZA9A 1C4RA 2A3YA 2VXRA 3R05A 4FOVA 4M00A 5E88A 1LECA 1N3PA 4FPYA 3SH3A 3V0AB 2GNBA 5JOWA 5T5PA 4XIOA 2ZGNA 1DIWA 4XE9A 3AJYA 1S0DA 3M3OA 3WLUA 2P34A 2PHUA 5SV8A 1Q8OA 5HCFA 4R9CA 4XXAA 3B3QE 4Y24A 3V0BB 1BJQA 2D3PA 1KITA 3AK0A 3RMYA 2ZACA 1G7YA 2DWRA 3N7KA 2D6PA 2A3WA 2GMEA 3POWA 4XXPA 3IPVA 5IT6A 1WUVA 1YYNA 2AREA 4YLZA 3IKWA 2TEPA 4WV8A 5DZEA 1AF9A 3TB0A 4UW4A 2E53A 3MW3A 4MYEA 2WQZC 1LENA 1F5FA 1LU1A 1N3QA 1S0JA 2WLQA 3NV4A 3PJQA 4FPKA 3RMXA 5T5OA 2AENA 3WCSA 1WW7A 1AJKA 3AFKA 1W6OB 3SISA 1ULGA 2AGSA 3QLQA 3A4UA 1LCLA 1C1FA 2A6YA 2RHPA 1BKZA 1GZCA 5T5LA 1Q8QA 3FLTA 4FVVA 5EYXA 1GZWA 1CN1A 1SCSA 1UL9A 4JCKA 3RQ0A 5GZCA 1V6MA 3B69A 2NZ9A 1MZ5A 4GWMA 2P37A 1WW4A 2PHFA 3PVEA 1CJPA 4GXLA 3ASIA 1D0HA 1JN2P 1UZZA 2GMPA 4YGEA 1V6JA 2A5ZA 1SCRA 4AGVA 1VALA 2DU1A 4R9BA 5CNAA 2ZHMA 3D4KA 4K21A 2EXJA 1OQ1A 3N3HA 2EXIA 5LK5A 5BYNA 5DXDA 1SLAA 2D43A 4M3CE 1LHWA 5H9SA 3WDUA 3GALA 3PMEA 1G9FA 1BYHA 2YXSA 1UKGA 2JKBA 1WLCA 1JUIA 3O0VA 2D3RA 2DUOA 2PELA 4XJZA 2GNMA 5GALA 3T1MA 1LOAA 3HMYA 4K1ZA 1GNHA 1W6QA 2GMMA 3I4IA 2DVDA 3AYEA 4Q8KA 2ZHKA 2WSVA 3WOGA 5CBLA 1CVNA 1VAVA 2JJ6A 2ZAAA 3SNMA 5EYYA 3I8TA 5HCAA 3USUA 1GSLA 1LGBA 1DFQA 2YZ4A 1QNYA 3OPZA 4FPLA 1JYIA 3C2UA 1YI7A 3GNEA 3ILFA 4FPJA 1MS9A 1BQPA 1NLSA 3AJZA 4PBOA 3M2MA 3LSDA 1LHNA 1Q8SA 1S0BA 2AR6A 3N7JA 2C9AA 2DVAA 4FPOB 2ZZJA 4XJWA 3H0OA 5JOXA 3WHTA 3PVOA 5IK5A 2AUYA 1ZM1A 3M3CA 4FPHA 4JC1A 1RINA 4XBQA 4XMIA 2R0FA 2D7FA 2ES3A 1W6MB 4XTMA 5GLUA 3WVJA 2A70A 4K1YA 3ILRA 4XJUA 4GWNA 3AYDA 1CIWA 4AYUA 4Q26A 1SLTA 1H30A 5JVVA 2EXHA 2GALA 4M01A 5GM0A 4P9WA 2ENRA 4LBMA 1F31A 1SBEA 3WCRA 3U4XA 1IOAA 4Y1YA 2NP0A 1PZ8A 2ZMLA 3AP6A 4YZ5A 5IK4A 1J1TA 1ZA4A 2C5DA 3UJOA 1QNWA 1JHNA 4YGCA 5IK7A 4LBKA 1IKPA 1MZ6A 3DUIA 1KRIA 1V6NA 4ISQA 4LBQD 1ULFA 4H55A 4CZSA 1S0GA 4DQAA 4YM3A 1CPMA 1W6QB 2BQPA 4YG0A 4TYSA 3NV3A 3BODA 3AP5A 4UW3A 3OYWB 1GYKA 2Q5TA 3SH5A 3USUB 3V64A 4PF5A 1TEIA 1Z78A 2W68A 2CL2A 2DVGA 4M3CB 4Y20B 1D2SA 1IS3A 1KJRA 2GNTA 3AXEA 4GALA 3ZSLA 5KXEA 2D44A 4XMAA 1WBFA 1PZ9A 4YW1A 3OBRA
chains in the Genus database with same CATH superfamily
4PQQA 2VVDA 3U37A 2VNOA 5C8WA 1HDKA 3ZFGC 1PK6C 3NNLA 3OY8B 2A6WA 3T0BA 2XB6C 2E7QA 4AEDB 4HFSA 1YCIA 1MS1A 1ZZ8A 5ANNA 1CPNA 2NPIA 1F2NA 2K0GA 3A23A 3WQ7A 3ATGA 1V70A 1D7PM 1UZWA 1NG0A 4JRAA 2JG9C 4BQ1A 3T1LA 3MIBA 1WW6A 2MHFA 1OD3A 1W0NA 2PQSA 3HNYM 1ZBA3 2Y6KA 2ZGPA 3DN7A 4LEJA 3WNXA 4AZZA 4BMBA 1OQDA 1GANA 4BQ4A 1MVEA 1AXKA 3NAPA 2VMCA 3POSA 1OFSA 5JIUA 1TVGA 2YPJA 4L9BA 1QJU1 1QJY1 1YQ5A 2J22A 1W03A 3J4UH 4ITCA 3ZN5A 4NIGA 1VBE2 2G19A 1HQLA 1NQDA 3ABZA 2XL7A 2D97A 2DFBA 2LALA 2RJKA 2XJPA 2Z4FA 2XDVA 2C9KA 3IDAA 1XE7A 3VDDC 4ASLA 1HXS3 3FBYA 2WYFA 2CAVA 2VMEA 5IUQA 4B29A 1GV9A 2WNVA 1ENRA 2EIGA 1UF2C 2J1SA 2BFUL 3I2OA 3MUY1 4PLOA 2GZWA 4BQXA 3ETPA 1GQHA 1DGRA 1WA6X 3KGLA 2VNVA 2GC1A 3CJIB 1YFUA 4P5HA 3INAA 5FBZA 4CCEA 4CUBA 4W65A 1UD1A 2WZR3 1DYOA 1FAYA 4KWJA 3FLRA 3JXSA 4ZU4A 2BBVA 3MYXA 2YROA 4W6XA 2DU0A 1TMF2 3NKGA 1GUIA 4CEWC 2QQWA 4DB5A 1SG3A 2XBO3 5A6XA 5FRAA 2BV4A 4Q4Y2 3P6BA 3GJAA 1OA2A 4YWAA 4DUXA 3FL7A 3IPVB 4Y1ZA 2V5YA 4A7ZA 1HB2A 2ZGSA 4XBLA 5G04L 5JR2A 2QKDA 1NT0A 1K12A 1H6XA 1XJAA 3MLLA 3MF6A 5DPNA 4KI5M 1QKQA 4LHSA 1QJY2 1Y7BA 1UZ0A 3IM0A 3IDBB 5A1FA 1I3HA 4XQWA 5FPVA 4QPYA 3OEBA 2DTYA 2KA3A 1RUC3 4XFCA 2HWB1 4ATEA 5M0TA 3ZSMA 3OD4A 4TXWA 2QZ2A 1M4WA 1TME1 1DZQA 1FV3A 3LA7A 1D0GA 1XNAA 4INDA 1PO13 4QQPA 4YYOA 1D2QA 4KWLA 2GSYA 2PLV3 2RG4A 1K42A 2J42A 2NN8A 2ORZA 5FUIA 1YXWA 5DUVA 4BLJA 3POJA 3WW4A 2XHKA 4P9XA 5DABA 3BCWA 4LNVA 5FTTC 5C4WA 3WXPA 4LO5B 3BPZA 2EICA 5FZ0A 1XE8A 2A7AA 3FLPA 4LIUA 1SBFA 3LCPA 4Y1UA 4FAHA 1LHOA 2GNDA 5C3QA 3OBTA 4AWDA 5IATA 1CAWA 1Y9QA 3CF6E 2VUDA 3ZXEA 1MQTB 5FBJA 5J36A 1J59A 1SBDA 1R1A1 1CAVA 4BLIA 3D82A 3FE5A 3K48A 3AZWA 1UX6A 2A73B 4J1WA 3I3BA 1XOYA 3MPBA 2BBAA 1UU6A 3GBFA 4WZFA 2RS51 1OH3A 4K20A 4K40A 5FK8A 4A6SA 1RMU1 3LIHA 3OPTA 2HBUA 4AOCA 4XAEA 2O8OA 1OFNA 3RMXA 1ZRDA 2HWB2 3VL8A 3O5SA 4G4FA 1TME2 1YQCA 3GBWA 3JU9A 3ROUA 3WDXA 4XBNA 2IVJA 1SHWB 2DCKA 1Q5OA 2AH2A 1QH7A 2BVBA 4XZPA 2CNAA 5FY4A 1B35A 4CU9A 3TEYA 4QWNA 3LOBA 2MNGA 3MV01 2G4IA 4HONA 5FYMA 5I0TA 3BU0A 4B4PA 1DZRA 4YVWC 2JDMA 1MVQA 4KBBA 5FY9A 3N36A 3J8F3 4FXKB 2J1EA 4GJYA 4A41A 1OUSA 5ACA1 2R073 2WFF3 4Y1XA 4CP0A 3M1HA 2D6KA 2VY0A 4WM7C 5T50A 1UY1A 3VKOA 4IEPA 4CUAA 1JODA 1GR3A 3ZXKA 1DLCA 3ACLA 4UT5A 2Y64A 2W95A 3M3IA 1A8MA 4UYBA 3C7FA 1R1A2 3Q8CA 3GDBA 3M4FA 2QJVA 1KJLA 2B42B 2IXCA 1CJDA 3OD0A 4ONUA 1C28A 3POEA 5LASA 5LBCA 1VMFA 1COV3 4YM1A 1YWKA 4DXTA 3ZKYA 2ET7A 5FMOL 2DVBA 3W20A 4DO0A 5C70A 5F7UA 3W59A 1JU3A 1RMU2 1ZRIA 1ND3A 1OLMA 1RJ7A 1YHFA 2R041 4GH4C 3ENRA 3W5MA 5LEKA 3UKVA 1GOGA 1MS3A 1FPN3 3NQHA 3PUHA 4HPKB 4NWWA 4Z07A 2HYKA 2Q8EA 1EPWA 5IK8A 4FQ4A 3W9AA 3H8RA 1DDLA 2YU1A 1Q8PA 5DUWA 3VBUC 4NHLA 5A7WA 4K8FA 4P9YA 4DXZA 4X6RB 5FPUA 3IDEA 5DAXA 4F3JA 1JHJA 1A78A 1Y9MA 4QHZA 3O1OA 3I97A 1R091 3AMPA 2BNOA 3POIA 5ACA2 3I3DA 1BMV1 1H4HA 1AYM1 1DGLA 2GC3A 1H8VA 3DPRB 4IGOA 3OBZA 1LB2A 2PYTA 1W6NA 1VBE3 2NYYA 2ZX1A 1XC6A 1Q43A 4JDMA 4MZUA 3TNQA 3ZYRA 4A7KA 2OUJA 3MEPA 2PHWA 4Y26A 1UY3A 3I3QA 1W9FA 5HXVA 3S5QA 5I0RA 5HPOA 3UNPA 2VW0A 4HKWA 1ZZBA 3HPNA 2BU9A 2P5BA 2ZEXA 5CU1A 4AGGA 1CD3G 2EVXA 1W6MA 2YV8A 4BM8A 5DZGA 4LO4B 5IAVA 5LA2A 3NAPB 3ZXDA 2CGPA 3BN6A 3LKJA 4JAAA 4OUSA 5FUPA 1RHI2 1W9TA 3A7QA 5IYYA 2EALA 5A6ZA 3PTYA 5CIRA 5I0DA 3THDA 2PAMA 1O4YA 2VQTA 1IZ3A 3IZOA 3QCWA 3TBDA 1I9RA 2CHHA 2W52A 4ASMB 2VNRA 2WO1A 4D3WA 4E4SA 3VDBA 4CE8A 1HJFA 2JG8C 2VOTA 2ZGMA 2ZMKA 5JOYA 1S2EA 1DQ1A 2RJLA 3OGRA 1JW6A 2P1BA 3ZYPA 5BUVA 4MGTA 1VAMA 5DN2A 5HV0A 4D0QA 3EO6A 4AVSA 3LEGA 3I3EA 1A6CA 2X5IC 3PTRB 4QQHA 4OI4A 3FFZA 4RS5C 1ZVFA 5FQ0B 1WD4A 2XJUA 1R092 1RGSA 1BMV2 2P3YA 1AYM2 1LHVA 1QJU3 1QJY3 1ULEA 1BBT2 4YG6A 3CLPA 1RUI3 3JBG2 3NMBA 5DG1A 5BXXA 1KD7A 1AVBA 1YEWA 3KZ4C 4IEYA 1OBNA 1STMA 4XF0A 2KM2A 3ZR5A 5FZMA 2XMLA 1HB1A 4EN9B 4GAZA 2IXKA 3ZSJA 1HRV1 4Q0SA 4LPLA 5LZ6A 1UXZA 4YM2A 5F9TA 1F5JA 3EBRA 3ZXFA 1KEXA 4HKLA 3VV1A 1W8TA 1JYXA 1UPIA 4LORA 5L73A 2W46A 4NJ4A 2XJVA 1ZYBA 3S7IA 5E8AA 1V9U1 3UGGA 1YLLA 3WG1A 3AZVA 3KQRA 1XPWA 2QQVA 3FC0A 2R30A 4CXWA 2RVAA 2B9VA 4NOTA 3ZYJB 1G9DA 3N7LA 1KDMA 3MIEA 4EN0A 2HWC1 5BNNA 2DTWA 1DP0A 1C1LA 4XF1A 3IN9A 1RXGA 3RZLA 3J7LA 2ZGKA 3LA3A 1UPSA 2X53S 1UY2A 2FCTA 5FZGA 1LOFC 3NV1A 3NJVA 5EJ3A 4CPBA 5ABJC 1ODMA 4HN1A 3WDYA 1V6KA 4BQYA 1JZ6A 5C4WB 5K0UB 1APNA 2BWAA 3VKFC 4AFMA 4L97A 4Q1RA 1LGNA 3GGLA 5FXZA 1S0FA 3JD71 5DUXA 3T09A 3VN4A 4Q4V1 1CAWB 4FOVA 1I5PA 4UFKA 5E88A 2ZJCA 3PL0A 5C3RA 4I3GA 5C3OA 2HWB3 5G05L 1YNAA 1T6BX 4AEJA 4XE9A 3TRSB 2BPA2 5FXWA 3TN91 4EROA 3E6BA 5SV8A 4ASKA 5F3CA 3KS7A 4HETA 2W9XA 4N7IA 3AMMA 4JX0A 2F4LA 1GQPA 3D8CA 4XC9A 5C71A 4BWOA 3RMYA 2ZACA 1G7YA 3N7KA 4EN7B 4YW7A 4AI1A 4AQ6A 4CDUA 2E32A 1BK0A 2GMEA 2Q8DA 2CDPA 1YYNA 2GU9A 2TEPA 5F6KA 3WP5A 4MYEA 2H6CA 2Y38A 3CZUA 1LU1A 4CP9A 4XUPA 4QPIC 2WINB 3WF2A 1ULGA 2LROA 5FZIA 5L7OC 2WNUA 1C1FA 3KQ4B 4ZS2A 1BKZA 1Q8QA 2JKXA 5C9AB 2R061 3PIJA 1SCSA 1UL9A 2RS53 4JCKA 4AI3A 4AW7A 2PFWA 5CKNA 4AI0A 1RMU3 5FJKA 4GWMA 1C5HA 2P37A 4QX8A 1HJGA 1REDA 5K4LA 1D0HA 1JN2P 1UZZA 4MX3A 5LBFA 4D7SA 5CADA 3SEEA 1VALA 3S6PA 2DU1A 4K21A 1JYWA 2VQAA 4QQOA 4AQTA 2UY8A 3LIGA 1XNDA 2D98A 5KR7A 2OQ6A 2VE1A 5JIAA 3TN92 1RUH1 3RZHA 5F1RA 2J1UA 5H9SA 1EAH2 4NHKA 4Y4RA 1U12A 4YVSA 1JYTA 3OEAA 3D0JA 4EN8B 5A1AA 5I0UA 2EA7A 1UKGA 1EPZA 2JKBA 4RD7A 3WR0A 3VZKA 5ACA3 1FOD1 3ES1A 4PIZA 4IV3B 1R081 4RR3B 4FSJA 1L7QA 2BEOA 2E9QA 2D5FA 1GNHA 2ILMA 3VBHC 1WGPA 3VBFC 2WBKA 3AYEA 5F5IA 3WOGA 3BU7A 3ZFFA 3J7NA 3H8OA 1AUYA 1QWRA 3I8TA 2PTMA 4I02A 5A7WB 3USUA 3AMQA 4IDZA 5HCAA 1OMIA 2GP3A 5FXXA 1HRI1 1NA1C 1PNGA 4FPLA 5HXMA 3PU3A 2V09A 3GNEA 1RL3A 5KWRA 2WA4A 4HLTA 1MS9A 1NLSA 4P9IA 4AI2A 1Q8SA 2AR6A 3N7JA 4FFIA 4A3XA 1UCXA 2R043 5J48A 4XJWA 1XNBA 3BYWA 5FPBA 3ZMOA 5IK5A 2AUYA 1WMFA 1ZM1A 2Y0OA 4HVRA 1PGL1 2B39A 4QDQA 4AEDA 3FX3A 1YUDA 1W04A 4PF1A 4XBQA 5IVYA 5JR7B 5JXIA 2E33A 1RVF1 4LKDA 1W6MB 5LA1A 5GLUA 5AC91 5IVEA 2VJXA 2HH9A 1RUH2 1Y43B 2AEZA 2Q4SA 5C3PA 2RJ2A 5B4NA 4AYUA 4D6SA 2VMGA 1SLTA 1UYPA 2QTWB 4M01A 2GALA 5JVVA 4IE5A 3WCRA 4HOOA 1SBEA 1W8WA 4COYA 4Y1YA 4ES8A 5IK4A 1ZA4A 1OUXA 1AYM3 1QNWA 1H1IA 4MGSA 1R082 3UJOA 3WNKA 4A45A 4EN6B 3RYPA 2WYSA 3LEKA 3DUIA 4GULA 4ISQA 4HSLA 4DXRA 1Q3EA 4Q0PA 5KBFA 1DGWA 2WZ8A 4QDRA 4R4ZA 4V2WA 4UFLA 1TNFA 5B2GB 1MZFA 1HRI2 3PUQA 4Z92B 3GYDA 4UFMA 3VD4A 2W87A 4LUKA 2W68A 2CL2A 1JH5A 4JHZA 2OA2A 1QQP1 4N53C 4A42A 5F37A 1U5IA 3ETQA 1LKNA 3E1F1 4GALA 5TSWA 5KXEA 2Y26A 3POGA 1VRBA 2IWGB 1JZ7A 3OSDA 3CJXA 4XTPA 2WNEA 3VBSB 3ST7A 3LPGA 4LULA 3NNMA 1PGL2 4HG6B 4LBJA 4EWAA 3CJIA 3ZXLA 4XUTA 4LT5A 4IETA 5HCHA 1O4TA 4D7YA 3LDKA 2YBKA 1ENQA 2PN5A 4YFWA 3T2TA 2D40A 1LHUA 4UFIA 5IWFA 1OOPC 4FQZA 2XXZA 4H7MA 4UXAA 4NIIA 4BXFA 3OGGA 5EJZB 2FDJA 4ZXKA 2ZGOA 2Y34A 3UGFA 4A7YA 2ZGTA 3ME2A 4IERA 5CFDB 3PUIA 4I2OA 4NWVA 1OF3A 3TEWA 5KHKA 4CDQB 5IHRA 1BXHA 1W2UA 2VUAA 3C7GA 4QKBA 4UAPA 3LOIA 2OPWA 4O65A 5F3EA 4XQDA 2CTVA 4YG3A 1WCQA 1JI6A 1U5YA 3T4HB 2OKXA 4CDXC 3E5XA 2DCJA 2W91A 4UW6A 5LRRA 5T3NA 1NXD1 4QB1A 3R4UA 4S2FA 3SCFA 2HJIA 4XCAA 2QQKA 5A7QA 1XB9A 2ZGQA 3IAPA 1HRV3 2ZS6B 1VBD3 3HD8B 4JTNA 5A7PA 5FO8B 2G9ZA 3SLIA 1LOGA 4CUGA 4N9IA 3JUUA 4CA9A 2D3SA 5FZ8A 5L36A 3KV9A 1S55A 2CYFA 3NAPC 4XF3A 1MEC1 2JE9A 3ON7A 1V00A 2JEMA 3LFMA 1QY4A 1V9U3 4Q2FA 4Q29A 5FP8A 3UK9A 2JDHA 2A1XA 2MEV2 4LBOA 5H9PA 5APAA 2VZSA 4FOQA 3RNSA 2OW4A 4BPZA 4CCJA 2XG3A 2HWC3 4C1WA 2JDYA 5J1XA 1FNZA 4YM0A 2ZXQA 4XILA 1KS5A 5FLHA 3LEIA 5LB6A 2PA7A 5E16A 3K3NA 2B5HA 3AX4A 3WV6A 2D5HA 1UU5A 4F7ZA 1MQTA 2WNVC 1VBA2 1Q8VA 4QM8A 4YW3A 2DYCA 4LBLA 1PVC1 1PX4A 1HLCA 4Q0VA 5FAXA 1HKDA 4QKDA 5I8TA 2RV9A 3RZZA 1LRHA 3PVNA 4Y33A 1UY4A 3JD73 1W0PA 4Q4V3 4Q1PA 3RZGA 5F5CA 1RJ8A 2LTNA 3AKQA 4EWDA 1CR7A 4HZFA 4CP9B 3HT1A 4XCBA 3EYPA 5JMCA 5FZAA 4FAGA 2K2SA 1CZTA 3KV5A 1Y3TA 2OYZA 1ZREA 2E6VA 1PZ7A 3MIDA 1PVXA 5DAPA 2GAUA 3TN93 4AHYA 5A3UA 3VZMA 1ENXA 3I2DA 3WDTA 1YIPA 2VQ0A 4NUBA 5FO9B 4IEOA 4CDWA 1OLQA 4FI9A 1YQ6A 1W3VA 1D4M2 1MEC2 1CONA 3H50A 1YIFA 4Q4W1 5J09A 4LOTA 1IHMA 4N43A 2P3JA 5EJ1B 1H9WA 1GBGA 2CDOA 2EF6A 1AYN1 1E5HA 1X8EA 4A2UA 2CY6A 3PHMA 2VU9A 4FOWA 4JTOA 5DDJ1 2JE7A 2AZ5A 5D8AB 1CZVA 5F5AA 2VOKA 4JV4A 1HQWA 3OPWA 4DOUA 3MHZA 1S1AA 2HEYF 3DYOA 5E89A 1F4AA 2JWPA 4FOYA 4PQ9A 4BOWA 3B93A 2W39A 1OA3A 2OPKA 4NR1A 5A6QA 2R063 5C3SA 1VBC2 1PVC2 4HKOA 3WUDA 1VJ2A 1MS5A 4IE7A 3AKPA 3PURA 2K46A 5ISLA 4K3UA 3G7DA 1K45A 2VOVA 4KQ7A 3K51A 5C4WC 2VBDA 1ZRCA 3AVRA 1JZ5A 3HNMA 4JKLA 4Q5OA 3ZFFB 2I74A 4XJ8A 2Q8OA 3USSA 3B01A 5DAWA 1UZVA 2VZ1A 4XACA 4DS0A 1LULA 4FPFA 2CWMA 2ORXA 4PCRA 4WZCA 1RUD2 1RUH3 4QXBA 3I49A 3H3LA 4WBBA 4PBPA 3GZEA 3D0SA 4XEZA 1UO9A 4CP2A 4CPBD 3OBAA 1FT9A 2VTXJ 3DECA 3PNAA 4EWEA 4Q4W2 3KWVA 3SCGA 1FOD3 5BNQA 1DQ0A 1R083 2BNNA 4BHPA 3HN1A 1AYN2 1ENSA 4MG2A 4LHNA 5GJ6A 4YW2A 3TEXA 3VL9A 4GD4A 3ZR6A 5A32A 4XOGA 5DDJ2 2DBNA 3OUIA 2QFEA 1OI6A 4PDWB 3RRDA 4L92A 3ZYBA 3DPRA 2QZ3A 3RG0A 1DQ4A 2HEVF 3PVBB 4MH0E 1TMF1 1HRI3 2O8QA 2VG9A 3B5LB 3LZZA 5GLVA 1B35C 2BOJA 5IVCA 4Q4Y1 2Z5WA 5CYYA 1I5ZA 3V65A 4FXGB 1O6UA 1JZ3A 4MGYE 2YPDA 2E7TA 2JDNA 2BDRA 1AR61 4YFZA 3ZFEB 1EUTA 1US2A 3LF7A 3KF3A 1QF3A 1U0AA 4N7UA 4CVUA 1X8MA 2QQLA 4Z2WA 4J1XA 2FMDA 4J25A 1UU4A 2JDPA 4IE4A 1RVF3 1J83A 5K8SA 2JD4A 1YQ8A 5AC93 4PLMA 1SFYA 3VD3A 1K5MB 1WKYA 4JHTA 1H1MA 5KHGA 3POFA 2VGDA 2O0OA 3OUHA 4QX7A 2VZRA 3N9NA 5BNOA 4Z82A 5IW0A 4UW5A 3D3AA 5F2SA 2FBEA 2DFCA 2GN7A 2JDZA 1N47A 1ND3C 4JGZA 5FQ0A 4QHBA 2C1FA 1IKQA 2ZKLA 2XL9A 1WLWA 4C0BA 3RZKA 3AKTA 4XFFA 1AL0G 5FY0A 4QPGA 3AFGA 3ZVXA 3DGTA 3LAGA 3LE0A 5CISA 4E4ZA 2OXBA 3POYA 3WX5A 5JLVA 3S30A 5FMBA 1G9CA 3BTZA 3ORJA 2YC0A 5FREA 1E57A 2FDGA 2D93A 2UWBA 5FP3A 1QQP3 1W28A 3RYRA 5DUUA 1REEA 3MIGA 4YZ4A 5KC5A 4ATFA 1JYCA 4YW1A 3ZYHA 1H9PA 3J9SA 5ANQA 3WSOA 1AR62 5KHHA 1BCXA 4ZKTB 3BOPA 3HJRA 5GLWA 2VZQA 2GC2A 4XF4A 3MPPG 4E4DX 2VW1A 2P4EA 3WW2A 2ZPXA 2R7EB 3OJBA 1HQNA 2DBIA 3VZLA 1BZWA 2YFZA 2X29A 1C8M1 4WM8B 1VRH3 2OZJA 4KU8A 4LIVA 1VB2A 4JGYB 1IG3A 4N90A 5GZEA 2VW2A 2ZHNA 2VOWA 4EQVA 2J1AA 1CAXB 3OYWA 4SLIA 2A75A 4ZPIA 3WF4A 2VR4A 1PO21 2EIEA 2ZMNA 5H9RA 2W1UA 1RUNA 5K0UA 1UW8A 3KVBA 1DCSA 3QH6A 4Y20A 3AMHA 3H7YA 3MW4A 1C57A 2UURA 1OD5A 1ND2A 4S2HA 2JENA 1OT5A 3K4ZA 3SH4A 3FN9A 2QQOA 2E26A 2X8KA 2RE9A 4YGDA 3U78A 3VZOA 3P3NA 2JD9A 1JOJA 1AR73 3B9CA 4U36A 1DQ5A 1W8ZA 2NM1A 3I2JA 1HV1A 5T5JA 1MEC3 1W2NA 1GP5A 3WUCA 4MGKE 4LE3A 3LPFA 2QBXA 5FPAA 3OF1A 4OHZA 3HR9A 3WG3A 2XUEA 3B7MA 4BMEA 3F2ZA 5EP9A 3KT4A 1KQRA 2VZVA 1L7LA 1Q56A 4XJAA 3KM5A 5F32A 1N3OA 1VIWB 2BTVC 4ZZ8A 1C8M2 5LCWL 4AE2A 4OI0A 1LODA 1LTEA 1WBLA 1S0CA 5EXOA 1UMHA 4CDWB 4TLFA 5FZ7A 4KGGA 1T6GC 4IV1A 4Q27A 4Z2AA 4N43B 1PVC3 4KBZA 3UYJA 1QDOA 3LB9A 4KG0A 2YYOA 1OQEA 1PO22 3ZFGA 4F8AA 5C9AA 2BP6A 3AL5A 5JPMB 4PI0A 4FP2A 1LU2A 3LSEA 3S7EA 1W8NA 5A3OA 1BLZA 3KCXA 1DQ6A 1S2BA 5BNNC 4YSFA 2FCUA 2ZAHA 2YY1A 4FP3A 4CCCA 3RWKX 4ES9A 2YDEA 3RPQA 1VMHA 1C4RA 1XRUA 1ZZ7A 3H1WA 4M00A 1UX7A 1LECA 1N3PA 4XUNA 3CZJA 3SH3A 3ECQA 2GNBA 2I45A 4BU2A 4LITA 5A3TA 5JOWA 5JWPA 5CG9A 2WZEA 2W5FA 3RVHA 4K8RB 2FDIA 2C6SA 3AJYA 3M3OA 4Q4W3 2EAAA 4RQPB 2X09A 1Q8OA 5AVPA 1EV11 3KCCA 5FR3A 1RHI1 3GZUC 3B3QE 2XWBB 4JDNA 1AYN3 1SMVA 2D3PA 3AK0A 4C90A 5C6CA 3V0BB 5ERLA 1CGPA 1TZOA 2XVLA 5F8PA 4IV3A 4LOSA 3Q8FA 4RR3A 5A80A 4UI9L 3MI8A 5IT6A 5FYYA 1H8TB 5EFUA 2WC2A 1OURA 5FP9A 3ZPOA 2VAUA 4IGPA 3MO4A 2ADEA 4YRDA 1VBB1 4BCUA 1Z7S1 1WW7A 3HQUA 1UYZA 3K4DA 1PIV1 2AGSA 3SISA 1OKOA 3H8XA 4CDUC 3SXWA 1GZCA 4QXKA 4RN5A 5A32B 5HBAA 3ZXAC 3FLTA 4IE6A 5E6HA 1YJLA 4G9SB 1ZNPA 5FZKA 2WWJA 1BBT1 3HAGA 1OHFA 4Y3OA 4OHVA 4B7KA 3M70A 1V6MA 3JBG1 5KHIA 1MZ5A 3TWIA 1WW4A 3PVEA 2HWE1 1DZTA 3K4AA 3N9QA 1ULPA 2GMPA 2XLAA 5FKBA 4YGEA 1V6JA 2QCSB 4CEYA 2WNUC 5DAVA 3GF6A 4R9BA 4Y5TA 1PHMA 2EXJA 1OQ1A 1AHSA 2B9UA 1NCRB 1J1LA 3WINE 4EZHA 1UOGA 5BYNA 1EV12 2ZX0A 1XU1A 4LJHA 4ZS3A 5I91A 1LAJA 1PX3A 1VR3A 2VVFA 3GALA 2WS91 4WVMA 3BTXA 1LNSA 1BYHA 3WNNA 3H9AA 3MZHA 4QX0A 1HB3A 1JUIA 2WO2A 2DUOA 2PELA 3T0AA 3WP6A 3CO2A 2CAUA 5IFPA 3T1MA 1LOAA 3HMYA 2BERA 5LW9A 4NRPA 1TMF3 5LA0A 2EIDA 4UBGA 3N4MA 2ZHKA 5BNOB 1QJEA 3U14A 1CVNA 1VBB2 2JJ6A 2ZAAA 4Q4Y3 4YVSC 5EYYA 4CP1A 1JYVA 1Z7S2 3VBRA 1PIV2 3OPZA 2YZ4A 3SHRA 4KH9A 4DEVA 4JGZB 1AR63 1W05A 1IG0A 3N9PA 4LLFA 1H2LA 2ATFA 1NY72 4BISA 4PBOA 4QPGB 3VD5A 4UWDA 2V4AA 1ZRFA 2F4PA 5JXGA 2HWE2 3H0OA 1NCQB 3ZFFC 3VBSA 1UYYA 4V2VA 3M3CA 1PM4A 3M7AA 4Q4X1 2YBSA 1JUHA 4G3YC 4JC1A 1RINA 4XMIA 5FY1A 4OCTA 1QXPA 5BY5A 1XNTA 3ES4A 4K1YA 5FYUA 5DQ0A 2VL4A 2WS92 1IQDC 5CFDA 3AM2A 3H7JA 3ACFA 4BE3A 1FI2A 4PT6A 3U4XA 1X7NA 2ENRA 3C7EA 3GCWA 2HWD2 1EY2A 2IXLA 4LE4A 3T30A 4CDQA 4YZ5A 2NP0A 1JU4A 1J1TA 3AVSA 4AEDC 2AEYA 2BFUS 4QPWA 1QJZA 4YGCA 3RZJA 5C5UA 4XF9A 1NLRA 1O7FA 4B1LA 1KRIA 1V6NA 1ULFA 4H55A 4CZSA 4DQAA 3EXUA 4QKNA 1W8HA 4CU7A 1C5IA 2RM21 5DAQA 3PJYA 3FHIB 5FKCA 2W2IA 3AP5A 4UW3A 3OYWB 1GYKA 1A34A 2WZPP 4E2QA 4PF5A 5FV3A 1FMD1 1TEIA 4MXVA 4CCKA 2H6BA 2VBBA 2DCTA 2VECA 1W90A 3NW4A 1CZSA 1FXZA 3KHCA 1UWWA 5A3WA 3N9LA 3W21A 4Y20B 1D2SA 1NKGA 1GQGA 3ZSLA 4TTGA 1ND2B 2D44A 3NJXA 1WA4A 4URTA 3OBRA 3TNPB 4ARXA 4KNCA 4O9GA 1WCSA 4FTSA 3ZYGA 1C8M3 3HOBA 1NAEA 1WMXA 4FPCA 4Q4X2 4Y22A 1T2XA 1TME3 3PIGA 4CCNA 4META 1QOOA 2GDFA 4IESA 2AYHA 3CDZB 1EAH1 4P02B 3J7HA 1DU3D 1LR5A 5KHJA 2RDNA 4MADA 3GM8A 4LHKA 1DGWX 1JOPA 1MACA 1PO23 2VZUA 4Q0QA 5FLIA 5L9VA 5LWBA 5EV7A 3O1RA 4MHRA 3K77A 5BNPB 1XNKA 3J26N 5EQUA 5GLZA 3CJIC 1D4VB 5JZGB 3VDCA 3LDBA 4KWKA 2EAKA 2VMIA 1PM7A 5C8CA 4NAMA 4UF0A 2JDAA 5FYTA 2R6QA 1R1A3 2D6NA 4IV1B 1FATA 2RM22 5FYHA 3U4SA 4LA2A 5FZOB 1AR82 3MF9A 2W1SA 4D69A 4K6BA 1PGW1 2PHXA 5F3IA 4IQPA 1W3XA 3ZM8A 1FMD2 4ET7A 3ZFGB 5KC6A 3IIIA 5J37A 4CTEA 2Q30A 1G9BA 1QIQA 4COWA 3AB0A 4MVTA 3TAYA 3RI8A 5CFCA 1W6PA 4XZUG 4Y1VA 4B3NA 3X29B 5HCBA 5T55A 4Y5Z0 1ODNA 2BVVA 1QGLA 1W8UA 3DYPA 1IS5A 1NZCA 4LQRA 4BYYA 1F9KA 3BKZA 4AFAA 2ARBA 1RIRA 3VKNA 1NXMA 2JG9B 3DL3A 4FT8A 5D8AA 4CU8A 1G8WA 3ALQA 2JICA 1R1ZA 3VHOA 1LESA 4P5YA 2IUWA 3D6EA 1HN0A 3UKTA 1MPXA 5I93A 3MICA 1G9AA 5L9BA 2OZ6A 1OA4A 5GZGA 4WVZA 3M3QA 3AKRA 5IVBA 2GH8A 2Y6LA 3BALA 2F17A 3K2OA 2LW8A 2PAKA 2VM9A 3AZXA 2VTXA 1GNYA 2AACA 2P6CA 4QDSA 1JXNA 4DRRA 1BVP1 5DG2A 4AK3A 5JCTA 3VBOA 2W1QA 3QH7A 1MQTC 2VMHA 5FMCA 1RB8G 1PGW2 3RJRA 3O0WA 3NL1A 5KXCA 4TLGA 1VE0A 2QVSB 2W47A 2V5DA 2IC1A 5T52A 1EV13 3K75B 3FFQA 1RHI3 4BXSV 1OKQA 4OQ8A 2XKPA 2H0VA 4RGAA 3I2GA 2X05A 4QX5A 3OOXA 4UFHA 1J3PA 2ZGRA 4I3PA 4EE2A 5FMOS 1AXZA 4XIKA 3LEMA 3A21A 3ACHA 1QOSA 1DBNA 2TBVA 2VZ3A 1TE1B 1WD3A 2VC9A 3DXUA 4NHXA 4CEYB 2FD8A 4D8MA 1LOBA 5JXJA 4PDWA 4NHYA 3ZXJA 2VTFA 3MBWA 2R16A 3T3YA 1ASJ1 1FV2A 1TQ5A 1VBB3 3KV6A 4CDWC 1Z7S3 2ARCA 1GU3A 5IVJA 4XHXA 1QJX2 4BQ3A 3AYCA 1QXRA 2DUQA 4WVMB 3W5NA 3GZAA 4N43C 1F8VA 1WW5A 4OI1A 1R093 3CBNA 4RA0A 3V56A 3ZPYA 1GLHA 4HBNA 5FPLA 4RGKA 2RDQA 1BBT3 2LM3A 3ZFEA 3JBG3 4XYXA 2HWE3 2XOMA 3ZOIA 1O3TA 1Z0HA 4L2NA 4QB2A 3H42B 1L7RA 4FPGA 4LBNA 3O14A 2WUHA 3VBRB 4TN7A 4XFIA 4CXYA 1SFPA 1BEV2 1K5MA 4I0WB 3CL1A 1IPKA 1YO8A 1UQXA 3NVCA 3WP4A 2P2KA 2WS93 3PUAA 3KT7A 2UU8A 3DV8A 3QD6A 1N1YA 3WQBA 3Q8EA 1YFYA 2MEV1 3NO8A 4DY5A 1W6OA 2G1MA 2NLRA 3IDCB 1YC61 3CKHA 2UYAA 5FZ3A 1ALYA 1XNCA 4QQ2A 4LHLA 1RUG1 1W06A 2IXJA 3G6JB 3U1XA 3ZYFA 4CU6A 1S2KA 5FZEA 5A3LA 1ASJ2 2OT7A 4GQ7A 4FPEA 5DMYA 4COZA 4E2SA 1VBA1 4NAOA 2C24A 1O4ZA 5EWSA 4CRQA 3C3VA 5FOJB 1KFUL 1SQ4A 2R49A 2VD7A 3M8LA 1URXA 1NOVA 4ZHNA 5HV4A 1MR5A 5A33A 1NE4A 1CAUA 2QNKA 5CB7A 3THPA 4CCDA 2HBTA 3DPRC 2VOXA 2WDBA 1LEDA 2E7AA 2DV9A 2YGMA 3PUSA 4QGMA 1U5XA 2WABA 4Q4X3 3MIFA 2DVFA 2ZBJA 2Y6GA 3SC7X 1SLCA 4YZ2A 2YMZA 2FDKA 2OQ7A 1HXS2 2J7MA 3RI9A 2W08A 3MDPA 4WM8A 4NE9A 2Y33A 2OVUA 4YVWB 2D6OX 4JGYA 4I09A 1HB4A 4LBQB 5J96B 1OXCA 1SFNA 1D4M1 1TG7A 3BI3A 1O8PA 1V6OA 4QGLA 1BVVA 2Y6FA 3L2YA 1CAXA 1GWKA 1ZA7A 3N9MA 4M4PA 5IVFA 1AXYA 4XFHA 3ZDSA 2VH9A 4Y22B 2UWAA 1JOBA 1RUG2 1JZ8A 2VMFA 4M4RA 5FP4A 2RM23 2WN2A 1SPPA 1DYKA 3UGHA 4QKFA 3VKLA 5LK7B 1B09A 2CGOA 2XJRA 4IEZA 1FMD3 3DKWA 2XJQA 4BDVB 4GWIA 1VBC1 3UKNA 5F3GA 3D5OA 5FWEA 5IJRA 4JGZC 1AX2A 1VAKA 3ZXGA 2UY9A 4MV2A 4ZXEA 1US3A 3JZVA 3I3MA 2PAEA 3ZSKA 5C8CB 3DKQA 3Q8AA 4QPGC 1POV1 3JB8A 4UF0B 1OVSA 4LKSA 3VBFA 1RUC2 2G9GA 1PGSA 1WLTA 3GZTB 3VBUB 1S4CA 2WT2A 3JCIA 3S0MA 4ARYA 3IIAA 1RUD1 2WQ4A 3AP9A 5A7NA 2ZTNA 3WEZA 1PO12 5JSPA 3BUCA 4QB6A 1EAH3 1CQ9A 1O3QA 1VPHA 4R52A 4AVCA 2RS31 2V73A 3LWCA 1W6PB 5CFCB 4IGQA 3P3PA 4L11A 2DDUA 3KCYA 1SLBA 4F83A 3VD9A 2FHRA 3B9IA 4QX1A 5JSOA 3ELNA 4NROA 2WIIB 2G9FA 3AP4A 2YUEA 1CWPA 1ULDA 2KR2A 1SACA 2RR11 2WSUA 1QMJA 2WLPA 1LJ7A 2QQMA 4M3CA 1AX0A 1X36A 4PJYA 1GZ9A 2W0XA 3BTAA 2AC1A 2WFPA 4PIYA 4XDOA 4NO4A 3CNAA 3EJKA 5FY5A 4W8JA 1LOEA 3NKTA 2P6HA 2ZGLA 3UETA 3WZ1A 3E97A 2QUOA 4YW6A 3OGSA 1I1EA 4XDQA 4LMFA 3WG2A 4OMDA 1XYOA 3C7OA 2WT0A 5FO7B 4FBFA 1O3SA 3T4VA 5K0UC 3HN3A 4H3WA 4RQPA 4RL7A 4MGZE 2JIJA 2B7YA 1PMHX 2JG8B 2VMDA 2Z2SB 5DZFA 5C33A 1ND2C 4GKXA 3V0BA 3AL6A 2DUPA 3VBOB 4P00B 1JZ2A 4I0BA 5FYZA 3I2IA 1XE0A 3MIHA 5FY8A 3VKMA 2XPJA 4LO6B 2OX0A 2R32A 3BPSA 4DFSA 1HW5A 1LOCA 3AZYA 1GICA 1H8TA 2WJSA 2X5IB 5FMDA 4GJZA 3LGRA 3T2QA 2BGCA 3R4DB 2RS32 4QXCA 1JBCA 5CEHA 2ZX2A 5LA9A 3BIWE 4DZGA 1XXNA 3WNMA 4IXLA 4YZ1A 5FZ4A 1OSGA 1AL21 3I54A 2WFF2 2D6LX 4KL1A 3R6SA 3O1UA 1VLNA 2R1BA 3O12A 2DURA 2EXKA 4O7XA 1W9YA 1WCUA 2QQUA 2RR12 2FZ1A 4QGNA 5EHDA 1F4HA 1ZZCA 2BUKA 5FZBA 1AJOA 3WNOA 2QE3A 3WHUA 4CXXA 2ET1A 2PHTA 4XFAA 4JRLA 4OFGA 1ONAA 2ZZQA 3A0KA 1FNYA 1OOPA 2XQXA 2ZA9A 4BZ4A 5FZ6A 1COV2 4GMP1 2XJTA 2PMWB 4FPYA 4N9HA 5FY7A 3SQOA 4B4RA 3V0AB 1GFF2 2CGNA 4XIOA 5C9AC 2ZGNA 1NCRA 4ZZ5A 3IWZA 4MXWB 1S0DA 1KFXL 3LFIA 3WLUA 3WF0A 2P34A 1C3HA 3WD5A 2PHUA 2B8MA 4IUGA 4NPMA 5FXVA 3CHXA 4R9CA 4XXAA 1FPN2 4Y24A 4LA3A 1KITA 3CU7A 3VZJA 1BK1A 4CDXA 1X9TA 4FTBA 1RUF1 2ZEYA 4QM9A 2D6PA 3MFAA 2L9LA 2A3WA 1ASJ3 5FJHA 3POWA 1NLQA 3S57A 1TNRA 4XQ4A 4OULA 1WUVA 2ZX3A 3IKWA 4FTEA 4WV8A 3IT8A 1AF9A 1NZIA 2ZEWA 5ABJB 2E53A 3MW3A 4XUQA 3NRUA 2WQZC 1LENA 1F5FA 2C4XA 2WLQA 1H4GA 1S0JA 3NV4A 3HBKA 3PJQA 4FPKA 4QU1A 5T5OA 4AG4A 1UYXA 1AJKA 3AFKA 1W6OB 1W8FA 5I8YA 1AL22 1JZ4A 3I2FA 3QLQA 4OYUA 4OQ9A 1PMJX 1QHDA 1V0AA 2C0ZA 2A6YA 2NQYA 3N9OA 1KS4A 4IV3C 4RR3C 3RWNA 3U11A 1RUI1 3BTYA 5LBBA 5EYXA 1GZWA 2XR4A 2Z69A 1DF0A 4MUVA 3HQXA 3IBMA 3RQ0A 4AEKA 2WO7A 5CKMA 4D94A 1NCQA 2BYVE 2NZ9A 4EYUA 4A6OA 1CJPA 3MV11 3WW3A 2O14A 3NJYA 1O91A 2VQUA 2ZEZA 2A5ZA 5GKAC 2XUMA 3ZSEA 4JVAA 1I6XA 2GH2A 4MOAA 4IE0A 5A33B 1CAUB 2ZCWA 3N3HA 5FK7A 5LK5A 4BA6A 3SEPA 5JAXA 1SLAA 2MEV3 4X8NA 3H3ZA 2XGXA 4M3CE 3WDUA 5A6YA 1UMIA 4JZRA 4DUVA 1HV0A 3RYKA 4MSVA 3VD7A 2V72A 4LTAA 1RUG3 1RUF2 2PXJA 1O5UA 1WLCA 4QPIB 3O0VA 1ZRRA 2D3RA 4SBVA 4CEYC 4I01A 1W9WA 2GNMA 3HT2A 5L7OB 3OTFA 4JKKA 1OPMA 5GALA 4K1ZA 5FZ1A 4A4AA 1VBA3 2RDSA 2YG0A 2DCZA 3AKSA 3BB6A 4Q8KA 2WSVA 3IMMA 2VCBA 4DY3A 3SNMA 2JIGA 3T2OA 1WWYA 1QJU2 1GSLA 1VP6A 1EP0A 3EMRA 3FJSA 1QNYA 2B45X 2RMU1 4GB31 1K5JA 3ZLIA 1JYIA 4S2GA 1YI7A 5JI7A 1RUI2 3ILFA 2QDRA 3MUZ1 4A3ZA 1BQPA 3AJZA 3M2MA 3ZYIB 4QX2A 4ORFA 1SPPB 5J98B 3O1PA 3I7DA 2QDNA 2C9AA 4AHWA 4FPOB 4N8MA 1JS9A 4IEWA 3WHTA 2MPFA 5A3MA 2TNFA 2WAAA 4LK6A 4P9JA 3AMNA 3P1IA 4S2DA 5FYCA 3VBRC 2LS6A 4FPHA 3L2HA 2VBPA 3ZDVA 2YC4A 1X33A 4QQLA 1D4M3 2F6BA 1E5RA 2XJSA 2R0FA 4MGQA 2D7FA 3K46A 4C91A 4XTMA 2BZDA 1POQA 4BK4A 4EZ4A 1GWMA 4ZU5A 3ILRA 4XJUA 2IXIA 3VBHB 2Q1ZB 2TUNA 4GWNA 4NIDA 1CIWA 3VBFB 3VBSC 4OHWA 3EQEA 2EXHA 3HNBM 3KLSA 5GM0A 4DXSA 4LBMA 5BNPA 4NVPA 1IOAA 1PZ8A 5JZGA 2HKXA 2HLEA 1NA1B 1JMUB 1JHNA 2VNGA 3A22A 3DXTA 3QBQA 4TWTA 4LBKA 1IKPA 1MZ6A 4DINB 3HQRA 1S0GA 3GHMA 3JQWA 4E8CA 1VBC3 5FZOA 1W6QB 2BQPA 5C5TA 5CFDC 3NV3A 4DEQA 4H14A 3GXUA 2Q5TA 3V64A 2RMU2 2Y0IA 4CDQC 4GB32 1PK6A 2BOIA 3JB4C 4C8DA 1Z78A 1M06G 1POV3 3NNFA 5K9YA 2DVGA 2GC0A 4M3CB 3HVDA 4NMIA 3UV9A 3AXEA 2GNTA 1IS3A 1KXGA 4OZOA 4HXCA 1RUJ1 4HMZA 1PZ9A 3ACIA 1RUD3 4AAPA 3RDIA 1GWLA 3CIHA 4BB3A 4P9LA 2FCVA 5FOBB 4XURA 2JDKA 4QAWA 3E5QA 2JG9A 1LGCA 2RS33 3F95A 3O1TA 3NJZA 5D2AA 5J7MA 2QQNA 3H3UA 3KHBA 1OH4A 4CCMA 1X50A 1GMMA 4M0HA 1RITA 4O61A 5FFOC 1POV0 1LEMA 4P14A 1W2TA 3ACGA 2HWF1 5F6LB 3WW1A 4BIFA 2CWSA 1E5IA 2IFWA 2J1VA 2RR13 5DDJ3 4AI8A 3T0DA 1H2MA 5F2WA 4GKYA 4BIOA 2E63A 4XW3A 3WF1A 1ULCA 2Q1FA 3IMNA 4ZONA 3EHKA 4B7EA 4B1MA 4HK9A 4N53B 3VDDA 2WNOA 2NMOA 2W92A 1XSRA 5FZHA 2Q1MA 1UIKA 2WWUA 5T54A 4BQWA 5A3PA 4RHV1 2DCYA 2RS52 3FUOA 2J1TA 4XPVA 2WAOA 1QH6A 3T08A 2Q0AA 2I2SA 3OG2A 4OMCA 1AZDA 1NY71 3UESA 4WVVA 5LRSA 1AR91 1WMDA 1G86A 3NNJA 2IFRA 2WRAA 4R4XA 3ZN6B 5FYBA 4DMIA 5C8CC 5IVVA 2YC2A 4A44A 4RYDA 1OOPB 1RUJ2 4L8QA 4AFCA 5I0SA 3C7HA 1ZX5A 3ILNA 1UY0A 2BJSA 5H9QA 2D6MA 4CEWA 4URAA 3KV4A 3E6CC 3MFCA 4HT1T 1JYNA 3DEMA 4RSUA 5A3NA 4JKMA 5CZKA 4FFFA 3VHNA 3GBGA 3N7MA 4LO7A 1F15A 3A0NA 2A6ZA 4JDOA 5CFCC 1AL23 1DHKB 4OHYA 5FZLA 4D6QA 2HWF2 2BWCA 2HWD1 3KT1A 4X8PA 5GLTA 1FX5A 1CESA 1OC1A 4AVVA 1W2AX 4CDXB 2XVGA 4XJ9A 1S0IA 3ZX7A 4COVA 5KXBA 1HX6A 1UOFA 4K9SA 4LUMA 3NSTA 4XDPA 1O3RA 4UOJA 2ZOEB 5D8AC 4XHBA 2GN3A 2SBAA 1NX9A 2WQ8A 2XHNA 3MW2A 3O7OA 3U75A 3FBMA 1SLLA 2QQPA 3FZ3A 5KXDA 3MLKA 4GA9A 3AP7A 5SV5A 4GMP3 4XFGA 4RHV2 4DUWA 3CMGA 5GZDA 2QQIA 4IEQA 4HL0A 1SDDB 2WO3A 3E6DA 1UKRA 3NV2A 4W6YA 4WVWA 2R042 1XYPA 3P5BA 4EV0A 3B02A 3B00A 1AR92 4FO9A 4PIXA 4AQ2A 5LY2A 5FPXA 1GZWB 4H7LA 4MHUA 2UYBA 3VUOA 2XQRA 1KDKA 2P3KA 1QOTA 5FYIA 2PHLA 1RUF3 3IB3A 2ADDA 1R64A 3VBOC 2R0HA 4CCOA 5K7PA 4KGQA 3CEWA 4CYDA 4R9DA 5FIXA 1ST8A 2NMNA 2WNVB 2VPVA 4GMP0 5J3UA 2SLIA 2JB8A 3WNLA 5CA6A 1YJKA 2OUHA 3ZMNA 2XLFA 3TOJA 1OLRA 4QHOA 3O1SA 2FZ2A 4QT6A 5F5QA 2EIBA 1CX4A 4AGRA 3URFA 1N1SA 1K3IA 5A7SA 3SITA 5FUNA 4PDWC 1UIJA 4P08A 2ZKNA 3KVAA 4NRMA 3J7MA 2A3XA 1VMJA 2I07B 2XLGA 3L9JT 1SDWA 3UL2A 2Z79A 1VBD1 1AR81 1GNZA 4KMQA 2FMYA 1MS4A 4GIQA 5FYVA 4QD2A 4IEXA 4DRVA 3R0RA 3Q9OA 2RS11 1F35A 1RUE1 2WKKA 1IS4A 3E5UA 5LATA 1SLIA 5D1IA 4YVWA 4NIHA 4E2GA 3H1MA 3APBA 3BOWA 4LBQA 4W6WA 2W1WA 3RSJA 3ZFEC 2Y6HA 3ZKUA 4YGBA 4AL9A 2Z42A 4AHXA 3AC0A 4YZ3A 2QQJA 5CAZA 2P3IA 3WG4A 4WM7A 4W4ZA 1IPSA 1SEFA 2XH6A 3TYJA 1X9PA 3EB7A 3U10A 1RUOA 4TSVA 3VLBB 1W2OA 3W58A 2A71A 2PHDA 2VCCA 1RYYA 3WDWA 1A8DA 1K5MC 2ZX4A 1DLLA 2E51A 5B4XA 1XSQA 3N35A 1OLME 1DQ2A 4AEMA 2ERFA 3TEZA 3GJBA 4BK5A 5GZFA 3OB8A 3GHNA 1PMIA 2RMU3 4GB33 1NUKA 4OZXA 2BW8A 4L99A 5D21A 4GH4A 5CG8A 2E31A 1IPJA 5A7OA 4IEVA 4HK8A 4AFDA 3RZMA 4OVEA 4V1PA 2CSGA 5JDBA 4NN0A 1J3QA 1NQJA 1CAVB 1W0OA 2JXAA 4KG8A 1GZTA 4U2AA 4AVBA 2VXJA 2OS2A 1ZBE1 4H2AA 1CIYA 1S0EA 1HRV2 1VBD2 1O5LA 4AAXA 1RTVA 3VBUA 1EUUA 4E4HA 1NYWA 1W39A 1H2KA 5FZ9A 3THTA 2RS12 4XAAA 1RUE2 1X82A 1UMZA 1GOFA 1UN1A 1PK6B 4RFT0 3VB9A 4HANA 1V9U2 4CSWA 1W9SA 5FCCA 3I59A 3NWKA 2ZHLA 1MS0A 3SKJE 1UAIA 2HYXA 4MO3M 2OIIA 4COUA 2IZWA 1IS6A 2HWC2 1Y9GA 4MGIE 2WT1A 2UWCA 3OCPA 1GP6A 3M3EA 4C0HA 5L19A 5I8SA 2XWJB 1B35B 4DPNA 4WM8C 3K3OA 4JGYC 1WMEA 1QJX1 1HN1A 2YFUA 4Y4YA 2BGPA 3MGUA 5JUVA 3WT3A 3KMHA 1QEXA 3JD72 4LXLA 4Q4V2 4J6GA 1MS8A 3HWJA 4BH9A 1UXXX 1GOHA 3R4SA 1ACCA 3ZIWA 3C8XA 2VVEA 3QOPA 1NE6A 2JG8A 1RUJ3 1IGOA 2JX9A 3ZO0B 1ZBE2 3AXDA 3O0XA 3VDDB 4RFRB 1JTZX 1RXFA 4AF9A 3WP3A 1N1TA 3AZZA 4XETA 2CV6A 2H0BA 1CX1A 3WQ1A 4R9AA 4CCLA 5LY1A 3H1YA 1N1VA 1BEV1 4D6RA 4LR4A 2X5IA 4RS5A 1ND3B 3FUQA 3JQXA 3SKVA 2B46X 3DCQA 3B94A 4NPLA 3HEIA 3KGZA 2JECA 4NHMA 4YW5A 1V6LA 1WCDJ 2VCAA 4QU2A 2HWF3 2JDUA 2WN3A 4X6QB 4PHZA 3QACA 1REFA 5A1LA 4OLLA 3RS6A 3NNGA 1XQNA 3KB5A 4FFGA 2R1DA 4CEWB 4K7JA 3PU8A 3SCHA 4M3CF 4LKFA 3MLJA 3BIEA 3FHQA 1AX1A 3PMSA 2LRPA 2YB7A 4ISRA 3UJQA 1PIV3 2R062 3PDQA 5FDBA 4RHV3 5CBLA 2A6VA 1ZBA1 5F39A 3VHRA 3WDVA 1A3KA 3V0AA 1W6NB 1AR93 2WWSA 4XVHA 2FDFA 1O8SA 4AR2A 3OY8A 4MXWA 1YRZA 1V6IA 5EPAA 4BJ0A 2KXLA 3RGBA 2A6XA 2ZABA 1YI9A 1RC6A 4XFBA 2Q8CA 5JMOA 4JQTA 2GP5A 3AYAA 4YW4A 4TZDA 5EIYB 2P17A 1YQ2A 4ZY9A 1HIXA 3FWEA 4FCAA 5BPXA 1QU0A 1WZXA 2ZGUA 5FYSA 3UT0A 1HXS1 2O1QA 1DG6A 4OUEA 4BQ2A 2HEWF 4E27A 4RGGA 2FDHA 4L0PA 1LOFA 5AVAA 3HIFA 5FZFA 5ABJA 1FOD2 4E9KA 4QXHA 2ARXA 1QJFA 1J3RA 4RQPC 4LK7A 4AVTA 4D7TA 3GCXA 2PQQA 1QDCA 4JQRA 2HWD3 2YGLA 2YU2A 3KD4A 5FZDA 1UZYA 1GKBA 3ZIXA 2WZR1 1MZEA 1YFXA 4IEUA 4Q8LA 4AQSA 2PHRA 5FP7A 4C1XA 1FYUA 3WF3A 1H8TC 5JXHA 2WL1A 1WLDA 5EZWA 4I30A 1H6YA 2XBO1 1DYPA 4Z8BA 1UOBA 3I2KA 4QMAA 5JOZA 2WA3A 1ZBA2 4P9GA 3LD8A 1E5SA 4KU7A 2A3YA 2VXRA 3R05A 3S5AA 2YHJA 2DF7A 5T5PA 4CUCA 1DIWA 4OUMA 5IAXA 3LQCA 1RVF2 5HCFA 5AC92 1BHGA 1RUC1 2V4VA 5FLJA 1UOJA 2VO5A 1BJQA 4AHZA 1VRH1 4HSJA 4ZU7A 1H1AA 4QPIA 4W50A 4AVAA 2LUWA 2DWRA 1PO11 5L7OA 2C26A 4XXPA 3RJ2X 1EYBA 2Y60A 3IPVA 1NCRC 2WR9A 2AREA 4YNIA 4YARA 2PLV1 4YLZA 3DYMA 5DZEA 3TB0A 4UW4A 4HVOA 4O9EA 1N3QA 1UNBA 4WM7B 3WCSA 2BGOA 4AXOA 1U5ZA 5BNNB 2AENA 4OHXA 2WZR2 3U0ZA 2N7GA 3DF0A 5AFBA 3A4UA 2Y6JA 4HVQA 1OF4A 1LCLA 2RHPA 5LEJA 5T5LA 2IXHA 3WNPA 1OPOA 1Y4WA 4FVVA 2XBO2 5AFEA 3PLQA 1AR83 1AR71 1CN1A 1XBFA 1ZZ9A 4I0AA 4R8HA 1J84A 1QQP2 1ULOA 3VZNA 5BNOC 3WY6A 5GZCA 3T2PA 3B69A 3BVCA 4QX3A 5JSRA 2RS13 1RUE3 2ARAA 2PHFA 4GZ9A 4LO8A 1IQAA 4GXLA 3ASIA 3KF5A 2B4KA 4GH4B 4AGVA 1SCRA 5FWJA 1L3JA 2ETEA 4Y5SA 5CNAA 2ZHMA 2XKOA 3D4KA 3OUJA 4NRQA 5LBEA 1SZBA 2EXIA 3VBHA 1O59A 4LLOA 5DXDA 2D43A 2J1RA 1OVPA 1XU2A 1H2NA 3O1MA 1NCQC 1LHWA 1VRH2 3PMEA 1G9FA 3SMHA 3O1VA 1PNFA 2YXSA 2W94A 2JE8A 5FZCA 3WQ0A 1NA1A 2VZTA 4XUOA 4XJZA 5JI9A 5HI0A 2FQPA 2VULA 5FPZA 4CDUB 3I59B 2PLV2 3OGVA 4YPJA 3J8F1 1W6QA 1WCKA 2GMMA 3I4IA 2DVDA 3HBZA 3RFRA 1VAVA 3KSCA 2VZPA 2IVIB 2K9ZA 2R071 1W8OA 2WFF1 4B4QA 4E8DA 1LGBA 4FFHA 1DFQA 3THCA 1VB4A 4PLNA 2Y8KA 4DIQA 4UBHA 3C2UA 3I2HA 3VHPA 1ZBE3 2WNUB 4FPJA 3VDAA 4OI2A 2X10A 3LSDA 1G6NA 1AR72 4LKEA 5E1RA 1LHNA 5CKQA 5IFTA 1S0BA 2VZOA 2DVAA 2ZZJA 2ID4A 1COV1 3PVOA 3LDRA 4PI2A 2CU5A 3FMGA 3U07A 4AFBA 2W3JA 4MLOA 2BRTA 5CVRA 3ITQA 1H0BA 2ES3A 4AI9A 3FHAA 2XONA 5A70A 3H8UA 2A70A 4Q0UA 3WVJA 1FPN1 2RDRA 4DNYA 4NIAA 3IAQA 3AYDA 1DGRN 4Q26A 5JOXA 1H30A 4YVSB 4P9WA 1F31A 2VCMA 4RS5B 2YBPA 2ZMLA 3AP6A 4IL7A 1ZZ6A 2C5DA 4IW3A 4M0NA 1C8NA 1QJX3 5C7GA 3CQOA 5IK7A 3Q8BA 4N53A 2XVKA 4LBQD 3J8F2 3BGAA 1QXJA 4YM3A 2VUJA 5BV6A 1CPMA 2VUCA 4UFJA 4YG0A 4TYSA 2R072 5L9RA 4B8EA 5BNPC 1GP4A 3BODA 4HN0A 2KD7A 4KWUA 4XABA 3SH5A 3USUB 3POBA 1VBE1 1W99A 4BQ5A 5JZGC 1YFWA 4HPKA 4EJRA 3ZN6A 2BNMA 2JB4A 3OGJA 1P8JA 4GWJA 3VGIA 3ZN4A 1KJRA 4IV1C 5JPNB 1BEV3 4XMAA 1XYNA 1WBFA 3LA2A 1KGYA 4NPRA 4Z1VA 1J58A
chains in the Genus database with same CATH topology
2VVDA 2VNOA 5C8WA 1HDKA 3ZFGC 1PK6C 3OY8B 2A6WA 2XB6C 2E7QA 4AEDB 4HFSA 1YCIA 1MS1A 1ZZ8A 1CPNA 2NPIA 1F2NA 2K0GA 3WQ7A 3ATGA 1V70A 1NG0A 4JRAA 2JG9C 4BQ1A 3T1LA 3MIBA 1WW6A 2MHFA 3WNXA 1ZBA3 2ZGPA 4BMBA 3DN7A 4LEJA 1OQDA 1GANA 1MVEA 1AXKA 3NAPA 3POSA 1OFSA 5JIUA 2YPJA 4L9BA 1QJU1 1QJY1 3ZN5A 3J4UH 4ITCA 1VBE2 1HQLA 1NQDA 2XL7A 2D97A 2DFBA 2LALA 2RJKA 2XJPA 3VDDC 1XE7A 4ASLA 1HXS3 3FBYA 2CAVA 5IUQA 4B29A 1GV9A 2WNVA 1ENRA 2EIGA 1UF2C 2BFUL 4PLOA 2GZWA 1GQHA 1DGRA 3KGLA 3CJIB 2GC1A 1YFUA 4P5HA 3INAA 5FBZA 4W65A 1UD1A 2WZR3 4ZU4A 1FAYA 4KWJA 3FLRA 2BBVA 3MYXA 2YROA 4W6XA 2DU0A 1TMF2 3NKGA 4CEWC 4DB5A 2XBO3 5FRAA 4Q4Y2 1OA2A 3IPVB 4Y1ZA 2V5YA 4A7ZA 2ZGSA 4XBLA 2QKDA 3MLLA 3MF6A 1QKQA 1QJY2 1Y7BA 3IM0A 3IDBB 1I3HA 4XQWA 4QPYA 2DTYA 2KA3A 1RUC3 4XFCA 2HWB1 4ATEA 3ZSMA 3OD4A 2QZ2A 1M4WA 1TME1 1DZQA 1FV3A 3LA7A 1D0GA 4INDA 1PO13 4QQPA 4YYOA 1D2QA 4KWLA 2GSYA 2PLV3 2NN8A 1YXWA 5DUVA 4BLJA 3WW4A 2XHKA 4P9XA 3BCWA 4LNVA 5FTTC 5C4WA 3WXPA 4LO5B 3BPZA 1XE8A 2A7AA 3FLPA 1SBFA 3LCPA 4Y1UA 4FAHA 1LHOA 2GNDA 3OBTA 4AWDA 1CAWA 1Y9QA 3CF6E 3ZXEA 1MQTB 5J36A 1J59A 1SBDA 1R1A1 1CAVA 4BLIA 3D82A 3FE5A 3K48A 3AZWA 1UX6A 2A73B 4J1WA 3MPBA 1UU6A 3GBFA 4WZFA 2RS51 4K20A 4K40A 1RMU1 2O8OA 1OFNA 1ZRDA 2HWB2 3VL8A 3O5SA 4G4FA 1TME2 3GBWA 3JU9A 3ROUA 3WDXA 4XBNA 4XZPA 2DCKA 1Q5OA 2AH2A 1QH7A 2BVBA 2CNAA 1B35A 3LOBA 2MNGA 2G4IA 5I0TA 4B4PA 1DZRA 4YVWC 1MVQA 4KBBA 3N36A 3J8F3 4FXKB 5ACA1 2R073 2WFF3 4Y1XA 4CP0A 3M1HA 2D6KA 2VY0A 4WM7C 5T50A 3VKOA 4IEPA 1GR3A 3ZXKA 3ACLA 3M3IA 1A8MA 1R1A2 3M4FA 2QJVA 1KJLA 2IXCA 2B42B 1CJDA 3OD0A 4ONUA 1C28A 1COV3 4YM1A 1YWKA 2ET7A 5FMOL 2DVBA 3W59A 1RMU2 1ND3A 1RJ7A 4GH4C 1YHFA 2R041 3ENRA 5LEKA 3UKVA 1MS3A 1FPN3 4HPKB 4NWWA 4Z07A 2HYKA 1EPWA 5IK8A 4FQ4A 3W9AA 1DDLA 5DUWA 1Q8PA 3VBUC 4NHLA 4K8FA 4P9YA 4DXZA 4X6RB 3IDEA 4F3JA 1A78A 1R091 3AMPA 2BNOA 5ACA2 1BMV1 1H4HA 1AYM1 1DGLA 2GC3A 1H8VA 3DPRB 1LB2A 2PYTA 1W6NA 1VBE3 2NYYA 2ZX1A 4JDMA 1Q43A 4MZUA 3TNQA 3ZYRA 4A7KA 2OUJA 3MEPA 2PHWA 4Y26A 5HXVA 5I0RA 2VW0A 4HKWA 1ZZBA 5CU1A 4AGGA 1CD3G 2YV8A 1W6MA 2EVXA 4BM8A 5DZGA 4LO4B 3NAPB 3ZXDA 2CGPA 3LKJA 4JAAA 4OUSA 1RHI2 2EALA 3PTYA 5CIRA 2PAMA 1O4YA 1IZ3A 3QCWA 3TBDA 1I9RA 2W52A 4ASMB 2VNRA 4D3WA 4E4SA 2JG8C 2ZMKA 2ZGMA 5JOYA 1DQ1A 2RJLA 1JW6A 3ZYPA 5BUVA 1VAMA 3EO6A 4AVSA 1A6CA 2X5IC 4QQHA 4OI4A 3FFZA 4RS5C 1ZVFA 5FQ0B 1WD4A 2XJUA 1R092 1RGSA 1BMV2 1AYM2 1LHVA 1QJU3 1QJY3 1ULEA 1BBT2 4YG6A 3CLPA 1RUI3 3JBG2 5DG1A 4AF9A 5BXXA 1KD7A 1AVBA 4IEYA 3KZ4C 4XF0A 2KM2A 4EN9B 2IXKA 3ZSJA 1HRV1 4Q0SA 4YM2A 5F9TA 1F5JA 3EBRA 3ZXFA 4HKLA 3VV1A 1UPIA 5L73A 2XJVA 1ZYBA 3S7IA 5E8AA 1V9U1 3WG1A 1YLLA 3AZVA 3KQRA 3FC0A 2R30A 4NOTA 3ZYJB 1G9DA 3N7LA 1KDMA 3MIEA 4EN0A 2HWC1 5BNNA 2DTWA 1C1LA 4XF1A 3IN9A 2ZGKA 3LA3A 1UPSA 2X53S 1LOFC 3NV1A 5EJ3A 5ABJC 4HN1A 3WDYA 1V6KA 5C4WB 5K0UB 1APNA 2BWAA 3VKFC 4AFMA 4L97A 4Q1RA 1LGNA 3VN4A 1S0FA 3JD71 5DUXA 4Q4V1 1CAWB 4FOVA 5E88A 2ZJCA 4I3GA 2HWB3 1YNAA 4AEJA 4XE9A 3TRSB 2BPA2 3TN91 4EROA 3E6BA 5SV8A 3KS7A 4HETA 4N7IA 3AMMA 3D8CA 4BWOA 3RMYA 2ZACA 1G7YA 3N7KA 4EN7B 4AI1A 4AQ6A 4CDUA 2GMEA 1YYNA 2GU9A 2TEPA 5F6KA 3WP5A 4MYEA 2H6CA 2Y38A 1LU1A 4QPIC 2WINB 1ULGA 5L7OC 2WNUA 1C1FA 1BKZA 1Q8QA 5C9AB 2R061 1SCSA 1UL9A 2RS53 4JCKA 4AI3A 4AW7A 2PFWA 4AI0A 1RMU3 4GWMA 1C5HA 2P37A 1REDA 1D0HA 1JN2P 1UZZA 4MX3A 4D7SA 5CADA 1VALA 3S6PA 2DU1A 4K21A 2VQAA 4QQOA 4AQTA 2UY8A 1XNDA 2D98A 3TN92 5JIAA 1RUH1 5F1RA 5H9SA 1EAH2 4NHKA 1U12A 4YVSA 3D0JA 4EN8B 5I0UA 2EA7A 1UKGA 1EPZA 2JKBA 4RD7A 3WR0A 3VZKA 5ACA3 1FOD1 3ES1A 4PIZA 4IV3B 1R081 4RR3B 4FSJA 2BEOA 2E9QA 2D5FA 1GNHA 2ILMA 3VBHC 1WGPA 3VBFC 3AYEA 3WOGA 3BU7A 3ZFFA 1AUYA 1QWRA 3I8TA 2PTMA 4I02A 3USUA 5HCAA 3AMQA 1OMIA 1HRI1 1NA1C 1PNGA 4FPLA 2V09A 3GNEA 1RL3A 5KWRA 2WA4A 4HLTA 1MS9A 1NLSA 4P9IA 4AI2A 1Q8SA 2AR6A 3N7JA 4A3XA 1UCXA 2R043 5J48A 4XJWA 1XNBA 3ZMOA 5IK5A 2AUYA 1WMFA 1ZM1A 2Y0OA 4HVRA 1PGL1 2B39A 4AEDA 3FX3A 1YUDA 4XBQA 5JR7B 1RVF1 1W6MB 5GLUA 5AC91 1RUH2 1Y43B 2Q4SA 4AYUA 2VMGA 1SLTA 5JVVA 4M01A 2GALA 3WCRA 1SBEA 4COYA 4Y1YA 4ES8A 5IK4A 1ZA4A 1AYM3 1QNWA 1H1IA 3UJOA 1R082 4EN6B 3RYPA 4GULA 3DUIA 4ISQA 4HSLA 1Q3EA 4Q0PA 5KBFA 1DGWA 4R4ZA 1TNFA 5B2GB 1MZFA 1HRI2 4Z92B 3GYDA 4LUKA 2W68A 2CL2A 1JH5A 2OA2A 1QQP1 4N53C 1U5IA 3ETQA 1LKNA 4GALA 5TSWA 5KXEA 2Y26A 2IWGB 3CJXA 4XTPA 2WNEA 3VBSB 3ST7A 4LULA 1PGL2 4LBJA 4EWAA 3CJIA 3ZXLA 4LT5A 4IETA 1O4TA 4D7YA 1ENQA 2PN5A 4YFWA 3T2TA 2D40A 1LHUA 1OOPC 4FQZA 4H7MA 4UXAA 3OGGA 4ZXKA 4A7YA 2ZGOA 2ZGTA 3ME2A 4IERA 5CFDB 4I2OA 4NWVA 5KHKA 4CDQB 1BXHA 1W2UA 2VUAA 3LOIA 4XQDA 2CTVA 4YG3A 1U5YA 4CDXC 3E5XA 2DCJA 4UW6A 5LRRA 5T3NA 1NXD1 3R4UA 4S2FA 3SCFA 2HJIA 2ZGQA 1HRV3 2ZS6B 1VBD3 3HD8B 4JTNA 5FO8B 3SLIA 1LOGA 4N9IA 3JUUA 2D3SA 5L36A 3NAPC 1S55A 2CYFA 4XF3A 1MEC1 2JE9A 1V00A 2JEMA 4Q2FA 1QY4A 1V9U3 4Q29A 3UK9A 2MEV2 4LBOA 5H9PA 4FOQA 3RNSA 2OW4A 4BPZA 2XG3A 2HWC3 4C1WA 1FNZA 4YM0A 4XILA 1KS5A 5FLHA 2PA7A 5E16A 2B5HA 3AX4A 3WV6A 2D5HA 1UU5A 4F7ZA 1MQTA 2WNVC 1VBA2 1Q8VA 4QM8A 4YW3A 2DYCA 4LBLA 1PVC1 1HLCA 4Q0VA 5FAXA 1HKDA 5I8TA 3RZZA 1LRHA 3PVNA 3JD73 1W0PA 4Q4V3 4Q1PA 1RJ8A 2LTNA 3AKQA 4EWDA 1CR7A 4HZFA 3HT1A 5JMCA 4FAGA 2K2SA 2OYZA 1ZREA 1Y3TA 2E6VA 1PZ7A 3MIDA 1PVXA 2GAUA 3TN93 4AHYA 3VZMA 1ENXA 3I2DA 3WDTA 1YIPA 2VQ0A 5FO9B 4IEOA 4CDWA 1OLQA 1D4M2 1MEC2 1CONA 3H50A 1YIFA 4Q4W1 5J09A 1IHMA 4N43A 2P3JA 1H9WA 1GBGA 2EF6A 1AYN1 1X8EA 4A2UA 2CY6A 3PHMA 2VU9A 4FOWA 4JTOA 5DDJ1 2JE7A 2AZ5A 5D8AB 2VOKA 4JV4A 1HQWA 4DOUA 1S1AA 2HEYF 5E89A 4FOYA 4PQ9A 4BOWA 3B93A 2W39A 1OA3A 2OPKA 4NR1A 2R063 1VBC2 1PVC2 4HKOA 3WUDA 1VJ2A 1MS5A 3AKPA 4K3UA 3G7DA 2VOVA 4KQ7A 3K51A 5C4WC 1ZRCA 3ZFFB 2I74A 4XJ8A 2Q8OA 3USSA 3B01A 4DS0A 1LULA 4FPFA 2CWMA 4PCRA 4WZCA 1RUD2 1RUH3 4WBBA 4PBPA 3D0SA 4XEZA 4CP2A 1FT9A 3PNAA 4EWEA 4Q4W2 3SCGA 1FOD3 5BNQA 1DQ0A 1R083 2BNNA 4BHPA 3HN1A 1AYN2 1ENSA 4LHNA 5GJ6A 4YW2A 3VL9A 5A32A 4XOGA 5DDJ2 2QFEA 1OI6A 4PDWB 3RRDA 4L92A 3DPRA 2QZ3A 3RG0A 1DQ4A 2HEVF 3PVBB 4MH0E 1TMF1 1HRI3 2O8QA 2VG9A 3B5LB 3LZZA 5GLVA 1B35C 4Q4Y1 2Z5WA 1I5ZA 3V65A 4FXGB 4MGYE 2E7TA 1AR61 4YFZA 3ZFEB 1QF3A 1U0AA 4N7UA 1X8MA 4Z2WA 4J1XA 2FMDA 1UU4A 1RVF3 5K8SA 2JD4A 5AC93 4PLMA 1SFYA 1K5MB 1H1MA 5KHGA 2VGDA 2O0OA 5BNOA 4Z82A 4UW5A 2FBEA 2DFCA 2GN7A 2JDZA 1N47A 1ND3C 4JGZA 5FQ0A 4QHBA 2C1FA 1IKQA 2ZKLA 2XL9A 1WLWA 4C0BA 3AKTA 4XFFA 1AL0G 4QPGA 3AFGA 3ZVXA 3DGTA 3LAGA 4E4ZA 3POYA 3WX5A 1G9CA 5JLVA 3S30A 2YC0A 5FREA 1E57A 2D93A 2UWBA 1QQP3 3RYRA 5DUUA 1REEA 3MIGA 4YZ4A 5KC5A 4ATFA 1JYCA 4YW1A 1H9PA 3J9SA 1AR62 5KHHA 1BCXA 4ZKTB 3BOPA 5GLWA 2GC2A 4XF4A 3MPPG 4E4DX 2VW1A 3WW2A 2ZPXA 3OJBA 1HQNA 3VZLA 1BZWA 2X29A 1C8M1 4WM8B 1VRH3 2OZJA 4KU8A 1VB2A 4JGYB 4N90A 5GZEA 2VW2A 2ZHNA 2VOWA 1CAXB 3OYWA 4SLIA 2A75A 1PO21 2ZMNA 5H9RA 1RUNA 5K0UA 1UW8A 3QH6A 4Y20A 3AMHA 3H7YA 3MW4A 1C57A 2UURA 1OD5A 1ND2A 4S2HA 2JENA 3SH4A 2X8KA 2RE9A 4YGDA 3VZOA 3P3NA 1JOJA 1AR73 3B9CA 4U36A 1DQ5A 2NM1A 1HV1A 5T5JA 1MEC3 3WUCA 4MGKE 4LE3A 3OF1A 4OHZA 3HR9A 3WG3A 3B7MA 4BMEA 3KT4A 1KQRA 1Q56A 4XJAA 3KM5A 1N3OA 1VIWB 2BTVC 1C8M2 4AE2A 1LODA 1LTEA 1WBLA 1S0CA 5EXOA 4CDWB 4TLFA 4KGGA 1T6GC 4IV1A 4Q27A 4N43B 1PVC3 1QDOA 3LB9A 4KG0A 2YYOA 1OQEA 1PO22 3ZFGA 4F8AA 5C9AA 5JPMB 4FP2A 1LU2A 3LSEA 3S7EA 3KCXA 1DQ6A 1S2BA 5BNNC 4YSFA 2ZAHA 2YY1A 4FP3A 4ES9A 2YDEA 3RPQA 1C4RA 1XRUA 1ZZ7A 3H1WA 4M00A 1LECA 1N3PA 3SH3A 3ECQA 2GNBA 2I45A 5JWPA 5JOWA 5CG9A 3AJYA 3M3OA 4Q4W3 2EAAA 4RQPB 1Q8OA 5AVPA 1EV11 3KCCA 1RHI1 3GZUC 3B3QE 2XWBB 4JDNA 1AYN3 1SMVA 2D3PA 3AK0A 4C90A 5C6CA 3V0BB 1CGPA 2XVLA 4IV3A 4RR3A 3MI8A 5IT6A 1H8TB 5EFUA 2WC2A 4YRDA 1VBB1 4BCUA 1Z7S1 1WW7A 1PIV1 2AGSA 3SISA 4CDUC 3SXWA 1GZCA 4QXKA 5HBAA 5A32B 3ZXAC 3FLTA 1YJLA 4G9SB 1ZNPA 1BBT1 3HAGA 1OHFA 4B7K