1GZCA

High-resolution crystal structure of erythrina cristagalli lectin in complex with lactose
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHMWDSTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDAPSKILHVVLVYPSSGAIYTIAEIVDVKQVLPDWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERYTHRINA CRISTA-GALLI LECTIN
publication title High-Resolution Crystal Structures of Erythrina Cristagalli Lectin in Complex with Lactose and 2'-Alpha-L-Fucosyllactose and Correlation with Thermodynamic Binding Data
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 55
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2002-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1gzcA00
1O4YA 1PZ9A 2ZMKA 4IQPA 2ZMLA 4HL0A 2W08A 4XJWA 1HKDA 1VAVA 2AREA 2AUYA 1W6QB 2E53A 3NWKA 5H9SA 2A70A 3WDXA 3WUDA 2YROA 1GICA 3OYWB 1QU0A 5HCAA 3BIWE 4YFZA 5CAZA 5EYXA 1LOGA 5KXEA 1B09A 2G4IA 3WHUA 1N1YA 2ZA9A 1CONA 4FOVA 2GDFA 5IK7A 1QOSA 1ULFA 2JJ6A 1YO8A 1HDKA 1HQWA 1LOBA 5CA6A 3ZSJA 3ASIA 2ENRA 4K20A 4YGDA 1FV2A 5IUQA 4Q27A 4WVVA 1AVBA 1LHVA 4P9XA 3SH3A 4YZ5A 4LBNA 1OKQA 2OUJA 2YMZA 3FFZA 4Q1RA 2PHWA 1G9AA 4K21A 2AGSA 3FBYA 3JUUA 4BMBA 1RITA 3R4UA 4LBQA 2D6LX 1UZZA 2ARXA 4M3CB 5EXOA 5DZEA 1Y7BA 1S1AA 1C1LA 1C4RA 4XJ8A 3OBTA 1GSLA 1IKPA 4R9AA 2E6VA 1SBEA 1MVQA 1MVEA 5CB7A 4MYEA 5F9TA 2ZACA 1DIWA 1V6JA 1U0AA 2AH2A 2HYKA 1SBDA 1UMZA 1X50A 4DRVA 4YZ4A 3A4UA 3AP4A 4YZ3A 1A78A 2JDZA 2ZGNA 1R1ZA 1GZWA 1BXHA 1N1VA 4AVTA 1FATA 1S0FA 2R0HA 5E89A 3ILNA 3IM0A 4K1YA 1CVNA 5GLTA 1WW5A 4XHXA 3GALA 5DG2A 5BYNA 1SLTA 1Q8PA 2ZGOA 4C1XA 1V6LA 3PVOA 3RG0A 5JOWA 1G86A 3VKLA 1UKGA 2SLIA 4BLJA 1WW6A 2BQPA 3I4IA 1DYPA 3FLTA 4FPGA 4XIKA 4F83A 4AYUA 2YV8A 4ISQA 3I8TA 5FRAA 4CTEA 1KDKA 2WSUA 4LBOA 4UW5A 5LK5A 3LCPA 1JBCA 1G9DA 3V0AA 3IKWA 2ZBJA 1BZWA 2P3JA 3AXEA 2D44A 2A3XA 3B69A 3V0BB 1Z0HA 1AJOA 1WLCA 4XTMA 1G9FA 2ZGRA 4FVVA 4YFWA 2PHTA 3KM5A 1N3QA 5DG1A 2ZZJA 1H30A 5FREA 1W6MA 2D3PA 1DQ1A 4WVWA 4Y1UA 1IS5A 3WLUA 4YZ2A 1MS8A 3WG1A 5JOYA 5KXBA 1Q8VA 3O12A 4M3CF 1LEDA 2KM2A 1LJ7A 5DUXA 2ZGQA 1SLLA 1Z78A 4R9BA 3FLRA 4PBPA 2H0BA 2GNTA 4Q1PA 4Y26A 2GN3A 3VKOA 1JYCA 2AENA 5IK8A 1SCRA 3T1LA 3AZYA 3AJZA 1V6MA 3NV1A 1CPNA 3NV3A 2EAKA 1F9KA 1CIWA 2D3RA 2V5YA 4KBBA 2ZKNA 2ZMNA 3POWA 1LHNA 1AX1A 1W6PA 1JYIA 3U4XA 1Q56A 4Q2FA 1FAYA 1LEMA 2A3YA 2JKBA 1ULGA 4LBQD 1H9WA 1AJKA 2ARBA 2ES3A 4XIOA 4XMIA 4AWDA 3QCWA 2XB6C 4M3CE 3M3QA 3N36A 5GZEA 2A7AA 2DTYA 3T2TA 2VW0A 2WLQA 2XG3A 2A5ZA 2A6WA 1WUVA 2NMNA 4Y22A 2YZ4A 2ZHNA 3O0XA 1QMJA 4XILA 1S0CA 4FPYA 1W6OA 1QKQA 1QOOA 1YRZA 4GALA 1DFQA 2EXIA 3WDWA 1C57A 4FPKA 1YI7A 2V73A 4U36A 2D7FA 2EXKA 1Q8QA 3ZYPA 1GZ9A 2JE7A 2LTNA 1QDCA 3ZXFA 1RIRA 3LSEA 2JD4A 1V6OA 3PMEA 4YM2A 5F5QA 3D4KA 1VAMA 1QOTA 2LALA 2NMOA 1LOEA 2WNEA 4FPEA 4LBQB 4M01A 1KITA 2ZGUA 5GLVA 2ERFA 3VV1A 3N35A 3M1HA 4PQ9A 3SISA 2DTWA 1DQ6A 1XQNA 4GKYA 1G7YA 2WT0A 3FLPA 4P14A 4FQZA 4BMEA 1F5FA 1KJRA 1JOJA 3N7MA 3WVJA 1IS4A 4XHBA 4BOWA 4C1WA 1MZ5A 3VUOA 2A6XA 1LU2A 1QNWA 3INAA 1DBNA 4YG6A 3RS6A 5GM0A 1DLLA 2EALA 3QLQA 2D43A 2VUAA 4TYSA 3VKFC 1JHNA 4YW1A 3WDTA 1W6NB 1I3HA 1KJLA 3TAYA 2D6KA 1LGBA 1A8DA 1S0JA 1MACA 4YZ1A 4Q8LA 2C5DA 3WV6A 4R9DA 4ZKTB 2Q5TA 1SCSA 1CQ9A 1WBFA 1MZ6A 4YGBA 1SFYA 2PHUA 3OYWA 3UK9A 3WDYA 4HANA 1YXWA 2ZGLA 3AZZA 4AGGA 2PHRA 3IN9A 3WUCA 1CPMA 5T52A 2WT2A 1JXNA 5IK5A 3AYDA 1DQ4A 1N3PA 3VKNA 1WBLA 5GZFA 4CRQA 5GZGA 2PELA 4XBNA 1GANA 1QNYA 2NYYA 1DZQA 4Y1XA 5GZDA 4FPCA 1IS6A 1LULA 4P9YA 1SLIA 2FMDA 3UL2A 2W52A 3V0AB 4I30A 4Y1ZA 4YGEA 4YW2A 1V00A 3OY8A 2NM1A 2DV9A 1W0PA 1C1FA 3AP7A 4M3CA 5H9RA 2W68A 3RRDA 3VKMA 4XYXA 1N1SA 3ZXJA 1LHWA 2ZHLA 1W6MB 1UPSA 1ENSA 2DWRA 1UZYA 2DU0A 3AXDA 2ZGPA 4AGVA 4UW3A 3IMNA 4WZFA 5L73A 1CESA 1RINA 2WQZC 4SLIA 2CY6A 5JOZA 2EIGA 1GYKA 4LBLA 2A6YA 1BYHA 3IPVA 3WG2A 3NV4A 5HCFA 4RA0A 1VALA 3AP9A 2VY0A 5KXCA 2E7QA 1HLCA 1LU1A 3MEPA 3O0VA 3O5SA 4JRAA 4XOGA 4OZXA 1ZA4A 4FPJA 3ZSKA 4Y1YA 1W6PB 3AJYA 1CJPA 2GNBA 3OGGA 1MS5A 3POYA 2A6VA 2R1DA 3JU9A 1LGCA 4RL7A 5H9PA 2AYHA 1A3KA 2ZAAA 4W65A 2UURA 3C2UA 2A6ZA 3D5OA 4DRRA 2GMEA 1KDMA 5IT6A 3MW2A 4GA9A 1JN2P 2D6MA 5DUVA 5DZFA 5T5JA 3WCSA 3WNXA 1AF9A 2ZABA 4Y22B 2DVDA 3N7JA 2YY1A 4BLIA 1IOAA 4CZSA 1Q8OA 4YGCA 5T5OA 2CL2A 2YXSA 5DUUA 4DS0A 1G9CA 4XBLA 4XJUA 2B7YA 2P37A 3WG3A 1AXYA 1LOFC 2ZGMA 5T50A 3Q9OA 3OPZA 5EWSA 1AXKA 1Q8SA 2WT1A 3ZYRA 1UN1A 1GZCA 1WD3A 2AR6A 1JW6A 4JCKA 5DZGA 3RMYA 1J1TA 2VU9A 3V0BA 1LGNA 5JOXA 1JUIA 4D69A 2E7TA 5JDBA 1UX6A 4FQ4A 4BPZA 2JE9A 3MPPG 2WKKA 4P9WA 4ATFA 3T1MA 4BQ1A 3AZVA 4AVVA 1LOFA 1PZ8A 3NV2A 4YLZA 5IK4A 3R4SA 3AZWA 3ZXLA 3H0OA 2P3KA 3MW4A 2R1BA 5GJ6A 1GBGA 1KRIA 2R16A 2VW1A 3RSJA 4BM8A 2DVBA 3PJQA 4XMAA 5CNAA 4XZPA 1G8WA 1SBFA 1YIFA 3DGTA 3AZXA 5DUWA 1HQLA 5GLWA 3AP6A 3OBRA 1TEIA 3B3QE 4PF5A 2OUHA 3GNEA 1ULCA 2A75A 3V65A 4H55A 2W39A 2OW4A 3ZPYA 1QGLA 4ITCA 3USUA 3WZ1A 4UW6A 1LODA 1S0IA 1ONAA 4ASMB 1MR5A 2ZGTA 4XXAA 4ATEA 1WW4A 4XJAA 1DHKB 1FV3A 1NLSA 3O0WA 1W0OA 1NXD1 4XXPA 1MS0A 5EYYA 3WCRA 3PVEA 3M2MA 5HCBA 4AGRA 1GZWB 1CR7A 1PZ7A 3N7LA 1ULEA 1WW7A 3B9CA 1N47A 5JVVA 1EPWA 3HR9A 4YG3A 5SV8A 4DPNA 4Y20A 2R49A 2TEPA 5GLZA 1GLHA 2DYCA 3ZSLA 2GN7A 4R9CA 4L8QA 1W6QA 1S0EA 4FPOB 2R0FA 3POSA 1LHUA 3OJBA 1BQPA 4FOWA 4Y1VA 4K1ZA 4YG0A 5T5LA 4DQAA 3AX4A 3N3HA 5GZCA 3AYEA 3OY8B 3UJQA 2NZ9A 2ZGKA 1SLCA 4LBJA 1CN1A 3DUIA 2D6PA 4JC1A 1SLBA 4XJ9A 3WHTA 1FX5A 3D6EA 3APBA 3LSDA 5JLVA 1O4ZA 1H9PA 3AYAA 1UAIA 4FOQA 3ZXEA 1SACA 3RMXA 4NO4A 5JMCA 2P34A 4WV8A 1DQ2A 1GNZA 1N1TA 4XDQA 2NN8A 5AVAA 5T55A 2PHXA 1LECA 1D2SA 2WJSA 2ZGSA 1URXA 1OQ1A 3IPVB 2FHRA 2GMMA 1GKBA 2D3SA 4LBKA 1I1EA 3M3EA 1QDOA 5GALA 4ZXKA 1ENRA 4FP3A 1IKQA 1V6KA 5KXDA 3ILRA 1N3OA 1W6NA 4YW4A 4YM3A 3A0KA 3BTAA 4U2AA 1APNA 4GKXA 3BOPA 5T54A 2UWCA 1DQ5A 1F31A 2DVFA 1AXZA 4UW4A 2NP0A 3V64A 1D0HA 4Q26A 1LHOA 3L2YA 1GV9A 2VH9A 2CYFA 3PVNA 1SLAA 3AP5A 3SH5A 4GWMA 5CBLA 3HMYA 1WLWA 1V6NA 2DUQA 3AYCA 3MW3A 2Z42A 3BODA 3ZVXA 1DYKA 2UWAA 3ENRA 1FNYA 3FUQA 4LBMA 4AVSA 3B01A 5E8AA 2DUPA 3HN1A 3RQ0A 2OVUA 1S0BA 3WG4A 1LCLA 2EF6A 5DXDA 4YM1A 1FYUA 1AZDA 1QF3A 2ZHKA 5E88A 4TZDA 3W59A 2UWBA 2I2SA 1MS3A 2WSVA 3WDVA 4GWNA 2CTVA 4PBOA 2DVAA 1S0DA 1BJQA 1WCSA 4XE9A 1W6OB 2DUOA 3KQRA 4GXLA 2CWSA 2DURA 1LOAA 5GLUA 2E51A 3AFKA 4YM0A 3TB0A 4Y24A 2DU1A 2GNMA 1G9BA 3A0NA 1WD4A 4YW5A 1FNZA 1LTEA 3CNAA 2GMPA 2RHPA 2CWMA 1LESA 1BKZA 2EXHA 3WOGA 3SNMA 4PCRA 1MS1A 2ZHMA 5H9QA 3M3CA 2A3WA 1IS3A 4FPFA 4DFSA 3R05A 3SITA 2P3IA 1AX0A 2VXRA 3M3OA 4FP2A 2A71A 3W58A 1ULDA 3WDUA 4YW3A 1WLDA 2CNAA 1YYNA 1MS9A 5T5PA 3FUOA 1MS4A 1DGLA 1ZM1A 2JECA 4M00A 3UJOA 4ISRA 2DVGA 2EXJA 3B00A 3SH4A 3N7KA 2C9AA 2UU8A 1KQRA 3USUB 4XJZA 1AX2A 1UL9A 2PHFA 3ATGA 2P2KA 3SLIA 2GALA 1DQ0A 1LOCA 3AK0A 1V6IA 1VIWB 4XTPA 4FPLA 4FOYA 1S0GA 3ZSMA 1OFSA 1GNHA 4XBQA 2D6NA 2GNDA 4FPHA 1ENQA 2D6OX 2VW2A 3ILFA 4Z8BA 4Y20B 3ZXKA 1VLNA 4Q8KA 1LENA 4NOTA 2SBAA
chains in the Genus database with same CATH superfamily
1O4YA 1PZ9A 4HL0A 5JAXA 2YC0A 4ZPIA 1XNDA 3G7DA 1W3VA 2GSYA 5H9SA 4XFAA 2A70A 3M8LA 3W20A 5A3OA 1RJ7A 3THTA 1X9TA 3H42B 3OYWB 2RJLA 1YEWA 3I2FA 3J9SA 4RFT0 1OLME 4LOTA 1RXFA 3WHUA 5IWFA 1N1YA 2VNVA 2ZA9A 1OOPB 1ULFA 1US2A 3GHMA 4S2HA 1HDKA 5C4WB 3CO2A 2BBVA 1RUG2 2VTXA 4YGDA 2HWB2 5FIXA 1FV2A 2PAMA 4FCAA 5LATA 5FZEA 4NE9A 2XQRA 4YVWA 3ZMOA 1W90A 3GHNA 5I0SA 1O91A 4OHYA 2W0XA 4QPGB 4LBNA 5FLIA 4OI1A 3ZM8A 2VQAA 4E4SA 3C7OA 4K21A 5FZAA 3R0RA 5J36A 3S5QA 3JUUA 4BMBA 1YQCA 2H0VA 3R4UA 4G9SB 1F35A 4W4ZA 1KS4A 1UZZA 5FPBA 2ZX4A 1GP5A 2VMIA 3DPRC 5DZEA 4FFHA 2PTMA 2RS53 4KG0A 2VXJA 1JH5A 5BXXA 1L7LA 4WM7A 3ACHA 3MUY1 3Q8CA 4XJ8A 5FYHA 3NL1A 5FZDA 5CB7A 1W06A 5JXIA 1CAXB 5F9TA 4AQ6A 5L7OA 5EJ3A 5BUVA 1RUE3 1V6JA 1VBC2 1VAKA 3OGSA 1O3QA 2RJ2A 2YFZA 4QKBA 3WD5A 1UF2C 1QQP1 2ARCA 2QQOA 2WNUB 5A1LA 5J7MA 1WMEA 1ZZ9A 3LE0A 1ND3B 5FZIA 2J22A 3HPNA 1A78A 2JDZA 5C3OA 1BXHA 1N1VA 1ULOA 2BJSA 1AR71 1FATA 3JBG3 3SC7X 1S0FA 1OUXA 2R0HA 3JQXA 2HJIA 3LOBA 4UBHA 4K1YA 2WC2A 4A41A 3LA7A 1QJFA 1CVNA 3WW4A 1SLTA 1ZRDA 2ZGOA 4MG2A 4C1XA 1AR91 2RDQA 4N7UA 3KVAA 2XWBB 3RDIA 1NE6A 2BW8A 2HWE1 5IATA 3I2HA 3KV5A 5FO8B 4B29A 3AMHA 2Y6LA 4EZ4A 2PXJA 4IV3B 1ACCA 1I5PA 1Q5OA 3CKHA 3I2IA 4GH4A 2VZ1A 4IGOA 4IV1B 3H8XA 5FRAA 1YUDA 5EIYB 2R043 2X5IA 4UW5A 1G9DA 1H8TB 1JBCA 1W2AX 2OPKA 4L97A 4P5YA 3RZZA 3V0AA 1PGSA 3AXEA 1BMV2 3ZOIA 3LEGA 2A3XA 3V0BB 2YB7A 3MIDA 4FXGB 4LJHA 4CP0A 1G9FA 3SQOA 1WGPA 2WO1A 3S30A 3KD4A 1N3QA 5DG1A 5IVEA 5C33A 2ZZJA 1H30A 3ZYBA 1PGW2 4YZ2A 2BYVE 2XONA 1IS5A 1IG0A 4WVWA 4Y1UA 2Y26A 5IVBA 2E7AA 4PQQA 1SQ4A 5KXBA 4AR2A 4D7TA 3EO6A 1K5MC 2B9VA 2P6CA 2RS52 2ZGQA 4IEUA 4BA6A 5A6QA 1T6BX 1S4CA 4TXWA 5DPNA 5C8CB 2PAKA 3AJZA 5EHDA 4JGZA 4MVTA 4HVQA 3ZKUA 3KLSA 2VZOA 1HRV3 2VO5A 1RUE2 4DUWA 1BHGA 2V5YA 3DXUA 3POWA 1AX1A 4QQPA 4KU7A 1TE1B 1ULGA 5FLHA 4LHLA 1AJKA 2ARBA 1W3XA 4XMIA 2G9GA 4AWDA 3JBG2 5JCTA 3VBHC 3OB8A 4NWWA 2XG3A 4CXYA 3T0DA 2NMNA 3IDBB 3KF3A 2YZ4A 4FO9A 2ZHNA 2R063 3O0XA 4XILA 1TQ5A 3VZJA 5FYSA 4CEYA 1DFQA 2WR9A 4XFIA 4IE5A 4QKNA 5JI7A 5IAXA 4YVWB 2V73A 4NAOA 4U36A 1RMU1 1JZ5A 1POV1 2ZKLA 1QDCA 1JHJA 1XC6A 3LSEA 1V6OA 1VB2A 3PMEA 1OF4A 3HQXA 2VECA 3W21A 4YARA 1MQTA 1LOEA 1QHDA 1SMVA 1WCKA 2IXLA 1DLCA 5JMOA 2XVLA 5EQUA 1RUC3 3FHAA 3CU7A 1OA3A 2Q1MA 4MSVA 4WBBA 2R042 4QT6A 3M1HA 4CCDA 2KD7A 2Q30A 4CCOA 2GU9A 3W5NA 3U14A 3O1SA 2ZEXA 1G7YA 4YRDA 5C6CA 4BMEA 4UFIA 3N7MA 3WVJA 1RMU3 2HWF1 4OHVA 4WVZA 1KS5A 1UNBA 2G9ZA 5JSOA 4H7LA 5F7UA 1DBNA 3ZDVA 4HSJA 1D4M1 5GM0A 4QGLA 2VZTA 4JHZA 2VUAA 3B5LB 2EIDA 1PVC2 1NLRA 4CDWB 4YW1A 3BPZA 3TN91 2BBAA 5FXXA 3ZYHA 3C7FA 4PHZA 2RG4A 1OOPC 4YZ1A 4Q4V1 1AUYA 5CIRA 5IW0A 5C4WC 4AEDA 1RUJ3 3WXPA 3S5AA 3T2OA 2VZSA 5FYBA 4LEJA 3DYMA 5F3EA 2Q5TA 1O3TA 4QPGC 1VBE2 1WKYA 2BGPA 2GH8A 3MF6A 3WDYA 1HRV2 2ET1A 2O8QA 4ZS2A 2JX9A 1CPMA 1XB9A 2WQ4A 1NE4A 2XKPA 5JSRA 2QVSB 1N3PA 5FZFA 1ZZBA 3VKNA 1FMD2 3AMQA 4XBNA 1GANA 4AHXA 4BHPA 3HIFA 4Q4V3 4GH4B 4D6QA 4MHRA 2FMDA 1JUHA 1X8MA 2JE8A 2VZQA 3V56A 1SG3A 1TG7A 1NY71 2X5IB 2W52A 4DOUA 3V0AB 2R062 3RZKA 1KEXA 4IDZA 4Y1ZA 2C9KA 1OLRA 4BB3A 3OBAA 1V00A 1YLLA 1O8PA 2NM1A 2VUJA 4UFJA 3AKTA 3AP7A 4M3CA 2WNUC 4XYXA 1N1SA 1ND3C 4QD2A 1U5ZA 4BH9A 5LK7B 4CDXA 4UI9L 4XUNA 3JCIA 3MV01 2DWRA 1UZYA 2JDPA 2DFBA 2ZGPA 2VR4A 3AXDA 4UW3A 4WZFA 5FZKA 4SLIA 5FY0A 1RUC2 3FJSA 4FT8A 4DY3A 2WWUA 4GMP1 5A3MA 1IPJA 3IPVA 4X8NA 4CU9A 4HLTA 4K8FA 1RL3A 1XOYA 3NSTA 2E7QA 5FQ0B 4PIXA 1LU1A 5KXCA 4JGZB 3O5SA 5TSWA 4JRAA 4XOGA 3WX5A 4CCJA 3POJA 4FBFA 2GNBA 4DMIA 3R4DB 1H1IA 1PIV3 3OD4A 3J4UH 2A6VA 2X53S 3JU9A 1PO23 4XQWA 4IV3C 4IV1C 2CSGA 4QX0A 4NHYA 3EBRA 3B93A 1YQ8A 1S2KA 1W8HA 2NPIA 4OQ9A 2UY9A 1H8TC 3NNJA 3MW2A 4GA9A 2JDUA 2D6MA 4WM8A 5L9RA 3ACGA 1RUJ2 3QOPA 5T5JA 1AF9A 1BEV1 1LNSA 2LM3A 2VOWA 5KHKA 3RZMA 1IOAA 2K2SA 1Q8OA 2QE3A 4BWOA 5LZ6A 3JZVA 4YGCA 2YXSA 4DS0A 1AYM3 2JDAA 1UWWA 3DKQA 3WF0A 2HYXA 4XBLA 2P37A 2WO2A 5FZ3A 1J3PA 4CCCA 3Q9OA 1FPN3 3WQ7A 1MQTB 2PAEA 2W94A 2GC2A 2XDVA 1WD3A 2AR6A 2VU9A 4QB6A 1LGNA 4HKOA 2E7TA 5JDBA 1F15A 2RS11 2RR12 3IDEA 4I09A 1UX6A 4BU2A 5C8CC 4XACA 2JE9A 3MPPG 1JYXA 1GQHA 3AZVA 4DO0A 1LOFA 3J8F3 2DF7A 2QQNA 4YLZA 1CZSA 2KR2A 3WNNA 5FPUA 1F8VA 3H0OA 2P3KA 2J7MA 2X8KA 2Y6JA 4XCAA 1U12A 5GJ6A 2LUWA 3SEPA 5LY1A 2B42B 5CG9A 2YU2A 3RSJA 2DVBA 3H8UA 1HRI1 3PJQA 4W50A 4CCKA 4UFKA 4XVHA 4IEQA 1G8WA 1SBFA 4FTBA 1YIFA 3VBRA 3AZXA 2J1EA 2XBO2 3BALA 4Q4Y1 3OBRA 4EE2A 3KSCA 2HH9A 4ZU5A 1ULCA 3V65A 2CV6A 4H55A 4CE8A 4QAWA 3ZPYA 1QGLA 4ITCA 4YVWC 3IIIA 5A3TA 4RHV1 1JU4A 5KC5A 1LODA 1S0IA 5SV5A 5FAXA 3ZIWA 2QZ2A 3POFA 4AI0A 3VBSA 3O0WA 2B9UA 4K7JA 4GAZA 3Q8BA 1MS0A 1ASJ3 2VCMA 1PIV2 5J1XA 4AHWA 2E32A 1GOHA 1PO22 2VZRA 1OVSA 4L0PA 1N47A 3ZPOA 2CHHA 4D7YA 5A70A 1EPWA 2XJUA 4YG3A 5SV8A 2R49A 3N9LA 4Q4Y3 2TEPA 4XF3A 4OFGA 4DEVA 2PHLA 2DYCA 4P9IA 2L9LA 1W6QA 3N9MA 3H1YA 4FPOB 2I74A 4L8QA 3H9AA 3JD71 4DUVA 3D82A 3OJBA 5B2GB 3K77A 1BQPA 4FOWA 4RHV3 4Y1VA 4YG0A 5T5LA 4CUCA 3AX4A 3MLLA 1QXJA 1JMUB 2JXAA 1L3JA 2VOKA 1AYM2 3PUAA 3VZMA 1GQGA 2ZS6B 4PLOA 3ZR6A 4B7EA 1J58A 3K4AA 1SZBA 1W2NA 1XJAA 2R072 2WNOA 4JGYA 4CDWC 1FX5A 5C9AA 3APBA 3KV6A 4OUSA 1HXS2 2VNGA 1HQNA 4FOQA 2OQ6A 1FPN2 3LZZA 1VBB3 2P34A 3NRUA 1UKRA 4GWIA 5T55A 4R4ZA 3JD73 2WJSA 4AHYA 1URXA 3K4ZA 3IPVB 4XZUG 1I6XA 5IJRA 4LBKA 5GALA 4FP3A 2CAVA 2WZEA 1UYZA 2WAAA 3J8F2 5FZGA 4COWA 3A0KA 3DN7A 4PIYA 2Q8CA 2DCYA 1COV1 1RYYA 2UWCA 3M7AA 2NP0A 2OZ6A 5HPOA 4GH4C 1T2XA 1LHOA 2V4AA 3L2YA 3BCWA 1JZ2A 5A7PA 2X5IC 4HFSA 4B8EA 4GWMA 4NWVA 5CBLA 2B46X 1WLWA 4WM8B 1Z7S1 4EJRA 5CKNA 3MW3A 4UF0B 1BLZA 3BODA 4XF4A 3ZVXA 5IFPA 2W2IA 5E8AA 1H2MA 2DUPA 1PO11 3MIEA 1VMFA 2CGOA 2J1RA 1ASJ2 1HB4A 2XH6A 3WG4A 1LCLA 2BDRA 1B35A 1FYUA 3OCPA 4YM1A 1QF3A 5E88A 3AMMA 5EJZB 1D4VB 4IE7A 4DINB 2WSVA 4GWNA 1ZRIA 2CTVA 2ET7A 1W39A 3BB6A 4CU8A 4QX3A 1WCSA 1W6OB 2ZJCA 1C8M3 2XJTA 2CWSA 1L7RA 5GLUA 2PLV3 5HCHA 4YM0A 1YQ5A 4JGZC 2ADEA 4Y24A 2GNMA 1G9BA 3T4VA 2W1SA 2X05A 3CEWA 1AL21 1W9WA 4JDNA 5BNOA 2RHPA 3LEMA 1BKZA 2Y60A 1CZVA 4A45A 2ZPXA 3VHPA 3MYXA 5H9QA 3WQ1A 2P3IA 2ZEWA 2AC1A 2VGDA 1VBB2 1NOVA 5BPXA 4CP9A 5F37A 1X7NA 4P9LA 2Y33A 4Q4W2 4YW3A 2CNAA 3ZLIA 1MS9A 3VHNA 2AACA 1TMF3 2JECA 3U07A 3T3YA 4J1WA 2Y6FA 2C9AA 3VB9A 4IE4A 1YI9A 1AHSA 4RR3B 3WQBA 2P2KA 2VCCA 1IG3A 1DQ0A 2WN3A 2WS91 3AK0A 4XTPA 5FP8A 3IBMA 4R4XA 1S0GA 2G1MA 3VBSB 4AL9A 2VM9A 1MQTC 3S0MA 3OGVA 3LFIA 2WL1A 2JDKA 2VW2A 2GC1A 4LITA 4ES9A 1HN1A 2VVDA 3FBMA 5A80A 1LENA 1JHNA 4IQPA 2ZMKA 3HQUA 5I0TA 1VBA3 2B8MA 2W08A 4XJWA 3NWKA 1VAVA 1W6QB 5HI0A 5FYZA 2C1FA 1AR81 3LGRA 2IVJA 4QPYA 1OH3A 1GICA 1AYN1 5CAZA 3C7GA 3I7DA 5EYXA 3U10A 4CDUB 1TME3 5KXEA 4HPKA 3VBOA 1XU1A 1CONA 3UKTA 4GD4A 2JJ6A 2JWPA 2ORZA 4JGYB 5C9AB 1VJ2A 1OMIA 3CF6E 3ZSJA 3ASIA 4K20A 5IUQA 1XE7A 4Q27A 2QQKA 1E5RA 4QU1A 1W2UA 4LLOA 4AXOA 2DCZA 1OKQA 2YMZA 3FFZA 1W8OA 2RMU1 3KMHA 5CU1A 3I2KA 1M06G 1C8M2 1UY0A 2GH2A 4LBQA 5F5IA 5G04L 4AE2A 4E4HA 2PLV2 5EXOA 1YIPA 3AL5A 1Y7BA 3KHBA 4PI2A 4BYYA 5L36A 1OHFA 2HKXA 1S1AA 4GJZA 4E8CA 2D97A 2Z79A 4R9AA 3TBDA 3AL6A 4Q0UA 1GWKA 3VZOA 3AMPA 1DIWA 4F8AA 1XE0A 1UMZA 5FYCA 2JG8B 2RV9A 1IHMA 1TNRA 5C70A 1DF0A 4MO3M 4LO7A 4QXKA 5B4XA 3AP4A 2F17A 1TMF2 3S6PA 5A6XA 1GOFA 1R64A 1R1ZA 1S55A 1GZWA 3KZ4C 3RFRA 2VAUA 5D21A 3THCA 2VUDA 3ILNA 3Q8EA 4GB33 3ON7A 2FDFA 2TBVA 2EIEA 4BQXA 1RUG1 3IM0A 2HWB1 2WIIB 1WW5A 4XHXA 1MZEA 5C3RA 3VDBA 3A22A 4C90A 4GIQA 1B35B 5FWJA 3SEEA 4CPBA 3S7EA 2BERA 3RG0A 5JOWA 1G86A 4KQ7A 1UMIA 1XPWA 3I59A 1UKGA 4B4QA 4CXWA 2J1SA 2X29A 1VBA2 1WW6A 3LEIA 1PVXA 3FLTA 3H7YA 3EJKA 1YJKA 2XPJA 4UYBA 2YV8A 4AYUA 1D0GA 2FCTA 3J7MA 4MGQA 1TME2 2FDKA 4CTEA 5BNOB 2HWB3 2LS6A 2WABA 4LBOA 3D0SA 3LA2A 1FT9A 1MZFA 3IKWA 5J98B 5J37A 2ZBJA 2P3JA 3GGLA 1VR3A 1VBC1 3B69A 4XTMA 4KH9A 4FVVA 4QKFA 4YFWA 2C6SA 2PHTA 4RGKA 4WM8C 4D0QA 4Z1VA 3BPSA 5FREA 1W6MA 1JS9A 2VBPA 3UT0A 1DQ1A 1U5XA 3WLUA 1H8VA 1VB4A 1JZ7A 5FZ6A 4B4PA 3SXWA 4OUEA 3O12A 1H1MA 3PLQA 3B94A 4M3CF 1LEDA 2KM2A 5K0UB 1LJ7A 3E97A 2WNVB 3I3QA 1SLLA 3FHIB 1HW5A 2PQQA 4UXAA 1K12A 2H0BA 3ZKYA 2AENA 5D2AA 3OPWA 1D7PM 2BGCA 1SCRA 1UX7A 2ZAHA 4OQ8A 2OS2A 5DDJ3 2XJRA 4K8RB 3NV3A 1UZVA 1PK6A 4EN7B 2EAKA 3EHKA 1KGYA 1F9KA 1CIWA 3LIGA 4KBBA 1O6UA 4BE3A 4Q2FA 1FAYA 1AR63 1CX4A 1QXPA 2Y34A 4UFLA 2DFCA 4E2QA 3EMRA 3ABZA 4XIOA 2ES3A 1M4WA 3ZXGA 2P5BA 1GWMA 4HPKB 2A7AA 2DTYA 3VBOB 3VD5A 4EV0A 1NZIA 3N9PA 2VW0A 2WLQA 4GB32 2A5ZA 1BMV1 4Y22A 3M70A 3O7OA 2MNGA 4MOAA 4BCUA 1QIQA 1C57A 2VPVA 4IE0A 2JE7A 4XABA 3ES1A 1PGW1 2LTNA 1UZ0A 5I91A 1RIRA 4L92A 1CIYA 1ZBA1 1QOTA 4M01A 5FUNA 2VZVA 4EN9B 4LBQB 1KITA 4XUPA 2RE9A 3M4FA 4RR3C 2RS51 4S2DA 5GLVA 4N53B 3T0BA 3POEA 4C8DA 4ZXEA 2F6BA 2Z69A 3VBSC 3N35A 3MO4A 5C7GA 2BNNA 3SISA 3H3ZA 1DQ6A 2YFUA 3C8XA 3FLPA 2WFF3 4GKYA 1CJDA 2XUMA 1OPMA 4FQZA 3OEAA 1RUE1 3VUOA 1UY2A 1MZ5A 5A6ZA 1QNWA 2YC4A 3I54A 3INAA 3MI8A 1W28A 5A33A 1ZBA3 4ZZ8A 4JZRA 5IVJA 3FMGA 2Q1FA 4TYSA 1W2TA 2YHJA 4TN7A 4CDUC 2RS33 3WDTA 4XETA 4KWUA 3JBG1 3TAYA 3A23A 3ES4A 1KFUL 1RGSA 3CZUA 1LGBA 2WWSA 2Z4FA 4Y4RA 4A3ZA 4Q8LA 4JGYC 1POQA 1OT5A 1XNCA 2C5DA 3LQCA 3WV6A 2Y0OA 5FFOC 5C9AC 2PN5A 3KT7A 1HJFA 4QDRA 5HXMA 5DDJ2 1ZREA 5FPXA 4FTEA 4FAHA 1MZ6A 3UK9A 4HMZA 1LB2A 5JXGA 4MH0E 1V0AA 4FFIA 4JKLA 1XYOA 5JSPA 3MIHA 5DMYA 4AGGA 3UGGA 3UYJA 2DBIA 3C7EA 3I59B 5T52A 2HWC2 1SFNA 2P3YA 2QJVA 2WT2A 5FTTC 1OSGA 5IK5A 1AR62 2IFWA 2J1AA 3AYDA 4RQPA 3X29B 5ABJA 4CRQA 3KVBA 4NUBA 3T2PA 2ZEYA 5GZDA 2W1QA 1XBFA 2R041 4FPCA 1IS6A 3WT3A 1LULA 2VZUA 2NQYA 2VULA 4N9IA 1J84A 1V9U3 5ACA1 4E4DX 3N9QA 4JRLA 4PDWA 5K7PA 3E5XA 2JG8C 3BTXA 1DYOA 5H9RA 3PNAA 4QB1A 3ZXJA 1LHWA 2ZX1A 4MXVA 1PVC1 1C3HA 2ZHLA 1W6MB 1IPKA 3K51A 2DU0A 3IZOA 5FMDA 2BU9A 1RINA 4Y5Z0 4QDQA 4IE6A 5ACA3 2ADDA 1DGWX 5FJKA 2VTFA 2A6YA 1BYHA 2YGMA 2Q8EA 3NV4A 4RGAA 3USSA 4RA0A 4IEXA 3ST7A 1BVP1 2VY0A 1B35C 2WFF2 3M3IA 1BBT3 1VBE1 4N8MA 1HRV1 4GWJA 1HN0A 5IVCA 1TZOA 4XUTA 1PK6B 4W6WA 4YVSA 3ZFGA 4OZXA 1PVC3 4Z07A 3ZSKA 3WW2A 2XJQA 4Y1YA 3CL1A 1CJPA 1ZBA2 4D6SA 4KU8A 2XLAA 1MS5A 1FMD1 1NCRB 4O7XA 3T09A 5H9PA 1L7QA 3BTYA 2RS32 4DXRA 2VCAA 4W65A 4N90A 5JXHA 2UURA 2VZPA 4NMIA 4QU2A 4DB5A 5FYIA 5BNOC 2BP6A 3TNQA 3D5OA 1RUI3 2VMFA 4AAXA 4AVBA 5IT6A 5DZFA 5DUVA 5AFEA 2R061 2BUKA 4XPVA 2ZABA 4Y22B 4XW3A 1VBE3 3N7JA 5LW9A 1QY4A 2CL2A 3GCXA 5DUUA 1SHWB 5F3CA 1JYVA 4XAAA 4BXFA 1AXYA 2H6BA 4N43A 1FMD3 5T50A 5DAQA 3OPZA 3WINE 3IB3A 4JKMA 1Q8SA 2WT1A 4I0BA 2XJVA 3WF3A 4BJ0A 1JZ8A 2EA7A 4ET7A 1RUC1 4EWDA 5K0UC 1JW6A 2WNVC 4NOTA 3RMYA 2VD7A 1RTVA 1JUIA 3NVCA 3PUHA 4JQRA 2A73B 4K6BA 4Q4X3 1I5ZA 1ALYA 2C26A 2ID4A 4LO5B 2G19A 4MGSA 4ZZ5A 1V9U2 2RDSA 4BPZA 1QH6A 4Q5OA 3EYPA 4NPLA 4O65A 4IGPA 1OBNA 4JHTA 1XNAA 1PZ8A 3SCFA 1ZRCA 3GZUC 3R4SA 4LUMA 3DF0A 3ZXLA 4KWKA 5IAVA 5JUVA 2W3JA 3CIHA 3KCYA 2VNOA 3OUIA 1Y9MA 1HB1A 1EYBA 3MW4A 4NHXA 2R6QA 5A33B 1OURA 3U37A 4QX1A 1KRIA 2R16A 3A7QA 4HOOA 4XMAA 5FP3A 5E16A 3VBOC 3ZYFA 4WM7B 4RFRB 1UIKA 1YC61 3CJIA 3DGTA 2FD8A 2VMEA 5DUWA 4XCBA 1RUJ1 5GLWA 3AP6A 5ACA2 1CWPA 3PVBB 1TEIA 1VBD2 4PF5A 5FY9A 1UXXX 1Y4WA 4TWTA 2VOVA 2W39A 2W95A 2WFPA 1HJGA 3HNYM 3KS7A 1BBT2 3PUQA 5EFUA 3E5QA 3RNSA 4UW6A 1ONAA 4ASMB 2IVIB 3LF7A 1NCQA 1WW4A 4XXAA 5DAXA 1NLSA 1SFPA 3ZN4A 5HBAA 5EYYA 3WCRA 3M2MA 3K75B 4RQPB 4N53C 5ABJB 1WW7A 4NR1A 1NA1A 3URFA 2FZ2A 2GC3A 3HR9A 1RUH3 5EV7A 4DPNA 1NQJA 2QZ3A 2RR11 4I02A 4B3NA 1CGPA 1RUI2 3ZSLA 2GN7A 4H14A 1LHUA 3WF1A 1FOD2 2HWD3 2RDRA 4IEZA 5L19A 4PDWB 4COYA 3UJQA 5FJHA 1WZXA 2ZGKA 4LNVA 4HVRA 4QMAA 3MLKA 5AVPA 1CN1A 3VDCA 2VZ3A 5D8AA 5FBJA 3ZFEA 2BPA2 3LSDA 4DUXA 1GWLA 1O4ZA 1H9PA 2LW8A 2PHDA 2RR13 4WV8A 2XBO1 1R083 3ACFA 2NN8A 4Q4X2 4XDQA 2XHKA 4COVA 4IEVA 3WUDA 1OQ1A 2WA3A 5JWPA 2FHRA 2GMMA 2WZR3 3IMMA 5APAA 4ZXKA 1ENRA 1RC6A 2GAUA 3CLPA 2IWGB 4NRMA 3MZHA 3RVHA 5KXDA 4HXCA 3NJVA 1N3OA 4IW3A 1W6NA 3MFCA 4YW4A 5FZMA 4CUGA 3T4HB 4S2GA 3WY6A 3K48A 3BTAA 1HV0A 3E5UA 1C28A 1QJU3 1PIV1 4GKXA 3OOXA 3RZGA 3BOPA 1PO21 2PMWB 1F31A 4DNYA 3WSOA 1AXZA 1W8FA 1CAWA 4IGQA 2XBO3 1D0HA 1W99A 3MDPA 4Q26A 5CFDA 4BISA 4NIIA 2QDRA 4BQ2A 4Y3OA 1J59A 2V72A 4AI2A 3ZR5A 4V2WA 4X6RB 1V6NA 4M0HA 3LB9A 5FZ0A 5A7QA 3WQ0A 5C71A 3KV9A 1AYM1 3POBA 1PM7A 3ENRA 4CU6A 5F2SA 2R071 1BVVA 5FP7A 3RJ2X 2JB8A 1HXS1 3HN1A 3VBUA 3WP6A 2OVUA 5CYYA 1FPN1 4AQSA 1AL0G 4LUKA 1RUOA 4H3WA 2P4EA 1VPHA 2EF6A 2BWAA 3HT2A 4MADA 4LOSA 2ZHKA 2UWBA 1RUH2 4EQVA 4FTSA 2I2SA 1IZ3A 1QH7A 4GZ9A 2C0ZA 1MEC3 4XF0A 4CEYB 1LOAA 4CYDA 3AFKA 4YPJA 3J8F1 2HWD2 3I49A 1RUF2 4QHOA 2P1BA 2DU1A 1PK6C 5CFCA 1OA4A 2R073 3A0NA 2DCJA 3T30A 1LTEA 3CNAA 1O4TA 3RZLA 1REFA 1HXS3 4CVUA 2D5FA 1X36A 4CXXA 1NCRC 4PCRA 1MS1A 3HT1A 3VBFA 4CCLA 2A3WA 4DFSA 3ACIA 4TLFA 5KBFA 3O1MA 4M4RA 2VXRA 3M3OA 3NJXA 5F5AA 4MGZE 5G05L 3W58A 3H8OA 4B4RA 1R082 3CJIB 5DAVA 3WDUA 2FCVA 4FFGA 1WLDA 4CUAA 5FZBA 2C24A 5T5PA 3FUOA 5CKQA 2WZR2 3UJOA 4YSFA 2DVGA 2EXJA 2XOMA 3SH4A 4DEQA 2UU8A 2D98A 5A7WA 2PHFA 1YFWA 3HBZA 5C8WA 1ZBE3 1LOCA 4K9SA 1ASJ1 1OLQA 4FOYA 1QJU2 1C5IA 3MIGA 4P08A 3ZSMA 4AAPA 4DZGA 4AVCA 3L9JT 5HXVA 3ILFA 4Y20B 4J25A 3T0AA 3ZXKA 5A3LA 1NA1B 1VLNA 2VMCA 5K4LA 4Q8KA 5A3UA 3H3LA 4F83A 1RVF3 1NG0A 2SBAA 4HT1T 4AEDB 2ZMLA 5HV0A 4OVEA 4LPLA 1RUD2 2IFRA 2VL4A 3HWJA 1HKDA 2AREA 2AUYA 2E53A 2JDYA 2WDBA 5T3NA 3WCSA 3WDXA 2YROA 4AW7A 2CDPA 1H4HA 1QU0A 1EV12 3BIWE 4YFZA 4D6RA 1JZ6A 1UW8A 1B09A 1H1AA 2XL9A 1K45A 2E9QA 2EICA 2ZTNA 3E6CC 1YO8A 1QJX3 1LOBA 1UCXA 2VC9A 5CA6A 5FPLA 1VBB1 4F7ZA 2DCKA 4WM7C 1AVBA 3BU7A 1XNTA 1LHVA 1OA2A 1HB3A 1R1A3 4P9XA 5LB6A 3SH3A 3AMNA 4Q4W1 4OI2A 3AKSA 4PJYA 2V5DA 3P1IA 2PHWA 1UXZA 2AGSA 3FBYA 1MEC2 1RITA 3QACA 2CAUA 4MX3A 2D6LX 1E5HA 2OX0A 3HEIA 3J7NA 4M3CB 2QNKA 3HBKA 1DZTA 4KNCA 1XRUA 2QDNA 2J1TA 4CDXB 5DAWA 4ZS3A 1GSLA 1IKPA 1YFUA 3GBWA 2E6VA 4RQPC 1ZX5A 5ABJC 1MVQA 1MVEA 2QQLA 2UY8A 1NKGA 4KG8A 1HIXA 1Y9QA 1XNKA 1CAWB 2ZACA 3MPBA 4Q4W3 1REEA 3LDKA 3RI8A 1U0AA 2HYKA 1SBDA 3LPGA 5A32A 5JPNB 1YNAA 4YZ4A 4P00B 1W9SA 3A4UA 4QX8A 1W04A 4CP1A 5FWEA 4OYUA 4YZ3A 4PDWC 2BRTA 2ZGNA 4OULA 3UV9A 5CVRA 5E89A 5LBEA 4NIAA 2FZ1A 3R6SA 3VD9A 3OTFA 1ZBE2 1HB2A 3WNXA 2FDHA 1NZCA 1OQDA 4QQLA 4UWDA 3VBUB 5FDBA 5F6KA 5GLTA 1ZRFA 2YBKA 4LA2A 5DG2A 5BYNA 1Y43B 5KHGA 1H6XA 1GZTA 5CEHA 2OA2A 2WO3A 5D1IA 2QCSB 4NRPA 2X09A 5JIAA 3VDDA 3VKLA 2FDGA 1RVF2 1C8M1 2B45X 4NAMA 1GFF2 1UPIA 2PLV1 2BQPA 2VMGA 3I4IA 1H4GA 4FPGA 4A6OA 4BK5A 1SPPA 3BI3A 3T08A 1SDWA 4ISQA 2XJPA 2HLEA 4EN8B 1ND2A 1WWYA 3I8TA 2FDIA 1KDKA 2WSUA 1G6NA 4LULA 3O1UA 4OCTA 2YYOA 4XF1A 5AC93 1XYPA 1QJX2 1UU6A 3C3VA 4P02B 4N9HA 3VBFB 4FAGA 5LRRA 1X33A 5LEJA 4META 1WLCA 2Q0AA 1R1A2 4AEMA 3TEWA 3KM5A 4HK8A 4IEPA 4QX7A 4QQOA 3I3EA 1TMF1 4Y33A 1O7FA 3ZXDA 4OLLA 1GOGA 4X6QB 3WG1A 1Q8VA 2WO7A 2R30A 1YWKA 3KGZA 3GBFA 2W47A 1EY2A 5FZOA 2OYZA 1K3IA 1Z78A 5LEKA 3FLRA 1QXRA 3NKGA 4PBPA 2BNOA 2GN3A 2O14A 4YW7A 2RVAA 5FZ9A 5BNNA 4E4ZA 5F3IA 3WNOA 3I2OA 1KXGA 4D8MA 5FOJB 3IAQA 4HKWA 1V6MA 2V09A 3NV1A 1QJY3 3DYPA 2VQUA 4P5HA 3VBRB 3WNMA 4OI0A 3ORJA 3PU3A 2CDOA 1VBA1 3NNMA 5FXZA 2ZMNA 2BTVC 2V4VA 4CEYC 4JDMA 1JYIA 3U4XA 1Q56A 1K5MA 2LROA 1LEMA 4INDA 2VNRA 3CQOA 1F4HA 3KWVA 1H9WA 5CKMA 1TME1 3P3NA 1A6CA 2FCUA 3I3DA 3QCWA 4M3CE 2Z5WA 2JICA 3I3BA 3M3QA 2HEYF 3WP5A 4BDVB 3N9NA 5FUIA 4LKSA 4S2FA 4Q0PA 3TEYA 3QD6A 4FPYA 3PTRB 2W91A 2BZDA 1QKQA 1QOOA 1YRZA 1T6GC 3FX3A 4J1XA 4EWAA 3AFGA 4MGIE 3MFAA 3TEZA 4A7YA 1YI7A 3CJIC 1YFXA 2D7FA 5FO7B 1Q8QA 1GZ9A 4LHKA 3ZXFA 5F5QA 3SMHA 5C5TA 5M0TA 4AI1A 1VAMA 2OXBA 1DG6A 2NMOA 2OZJA 2QTWB 3ETQA 3PUSA 5IK8A 5LASA 1KD7A 2YPJA 4HN1A 5FUPA 3DCQA 3BTZA 2ERFA 4OMCA 2J1VA 4QWNA 2B4KA 3B7MA 1YHFA 3I3MA 5AC92 1XQNA 4BQYA 4DY5A 1IQDC 4N7IA 5FP4A 5A3WA 3RI9A 4H7MA 3OF1A 1GQPA 3WEZA 1NA1C 3NJYA 1F5FA 2GP3A 3ZDSA 1IS4A 4XHBA 2Q1ZB 4AEDC 4BOWA 5KR7A 3BYWA 3AVSA 2A6XA 1LU2A 1K42A 1R093 1US3A 4YG6A 1LAJA 2ZX2A 4JDOA 4JV4A 5A32B 1ZA7A 4NIGA 4MXWA 1DLLA 3VKFC 2D43A 4MV2A 3LA3A 4AZZA 4YYOA 5JZGA 1KJLA 3FHQA 2D6KA 1S0JA 3MBWA 4GB31 2W5FA 2TUNA 3LEKA 4LHSA 5FKBA 2MHFA 5FY1A 4R9DA 3DKWA 5A7SA 1ZZ6A 1CQ9A 1WBFA 2MPFA 1QJY2 2IUWA 2PHUA 2XR4A 3OYWA 4YGBA 5DABA 3VDDB 4CCMA 3S57A 4HANA 1YXWA 2VOTA 4OHWA 2PHRA 3IN9A 3C7HA 1BCXA 3TOJA 4B7KA 2VMHA 4BZ4A 3GM8A 1OOPA 4QX5A 2R7EB 4XUQA 1RHI3 1WBLA 2IZWA 5GZFA 4D3WA 5GZGA 4IEWA 3K3NA 1QNYA 2BNMA 3VL9A 1DZQA 3Q8FA 4Y1XA 1VMJA 4CDXC 1ND2B 3CMGA 4DXSA 1SLIA 4CSWA 3I97A 5FKCA 3UL2A 4AQTA 3EB7A 4LO6B 4I30A 3RYRA 4IESA 3P3PA 4YW2A 3OY8A 1FI2A 5AFBA 1W0PA 3RRDA 4LKDA 3VD3A 1VRH3 4QHBA 3RZJA 4IETA 1ENSA 1DCSA 3DECA 1JZ3A 4AGVA 5L73A 3OGRA 3IDCB 1CESA 2XLFA 2WQZC 4B1MA 1XSQA 2CY6A 4QGNA 5JOZA 2EIGA 4YWAA 5LA1A 1JOPA 1EAH3 1CD3G 1UY4A 3NNGA 1GYKA 5FZOB 3VBUC 4LBLA 3VHOA 3WG2A 4XDOA 5HCFA 1U5YA 1VALA 3AP9A 5DDJ1 3WF2A 5BNNB 5LA0A 2WQ8A 1ND3A 4CP9B 5F3GA 1PX4A 3PUIA 4K40A 1UMHA 5FO9B 3H50A 3SKJE 3H3UA 4QPWA 2XL7A 4Y5SA 2HWC1 1R092 4FPJA 4LHNA 3VZLA 1AR61 1DU3D 1ST8A 3AJYA 4LIVA 1LGCA 3HN3A 4HBNA 4BQ5A 1A3KA 2RM23 2ZAAA 1Y9GA 1HV1A 5J48A 2A6ZA 4CUBA 2GMEA 1K5JA 3OBZA 1JN2P 4C91A 5JR2A 4IEYA 3VBFC 2F4PA 4I0AA 2DVDA 2YY1A 3BOWA 4BLIA 4CZSA 3E6BA 2K9ZA 1G9CA 4NIHA 2HWC3 3WG3A 4ES8A 2IXIA 3VZNA 1E5IA 3EXUA 4BQ3A 1LOFC 2E31A 3P6BA 1UIJA 2XHNA 3KGLA 5EWSA 1H8TA 1RHI2 4XQDA 4RSUA 1UN1A 1GZCA 5DZGA 1YJLA 4WVMA 4XC9A 1J1TA 3V0BA 2MEV3 2H6CA 3SCGA 4D69A 5FY8A 2LRPA 1NAEA 3AKRA 4FQ4A 4GJYA 2WFF1 2EAAA 3T1MA 4BQ1A 3VBRC 3O1VA 3POGA 4HSLA 3NV2A 5IK4A 3ZYJB 3AZWA 3A21A 4LKFA 3IT8A 2G9FA 1V70A 1NUKA 2IXJA 2VQTA 4NRQA 2Y64A 4CU7A 3KCCA 4KGQA 1VRH2 3PHMA 5FMOS 5LBCA 4MXWB 5DN2A 1ULPA 1JZ4A 1GBGA 2RS31 3E1F1 2WYSA 1VP6A 5JZGB 2I07B 4ZU7A 1BK0A 2VUCA 4XZPA 1OKOA 5HV4A 3QBQA 4AVAA 3VD4A 2E63A 1HQLA 1EAH2 1PGL2 2HBUA 3GF6A 5CG8A 3GNEA 4PLNA 5FY5A 5LY2A 4COZA 3KF5A 2OW4A 2WUHA 5FPZA 2JDHA 5KHHA 2FBEA 4CA9A 2BOIA 4AQ2A 4CDQA 2P17A 1MR5A 1SEFA 1WCQA 4OUMA 4ATEA 1UOBA 1DHKB 1FV3A 3NAPA 3VLBB 1W0OA 4XXPA 4E9KA 3ME2A 1JTZX 4WZCA 3PVEA 5HCBA 1NT0A 4AGRA 2VG9A 1GZWB 1PZ7A 2Y38A 4M0NA 1W8TA 2RM22 3CHXA 4CEWA 4ARXA 4W6XA 3HQRA 5FYYA 3H7JA 1V9U1 4R9CA 5FZ7A 1O8SA 4F3JA 1JU3A 1S0EA 2FDJA 2R0FA 3BGAA 3ELNA 5IVYA 3VN4A 1JOBA 3ZN6A 2AEZA 1JI6A 1UOFA 4QPIA 1O59A 2DCTA 5GZCA 1W8UA 3AYEA 3IWZA 3KT1A 3OY8B 2XUEA 4ZONA 3NKTA 3VHRA 5FK8A 3DUIA 4JC1A 1SLBA 3UKNA 4TSVA 3D6EA 3H1WA 1O5LA 2JD9A 2J1UA 3VGIA 3OUHA 5B4NA 3FL7A 2BFUS 4W6YA 4A6SA 4W8JA 5KC6A 3RMXA 1KFXL 2D5HA 4NO4A 4XFBA 1W2OA 4XF9A 3WNLA 2A1XA 1GNZA 3BU0A 1N1TA 1H2LA 2MEV2 2ZZQA 4URTA 1I9RA 5AVAA 1VBD1 4Z2WA 2PHXA 1LECA 1D2SA 1PMHX 2ATFA 3KCXA 5A7OA 1I1EA 1GKBA 2D3SA 3M3EA 1QDOA 1BBT1 1POV0 2PYTA 2UYAA 2WWJA 5LA2A 5C3PA 1IKQA 4CDWA 3KQ4B 3VDDC 5FPAA 4MLOA 2ARAA 1PNFA 3LD8A 4KWJA 3U0ZA 4LXLA 2O8OA 3D3AA 2QQPA 4U2AA 1HX6A 1APNA 3F95A 4LA3A 5CADA 1NQDA 3PMSA 3V64A 3NNFA 1RXGA 4JTOA 1ND2C 4JVAA 1GV9A 1VBD3 1RUI1 2VQ0A 4DXZA 4KGGA 3N4MA 1H2KA 3AP5A 1QQP3 2XXZA 3S7IA 1OPOA 4NHLA 1FOD1 3VZKA 3AYCA 5FZ4A 2XMLA 2Y8KA 2Z42A 5KHJA 4RYDA 1UOJA 3FZ3A 4D94A 2WAOA 4QQHA 3POIA 2QUOA 1F4AA 1FNYA 4LT5A 3FUQA 1AR73 3RGBA 4AVSA 3B01A 1XYNA 4QXBA 3SHRA 4PI0A 4L99A 3U4SA 5K9YA 5JI9A 1OF3A 3RQ0A 4BIFA 3O1TA 5F6LB 2YG0A 1A8MA 2F4LA 1J3QA 2WA4A 4R8HA 1AZDA 2YBPA 2ZEZA 4EN0A 4TZDA 4Q4X1 4WVMB 1C8NA 1IQAA 1AR93 1MS3A 1W8WA 5I0RA 1PNGA 1FOD3 2ZOEB 4AEJA 2DVAA 1S0DA 1BJQA 5BNNC 2N7GA 2DUOA 2HWE3 3MIBA 3PURA 4GXLA 4NN0A 5JIUA 2IXCA 2QFEA 3TB0A 4UOJA 4A4AA 4LTAA 1WMDA 1TVGA 3MGUA 5FZCA 2Q4SA 2JB4A 2GMPA 3AC0A 1OD3A 4L2NA 1LESA 2KA3A 3P5BA 3WW3A 5BNQA 5FY4A 2J42A 2XQXA 3M3CA 4IEOA 1IS3A 2VCBA 5K8SA 4AFMA 3RYKA 1WMFA 4ASKA 1S2BA 4FP2A 2A71A 4IXLA 3T2QA 5FQ0A 3AB0A 5BY5A 4V1PA 4NJ4A 1OXCA 4ZU4A 2OPWA 1MS4A 1QEXA 4M00A 3B00A 5CZKA 3N7KA 1AX2A 1UL9A 4ARYA 1W0NA 4CDQB 3SLIA 4ASLA 4RGGA 3U75A 2XKOA 4Q0SA 4FPLA 5L9BA 2DBNA 1OFSA 3NAPB 1GNHA 1DDLA 4JX0A 2GNDA 3NQHA 4XBQA 4FPHA 1EUTA 5EZWA 5IFTA 2AZ5A 2XLGA 4GMP0 5E6HA 3ROUA 4AF9A 3I2DA 3ALQA 4A7KA 1RUH1 2JKXA 2CGNA 1VE0A 3ACLA 4CEWB 5FOBB 5LWBA 4JKKA 3D0JA 3OBTA 4LIUA 3NJZA 5DAPA 4LO8A 3PU8A 5ANQA 1QQP2 4V2VA 4QXCA 4LMFA 2HWD1 1RUF1 3MICA 1UY3A 1WMXA 3ZN6B 3WP3A 4URAA 5HCAA 1LKNA 1NLQA 4QPIB 1LOGA 1GU3A 4HK9A 2G4IA 1XNBA 2EIBA 4FOVA 1AR72 2GDFA 5KHIA 5IK7A 1QOSA 1DGRN 4GULA 1HQWA 3G6JB 2OKXA 5JZGC 2ENRA 4HONA 5JR7B 4GQ7A 5DQ0A 4WVVA 4BQ4A 3KB5A 2BOJA 1R081 1DGRA 2AEYA 4YZ5A 3RJRA 4XFGA 2OUJA 1AR92 1POV3 2K46A 4Q1RA 1G9AA 1RUF3 2WZR1 1OI6A 2GC0A 3OGJA 2HWE2 2WBKA 3TRSB 3UGHA 4OI4A 5FMOL 2JG9A 2ZX3A 2ARXA 4AG4A 4JQTA 1QJZA 1ZYBA 2Y6KA 4EWEA 1C1LA 1C4RA 1QJU1 1JYWA 4M4PA 3SKVA 3JQWA 4JAAA 1UY1A 1SBEA 2OQ7A 3IIAA 4MYEA 4HZFA 2D40A 3RYPA 3ZYGA 4BXSV 3OG2A 1IPSA 2HWF3 4HETA 2AH2A 3GCWA 3ZIXA 1PMJX 1RUD1 1X50A 2W1WA 2JDMA 4DRVA 2I45A 5J09A 1LRHA 1D4M3 1JYTA 1EV11 4Q0VA 4BQWA 4MGTA 1PX3A 3VD7A 3TN93 4YVSB 3ZFGB 2BVVA 4AVTA 2PFWA 3AVRA 3HAGA 3BIEA 3MV11 4RS5A 3ITQA 3KV4A 3JB4C 2XGXA 1PHMA 3BN6A 5FMCA 3GALA 4LO4B 1Q8PA 2BVBA 1RUD3 3FFQA 1WA4A 1V6LA 3PVOA 4MHUA 3THDA 3K2OA 4Y5TA 1J83A 2SLIA 4BLJA 1MEC1 2K0GA 1EV13 5LCWL 4Y4YA 1DYPA 4NPMA 3FE5A 5C5UA 5EJ1B 4XIKA 1YFYA 4H2AA 2W46A 3PDQA 2BFUL 1D2QA 5A1FA 4N43B 4EN6B 4A42A 4EZHA 2UYBA 3ETPA 4UBGA 5LK5A 3LCPA 4UFMA 3JXSA 4DXTA 3GBGA 4QB2A 1BZWA 1E57A 5FXWA 5FYUA 1WCUA 2D44A 4A44A 3CZJA 1Z0HA 1AJOA 2RJKA 2ZGRA 1QJEA 4XURA 1RMU2 2E26A 3HNMA 1VMHA 3KT4A 4O9EA 4RD7A 3TYJA 2D3PA 3RWKX 4QGMA 5I8YA 4CP2A 1MS8A 5JOYA 2BEOA 2WN2A 4IL7A 4FSJA 3ZFFA 1ZBE1 5DUXA 1UO9A 4FFFA 3GZTB 4GMP3 2NLRA 4R9BA 4Q1PA 2VOXA 2GNTA 2JENA 4Y26A 3VKOA 1JYCA 5IVFA 5I8SA 3T1LA 3AZYA 1XU2A 5IVVA 5I93A 2IXHA 5E1RA 1CPNA 2QQJA 4UF0A 1RVF1 3LOIA 2HWF2 3Q8AA 4NVPA 2D3RA 4OMDA 5FBZA 4AK3A 1YCIA 2ZKNA 3CJXA 3TWIA 1LHNA 1W6PA 1ZZ7A 1BK1A 1UU5A 4ZY9A 3ZYIB 4BK4A 5BNPA 5FR3A 3AM2A 1RUNA 2A3YA 2JKBA 1JYNA 1D4M2 4LBQD 3K3OA 3HVDA 5FZHA 2Y6GA 4G3YC 3TEXA 3TN92 3GJAA 3ZMNA 1NCQB 2XB6C 3LKJA 3N36A 5GZEA 3T2TA 3DL3A 2O0OA 3OSDA 2P6HA 1QJX1 2VE1A 4Q4V2 2A6WA 1WUVA 1W03A 2E33A 4UAPA 4P9GA 1QMJA 1BEV3 1S0CA 1OQEA 1A34A 1W6OA 3ZO0B 3VL8A 3U1XA 4LKEA 4GALA 2EXIA 3WDWA 1R1A1 1O3SA 4FPKA 2W9XA 3WR0A 2EXKA 3ZYPA 5FMBA 5C3SA 3O1PA 2JD4A 4YM2A 3ZN5A 3D4KA 3MUZ1 2LALA 2WNEA 4PLMA 5F39A 4FPEA 5ERLA 3U11A 1Y3TA 4CDQC 2JG9B 2ZGUA 3THPA 3ZFEB 5D8AB 3VV1A 3OEBA 4B1LA 3NAPC 2OIIA 4PQ9A 2RS13 4NPRA 4LR4A 2DTWA 2WT0A 4XDPA 4BIOA 4P14A 1NY72 3BUCA 4G4FA 4CEWC 1KJRA 1JOJA 3MF9A 2JIJA 3TNPB 4CPBD 4C1WA 4AFCA 3LWCA 3WNPA 4PT6A 4RR3A 2XVGA 3RS6A 4TLGA 2TNFA 2EALA 3QLQA 3ZXAC 2ZXQA 4QPIC 1W6NB 1I3HA 1DGWA 4XFHA 5L7OB 3NNLA 1HRI3 2QBXA 5JOXA 1A8DA 1MACA 5FPVA 3PL0A 4RS5B 5J3UA 2JIGA 3LPFA 3W5MA 3ZX7A 1OUSA 4ZKTB 1O3RA 4I2OA 5CFDB 3BVCA 5I0DA 1SCSA 4A7ZA 3DPRA 3RWNA 1SFYA 3O14A 4CDUA 5GKAC 2ZGLA 3AZZA 4LORA 3WUCA 3K4DA 3OD0A 1NX9A 3IAPA 2KXLA 1JXNA 1LR5A 1CZTA 1DQ4A 2QQVA 3IDAA 4L9BA 2PELA 1J3RA 2NYYA 5FY7A 3WP4A 5FYVA 1VRBA 2VBBA 4P9YA 5LA9A 5FXVA 5AC91 2OT7A 3I2JA 1WLTA 2HBTA 4AI9A 5BV6A 4O61A 1BEV2 1OH4A 1P8JA 4YGEA 4E8DA 5FV3A 5A3PA 1UZWA 1UYXA 2DV9A 1C1FA 5A6YA 2W68A 4KWLA 4MGYE 3VKMA 4COUA 1W9TA 1NXMA 2WZPP 3BKZA 1UPSA 4KMQA 2FMYA 3WNKA 4YVSC 5F32A 1EUUA 3UKVA 3ZFGC 4AFAA 5CFCB 3PIJA 3ECQA 4QKDA 3IMNA 3ZFFB 4I0WB 1CAVA 3FWEA 2Q8OA 4CCNA 3GXUA 2RS12 4J6GA 2JG8A 5J96B 4KBZA 1OLMA 3B02A 1WA6X 4I3PA 1YQ2A 3NMBA 1QJY1 2QQMA 1W9YA 1HLCA 1F5JA 3MEPA 3O0VA 1EPZA 3UETA 1GP4A 3CDZB 4KL1A 3HD8B 5FZLA 1ZA4A 1GUIA 4AFBA 1QWRA 5KWRA 1W6PB 5BNPB 2QQIA 3OGGA 3POYA 1COV3 2R1DA 4RL7A 3MHZA 4XFFA 5A7WB 3VDAA 2AYHA 2BGOA 1OVPA 4JTNA 4L11A 3CBNA 4N43C 1GP6A 4Q0QA 1HRI2 3C2UA 3DXTA 4Z2AA 4DRRA 3UNPA 1W9FA 4NHKA 3NW4A 1KDMA 4I3GA 2XVKA 3LIHA 3AKQA 4Q4Y2 3LFMA 1J1LA 4CCEA 1GNYA 1WCDJ 1Z7S3 3L2HA 4QQ2A 5A7NA 2VBDA 3GZEA 3H1MA 5T5OA 5A1AA 4IUGA 1CAUA 1OFNA 2YGLA 4RHV2 4XJUA 2B7YA 1ODNA 4QHZA 5LBBA 4NIDA 5FLJA 2ZGMA 1PO13 1REDA 1AXKA 4HN0A 4UT5A 4HKLA 3ZYRA 1STMA 4JCKA 4XAEA 4LQRA 4YNIA 2VJXA 5I8TA 4R52A 4E2GA 2ZCWA 1UOGA 1ZZ8A 1O5UA 2HEWF 2JDNA 4QM9A 2WKKA 4P9WA 1DP0A 4AFDA 4ATFA 3JD72 4AVVA 3OUJA 4AOCA 2WINB 3D8CA 1H6YA 5F5CA 5LRSA 2Y6HA 1R091 3ZSEA 1CX1A 3HOBA 1RJ8A 3VBHA 1PMIA 3F2ZA 1AL23 1S2EA 2GP5A 5K0UA 1DZRA 3O1RA 2R1BA 2WNVA 1XE8A 4OHXA 4RN5A 4FI9A 1F2NA 2HEVF 2GZWA 2VW1A 4BM8A 1NCQC 1ZRRA 2FQPA 5FYMA 2Y0IA 2VTXJ 2RDNA 5CNAA 2PQSA 1X9PA 2PA7A 4LE3A 2W1UA 2WRAA 3B3QE 2OUHA 1UU4A 2A75A 3DEMA 2YC2A 3LAGA 3USUA 3PIGA 3E6DA 3WZ1A 5IHRA 3DPRB 1TNFA 4EYUA 5JXJA 2ZGTA 4HG6B 2YPDA 4XJAA 2WS93 1NXD1 2XWJB 1RHI1 4Q29A 1U5IA 1COV2 2JG9C 1CR7A 1GMMA 3N7LA 5LBFA 1ULEA 4ONUA 3B9CA 4X8PA 3ZFEC 1IGOA 5D8AC 4NROA 5FCCA 2ZX0A 3LDBA 4MGKE 4XEZA 5JVVA 4Y20A 4LK6A 4Z82A 4AHZA 5GLZA 1GLHA 3QH7A 3POSA 3J26N 5ISLA 3O1OA 1Z7S2 1AR83 4K1ZA 4DQAA 2B5HA 2QKDA 2BWCA 4Z92B 3N3HA 1AYN3 4PIZA 2NZ9A 3GJBA 1SLCA 2DDUA 1VRH1 2ORXA 4LBJA 2IC1A 4N53A 4PF1A 2XJSA 2D6PA 4QXHA 4XJ9A 3WHTA 1Q43A 4IERA 5C4WA 4E27A 1SPPB 5JLVA 1PO12 3AYAA 1UAIA 5L7OC 2VVEA 3ZXEA 1SACA 3W9AA 1ZZCA 4A2UA 1EP0A 5JMCA 2YUEA 1DQ2A 4QPGA 1EAH1 3DV8A 4RS5C 1PGL1 2ETEA 1CAVB 2ZGSA 3JB8A 1H0BA 2RMU3 5CFDC 3PJYA 5JPMB 3LDRA 4OZOA 1UD1A 5EP9A 1XXNA 2Q8DA 1V6KA 4NHMA 2VMDA 4P9JA 4QM8A 4D7SA 3ILRA 4EROA 4TTGA 5FZ1A 2CU5A 2B39A 1UYPA 4C0HA 4YM3A 5IYYA 1GR3A 2YU1A 1ZVFA 3SCHA 1AL22 1NYWA 4O9GA 1ENXA 1OD5A 4FXKB 1W8NA 5T54A 1DQ5A 4HVOA 1CAXA 2DVFA 3FC0A 4UW4A 2RM21 3FN9A 4ORFA 2QQWA 2C4XA 5F8PA 3OPTA 1X8EA 2VH9A 2CYFA 3PVNA 4I01A 1SLAA 2WYFA 2WNUA 3SH5A 3HMYA 5C3QA 1JODA 2DUQA 1ODMA 4XUOA 2D93A 4XFCA 4AI8A 1DYKA 2ILMA 2UWAA 3GYDA 3HNBM 4QX2A 5F1RA 1CAUB 1OC1A 4LBMA 4XQ4A 5FK7A 5FYTA 3GDBA 1K5MB 3MLJA 3UGFA 1ZNPA 2WLPA 2WS92 5CFCC 5A3NA 1RUG3 1S0BA 2W92A 5L9VA 4E2SA 5DXDA 1C5HA 3ZFFC 4LE4A 2MEV1 3W59A 1XSRA 3WDVA 4PBOA 2R32A 4YW6A 5ANNA 4A3XA 4XE9A 2CGPA 4AEKA 3KQRA 2DURA 3U78A 1E5SA 2E51A 3N9OA 4MUVA 1AR82 4IV3A 3RZHA 1UQXA 4IV1A 2IXKA 1WD4A 1AYN2 1MPXA 1PM4A 1FNZA 1Q3EA 2WZ8A 5EPAA 4YW5A 4OHZA 5BNPC 3I2GA 4MZUA 2CWMA 3UESA 3PTYA 2EXHA 2VVFA 3VBHB 3HJRA 3WOGA 3SNMA 4C0BA 3MIFA 2BV4A 2ZHMA 4FPFA 4AI3A 4LK7A 3R05A 3SITA 3J7LA 3J7HA 1AX0A 1VBC3 3AKPA 1H2NA 1ULDA 4UFHA 2Z2SB 5I0UA 2X10A 3WF4A 4DIQA 2O1QA 2QQUA 1W05A 1X82A 1YYNA 3NO8A 1DGLA 1ZM1A 2RMU2 3WW1A 4SBVA 4ISRA 1FXZA 4K3UA 2W87A 2YBSA 3H8RA 1NCRA 1KQRA 3QH6A 4XJZA 3USUB 3RPQA 3KHCA 2EVXA 3ATGA 4QDSA 5F2WA 3K46A 2GALA 2JEMA 5CISA 1V6IA 1VIWB 5FZ8A 1RB8G 3EQEA 4ZHNA 5C8CA 2D6NA 1W8ZA 1UYYA 1SDDB 1ENQA 3DYOA 2D6OX 3GZAA 4LLFA 4KI5M 5FP9A 4Z8BA 3B9IA 2YDEA 1YQ6A
chains in the Genus database with same CATH topology
1O4YA 1PZ9A 4HL0A 5JAXA 2YC0A 3WUDA 1XNDA 3G7DA 2GSYA 5H9SA 4XFAA 2A70A 3M8LA 1RJ7A 3THTA 3OYWB 2RJLA 3J9SA 4RFT0 3WHUA 1N1YA 2ZA9A 1OOPB 1ULFA 3GHMA 4S2HA 1HDKA 5C4WB 3CO2A 2BBVA 1RUG2 4YGDA 2HWB2 1FV2A 2PAMA 4FCAA 3ZMOA 5I0SA 4YVWA 3GHNA 1O91A 4OHYA 2W0XA 4QPGB 4LBNA 5FLIA 4OI1A 2VQAA 4E4SA 4K21A 3R0RA 5J36A 3JUUA 4BMBA 3R4UA 2H0VA 4G9SB 1KS4A 1UZZA 2ZX4A 2VMIA 3DPRC 5DZEA 2PTMA 2RS53 4KG0A 1JH5A 5BXXA 4WM7A 4XJ8A 3NL1A 5CB7A 1CAXB 5F9TA 4AQ6A 5EJ3A 5BUVA 1RUE3 1V6JA 1VBC2 1VAKA 1O3QA 3WD5A 1UF2C 1QQP1 5J7MA 2WNUB 1WMEA 1ZZ9A 1ND3B 1A78A 2JDZA 1BXHA 1N1VA 3JBG3 1AR71 1FATA 1S0FA 2R0HA 3JQXA 2HJIA 3LOBA 4UBHA 4K1YA 2WC2A 3LA7A 1CVNA 3WW4A 1SLTA 1ZRDA 2ZGOA 4C1XA 1AR91 4N7UA 2XWBB 3RDIA 1NE6A 2BW8A 2HWE1 5FO8B 4B29A 3AMHA 4IV3B 1Q5OA 4IV1B 4GH4A 5FRAA 1YUDA 2R043 2X5IA 4UW5A 1G9DA 1H8TB 1JBCA 2OPKA 4L97A 3RZZA 3V0AA 1BMV2 1PGSA 3AXEA 2A3XA 3V0BB 3MIDA 4FXGB 4CP0A 1G9FA 1WGPA 3S30A 3KD4A 1N3QA 5DG1A 2ZZJA 1H30A 1PGW2 4YZ2A 2BYVE 4WVWA 1IS5A 4Y1UA 2Y26A 2E7AA 1SQ4A 5KXBA 4D7TA 3EO6A 1K5MC 2RS52 2ZGQA 4IEUA 4BA6A 5C8CB 2PAKA 3AJZA 4JGZA 4MVTA 4HVQA 3KLSA 1HRV3 1RUE2 2V5YA 3POWA 1AX1A 4QQPA 4KU7A 1TE1B 1ULGA 5FLHA 4LHLA 1AJKA 2ARBA 4XMIA 2G9GA 4AWDA 3JBG2 5JCTA 3VBHC 4NWWA 2XG3A 2NMNA 3IDBB 2YZ4A 4FO9A 2ZHNA 2R063 3O0XA 4XILA 1TQ5A 3VZJA 4CEYA 1DFQA 4XFIA 5JI7A 4YVWB 2V73A 4U36A 1RMU1 1POV1 2ZKLA 1QDCA 3PMEA 3LSEA 1V6OA 1VB2A 3HQXA 4YARA 2VECA 1MQTA 1LOEA 1QHDA 1SMVA 1WCKA 2IXLA 2XVLA 1RUC3 3CU7A 1OA3A 2Q1MA 4MSVA 4WBBA 2R042 4QT6A 3M1HA 2Q30A 2GU9A 1G7YA 4YRDA 5C6CA 4BMEA 3N7MA 3WVJA 1RMU3 2HWF1 4OHVA 4WVZA 1KS5A 5JSOA 4H7LA 1DBNA 4HSJA 1D4M1 5GM0A 4QGLA 2VUAA 3B5LB 1PVC2 1NLRA 4CDWB 4YW1A 3BPZA 3TN91 1OOPC 4YZ1A 4Q4V1 1AUYA 5CIRA 5C4WC 4AEDA 1RUJ3 3WXPA 4LEJA 2Q5TA 1O3TA 4QPGC 1VBE2 3WDYA 2GH8A 3MF6A 1HRV2 2ET1A 2O8QA 2JX9A 1CPMA 2WQ4A 1NE4A 2XKPA 5JSRA 2QVSB 1N3PA 3VKNA 1ZZBA 1FMD2 3AMQA 4XBNA 1GANA 4AHXA 4BHPA 3HIFA 4Q4V3 4GH4B 2FMDA 1JUHA 1X8MA 3V56A 2X5IB 1NY71 2W52A 4DOUA 3V0AB 2R062 4Y1ZA 1OLRA 1V00A 1YLLA 2NM1A 2VUJA 3AKTA 3AP7A 4M3CA 2WNUC 4XYXA 1N1SA 1ND3C 4QD2A 1U5ZA 4BH9A 5LK7B 4CDXA 3JCIA 2DWRA 1UZYA 3AXDA 2DFBA 2ZGPA 4UW3A 4WZFA 4SLIA 4DY3A 1RUC2 3FJSA 4FT8A 4GMP1 5A3MA 1IPJA 3IPVA 4X8NA 4HLTA 4K8FA 1RL3A 3NSTA 5KXCA 2E7QA 5FQ0B 4PIXA 1LU1A 4JGZB 3O5SA 5TSWA 4JRAA 4XOGA 3WX5A 4FBFA 2GNBA 4DMIA 3R4DB 1H1IA 1PIV3 3OD4A 3J4UH 2A6VA 2X53S 3JU9A 1PO23 4XQWA 4IV3C 4IV1C 3EBRA 3B93A 1S2KA 2NPIA 2UY9A 1H8TC 3MW2A 4GA9A 2D6MA 4WM8A 5T5JA 3WCSA 1RUJ2 3QOPA 3WNXA 1AF9A 1BEV1 2LM3A 5KHKA 2VOWA 1IOAA 2K2SA 1Q8OA 2QE3A 4BWOA 3JZVA 4YGCA 2YXSA 4DS0A 1AYM3 4XBLA 2P37A 1J3PA 3Q9OA 1FPN3 3WQ7A 1MQTB 2PAEA 2GC2A 1WD3A 2AR6A 2VU9A 1LGNA 4HKOA 2E7TA 5JDBA 2RS11 2RR12 3IDEA 4I09A 1UX6A 5C8CC 2JE9A 3MPPG 1GQHA 3AZVA 1LOFA 3J8F3 2DF7A 4YLZA 1F8VA 3H0OA 2P3KA 2X8KA 5GJ6A 1U12A 2LUWA 5CG9A 2B42B 3RSJA 2DVBA 3H8UA 1HRI1 3PJQA 4IEQA 1G8WA 1SBFA 4FTBA 1YIFA 3VBRA 3AZXA 2XBO2 4Q4Y1 3BALA 3OBRA 3KSCA 4ZU5A 1ULCA 3V65A 2CV6A 4H55A 3ZPYA 1QGLA 4ITCA 4YVWC 4RHV1 5KC5A 1LODA 1S0IA 5SV5A 5FAXA 3ZIWA 2QZ2A 4AI0A 3VBSA 3O0WA 2B9UA 4K7JA 1MS0A 1ASJ3 1PIV2 4AHWA 1PO22 4D7YA 1N47A 1EPWA 2XJUA 4YG3A 5SV8A 2R49A 4Q4Y3 2TEPA 4XF3A 4OFGA 2PHLA 2DYCA 4P9IA 4L8QA 1W6QA 3H1YA 4FPOB 2I74A 3H9AA 3JD71 3D82A 3OJBA 5B2GB 1BQPA 4FOWA 4RHV3 4Y1VA 4YG0A 5T5LA 3AX4A 3MLLA 1QXJA 2JXAA 1L3JA 2VOKA 1AYM2 3VZMA 1GQGA 2ZS6B 4PLOA 4B7EA 1J58A 2R072 4JGYA 4CDWC 1FX5A 5C9AA 3APBA 4OUSA 1HXS2 2VNGA 1HQNA 4FOQA 1FPN2 3LZZA 1VBB3 2P34A 1UKRA 5T55A 4R4ZA 3JD73 2WJSA 4AHYA 1URXA 3IPVB 1I6XA 4LBKA 5GALA 4FP3A 2CAVA 3J8F2 4COWA 3A0KA 3DN7A 4PIYA 2DCYA 1COV1 2UWCA 3M7AA 2NP0A 2OZ6A 4GH4C 1LHOA 3L2YA 3BCWA 2X5IC 4HFSA 4B8EA 4GWMA 4NWVA 5CBLA 2B46X 1WLWA 4WM8B 1Z7S1 4EJRA 3MW3A 3BODA 4XF4A 3ZVXA 5E8AA 1H2MA 2DUPA 1PO11 3MIEA 2CGOA 1ASJ2 2XH6A 3WG4A 1LCLA 3OCPA 1B35A 1FYUA 4YM1A 1QF3A 5E88A 3AMMA 1D4VB 4DINB 2WSVA 4GWNA 2CTVA 2ET7A 3BB6A 1W39A 1WCSA 1W6OB 2ZJCA 1C8M3 2XJTA 2CWSA 5GLUA 2PLV3 4YM0A 4JGZC 4Y24A 2GNMA 1G9BA 3CEWA 1AL21 4JDNA 5BNOA 2RHPA 1BKZA 2ZPXA 3VHPA 3MYXA 5H9QA 3WQ1A 2P3IA 2VGDA 1VBB2 1NOVA 5BPXA 1X7NA 4P9LA 4Q4W2 4YW3A 2CNAA 1MS9A 3VHNA 2JECA 1TMF3 3U07A 4J1WA 2C9AA 1YI9A 1AHSA 4RR3B 2P2KA 1DQ0A 2WS91 3AK0A 4XTPA 3IBMA 4R4XA 1S0GA 3VBSB 3S0MA 1MQTC 2WL1A 2VW2A 2GC1A 4ES9A 2VVDA 3FBMA 1JHNA 1LENA 4IQPA 2ZMKA 5I0TA 1VBA3 2B8MA 2W08A 4XJWA 3NWKA 1VAVA 1W6QB 5HI0A 2C1FA 1AR81 3LGRA 4QPYA 1GICA 1AYN1 5CAZA 3I7DA 5EYXA 4CDUB 3U10A 5KXEA 1TME3 4HPKA 3VBOA 1XU1A 1CONA 3UKTA 2JJ6A 4JGYB 5C9AB 1VJ2A 1OMIA 3CF6E 3ZSJA 3ASIA 4K20A 5IUQA 1XE7A 4Q27A 1W2UA 4LLOA 4AXOA 2DCZA 1OKQA 2YMZA 3FFZA 2RMU1 3KMHA 5CU1A 1M06G 1C8M2 2GH2A 4AE2A 4LBQA 2PLV2 5EXOA 1YIPA 1Y7BA 4BYYA 5L36A 1OHFA 2HKXA 1S1AA 2D97A 2Z79A 4R9AA 3TBDA 4Q0UA 3VZOA 3AMPA 1DIWA 4F8AA 1UMZA 2JG8B 1IHMA 1TNRA 1DF0A 4LO7A 4QXKA 3AP4A 1TMF2 3S6PA 1S55A 1R1ZA 3KZ4C 1GZWA 3ILNA 4GB33 2TBVA 1RUG1 3IM0A 2HWB1 2WIIB 1WW5A 4XHXA 1MZEA 4C90A 4GIQA 1B35B 3S7EA 3RG0A 5JOWA 1G86A 4KQ7A 3I59A 1UKGA 4B4QA 2X29A 1VBA2 1WW6A 1PVXA 3FLTA 3H7YA 3EJKA 1YJKA 2XPJA 4AYUA 2YV8A 1D0GA 1TME2 4CTEA 5BNOB 2HWB3 4LBOA 3D0SA 3LA2A 1FT9A 1MZFA 3IKWA 5J98B 5J37A 2ZBJA 2P3JA 1VR3A 1VBC1 3B69A 4XTMA 4KH9A 4FVVA 4YFWA 2PHTA 4WM8C 4Z1VA 5FREA 1W6MA 1DQ1A 1U5XA 3WLUA 1H8VA 1VB4A 4B4PA 3SXWA 3O12A 1H1MA 3PLQA 3B94A 4M3CF 1LEDA 2KM2A 5K0UB 1LJ7A 3E97A 2WNVB 1SLLA 3FHIB 1HW5A 2PQQA 4UXAA 2H0BA 2AENA 2BGCA 1SCRA 2ZAHA 5DDJ3 2XJRA 3NV3A 1PK6A 4EN7B 2EAKA 3EHKA 1F9KA 1CIWA 4KBBA 4BE3A 4Q2FA 1FAYA 1AR63 1CX4A 1QXPA 2DFCA 4E2QA 4XIOA 2ES3A 1M4WA 3ZXGA 4HPKB 2A7AA 2DTYA 3VBOB 4EV0A 4GB32 1BMV1 2VW0A 2WLQA 2A5ZA 4Y22A 3M70A 3O7OA 2MNGA 4BCUA 1C57A 2VPVA 2JE7A 3ES1A 1PGW1 2LTNA 5I91A 1RIRA 4L92A 1ZBA1 1QOTA 4M01A 4EN9B 4LBQB 1KITA 2RE9A 3M4FA 4RR3C 2RS51 4S2DA 5GLVA 4N53B 2F6BA 2Z69A 3VBSC 3N35A 2BNNA 3SISA 3H3ZA 1DQ6A 4GKYA 5C33A 3FLPA 2WFF3 1CJDA 2XUMA 1OPMA 4FQZA 1RUE1 3VUOA 1MZ5A 1QNWA 3I54A 3INAA 3MI8A 5A33A 1ZBA3 3FMGA 4TYSA 2YHJA 4CDUC 2RS33 3WDTA 4XETA 3JBG1 3TAYA 3ES4A 1KFUL 1RGSA 1LGBA 2WWSA 4Q8LA 4JGYC 5C9AC 2C5DA 1XNCA 3WV6A 2Y0OA 5FFOC 2PN5A 3KT7A 5DDJ2 1ZREA 5FPXA 4FTEA 4FAHA 1MZ6A 3UK9A 4HMZA 1LB2A 4MH0E 1XYOA 5JSPA 3MIHA 4AGGA 5T52A 3I59B 2HWC2 1SFNA 2QJVA 2WT2A 5FTTC 1OSGA 5IK5A 1AR62 2IFWA 3AYDA 4RQPA 3X29B 5ABJA 4CRQA 5GZDA 3WT3A 2R041 4FPCA 1IS6A 1LULA 2NQYA 2VULA 4N9IA 1V9U3 5ACA1 4E4DX 4JRLA 4PDWA 5K7PA 3E5XA 2JG8C 5H9RA 3PNAA 3ZXJA 1LHWA 2ZX1A 4MXVA 1PVC1 1C3HA 2ZHLA 1W6MB 1IPKA 3K51A 2DU0A 1RINA 4Y5Z0 5ACA3 1DGWX 2A6YA 1BYHA 2YGMA 3NV4A 4RGAA 3USSA 4RA0A 4IEXA 3ST7A 1BVP1 2VY0A 1B35C 2WFF2 3M3IA 1BBT3 1VBE1 1HRV1 1PK6B 4W6WA 4YVSA 3ZFGA 4OZXA 1PVC3 4Z07A 3ZSKA 3WW2A 2XJQA 4Y1YA 3CL1A 1CJPA 1ZBA2 4KU8A 2XLAA 1MS5A 1FMD1 1NCRB 5H9PA 2RS32 4W65A 4N90A 2UURA 4QU2A 4DB5A 5BNOC 3TNQA 3D5OA 1RUI3 5IT6A 4AVBA 5DZFA 5DUVA 5AFEA 2R061 2BUKA 4XPVA 2ZABA 4Y22B 4XW3A 1VBE3 3N7JA 1QY4A 2CL2A 5DUUA 1AXYA 2H6BA 4N43A 1FMD3 5T50A 3OPZA 3WINE 1Q8SA 2WT1A 4I0BA 2XJVA 2EA7A 4EWDA 1RUC1 5K0UC 1JW6A 2WNVC 4NOTA 3RMYA 1RTVA 1JUIA 3NVCA 4JQRA 4Q4X3 2A73B 4K6BA 5JOXA 1I5ZA 1ALYA 4LO5B 1V9U2 4BPZA 1QH6A 1PZ8A 3SCFA 1ZRCA 3GZUC 3R4SA 4LUMA 3DF0A 3ZXLA 4KWKA 3KCYA 2VNOA 1EYBA 3MW4A 2R6QA 5A33B 1KRIA 2R16A 4XMAA 5E16A 3VBOC 4WM7B 1UIKA 3CJIA 3DGTA 5DUWA 1RUJ1 5GLWA 3AP6A 5ACA2 3PVBB 1TEIA 1VBD2 4PF5A 4TWTA 2VOVA 2W39A 3KS7A 2WFPA 5EFUA 1BBT2 3RNSA 3E5QA 4UW6A 1ONAA 4ASMB 4XXAA 1NCQA 1WW4A 1NLSA 3ZN4A 5HBAA 5EYYA 3WCRA 3M2MA 4RQPB 4N53C 5ABJB 1WW7A 4NR1A 1NA1A 3URFA 2FZ2A 2GC3A 3HR9A 1RUH3 5EV7A 4DPNA 1NQJA 2QZ3A 2RR11 4I02A 4B3NA 1CGPA 1RUI2 3ZSLA 2GN7A 4H14A 1LHUA 1FOD2 2HWD3 4IEZA 5L19A 4PDWB 4COYA 3UJQA 4LNVA 2ZGKA 4HVRA 4QMAA 3MLKA 5AVPA