1GZCA

High-resolution crystal structure of erythrina cristagalli lectin in complex with lactose
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
239
Chain Sequence
b'VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHMWDSTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDAPSKILHVVLVYPSSGAIYTIAEIVDVKQVLPDWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERYTHRINA CRISTA-GALLI LECTIN
publication title High-Resolution Crystal Structures of Erythrina Cristagalli Lectin in Complex with Lactose and 2'-Alpha-L-Fucosyllactose and Correlation with Thermodynamic Binding Data
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 55
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2002-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1gzcA00
1KQRA 4PBPA 4P9XA 5EWSA 5IK5A 1WW7A 4WVVA 4XMIA 3WG4A 1SLAA 2NMNA 1S0EA 4Y26A 3RQ0A 3UK9A 3WDWA 5HCFA 1QKQA 1VALA 3V0AA 1LGNA 2ZAAA 3T1LA 1G9FA 2V5YA 4R9AA 3B01A 4XDQA 1W6QB 1WW5A 4XJZA 2P34A 4FPKA 3MW2A 1A8DA 1VAMA 3QCWA 5GLVA 5T52A 2VW0A 1AVBA 3ZSMA 3FLRA 1KITA 2OVUA 5GZGA 3R4UA 2NYYA 4DPNA 1BYHA 1C1LA 3MPPG 4Y1ZA 1LOBA 2OW4A 4YW3A 1JW6A 1BQPA 3ENRA 4PBOA 2GDFA 5CB7A 1RIRA 1ULEA 4SLIA 1CQ9A 1F5FA 1WD3A 3WDXA 4CTEA 1N3PA 2GN7A 3ZSKA 2NMOA 1IOAA 1W6NB 3AP5A 3N7LA 4FPFA 3ZXKA 4FPJA 2FHRA 3OY8A 1G8WA 4XBNA 2AREA 4YM3A 4FPOB 1QDCA 5DUXA 1MVEA 5GM0A 2ZGMA 1MS5A 4Y1YA 5JLVA 4FOQA 1S0CA 2R16A 1MS9A 2OUHA 2AGSA 2R0HA 2EF6A 3HMYA 1WLDA 2KM2A 2ZHNA 3AXEA 3AP6A 3M2MA 2CWMA 3POSA 1C57A 4Q1RA 3SH4A 1MS3A 1GYKA 1ULFA 4ISQA 3VKOA 3WG3A 3ZSJA 1I1EA 4R9DA 1ULDA 2TEPA 1LOEA 1MS0A 1ZM1A 3M3CA 4GXLA 1Q56A 4BPZA 2D6NA 3NV2A 4GWMA 1DGLA 1W6PB 3I4IA 3A4UA 5DZEA 1DFQA 4LBMA 2D3SA 2ZGOA 5GZEA 2A71A 2PELA 1GNHA 2A3WA 5DZFA 5CBLA 1GZ9A 5T54A 1UAIA 1NXD1 1W6QA 1YRZA 4AYUA 1SCSA 1DZQA 2NZ9A 4P9YA 2ZGRA 5H9QA 2UURA 2LALA 2A70A 3ZXJA 5KXDA 2ZABA 1LODA 3FFZA 2D43A 1DQ4A 3UJQA 4Q2FA 3WVJA 5BYNA 3O0VA 4Z8BA 3GNEA 5EXOA 5IK4A 1S0DA 1TEIA 3OJBA 2DV9A 2GMPA 1WBFA 1IS4A 1QGLA 1YXWA 2UWCA 1OFSA 2I2SA 3AXDA 2JJ6A 1V6KA 1D0HA 2XG3A 1MZ5A 1W6NA 3AZXA 3D6EA 3JU9A 1A78A 4Y24A 2D7FA 1GNZA 3RSJA 4Y1UA 1VAVA 2CYFA 4K1ZA 4AGVA 4RA0A 2DUOA 3N7JA 1V00A 3A0KA 3ZXLA 2GNMA 1IS5A 2ZHMA 1YYNA 4YFZA 4WZFA 5T55A 1APNA 3OBTA 4FPYA 1DQ6A 1KDMA 1G9CA 5IK8A 3VV1A 3WDTA 3UL2A 4LBLA 3D5OA 1ENSA 3NV3A 3VKMA 3IPVB 3LCPA 3NV4A 4Y20B 4YGEA 4FVVA 1G7YA 1QDOA 4YGCA 5KXCA 4XXPA 4R9CA 4XHBA 1SCRA 5KXEA 4NOTA 1CIWA 2JKBA 4LBOA 3AFKA 3V65A 5JOWA 2DVBA 2GMMA 3ZVXA 3W58A 1GBGA 1LENA 1Q8PA 2B7YA 2H0BA 4XMAA 4FQ4A 1WLCA 1CVNA 1EPWA 2A6YA 3B9CA 4FOYA 4TYSA 4XJ9A 1W6PA 5HCBA 4W65A 1QU0A 2PHTA 2UU8A 2EXHA 3PVNA 2A3XA 2A7AA 2P3IA 2NM1A 1V6MA 4U36A 4UW6A 2R49A 1W6MB 1LOFC 3AZWA 1DQ0A 4K21A 4FP2A 2W68A 4YZ1A 1DQ1A 2ARBA 4P14A 2AUYA 5DZGA 1H9WA 2A3YA 4BMBA 3NWKA 4M00A 2P3KA 2AYHA 2JDZA 2PHRA 4AVTA 1V6JA 2DUQA 3WHUA 2DU1A 4K1YA 2W52A 4CZSA 4PCRA 3U4XA 2PHXA 5DG1A 3RMYA 3V0BB 1GKBA 1G9AA 4FOVA 2VU9A 2EXKA 2ZGPA 1N47A 4Q26A 3RRDA 4YGDA 1LHVA 3M1HA 4XJWA 1SLLA 3Q9OA 1GLHA 2ERFA 1DYKA 2WNEA 5JVVA 5DXDA 3H0OA 1QOTA 1ZA4A 2DVAA 2NN8A 5LK5A 1WW4A 3KQRA 1LHUA 4UW5A 4YZ3A 3AP4A 1LGCA 3WCSA 2RHPA 1AXZA 3VKLA 1SLTA 4BLJA 2WT1A 4XTPA 2WT2A 1G9DA 2UWBA 1SLCA 1C1FA 1URXA 3IPVA 1RITA 4OZXA 4Y20A 1ENQA 1QOSA 4Q27A 2E51A 3BIWE 1LESA 3FBYA 5H9PA 5EYXA 4RL7A 1QNYA 3OPZA 2DTWA 1DQ5A 2EALA 2OUJA 2A75A 2G4IA 2SBAA 3OGGA 1IKQA 4ISRA 4Q8LA 4DQAA 1GICA 2V73A 1WLWA 1CJPA 1AF9A 5GZDA 2GNTA 2ZACA 3FLTA 2GMEA 1Q8SA 4XZPA 1H30A 1O4ZA 2DVFA 2ZMNA 1LECA 2PHWA 4GWNA 4ATFA 2D3PA 5IT6A 2ZMKA 1JOJA 1LCLA 4M01A 1DQ2A 1W6MA 1S0IA 3O0WA 3ZYRA 1JYIA 4FOWA 5GLTA 1WD4A 2D44A 1B09A 1MVQA 2YV8A 2ZHKA 2JECA 3WG2A 3WLUA 4JC1A 1QF3A 1N1VA 1UPSA 3IKWA 4IQPA 3N7KA 4M3CF 4GKXA 4Q8KA 1SACA 3WUDA 3AYCA 4BQ1A 1GV9A 1C4RA 1HQWA 2JE7A 3D4KA 1S0JA 1GZCA 2NP0A 1Z0HA 3POYA 3VUOA 4LBQB 4DRRA 1N3OA 4YZ5A 3V0BA 1U0AA 1FNYA 1LU2A 4XTMA 3AK0A 4HL0A 4Y1VA 3OYWB 5T5JA 1AJKA 1G86A 2EAKA 1I3HA 5T50A 1QOOA 3SH3A 1AXYA 4FP3A 3WUCA 2AH2A 2GNDA 4C1XA 1V6IA 3RS6A 3ZXFA 1R1ZA 1VLNA 3IN9A 4GA9A 2C5DA 4UW3A 5F9TA 3JUUA 3WDUA 5IK7A 3VKNA 2ZKNA 1KJLA 4L8QA 2DVDA 2D6LX 2P2KA 1S1AA 1SFYA 4XJ8A 3ILNA 2A6ZA 3HR9A 3WV6A 3SLIA 4XIKA 1AZDA 1SLIA 1F31A 4YM1A 4YZ4A 3LSEA 3C2UA 3CNAA 4I30A 2AENA 4GALA 2AR6A 5F5QA 1LU1A 2WJSA 3USUB 1XQNA 3PVEA 4AVVA 1SBDA 1MZ6A 4AGRA 1Q8QA 4YG0A 4DRVA 2EXIA 4MYEA 5JOXA 1GZWB 1LTEA 3R05A 1LOFA 4YW2A 1IS6A 3UJOA 3DUIA 1DYPA 1LOCA 1N1YA 3I8TA 1AX2A 3T1MA 5CAZA 2GN3A 4AGGA 2A6VA 1LOAA 2ZGLA 3M3EA 1BZWA 1HLCA 1SBFA 2D3RA 3AJZA 3AX4A 3PMEA 1KRIA 5E88A 5IUQA 4NO4A 5T5LA 5FREA 2EXJA 1AX1A 3N7MA 2VW1A 4LBJA 2SLIA 3M3QA 1PZ8A 3HN1A 1A3KA 4K20A 1LEDA 1CPMA 2W08A 3FLPA 1SLBA 1OQ1A 4LBKA 3AYEA 3O12A 3R4SA 2WQZC 5DUWA 3A0NA 4YW1A 3SNMA 4YZ2A 4F83A 1CESA 5GZFA 5JOYA 3IMNA 1JUIA 1Q8VA 4LBQA 4PQ9A 2HYKA 1AJOA 4D69A 4KBBA 4ASMB 3OYWA 2YROA 1SBEA 1UL9A 4YGBA 1FX5A 1CR7A 1JHNA 1LHWA 2ZGTA 3BODA 1PZ9A 3AYAA 3IM0A 2A6XA 2WT0A 3B00A 1JXNA 3O5SA 5DUUA 3WNXA 2CNAA 2DUPA 4XOGA 3WDYA 3N3HA 1ONAA 2PHFA 1JN2P 2ZZJA 2YZ4A 4YG3A 4XE9A 2Q5TA 1H9PA 2ZGSA 1BJQA 1RINA 2E53A 2CWSA 2ZGUA 4FPGA 4M3CB 3ILRA 2DYCA 1AXKA 2DVGA 5T5PA 4ZKTB 2DTYA 2XB6C 2ENRA 1W6OB 2ZGKA 3B3QE 4ITCA 3MW3A 2UWAA 1O4YA 1W0OA 4YM0A 1F9KA 5JOZA 3ATGA 3MEPA 3WG1A 1UZYA 5GZCA 2VY0A 4U2AA 3USUA 1MACA 1VIWB 1J1TA 3ZSLA 5JMCA 1LJ7A 4CRQA 3AJYA 1KDKA 3FUOA 1GZWA 1S0GA 1YIFA 5DUVA 5GLUA 1DLLA 1FATA 2D6OX 5L73A 3SH5A 1BXHA 2VXRA 4YW5A 1JBCA 4DFSA 1V6OA 3NV1A 3ZYPA 5T5OA 4P9WA 1LOGA 1YI7A 1WUVA 3WZ1A 4Y22B 1X50A 4AVSA 1W0PA 5H9SA 2GALA 3N36A 3FUQA 2WLQA 3WOGA 3WCRA 1G9BA 4M3CE 4XILA 5EYYA 4AWDA 4FPHA 2ZMLA 3ZXEA 3GALA 4GKYA 2A5ZA 3SISA 4XYXA 1MR5A 1LEMA 2E6VA 4ATEA 4HANA 1MS8A 3N35A 2ZBJA 4BMEA 1GSLA 1HKDA 4DS0A 5GLWA 4LBQD 1S0FA 4Q1PA 5E89A 3LSDA 4XJUA 4ZXKA 3RG0A 1FV2A 1N1SA 1AX0A 4FPEA 5KXBA 5AVAA 1OKQA 1ULCA 1UX6A 2P37A 2VW2A 3AZVA 5H9RA 4XBQA 1PZ7A 2PHUA 3V64A 2E7TA 3AP7A 1DHKB 2JD4A 2VUAA 1Q8OA 2DURA 2YY1A 3ASIA 1FAYA 3M3OA 4PF5A 4XJAA 5E8AA 3POWA 3T2TA 1FV3A 4XBLA 1CPNA 1YO8A 1LHOA 4M3CA 2Z42A 3PVOA 2ZGNA 1D2SA 1QMJA 5CA6A 3AYDA 1W6OA 2YMZA 1WBLA 2WKKA 2P3JA 2W39A 2WSUA 4YLZA 4YM2A 1FNZA 2DU0A 3SITA 1UMZA 5JDBA 1Y7BA 4YG6A 4BLIA 1MS4A 1JYCA 4C1WA 3W59A 5DG2A 1Z78A 4LBNA 3QLQA 2ARXA 1WCSA 3BOPA 4FQZA 4FPCA 5GALA 5CNAA 3O0XA 5HCAA 4Y1XA 1IS3A 1CONA 4FPLA 2DWRA 3V0AB 4BOWA 1NLSA 1S0BA 2A6WA 3PJQA 4JRAA 1LHNA 4JCKA 4WV8A 4Y22A 1BKZA 3INAA 3TB0A 1LGBA 4UW4A 5GLZA 4R9BA 3WDVA 4BM8A 1UN1A 4XIOA 5SV8A 2ZGQA 1HQLA 2D6KA 3AZYA 3AP9A 3APBA 3WHTA 1DBNA 2FMDA 2ZA9A 1GANA 1FYUA 2VH9A 4TZDA 3AZZA 3RMXA 2CY6A 3TAYA 2D6PA 2R1BA 1MS1A 2GNBA 4YW4A 2YXSA 5FRAA 3VKFC 2BQPA 1DIWA 3MW4A 2D6MA 1N1TA 4XXAA 2R0FA 3ZPYA 2R1DA 1WW6A 3OY8B 2LTNA 1N3QA 2ES3A 3KM5A 3L2YA 4H55A 2ZHLA 4YFWA 5GJ6A 4XHXA 1HDKA 2WSVA 1LULA 2E7QA 1CN1A 1ENRA 2CTVA 3DGTA 1QNWA 1V6NA 1KJRA 2EIGA 3BTAA 2JE9A 3B69A 1ULGA 1IKPA 3OBRA 2C9AA 2CL2A 4WVWA 1UZZA 3ILFA 1UKGA 1V6LA
chains in the Genus database with same CATH superfamily
1GP6A 1KQRA 3ZIWA 4DXRA 3EHKA 3VBOA 1PGL2 2VOWA 1R093 4D7SA 5A7OA 4HXCA 4AOCA 1IG0A 1RUC1 4OHWA 4Y26A 3RQ0A 5ACA1 1HRI3 1TME1 3VBUC 1OVSA 2JIGA 2V4AA 1FMD2 4QPGC 4ZU5A 2V5YA 2MEV2 3B01A 1QJU2 2IXJA 3OD4A 3WQ1A 3KD4A 2WZR1 3WNOA 3ACLA 2Q8CA 1ULPA 2HWC3 1P8JA 5T52A 5EP9A 2BBAA 2VW0A 1GFF2 4CDXB 3O1UA 4BQ4A 2ADDA 2OVUA 3OUIA 2OQ7A 3H1MA 1R081 3CLPA 3TEZA 2P5BA 3ENRA 5KHGA 4IV1C 1PVC1 5JZGB 2ORXA 5CB7A 1ULEA 3CJIA 2BGCA 1N3PA 2CHHA 2GN7A 5ERLA 1YIPA 4LUKA 3AP5A 4FPFA 3T0BA 1F35A 2FHRA 4PIYA 2X05A 3P3NA 5FPXA 2Y26A 1G8WA 3TN93 4FSJA 3ZFEA 4TWTA 4XBNA 3HT2A 1FMD1 1AYN2 4AE2A 4FPOB 3VD7A 2MEV1 4QDRA 3UETA 4B4RA 5F8PA 4XF0A 3ES1A 5GM0A 4DUXA 2WNUA 5JLVA 2R061 1NCQB 2VOKA 5C9AB 5BNOB 2VBDA 4TLFA 3KGZA 3OOXA 2HEVF 1VBE2 4H14A 4AEDC 5CFDB 4CDQA 5FZEA 1W8FA 2WQ8A 2XR4A 2ZTNA 3AP6A 2E9QA 1R1A3 1US3A 2CWMA 3POSA 4LKFA 4XPVA 3IDBB 1QJEA 3A21A 2Y0OA 3ROUA 3ZSJA 4WM8C 3IWZA 1UIKA 1LOEA 4Q0QA 2VCAA 3ZX7A 3M3CA 4EWDA 2XJUA 1Q56A 5FP9A 2D6NA 4BPZA 3K77A 1ND3C 1W6PB 3I4IA 1OH4A 3U1XA 4ZZ5A 2EICA 1UYZA 2RS33 5GZEA 3U4SA 5FP4A 3HAGA 4NR1A 2WWJA 1V70A 4MADA 1NXD1 1T2XA 3HVDA 1DDLA 1YRZA 1J1LA 1DZQA 2XBO2 2XVKA 3CQOA 4P9YA 5H9QA 4EE2A 1EAH3 5FYMA 1L7QA 4RR3C 1CAWB 4ONUA 4CDXA 4UFJA 3SQOA 2FDIA 1VBE1 3MO4A 4D94A 4YWAA 5I0UA 3CHXA 3J7NA 4QQ2A 4KGQA 2JX9A 4D7TA 5EXOA 1WKYA 3TYJA 1TEIA 5JZGA 2DV9A 5C3QA 3RZLA 4IERA 2XPJA 1OFSA 2X8KA 3AXDA 1UW8A 3B9IA 2JJ6A 5LBCA 4A44A 1WMFA 5A3TA 1A78A 4K8RB 3FFQA 5B2GB 2D7FA 1CGPA 4W50A 1UU5A 2VXJA 3RSJA 4AGVA 3SEPA 1XBFA 2EIEA 2DUOA 2RR13 4COUA 3P3PA 4D6SA 1AR92 3H8RA 4Q0UA 3AKRA 3IMMA 2GZWA 1ASJ3 2X53S 3U78A 3LF7A 3C8XA 5CIRA 1RUG3 2XBO1 5T55A 3EQEA 3I2KA 4FPYA 1W8ZA 2B8MA 3KGLA 2BJSA 1NCQA 3B02A 5C9AA 3KHCA 5BNOA 3KS7A 4LBLA 3VKMA 2TUNA 4NIHA 1OPMA 2ID4A 4JGYC 1BBT3 4QXBA 2VTXA 3EB7A 5CFDA 2RV9A 3DKWA 4K8FA 2W95A 5EQUA 2XJPA 2FDFA 3VDAA 4BXFA 4UFHA 4R9CA 4XHBA 5KXEA 2JKBA 2XUMA 2VZOA 3AFKA 1O91A 5JOWA 3SKJE 2GMMA 3ZVXA 1AHSA 4CU9A 2B7YA 3B9CA 3JZVA 4XJ9A 2A6YA 4FOYA 4D0QA 1W6PA 2WAAA 5HCBA 1H0BA 1QXPA 4W65A 1YQ6A 2UU8A 3WD5A 5LK7B 1AR91 5F6KA 2A7AA 3Q8EA 4U36A 1J3PA 4QDQA 3LDKA 3LKJA 1C5IA 4H7MA 5LATA 4ZZ8A 1LOFC 2P1BA 4WZCA 4UFLA 1DQ0A 1DQ1A 4P14A 1CAWA 2V72A 4P9GA 2VC9A 5DZGA 5FY8A 4BMBA 4TLGA 4AEJA 4AHZA 4HVRA 3N9OA 4UYBA 2JDZA 3JB8A 2RS13 3VBSB 4QQPA 2ZX4A 2J1RA 4NWWA 3VBRB 4BWOA 2W52A 3ZYGA 4CUCA 5BNNB 5A1FA 2QUOA 4LHNA 1XNTA 3CF6E 4IDZA 1G9AA 1KFXL 1RL3A 3J7LA 5A80A 4YGDA 2WA4A 1POV3 1EPZA 1AL0G 2W94A 4OMDA 2J1EA 5A7WB 5JVVA 1U5XA 2V5DA 5DXDA 3I2OA 4N43C 5L9RA 2NN8A 5JSOA 3D8CA 5JR7B 1GMMA 1PX3A 4IEZA 4YZ3A 3AP4A 1LGCA 1W0NA 1DP0A 5IVYA 2RHPA 4FAHA 5LA1A 2YC2A 3FMGA 1RTVA 5C8CC 5F3EA 5CG9A 3LA7A 4UFIA 1QJZA 4CA9A 3LFIA 4NVPA 4BHPA 4ZKTB 1POV0 1X9TA 3BIWE 2WR9A 1QNYA 3L2HA 4AI8A 2G4IA 4Q8LA 4QQLA 5G04L 2JDKA 3GZEA 1GOGA 4MGIE 3QOPA 3WNNA 4DQAA 1GICA 3WINE 1OLME 3HBZA 3M7AA 4XCBA 1NCRB 5GZDA 2WFF3 5DAPA 2KA3A 3ECQA 1CZTA 4IEVA 1Q8SA 3VD4A 1O4ZA 5E16A 3N9QA 2FCUA 2OZ6A 1VBB3 2RJKA 1JYWA 2ZPXA 4FFIA 1LKNA 1RUH1 2XH6A 4GWNA 5LB6A 1JTZX 5A7SA 3SHRA 4LXLA 1OOPB 1JOJA 1XE8A 2Q1MA 3GBGA 3ZDVA 4NE9A 3VDCA 1RJ7A 3GZTB 3ZYRA 4FOWA 3AMQA 4KL1A 4Q0VA 3WLUA 1MVQA 4LO8A 4I3PA 4Z2WA 5JR2A 5JXHA 3H8XA 3GYDA 1UPSA 4UI9L 5BPXA 3TNQA 3EO6A 4GKXA 4M3CF 4Q8KA 2PN5A 1SACA 4LIVA 3VBSA 3ILFA 2ZX3A 5BNNA 1C4RA 4XFGA 3VBRA 1QWRA 4NIAA 1S0JA 2HBUA 5AFBA 1Z0HA 2P6CA 4DRRA 3CIHA 3EMRA 5I8SA 1LU2A 4XTMA 2XKPA 3IB3A 4Y1VA 1AJKA 2VMCA 2EAKA 5T50A 3WUCA 1QOOA 3SH3A 4CDWB 4YARA 5IFPA 5A7WA 1V6IA 2F4PA 4Z82A 1R1ZA 4YVWC 2ZX0A 3T2PA 2C5DA 4V1PA 5IK7A 2WO2A 3VKNA 1A6CA 5A3NA 1W8WA 1WCKA 4O61A 4CP2A 4XFAA 2P2KA 3ILNA 3HR9A 2O14A 4RS5B 1YEWA 4HOOA 1AR82 4YM1A 4J1XA 4I30A 1RGSA 3CO2A 5L9VA 2WJSA 4XUOA 4AVVA 3NJVA 5J3UA 3HD8B 4AGRA 1Q8QA 2KXLA 3VN4A 3WNPA 1NCRA 1KXGA 1GZWB 1UIJA 3KMHA 2YU1A 5AC93 3HQXA 4NMIA 1IS6A 3UJOA 5IFTA 4HZFA 3T1MA 5HPOA 2BNNA 3I8TA 1AX2A 4XUNA 5FZOB 5CAZA 3LDRA 3PJQA 3FJSA 3SXWA 1SBFA 2D3RA 3ZXAC 2JB4A 3LOIA 1O4TA 2B42B 5E88A 1OOPA 5FYHA 5TSWA 5T5LA 1SEFA 5FZIA 2GC3A 4ES9A 3P6BA 2E31A 2CAUA 1NT0A 3S7EA 2CGPA 3JB4C 4Z2AA 3RVHA 4OUEA 1CAUB 1PZ8A 2VNGA 1AR81 1ST8A 2JG8C 2VMIA 2LW8A 5EFUA 4EZ4A 1XOYA 3R4SA 5DUWA 4YW1A 5L9BA 5F1RA 4F83A 1CESA 3H3ZA 3GZUC 5AVPA 4BYYA 4QWNA 5GZFA 5JOYA 2YPJA 5A3UA 5FY9A 1Q8VA 3H7YA 4Q29A 2WABA 3AC0A 3PIJA 4RGKA 4GMP3 3ACGA 2IFWA 4A7ZA 5BNPB 1YJKA 2CV6A 2DCKA 4AI1A 3K51A 3UNPA 1WA6X 4C91A 1UL9A 4LUMA 5FKCA 1FX5A 4CDWA 1CR7A 4BQ3A 2QQMA 2ZGTA 1BHGA 1DZRA 2W2IA 3DPRB 2HJIA 3VD5A 1OT5A 4XOGA 3WDYA 5A1AA 4XF9A 3JBG2 1F4HA 3N3HA 1JN2P 1Q5OA 4M4RA 2WUHA 2Q5TA 1H9PA 3MIFA 1PMIA 3ZYHA 2BOJA 2E53A 4NPMA 3ETQA 4CU8A 2CWSA 2ZGUA 4FPGA 4M3CB 1RUNA 3OBZA 4RS5A 2E63A 2DYCA 4GMP0 2HH9A 3J8F3 2XB6C 2ENRA 4YM0A 2ZGKA 5FMDA 4JDOA 5JOZA 2PYTA 1W3XA 2OX0A 2XL7A 3ATGA 5F5AA 3WG1A 3K3OA 2EIBA 4NJ4A 4QHZA 5IAVA 4AI9A 5FOBB 4OHVA 1OA4A 3BI3A 4MH0E 4HN0A 1SHWB 2ZEYA 4Q5OA 1KDKA 1GZWA 2D6OX 3WP5A 4P5YA 3WP3A 3K4AA 3JD73 1JBCA 3FHIB 4GJZA 4YW5A 3PURA 4JAAA 1VBD1 5FZOA 1GNYA 2P3YA 1X9PA 4P9WA 2H6BA 5F2WA 3BTYA 3JBG1 5JCTA 4ZU4A 3SC7X 2RM22 1W0PA 5FY5A 4MGYE 3PLQA 2CDOA 3FUQA 2VGDA 1AL23 3E97A 2PXJA 1CAUA 1ZA7A 1HQNA 4AQ6A 1ZYBA 5FBJA 4ZPIA 5C3PA 4GKYA 2A5ZA 5FMOL 1MR5A 1TZOA 3IAQA 2RVAA 3F2ZA 3KV5A 2WO3A 5FO7B 5LBEA 5IVJA 3N35A 4CVUA 2ZBJA 1HKDA 2PTMA 4BQYA 3HOBA 3S7IA 5E89A 2HWF3 2IFRA 3RG0A 1FV2A 4RGGA 5BNPA 1AX0A 2RMU3 3TBDA 4HVQA 1UKRA 4L0PA 1ULCA 1ZRIA 5ANNA 2VW2A 2W92A 1PZ7A 1HJGA 3U75A 1AR63 3THDA 2XLAA 2AEYA 2E7TA 2QE3A 3DPRA 5ANQA 1O3QA 2Z2SB 2VUAA 2DURA 4PF5A 3WQ0A 3WSOA 3T2TA 4CP9B 4N7IA 4QPGB 5DDJ3 1XNKA 4M3CA 1QJX2 3PVOA 2ZGNA 5CZKA 5IHRA 3EBRA 3KF5A 4EQVA 1F5JA 3I97A 1WBLA 2WKKA 3I3MA 4B1MA 4OHXA 4XEZA 3FX3A 5JDBA 1M06G 4KWLA 2VM9A 3C7HA 4E2SA 1GQHA 4CCLA 5KHKA 5F32A 2Y0IA 4C1WA 5A3PA 5DG2A 5APAA 4IEUA 3QLQA 4BB3A 2ETEA 4QPIC 4FQZA 5D8AB 3NNJA 5CNAA 2PQQA 3O0XA 1IS3A 1RUC3 4H7LA 1W2OA 2OT7A 4IEPA 2YGLA 4N7UA 1EV12 1IQAA 4PDWC 1TME3 5ACA3 4KGGA 1BEV2 1S0BA 4EN6B 4JKMA 2QQUA 1XSQA 2B5HA 2E33A 5ABJC 5A70A 3INAA 1UU6A 3RZKA 2WZR3 5GLZA 2JEMA 1JZ6A 2I07B 2D6KA 1W8OA 1FPN2 3W5NA 4CP0A 2FMDA 2ZEXA 4QQHA 2LROA 5K7PA 1R083 1OI6A 4HETA 4N53C 4ASKA 5KC6A 2BGOA 2WC2A 3TAYA 2R1BA 1ZBA2 2GNBA 1PVC3 4YW4A 3GJAA 1UOJA 3WT3A 1VMFA 4QDSA 4HMZA 1KFUL 3C7EA 3LIHA 1IZ3A 4XXAA 4A7KA 4W6WA 1S55A 1K42A 2K9ZA 1EV11 1N3QA 2ES3A 1BEV1 2ZHLA 2QQWA 4A2UA 1HDKA 2WWUA 5FYUA 1FMD3 2Z4FA 2YC0A 1LULA 2MEV3 1QJU3 1US2A 2YUEA 4CP9A 5J96B 4QPGA 1QNWA 1KJRA 1V6NA 4I3GA 5FMCA 1W06A 2R063 2XMLA 2TBVA 4CEYC 4AQ2A 3M3IA 1UYPA 3C7GA 3WF2A 1XPWA 1ULGA 1OLRA 1IKPA 2NLRA 5EZWA 5BV6A 4JGZB 4WVWA 4S2HA 1ZBA1 2H0VA 4DINB 4LITA 2ORZA 4OUMA 1UKGA 5A6QA 4R9AA 3FZ3A 3VBFC 4DB5A 1HV0A 5IK5A 3RZJA 3JQWA 4WVVA 2Y6LA 1XYPA 3R0RA 5D8AA 1EY2A 1UOBA 5C3RA 2X5IC 3K3NA 2Y8KA 3UKVA 1VALA 2QVSB 4RHV2 4BJ0A 3FL7A 3NSTA 4XDOA 2J1AA 3T1LA 3Q8FA 4ZONA 5JAXA 1MQTB 2BBVA 3S5AA 4XJZA 4NRMA 4FPKA 4IV3C 4DY5A 1A8DA 1WCUA 3ZSMA 4MGTA 4SBVA 1AVBA 3VBHB 5A6XA 1Q3EA 2WZPP 3ZFFC 1OA2A 2WA3A 1MEC1 5FTTC 3MFCA 1LB2A 1VBE3 4QKDA 4Y1ZA 1LOBA 4GB32 2JXAA 3GCXA 4EN8B 5SV5A 1BQPA 4PBOA 1DU3D 4XAEA 1W99A 1EYBA 3I54A 1PIV2 4NROA 4OI2A 1IPSA 1RIRA 1BK0A 1KS5A 1F5FA 2QQKA 2ZXQA 3ZSKA 1IOAA 4HG6B 4QKBA 3RPQA 1PO12 4L99A 3R6SA 4ZXEA 4RHV1 2GC1A 4ZS2A 4YM3A 3NAPB 2ZX2A 3VD3A 2VVDA 2XVGA 3KHBA 3N4MA 4Q4W1 4Y1YA 1RXGA 1H1AA 2XBO3 2V09A 4KWKA 4MX3A 1S0CA 4XW3A 4LULA 3W21A 5F5IA 1MS9A 2OUHA 2AGSA 2HWB2 3IAPA 5IJRA 2W1SA 3BOWA 4QB1A 2XJQA 3HMYA 5A3WA 3QBQA 1WLDA 2VQAA 1WWYA 3WP6A 3BVCA 3ETPA 4L9BA 4P5HA 5FPZA 4JGZA 1XU1A 2JIJA 4MZUA 4Q1RA 1MS3A 2PFWA 4QPYA 4AFCA 1TMF2 1PIV1 3RWKX 4X8PA 5CFCC 4MSVA 1UO9A 3NJZA 2BRTA 4FI9A 4XFFA 4GWMA 1DGLA 5FPVA 4GH4B 3T0AA 3VZNA 1DFQA 2D3SA 4L11A 5I93A 2A71A 2PELA 4AFMA 1GNHA 1AR93 2A3WA 5DZFA 1GZ9A 5CBLA 5K0UC 2ZJCA 1JYNA 5I8YA 2F17A 5I0RA 1MQTA 4RSUA 5KR7A 5CG8A 3UGFA 4XFHA 1ULOA 4OUSA 5D1IA 2UURA 3J26N 3ZYIB 2HWB1 3ZXJA 5KXDA 3VBHA 3UT0A 3FFZA 2D43A 1RUE2 1AR72 1HRV2 5F5CA 3UJQA 2RE9A 3WVJA 5BYNA 3O0VA 2R072 1W28A 5IK4A 1O8PA 3OJBA 2RDRA 1WBFA 3ZFGC 5M0TA 1IS4A 4OFGA 2YU2A 1YCIA 2I2SA 2QQIA 4HT1T 4OVEA 1CAXB 2XG3A 3HWJA 3WHTA 5C7GA 1O8SA 2VNVA 2PLV2 2K46A 5FXXA 2XQRA 4Y1UA 4K1ZA 4A3ZA 1ZBE2 3A0KA 2K0GA 1E5RA 2RS52 3H8OA 3NAPA 1YYNA 4TSVA 1W90A 1W9SA 1S2EA 2BYVE 2NQYA 4XETA 4XABA 3SKVA 3H1YA 3DF0A 3J4UH 3B93A 4ET7A 1DQ6A 1KDMA 3VV1A 3WDTA 3C7FA 3U4XA 1IHMA 1ENSA 1V9U2 3WW1A 1RUE1 1AR71 1JHJA 3IPVB 1FOD2 4JQRA 4UOJA 5FYSA 2AZ5A 4LO7A 1UXXX 4FVVA 1G7YA 1QDOA 4W8JA 5KXCA 4D3WA 1UNBA 5BXXA 5DDJ1 4LBOA 1DGWX 3BTZA 4Y33A 1RB8G 1XRUA 1CVNA 2A73B 1X7NA 2GC0A 5LA9A 3THPA 4NAMA 2FCTA 4GH4A 3BCWA 2EA7A 1QU0A 1TVGA 2PHTA 2EXHA 2YBSA 1ZBE1 2WQ4A 2QQVA 4COVA 3E6CC 1V6MA 4M0NA 2FDGA 3PDQA 1RUH3 2IXKA 2R49A 4META 3ZYFA 3E5XA 1UZVA 5LASA 1W2NA 5FZFA 1V9U1 2WAOA 5A3OA 3RJRA 3RYRA 4M00A 1FOD1 3VZOA 2P3KA 4JZRA 3ACFA 4AVTA 2DUQA 3WHUA 2DU1A 2UYBA 1OMIA 4AVCA 5C6CA 3KSCA 1C8M2 5KHHA 3PUQA 4ARYA 1NAEA 5HXVA 1RUF2 2EXKA 5A32B 3RRDA 1U5ZA 1CAXA 2OKXA 2YGMA 1SLLA 1CD3G 4L97A 3NNMA 1GLHA 4DOUA 2OA2A 4DEQA 4G9SB 3D0SA 1XE0A 2DVAA 3ITQA 5FMOS 4A6SA 1WW4A 4Y4YA 4IESA 1NXMA 1PGL1 4IE7A 3PNAA 3T08A 4NHXA 5FY0A 5IAXA 3VKLA 1K5MB 1ENXA 2WT1A 4XFIA 2WT2A 1G9DA 5DQ0A 3NL1A 4C8DA 2FMYA 1URXA 3IPVA 1L7LA 3T2QA 4Q27A 2E51A 3LPGA 4LJHA 2XXZA 4LT5A 1QJU1 1UZ0A 4Y5TA 2XGXA 3OPZA 2DTWA 1YQCA 1C8M1 4CCCA 2SBAA 1IKQA 4ISRA 3GHMA 1NA1B 2V73A 5GKAC 4IE6A 4QX8A 1PHMA 3I3BA 1HN1A 1AF9A 2GNTA 5JXJA 2RJ2A 2E7AA 2ZACA 4XZPA 3ZKYA 3POFA 5K8SA 2DVFA 1NY72 2PHWA 4LLFA 3RZMA 5FZLA 1W03A 2ZMKA 1SDWA 1DQ2A 1W2AX 5FUIA 3TEYA 4YVSC 3I3QA 3O0WA 2KD7A 4LOSA 2FZ2A 2W5FA 1WD4A 2D44A 1B09A 2YV8A 2ZHKA 4GZ9A 4LKEA 4JC1A 1QF3A 3BYWA 4JDMA 4E2GA 2IUWA 4YNIA 1AYN1 1AR83 5LEKA 3WQBA 2VL4A 2ILMA 5FY1A 2XKOA 3AYCA 3GXUA 2FDJA 2DF7A 3D4KA 3DYPA 2NP0A 1REDA 1NLQA 2LM3A 5FYIA 5FZCA 1OLMA 5A32A 5HI0A 1FI2A 3KT1A 2OZJA 5FFOC 1W2UA 1SQ4A 2XWJB 2GNDA 3PMSA 2O8QA 4K9SA 2RDSA 4GA9A 4KI5M 4QMAA 3POEA 3WDUA 3MGUA 3GBWA 3P1IA 4CUBA 2WWSA 2D6LX 3WV6A 1K5MA 1G6NA 2W9XA 2XL9A 2JB8A 2VZUA 3AMPA 2YG0A 1VRH2 1SLIA 1J3RA 4NPRA 4UFKA 5JPMB 3C2UA 4CDUB 2IXIA 3CNAA 1IPKA 5FQ0B 2BDRA 5F5QA 1LU1A 1YUDA 4C0BA 1VBA2 2O8OA 2VUDA 2VCCA 3PVEA 4Q4Y2 1A8MA 1VMJA 4DRVA 1CZVA 1NA1A 2XLFA 4PI0A 5F39A 2JDAA 1LTEA 4YYOA 4XQWA 5C5UA 3LZZA 3E6BA 3FE5A 4KWUA 1RJ8A 4I0WB 3KCXA 2GN3A 4NHLA 4IEQA 1K12A 5L7OB 3PMEA 1VBD3 1BZWA 3AX4A 2FZ1A 2ET1A 1QQP2 4RN5A 4QXCA 3JBG3 4CEWC 3E5QA 1D0GA 5FREA 1UQXA 3ZYJB 1UMHA 2VW1A 2SLIA 1POQA 1VRH1 3LD8A 5HCHA 1A3KA 1JMUB 3ZMOA 2YB7A 3BKZA 4LK7A 4FXKB 3AYEA 3O12A 4IE5A 1O3TA 5KHJA 4YZ2A 2VQ0A 3S6PA 3CZUA 1B35B 1JU4A 3IMNA 4AEKA 2J7MA 3KCYA 3HQRA 4RQPB 1TE1B 1GWLA 4QB6A 2FQPA 2IVIB 3DXTA 3MIHA 2CDPA 2Y38A 3R4DB 2YROA 4DXZA 4HVOA 1SBEA 3CKHA 1JHNA 4NUBA 1LHWA 5FWJA 3AYAA 3O5SA 1BMV2 2WT0A 2VZSA 2CNAA 4IGOA 2K2SA 2BERA 4MOAA 4URAA 1NQJA 4YG3A 1ONAA 2PHFA 1XXNA 3VHOA 1BJQA 1OQEA 1UWWA 3K4DA 1U12A 4BU2A 4ZU7A 3WEZA 3I2JA 3CMGA 5T5PA 5HV0A 3OF1A 1SFPA 5FP3A 5HXMA 4GJYA 1O4YA 1W0OA 1JS9A 1F9KA 4IUGA 4AAPA 3RDIA 4CDUA 2WS92 1O3RA 5FQ0A 3VHRA 4U2AA 4OQ8A 1RC6A 1MACA 1VIWB 1J1TA 3KLSA 1Y4WA 4OCTA 3K75B 3IBMA 3AB0A 1JYTA 5DUVA 1YIFA 2QQPA 1DLLA 1FATA 1XSRA 1ND2C 5F2SA 3UGGA 2WO7A 1BMV1 1UY2A 4QPWA 5L7OA 3LEIA 3WZ1A 4AFAA 3WY6A 3VBOC 4AI2A 5H9SA 2QQJA 1UOFA 1WMEA 3N36A 3IZOA 3WOGA 1DYOA 4CU6A 4UT5A 2PAKA 1GU3A 1UY1A 2VBBA 2C6SA 4MXVA 2W87A 2BV4A 1VBC2 2ATFA 2JDYA 1HRI2 3B5LB 2F4LA 2VMEA 2WS91 4QX3A 1DGRN 2Q0AA 5FYVA 2VQUA 4ATEA 4Z1VA 3WNLA 2JE8A 4DS0A 1NZIA 1B35A 1TQ5A 4BQ5A 5BUVA 1DZTA 2MHFA 4FFGA 3A23A 4XJUA 4MLOA 4RQPA 4ZXKA 2FCVA 3HNBM 4CXXA 3H50A 1N1SA 3BALA 4FPEA 1WMDA 1OKQA 2P37A 1W05A 5H9RA 3AZVA 1NOVA 4XBQA 2GP5A 3SCHA 5FZHA 3T2OA 1W9TA 3FN9A 2PHUA 5CYYA 1EV13 4DMIA 1JZ2A 3ZOIA 1BEV3 3AP7A 3CJIC 1WCDJ 2YY1A 1FAYA 1HB3A 2CSGA 5FMBA 1CPNA 2RDQA 3H3LA 2Y6JA 1SMVA 1DGRA 1YO8A 4ZS3A 5J37A 1QMJA 1QXJA 5CA6A 4Z92B 4FBFA 2WSUA 2W39A 3BB6A 5FDBA 3TN92 3H7JA 3GJBA 1UMZA 1OD5A 1H8TC 4XUPA 1Y7BA 2WNUC 4BLIA 1T6BX 1ZBA3 3LDBA 3LWCA 4I02A 1PGW2 4J25A 3W59A 3W9AA 1Z78A 4LBNA 1W8HA 2VNOA 2W47A 4QX5A 2GP3A 2ARXA 1WCSA 3BOPA 2P17A 4FPCA 3OG2A 5FZ3A 5GALA 4CDQC 5HCAA 3HBKA 3RFRA 5IVVA 4D7YA 3BU7A 2ZZQA 3VGIA 3KVBA 1PX4A 4FPLA 3SMHA 3V0AB 3LIGA 4R52A 3WQ7A 4JRAA 5JXGA 1LHNA 4LKSA 1R1A2 2VQTA 4BK5A 2QJVA 4E8CA 2IXHA 1BKZA 3AKQA 4JHTA 2KR2A 4MGKE 3TB0A 1HJFA 3RZGA 3T0DA 1UU4A 3WDVA 1NKGA 4R9BA 1OFNA 2ZGQA 3AM2A 5LRRA 1HX6A 3VDDB 3AZYA 3MUY1 3ZR6A 3AP9A 2BVBA 4E4ZA 1MEC3 3W5MA 3OEBA 1OH3A 5A7QA 1GANA 4TZDA 1I5PA 5LCWL 2CY6A 3BN6A 1PGW1 5FZ0A 3VKFC 2YXSA 5KC5A 4CDXC 2D97A 4DO0A 2BQPA 2VNRA 3MW4A 3JCIA 4P08A 5C4WB 2UY9A 4G3YC 2HEWF 2CU5A 3OY8B 4LPLA 2YDEA 3KM5A 3L2YA 4H55A 5JZGC 5J36A 4XHXA 4RHV3 2VUJA 4COYA 4ES8A 1VRBA 2XDVA 1ENRA 3MI8A 3UV9A 1UZWA 3KV9A 1EP0A 5A6YA 3DGTA 2JENA 1XYOA 3PL0A 4LEJA 4O9GA 3WW4A 4Q4W3 1K5JA 5F3IA 1I9RA 3WNKA 3BTAA 2EVXA 5F3CA 4JDNA 1UX7A 2JE9A 2RR12 5DAQA 2C9AA 1XU2A 1UZZA 4BISA 5GZGA 1PK6B 1NCQC 1ASJ2 1V6LA 5FY7A 3ORJA 5C9AC 1PIV3 5BNOC 1ODMA 3BGAA 4P9XA 5EWSA 3O1SA 1PO22 5F6LB 4XMIA 1V0AA 1SLAA 5FLIA 3WG4A 2NMNA 4S2GA 1S0EA 5CFDC 3UK9A 3WDWA 4I09A 5HCFA 3OB8A 1QKQA 2BFUL 1W9YA 4IW3A 3V0AA 1LGNA 5C3OA 2ZAAA 1QEXA 3MFAA 3NNGA 1F8VA 2Z69A 3H42B 4XUQA 4JQTA 1H4GA 4FT8A 4CUAA 4CXWA 1UY0A 4MGQA 4EWAA 5C70A 3AMHA 1VAMA 1VAKA 4LO5B 5GLVA 1DG6A 1JODA 3VZMA 5L36A 3AKTA 4N90A 1KITA 5CEHA 2HWB3 4P9LA 1OPOA 3VDDA 5F7UA 3ACIA 2NYYA 3R4UA 4DPNA 3O7OA 4Y5Z0 1O3SA 1BYHA 3MPPG 5E6HA 2OQ6A 3NNLA 4CYDA 4MGZE 4B7EA 2QFEA 3VB9A 1I6XA 3DL3A 1ZRCA 2R30A 4UBGA 5FZMA 2Y6GA 3IIIA 1WD3A 4HKWA 4SLIA 4CTEA 1ZVFA 3GZAA 3DXUA 3PVBB 2JG9B 4YW7A 2NMOA 1OA3A 5C4WA 5FZAA 4N9HA 3ZXKA 2OYZA 4NN0A 1W39A 3OY8A 1PNGA 2C1FA 1OF4A 2IZWA 2RS12 4IXLA 1O7FA 2Q8DA 2QDNA 3VL8A 4YSFA 2WNVB 1MVEA 2BEOA 4PI2A 4A45A 4B4PA 2R32A 4FOQA 3I2IA 2R16A 2VO5A 1M4WA 4WM7B 3THTA 1OUSA 3POIA 5IVFA 2FDHA 3IIAA 2EF6A 2ZS6B 1RUE3 1AR73 1HRV3 3QH7A 3WF3A 1NQDA 2KM2A 2ZHNA 3AXEA 2RM21 3M2MA 3VBUB 4HBNA 2PAEA 1GP4A 1C57A 3FBMA 3SH4A 1ULFA 2X09A 4CCDA 3WG3A 5JSRA 1PK6A 1I1EA 4BQWA 3USSA 4XF1A 3AFGA 5BNQA 1MS0A 1ZM1A 1ZNPA 2Q1FA 1EUTA 2BGPA 3KVAA 3NV2A 5DZEA 2ZGOA 1F15A 4RD7A 4Y3OA 2G9FA 1ZBE3 4KG8A 5A3LA 5T54A 1UAIA 4PQQA 4AYUA 1TNRA 2NZ9A 4LIUA 4IV1B 1MPXA 1Z7S2 1ALYA 2ZGRA 4HKOA 4XF4A 3TEXA 1SZBA 3AKSA 3I3DA 5I8TA 1AYM2 1HIXA 3ZM8A 5FUPA 2EIDA 5FP7A 1V9U3 2E26A 1X36A 2X10A 4AHWA 1DQ4A 1FOD3 5BY5A 2PHDA 1JYXA 1CWPA 4CCJA 5FY4A 1ACCA 1J84A 4PF1A 5A6ZA 3GNEA 3LEKA 3ACHA 3BTXA 3MBWA 2GMPA 1RUI2 1QJX1 3J9SA 5LA2A 2IWGB 5FZ8A 3S57A 2JG9A 2VZ1A 1D0HA 1MZ5A 3VBSC 2WNOA 5BNNC 3VBRC 2CYFA 2WDBA 3O1PA 2WRAA 4RA0A 3KZ4C 5CKMA 1SPPB 1OLQA 2GNMA 1QH6A 2ZHMA 2XVLA 3DEMA 1VB2A 4AEDB 2GH2A 5A33B 2BNOA 2WNVA 4YFZA 3OPTA 1JH5A 1Z7S1 2XQXA 4WZFA 1APNA 4AEMA 3LGRA 1BVP1 4WM7A 2DCJA 1AYM1 4FFFA 4MO3M 4WM8B 3GGLA 3D5OA 3KQ4B 1W8NA 3I2FA 3NV4A 4GQ7A 2VR4A 1PGSA 3S30A 2G19A 1ND3B 4QX1A 3T4VA 2XJVA 3VBUA 4YGCA 1GQGA 4XXPA 3ME2A 3WXPA 4AVAA 2JKXA 1RUI1 3K2OA 4LHLA 4NOTA 2AEZA 1C8M3 2J1VA 1J59A 3V65A 2VTFA 2DVBA 3V56A 5EHDA 1RUF3 1LENA 1HB2A 1Q8PA 4JX0A 5DAVA 4XMAA 1FPN1 3U10A 1RVF2 3NNFA 1WLCA 5FPLA 1EPWA 3WW3A 4RR3B 2B9VA 2QCSB 3NJXA 3ST7A 2ET7A 1IQDC 2A3XA 3IT8A 4D8MA 1CX1A 3DKQA 2NM1A 5EJ3A 3KCCA 2W1UA 4JHZA 3QACA 1NCRC 2CAVA 2Q4SA 5KBFA 2DBNA 2VBPA 5FLJA 1S2BA 4IV1A 2MPFA 2W68A 4FP2A 2ARBA 4IGQA 3OBAA 2AUYA 4NHMA 3WF4A 5FOJB 1H9WA 5JI9A 2A3YA 4CU7A 5FWEA 5AC92 2AYHA 1AYN3 2PHRA 1V6JA 1OOPC 1QJY2 4K7JA 4K1YA 4BH9A 4LHKA 4L92A 5DG1A 4OI1A 4FOVA 2VU9A 3OTFA 2ZGPA 1RVF1 5I0TA 1LHVA 1WMXA 4INDA 4I01A 4LA3A 1C8NA 3QD6A 4UAPA 4XJWA 1O6UA 1VJ2A 2AC1A 4EN7B 3RZHA 2XONA 4BQ2A 1DYKA 2WNEA 2J42A 4LHSA 3H0OA 1ZA4A 1SPPA 3ES4A 4JGYB 5LK5A 4PT6A 4AEDA 4Q4X2 1LHUA 1REEA 4UXAA 4UW5A 5A33A 3PIGA 1AXZA 4XVHA 3M70A 5JUVA 3IDAA 4CDWC 2LRPA 4BLJA 4XTPA 1YWKA 3AVRA 2UWBA 4DIQA 4WM8A 2QZ3A 1RITA 4OZXA 1ENQA 1QOSA 1I5ZA 1LESA 3FBYA 1ND3A 4RL7A 1QJY1 3A7QA 1D4VB 1ZX5A 1ZZCA 3H8UA 2FBEA 2EALA 3ZN5A 2OUJA 3OGGA 3HIFA 4CCKA 4NIGA 4RS5C 3U07A 1PMHX 1CJPA 2UY8A 3MLKA 5LRSA 2R042 4BIFA 2GMEA 3GDBA 4PJYA 4S2DA 4GB31 5LY1A 4RR3A 4HONA 4FTEA 5A7PA 2ZMNA 2YBPA 1LECA 2VJXA 1YQ8A 2OS2A 2MNGA 1KGYA 3WR0A 5IT6A 4Q4X1 5A3MA 5IVEA 4LORA 5IATA 3HNMA 4ASLA 3O1TA 1S0IA 1JYIA 5DABA 1SDDB 1PO11 4YRDA 3WG2A 1D4M2 1N1VA 3D0JA 1VRH3 2J1SA 4IQPA 3N7KA 5FYBA 3T30A 4F3JA 1ZRDA 4P02B 1TNFA 1XYNA 3CU7A 3WUDA 4XC9A 3MZHA 4UWDA 3RI9A 2W91A 4TN7A 3RI8A 4N43B 3U11A 3POYA 4RFT0 3T4HB 2JICA 1L7RA 1YFXA 4YZ5A 2YFZA 4PLNA 1FNYA 3WF1A 2WBKA 1OKOA 2WIIB 2R041 4RGAA 3URFA 2BNMA 3OYWB 5T5JA 3RYKA 5C8WA 5I0SA 5C8CB 1G86A 3GBFA 1I3HA 2Q1ZB 5FXVA 4AL9A 3KWVA 2AH2A 4C1XA 1YI9A 3ZXFA 4LMFA 1TMF1 4JGYA 2AACA 2VPVA 4UW3A 3JUUA 3GHNA 4BZ4A 5BNPC 2DVDA 1Y9MA 2HWF2 1S1AA 1SFYA 4Z07A 1L3JA 2W1QA 4XIKA 1D4M1 3PU3A 2RMU2 1SG3A 1XE7A 3DPRC 4YZ4A 5JIUA 3OD0A 4KBZA 3NRUA 3W20A 4F8AA 1RMU2 3I2DA 2AENA 2GH8A 4XFCA 1H6XA 2AR6A 4LKDA 3RWNA 1XQNA 5JI7A 1ZZ7A 3FC0A 4MVTA 2B46X 3Q8BA 1SBDA 1MZ6A 1OD3A 4AHXA 2QQLA 4MYEA 4QT6A 2VZVA 1YHFA 4J1WA 4CPBA 1HRV1 4LO6B 1WGPA 1LOFA 4XFBA 4YW2A 5L19A 3OEAA 3DUIA 3X29B 2R071 1MZFA 5EIYB 2I45A 4CCEA 3HEIA 2A6VA 1LOAA 1HLCA 4QX2A 4B7KA 1PVXA 3VZLA 4K3UA 3LEMA 1XNDA 1HXS2 5IUQA 1RUJ2 4NIIA 4QXHA 1NX9A 1J3QA 2PLV1 1AX1A 3TWIA 1HN0A 4LBJA 5DN2A 4K20A 1LEDA 2R6QA 2W08A 2YYOA 4B1LA 5C5TA 2RS51 3WP4A 1OC1A 1TME2 1XJAA 2BFUS 2VOVA 2WS93 1GP5A 3MHZA 4IETA 5CVRA 3BU0A 4GULA 4N43A 4YVWB 1JUIA 2Q8EA 2HYKA 3MYXA 2OXBA 1IGOA 1AJOA 1H8TB 2ZOEB 4NRQA 3OYWA 4ASMB 5FPUA 1COV2 5C8CA 2XUEA 2HKXA 2YC4A 3HJRA 3PUSA 4GWJA 2HBTA 3IM0A 2A6XA 4FXGB 3WNXA 5DUUA 4EV0A 3I7DA 3MDPA 1HXS1 3PTYA 1RUJ1 2QBXA 2YZ4A 4XE9A 4DZGA 2WO1A 2A1XA 1RINA 1ZZ9A 3ILRA 4LOTA 1W9WA 1AXKA 2DVGA 1RHI2 3B3QE 1W6OB 4ITCA 1VBC3 3MEPA 2DDUA 2VY0A 2QNKA 2G9GA 3QH6A 4QX7A 4BQXA 4CP1A 3ZIXA 2HWD2 2BU9A 2HYXA 4E9KA 3ZSLA 4AQTA 4LLOA 3O14A 4X6QB 1OQDA 1O59A 4UBHA 3T3YA 4CRQA 3C3VA 5FBZA 3AJYA 3NMBA 3FUOA 5GLUA 1S0GA 1COV1 4LQRA 1W3VA 2XOMA 3CEWA 5FUNA 5FZKA 4QXKA 2R062 2VXRA 1D7PM 4AK3A 4DFSA 2R7EB 2JG8B 1V6OA 1DCSA 3NV1A 3PHMA 5T5OA 1OUXA 1BLZA 1LOGA 3ZYPA 2JDMA 1X50A 1RUF1 5CKQA 2QTWB 2DBIA 2GALA 3MLJA 2VZ3A 2ZAHA 5D8AC 4S2FA 3VHNA 3WCRA 2RG4A 2W3JA 4MHUA 4XILA 1RHI1 1S2KA 3VHPA 2Y6HA 5FZGA 3ZXEA 3GALA 3MV11 2DCTA 5FKBA 5LY2A 3NO8A 3SISA 1LEMA 2E6VA 4KG0A 4OYUA 5FZBA 5J7MA 4HANA 1MS8A 2HWD1 4BMEA 5B4NA 3ZN6B 5GLWA 5DMYA 4LBQD 1S0FA 4Q1PA 4JVAA 4YVWA 3LSDA 2Q8OA 4R4XA 2B45X 2BZDA 5IYYA 1H8TA 5FZ6A 5KXBA 5AVAA 1H1MA 1UX6A 2L9LA 2ZX1A 5FZ9A 2B9UA 3ZXGA 3V64A 2J22A 3ZO0B 3VLBB 1QJFA 1DHKB 2JD4A 3ASIA 1Q8OA 4XJAA 3M3OA 3POWA 4XUTA 3M8LA 4XBLA 1IPJA 2F6BA 2BOIA 5HV4A 1LHOA 1OBNA 4BXSV 4WVMB 1D2SA 1NY71 3AYDA 2IXLA 4LTAA 1W6OA 4YLZA 4JTOA 5J98B 4COZA 1FNZA 4KQ7A 4LK6A 3SITA 1VE0A 3EJKA 5F37A 4A41A 3VL9A 1MS4A 3HQUA 1QY4A 1JYCA 5LWBA 5JIAA 1OF3A 3T09A 4AFDA 1J58A 2CGOA 4GWIA 4OQ9A 4HN1A 3A22A 1Q43A 1CONA 4JGZC 2YFUA 2WLPA 4IE0A 1H2MA 4URTA 2DWRA 2JG8A 4BOWA 1CJDA 1H4HA 3VD9A 1RUOA 4JCKA 2DFBA 4BDVB 4P00B 4Y5SA 5I91A 5J09A 5KWRA 2VCBA 5CADA 1A34A 1UY3A 3GF6A 4XZUG 4W6XA 2B4KA 4DNYA 4PHZA 5FYZA 2VMDA 4BM8A 5SV8A 1OXCA 3KF3A 2XJRA 2VOXA 3APBA 3E1F1 2WYFA 4HPKB 2JWPA 2X29A 4B3NA 2ZA9A 4XQ4A 1FYUA 1MQTC 1K3IA 3M4FA 4QM9A 1ODNA 2D6PA 1RYYA 1T6GC 4QD2A 2P4EA 2GC2A 3ZN6A 1MS1A 2XWBB 5JXIA 3VBHC 5K9YA 2VOTA 3UGHA 2J1TA 4LR4A 1PO23 1N1TA 3ZPYA 3ZPOA 2R1DA 1WW6A 2C4XA 3CBNA 2LTNA 4Q4V2 1VBA1 4YFWA 5GJ6A 1GWKA 4Q4Y1 5ISLA 2C26A 2BWCA 2E7QA 3ON7A 3DYOA 4AVBA 2W0XA 4EN9B 1YQ2A 4FO9A 1D2QA 3PTRB 4NHYA 3DN7A 4WVMA 4EZHA 5FZ7A 1JZ4A 1C28A 1JOBA 5FK7A 4QPIB 3NAPC 1QQP1 1W9FA 3OBRA 2CL2A 2QDRA 2RM23 4CSWA 4PDWB 2ARAA 1CIYA 3G7DA 4LO4B 3U14A 2Y6FA 4PBPA 2D93A 1NUKA 4AF9A 5ABJB 1PMJX 1WLTA 1WW7A 3UKTA 4A42A 4AFBA 4I0BA 2VZRA 4Q4V1 4DUVA 3EXUA 1RUD2 2O0OA 1G9FA 2CGNA 3AVSA 5F3GA 1XNCA 1OSGA 2Y6KA 4XDQA 1C5HA 1W6QB 1WW5A 4N53B 4CPBD 2P34A 3POJA 3MW2A 4V2VA 4GH4C 3QCWA 3RGBA 4JKKA 1BCXA 2DCZA 3FLRA 3POBA 4QKNA 5DAWA 5FP8A 1NE6A 4HPKA 1C1LA 1RXFA 2OW4A 4XURA 4YW3A 1JW6A 1JZ3A 4A7YA 2HWE2 4E4HA 2GDFA 1UY4A 2C24A 3SCFA 1RUH2 2JDHA 5J1XA 3WDXA 1CQ9A 1R092 4K6BA 1QJX3 3VZJA 1CAVB 1W6NB 1KS4A 4MG2A 3LA2A 3N7LA 4FPJA 5FV3A 1DLCA 4AW7A 1H1IA 3LQCA 1GOFA 3OUHA 4IEWA 4CEYB 2AREA 1RUD1 4QKFA 1QDCA 3RZZA 5DUXA 4DEVA 1E5IA 3PU8A 4IEOA 1UPIA 3D82A 2ZGMA 1W8UA 2HWC2 1MS5A 4HFSA 4EROA 4JKLA 3N9PA 1Z7S3 1REFA 4FFHA 3VBFB 2D5FA 2R0HA 2XLGA 3MV01 4ORFA 1LAJA 1AYM3 1WZXA 4FTBA 4H3WA 4QPIA 5FK8A 2BUKA 2YBKA 2PA7A 4EYUA 3J7HA 2Y60A 1ZREA 1F4AA 2HWE1 2X5IB 2QQNA 1DF0A 4PDWA 1YNAA 2PAMA 1GYKA 4ISQA 3CZJA 3VKOA 4GAZA 2Z5WA 4R9DA 1QIQA 1ULDA 1R091 1RUI3 2TEPA 3WNMA 5A1LA 3MIGA 4GXLA 3ZFEC 4BA6A 5ABJA 3I2HA 4WVZA 1VBC1 3TEWA 1HRI1 1CX4A 1FPN3 2WFPA 3N9LA 3A4UA 4IV3B 4LBMA 4R8HA 4BCUA 2V4VA 5D21A 4OI0A 2D5HA 3ZFFB 4A4AA 2JD9A 3BPZA 4RYDA 2DFCA 3LAGA 1W6QA 4KH9A 4N53A 1SCSA 2HWC1 3PJYA 3UESA 3ZLIA 2VZPA 2LALA 2A70A 2DCYA 2ZABA 1LODA 4QGMA 2W46A 3Q8AA 1MZEA 1QH7A 4Q2FA 3U0ZA 5DAXA 4XF3A 3O1MA 3B7MA 3KV6A 5T3NA 2OPWA 4Z8BA 3PUIA 3JXSA 1S0DA 3UKNA 1ZRFA 4RFRB 5FLHA 4XAAA 1X33A 1QGLA 1YXWA 3MF9A 4TXWA 2UWCA 5IVCA 3F95A 4IGPA 1FXZA 4YW6A 1V6KA 3D6EA 1CAVA 3JU9A 1W6NA 3AZXA 1W2TA 1RVF3 4Y24A 4CCOA 1GR3A 3TN91 2RS32 4DXSA 4C90A 1GNZA 1VAVA 2WZ8A 1QXRA 5LEJA 3N7JA 3ZSEA 4CEYA 4QU1A 1V00A 3ZXLA 1CZSA 1IS5A 3P5BA 4O65A 3J7MA 3TOJA 3LFMA 4NRPA 1XNAA 4QHOA 5D2AA 4QM8A 1HW5A 3ABZA 1EAH2 4H2AA 2GAUA 3OBTA 5FO8B 1H2LA 4X8NA 4NWVA 1G9CA 5IK8A 3VBFA 1DGWA 3UL2A 3D3AA 5CFCB 3NV3A 5FAXA 3VDBA 3LCPA 4Y20B 4K40A 1VMHA 2IXCA 1AUYA 4YGEA 4OHYA 1R1A1 4N8MA 1C3HA 1WA4A 4L2NA 2X5IA 1QJY3 4MGSA 1SCRA 1UYYA 1CIWA 2NPIA 1K5MC 4UF0B 3MIBA 1IG3A 5K4LA 4FAGA 5K0UB 1GZTA 5IW0A 1U5YA 2Y34A 1GBGA 3W58A 3BUCA 1O5LA 1K45A 2H0BA 2RDNA 1W8TA 4FQ4A 2RS31 4IV3A 4TYSA 4NPLA 4AZZA 4AHYA 4GB33 4GD4A 1HB1A 2EAAA 4KNCA 5LZ6A 3PVNA 2P3IA 3CDZB 3ZFFA 3HT1A 1LRHA 1NA1C 4X6RB 5EJZB 4UW6A 1RUG2 4Q4X3 2ARCA 2WZEA 1EAH1 2JDUA 2VUCA 1W6MB 2XJTA 3CJXA 4QAWA 3AZWA 4K21A 4YZ1A 4AG4A 5AFEA 3ZFGB 3HN3A 4HSJA 3GM8A 1PO13 3NWKA 1BBT2 4D6QA 2JDNA 5HBAA 2HLEA 3ZYBA 5FXWA 3RJ2X 3WX5A 1H2NA 3MICA 1VBD2 5FR3A 3ELNA 2BW8A 2PHXA 4PCRA 1GQPA 3RMYA 3V0BB 1GKBA 3ZR5A 2QKDA 4KMQA 1BVVA 1N47A 4Q26A 5LA0A 2VMGA 3M1HA 3MLLA 2R043 1E5SA 2RR11 3Q9OA 4G4FA 2ERFA 2GU9A 4MV2A 4QGNA 3K48A 2OPKA 1QOTA 2VMFA 4OULA 2VG9A 1YQ5A 1ASJ1 3DYMA 5JWPA 4CXYA 4BK4A 1RUG1 1TMF3 1KEXA 3KQRA 3RYPA 1H2KA 1PO21 3S5QA 3WCSA 4AQSA 1PNFA 1SLTA 3WF0A 5IVBA 5C3SA 4QHBA 3WW2A 4QQOA 1SLCA 1C1FA 1BBT1 5CFCA 4HLTA 1D4M3 4Y20A 4FTSA 5H9PA 4J6GA 5LW9A 5EYXA 4BIOA 2VMHA 5FJKA 1DQ5A 1SFNA 2Z79A 4B4QA 4DY3A 1JZ5A 3E6DA 2A75A 3LB9A 5LBBA 3AMNA 4IEXA 4UF0A 4E27A 4NIDA 5K0UA 1WLWA 3NVCA 2G1MA 5FJHA 4XDPA 1PM7A 3FLTA 4HKLA 4OLLA 4CDUC 2BP6A 1H30A 1X8MA 4GIQA 2ZCWA 1TG7A 3I59B 2R073 4P9JA 4ATFA 2D3PA 4M01A 1LCLA 5E1RA 1E5HA 3HNYM 4B8EA 1W6MA 3TRSB 3UYJA 3LOBA 3OPWA 4IL7A 5GLTA 3NKGA 3ZFGA 2ZEZA 1FT9A 2PLV3 2JECA 3THCA 1JUHA 2Y33A 3IKWA 3L9JT 4OHZA 5L7OC 2WL1A 2RS11 4R4ZA 3RNSA 1ZZ8A 3ZDSA 1OVPA 4BQ1A 1UCXA 1GV9A 1RMU3 2RS53 1HQWA 1KD7A 2JE7A 3PUAA 4CCMA 1GZCA 3VUOA 1R64A 1VR3A 3GCWA 4LBQB 1N3OA 3V0BA 1U0AA 5FCCA 2WFF2 3AK0A 1POV1 4HL0A 2W1WA 4ARXA 4MHRA 2TNFA 4UFMA 1JZ7A 3MF6A 1AXYA 4FP3A 2C0ZA 1VBB2 5FPAA 4ZY9A 2QZ2A 3KV4A 3RS6A 1B35C 1VLNA 3IN9A 2UYAA 4RQPC 4EWEA 5F9TA 4CCNA 2ZKNA 1KJLA 3CL1A 4L8QA 1HXS3 3K46A 1RUJ3 1NG0A 3OGRA 2BVVA 4XJ8A 3OUJA 4C0HA 2A6ZA 4V2WA 3MPBA 3SLIA 1AZDA 4W4ZA 1F31A 1UF2C 3I3EA 4DXTA 3LSEA 1GOHA 2GSYA 3TNPB 4GALA 4Q0PA 5B4XA 3USUB 2ZKLA 4I0AA 5JMOA 5EV7A 2VZTA 4Y4RA 3NKTA 2WFF1 4YG0A 1HB4A 2EXIA 1NYWA 2VD7A 3OGJA 5JOXA 4HSLA 3R05A 1NZCA 4YVSB 1UD1A 3O1OA 1COV3 2OIIA 1VBB1 4P9IA 1DYPA 1LOCA 1N1YA 3S0MA 1UOGA 3I59A 4AGGA 4COWA 1J83A 2ZGLA 1NLRA 3M3EA 5FZ1A 3AJZA 2VECA 1KRIA 2O1QA 3SCGA 4NO4A 2EXJA 2G9ZA 4PLMA 3MUZ1 1LR5A 3N7MA 1STMA 4XACA 4E4DX 2PQSA 3M3QA 5DPNA 5I0DA 3HN1A 4O7XA 1U5IA 3ZXDA 1CPMA 3FLPA 3NW4A 1RHI3 3N9NA 1SLBA 1OQ1A 4LBKA 4LNVA 2WQZC 2N7GA 3A0NA 2D40A 3SNMA 4QB2A 1YFWA 1OURA 2LS6A 4JV4A 2HWD3 1UYXA 1ZZ6A 3NQHA 3KT7A 4LBQA 4PQ9A 4QU2A 2VZQA 4D69A 4KBBA 1HV1A 1S4CA 5JSPA 2J1UA 4AI0A 4E8DA 4YGBA 2VTXJ 3I49A 2ZEWA 3KB5A 3BODA 1PZ9A 3EYPA 1XC6A 3B00A 5FZ4A 1JXNA 1MEC2 3OCPA 3N9MA 3OGSA 3LPFA 2DUPA 3E5UA 3C7OA 2WN2A 1UMIA 4A6OA 1ZRRA 3MIEA 3ZMNA 2ZZJA 4QX0A 3BPSA 2ZGSA 3FWEA 3LE0A 1QHDA 3AKPA 2VULA 1ZZBA 4OZOA 4E4SA 1WCQA 2DTYA 3MW3A 2UWAA 1YC61 2H6CA 1UZYA 2Y64A 5GZCA 2XHKA 4KU8A 3HPNA 5EJ1B 3USUA 2E32A 2XJSA 4MUVA 5JMCA 4D6RA 1LJ7A 2WINB 1X8EA 4JRLA 5A7NA 4AAXA 4CZSA 4CEWB 3AL6A 3I2GA 5L73A 5AC91 4Q4W2 2BTVC 2PHLA 4YVSA 3SH5A 1BXHA 3IDCB 1Y9GA 2JDPA 3Q8CA 4KU7A 1JU3A 4DUWA 2VVFA 5FYCA 1YI7A 1WUVA 2P6HA 2D98A 4Y22B 4AVSA 3NJYA 1VP6A 4FCAA 5FIXA 1JI6A 1XB9A 2WLQA 4IE4A 1G9BA 4M3CE 3K4ZA 4LE3A 2B39A 1W04A 3J8F2 5EYYA 3DV8A 4AWDA 4FPHA 2ZMLA 4NHKA 4XYXA 4N9IA 5JPNB 3H1WA 3U37A 1GSLA 4EN0A 1OHFA 2WN3A 4GMP1 4LA2A 3DECA 1O5UA 4HK9A 4OI4A 5G05L 3VDDC 2FDKA 4I2OA 4MXWB 1F2NA 5FYYA 2XHNA 4F7ZA 3JD72 1X82A 2VCMA 5C71A 3FHAA 1EUUA 2BPA2 5CU1A 3MIDA 1VBA3 4IEYA 4Q4Y3 1YFYA 1VPHA 5E8AA 2IC1A 3VZKA 4EJRA 1AL22 1FV3A 5C4WC 4AR2A 2I74A 3BIEA 3G6JB 4PIXA 3OGVA 3H3UA 2Z42A 1JOPA 1H6YA 3J8F1 2PMWB 4B29A 2BWAA 4XCAA 4W6YA 2FD8A 3SEEA 5CISA 2YMZA 5FXZA 2P3JA 2YPDA 1UXZA 4CE8A 3KT4A 4YM2A 1ND2B 2DU0A 1QQP3 4YG6A 4WBBA 4HK8A 4AI3A 5FO9B 3FHQA 3VBOB 4TTGA 4CEWA 4M4PA 1YLLA 4PIZA 3JD71 4Y1XA 5EPAA 3B94A 5IWFA 4Q0SA 3AMMA 5KHIA 1Y3TA 4Q4V3 3ZN4A 1AR62 5LBFA 1NLSA 1Y9QA 1PK6C 2A6WA 4LE4A 3OSDA 4WV8A 4Y22A 4ZHNA 2VAUA 1AL21 1NE4A 1YJLA 1H8VA 5DDJ2 1E57A 4JTNA 1LGBA 4UW4A 1LNSA 1UN1A 4XIOA 5FPBA 4NAOA 1HQLA 4PLOA 3ZKUA 4CUGA 1DBNA 1PM4A 2WYSA 3IDEA 3POGA 4O9EA 2LUWA 2VVEA 2VH9A 4AXOA 3AZZA 5CKNA 3RMXA 2Q30A 2HWF1 5FRAA 1JYVA 4E2QA 3O1RA 3CJIB 2RMU1 3PUHA 1XNBA 1DIWA 3H9AA 4QGLA 4A3XA 2D6MA 4MXWA 1VB4A 3ALQA 5C33A 1RUC2 2HEYF 2R0FA 1RMU1 5J48A 5FZDA 1AR61 4BE3A 5ACA2 1BK1A 1Y43B 3ZFEB 4YPJA 4XQDA 4M0HA 2YHJA 1RUD3 2WSVA 1YFUA 2IVJA 1CN1A 2JG9C 2WZR2 2CTVA 4OMCA 2WNUB 2ADEA 3AL5A 3DCQA 1JZ8A 2EIGA 1GWMA 5FYTA 4CDQB 1R082 2RJLA 3B69A 3LEGA 1ND2A 2C9KA 2VE1A 2WNVC 3JQXA 1GUIA 4KWJA 3O1VA 2QQOA 2HWE3 1PVC2 3LA3A 4WM7C
chains in the Genus database with same CATH topology
1KQRA 3ZIWA 3EHKA 3VBOA 1PGL2 2VOWA 1R093 4D7SA 1RUC1 4OHWA 4Y26A 3RQ0A 5ACA1 1HRI3 1TME1 3VBUC 1FMD2 4QPGC 4ZU5A 2V5YA 2MEV2 3B01A 1QJU2 2IXJA 3OD4A 3WQ1A 3KD4A 2WZR1 3ACLA 2HWC3 5T52A 2VW0A 1GFF2 4CDXB 2OVUA 3H1MA 1R081 3CLPA 3ENRA 5KHGA 4IV1C 1PVC1 5JZGB 5CB7A 1ULEA 3CJIA 2BGCA 1N3PA 2GN7A 1YIPA 4LUKA 3AP5A 4FPFA 2FHRA 4PIYA 5FPXA 3P3NA 2Y26A 1G8WA 3TN93 4FSJA 3ZFEA 4TWTA 4XBNA 3HT2A 1FMD1 1AYN2 4AE2A 4FPOB 2MEV1 4B4RA 4XF0A 3ES1A 5GM0A 2WNUA 5JLVA 2R061 1NCQB 2VOKA 5C9AB 5BNOB 4TLFA 3KGZA 2HEVF 1VBE2 4H14A 4AEDC 5CFDB 4CDQA 3AP6A 2ZTNA 2E9QA 1R1A3 2CWMA 3POSA 4XPVA 3IDBB 3ZSJA 3ROUA 2Y0OA 4WM8C 3IWZA 1UIKA 1LOEA 4Q0QA 3ZX7A 4EWDA 3M3CA 2XJUA 1Q56A 4BPZA 2D6NA 1ND3C 1W6PB 3I4IA 2RS33 5GZEA 3HAGA 4NR1A 1V70A 1NXD1 1DDLA 1YRZA 1J1LA 1DZQA 2XBO2 2XVKA 4P9YA 5H9QA 1EAH3 4RR3C 1CAWB 4ONUA 4CDXA 1VBE1 4D94A 5I0UA 4QQ2A 4KGQA 2JX9A 4D7TA 5EXOA 3TYJA 1TEIA 5JZGA 2DV9A 4IERA 2XPJA 1OFSA 2X8KA 3AXDA 1UW8A 3B9IA 2JJ6A 1WMFA 1A78A 1CGPA 3FFQA 5B2GB 2D7FA 1UU5A 3RSJA 4AGVA 2DUOA 2RR13 4COUA 3P3PA 1AR92 4Q0UA 3AKRA 2GZWA 1ASJ3 2X53S 5CIRA 2XBO1 1RUG3 5T55A 3EQEA 4FPYA 2B8MA 3KGLA 1NCQA 3B02A 5C9AA 5BNOA 3KS7A 4LBLA 3VKMA 2TUNA 1OPMA 4JGYC 1BBT3 5CFDA 3DKWA 4K8FA 2XJPA 4R9CA 4XHBA 5KXEA 2JKBA 2XUMA 3AFKA 5JOWA 1O91A 2GMMA 3ZVXA 1AHSA 2B7YA 3B9CA 3JZVA 4XJ9A 2A6YA 4FOYA 1W6PA 5HCBA 1H0BA 1QXPA 4W65A 2UU8A 3WD5A 5LK7B 1AR91 5F6KA 2A7AA 4U36A 1J3PA 3LKJA 1C5IA 4H7MA 1LOFC 4WZCA 1DQ0A 1DQ1A 4P14A 1CAWA 4P9GA 5DZGA 4BMBA 4AEJA 4AHZA 4HVRA 2JDZA 3JB8A 2RS13 3VBSB 4QQPA 2ZX4A 4NWWA 3VBRB 4BWOA 5BNNB 2W52A 3ZYGA 2QUOA 4LHNA 3CF6E 1G9AA 1KFXL 1RL3A 4YGDA 2WA4A 1POV3 1EPZA 1AL0G 5JVVA 1U5XA 5DXDA 4N43C 2NN8A 5JSOA 3D8CA 5JR7B 4IEZA 4YZ3A 3AP4A 1LGCA 4FAHA 2RHPA 5CG9A 3FMGA 1RTVA 5C8CC 3LA7A 1QJZA 4NVPA 4BHPA 4ZKTB 1POV0 3BIWE 1QNYA 3L2HA 4AI8A 2G4IA 4Q8LA 4QQLA 4DQAA 4MGIE 3QOPA 1GICA 3WINE 3HBZA 3M7AA 1NCRB 5GZDA 2WFF3 2KA3A 3ECQA 4IEVA 1Q8SA 1O4ZA 5E16A 2OZ6A 1VBB3 2RJKA 2ZPXA 1LKNA 1RUH1 2XH6A 4GWNA 1JTZX 3SHRA 1OOPB 1JOJA 1XE8A 2Q1MA 3GBGA 1RJ7A 3GZTB 3ZYRA 4FOWA 3AMQA 4KL1A 4Q0VA 3WLUA 1MVQA 4LO8A 4I3PA 4Z2WA 3GYDA 1UPSA 5BPXA 3TNQA 3EO6A 4GKXA 4M3CF 4Q8KA 2PN5A 1SACA 3VBSA 3ILFA 2ZX3A 5BNNA 1C4RA 4XFGA 3VBRA 1QWRA 1S0JA 5AFBA 1Z0HA 4DRRA 5I8SA 1LU2A 4XTMA 2XKPA 4Y1VA 1AJKA 5T50A 2EAKA 3WUCA 4CDWB 1QOOA 3SH3A 4YARA 1V6IA 2F4PA 4Z82A 1R1ZA 4YVWC 2ZX0A 2C5DA 4V1PA 5IK7A 3VKNA 1A6CA 1WCKA 4CP2A 4XFAA 2P2KA 3ILNA 3HR9A 4RS5B 1AR82 4YM1A 4J1XA 4I30A 1RGSA 3CO2A 2WJSA 4AVVA 5J3UA 3HD8B 4AGRA 1Q8QA 2KXLA 3VN4A 1NCRA 1KXGA 1GZWB 1UIJA 3KMHA 5AC93 3HQXA 1IS6A 3UJOA 4HZFA 3T1MA 2BNNA 3I8TA 1AX2A 5CAZA 3PJQA 3FJSA 3SXWA 1SBFA 2D3RA 3ZXAC 3LOIA 1O4TA 2B42B 5E88A 1OOPA 5TSWA 5T5LA 1SEFA 2GC3A 4ES9A 2CAUA 3S7EA 2CGPA 3JB4C 1CAUB 1PZ8A 2VNGA 1AR81 2JG8C 2VMIA 5EFUA 3R4SA 5DUWA 4YW1A 5F1RA 4F83A 1CESA 3H3ZA 3GZUC 5AVPA 4BYYA 5GZFA 5JOYA 2YPJA 1Q8VA 3H7YA 4Q29A 4GMP3 2IFWA 4A7ZA 5BNPB 1YJKA 2CV6A 2DCKA 4AI1A 3K51A 4C91A 1UL9A 4LUMA 4CDWA 1FX5A 1CR7A 2ZGTA 1DZRA 3DPRB 2HJIA 4XOGA 3WDYA 4XF9A 3JBG2 3N3HA 1JN2P 1Q5OA 2Q5TA 1H9PA 3MIFA 1PMIA 5C33A 2E53A 3ETQA 2CWSA 2ZGUA 4FPGA 4M3CB 1RUNA 4RS5A 2E63A 2DYCA 4GMP0 3J8F3 2XB6C 2ENRA 4YM0A 2ZGKA 4JDOA 5JOZA 2PYTA 3ATGA 2XL7A 3WG1A 4DXZA 5FOBB 4OHVA 1OA4A 4MH0E 4HN0A 1KDKA 1GZWA 2D6OX 3WP5A 3JD73 1JBCA 3FHIB 4YW5A 4JAAA 1VBD1 4P9WA 2H6BA 3JBG1 5JCTA 4ZU4A 2RM22 1W0PA 4MGYE 3PLQA 3FUQA 2VGDA 1AL23 3E97A 1CAUA 1HQNA 4AQ6A 1ZYBA 4GKYA 2A5ZA 5FMOL 1MR5A 5FO7B 3N35A 2ZBJA 1HKDA 2PTMA 3S7IA 5E89A 2HWF3 2IFRA 3RG0A 1FV2A 4RGGA 5BNPA 1AX0A 2RMU3 3TBDA 4HVQA 1UKRA 1ULCA 2VW2A 1PZ7A 1AR63 2XLAA 2E7TA 2QE3A 3DPRA 1O3QA 2Z2SB 2VUAA 2DURA 4PF5A 3WQ0A 3T2TA 4N7IA 4QPGB 5DDJ3 1XNKA 4M3CA 1QJX2 3PVOA 2ZGNA 3EBRA 1F5JA 1WBLA 2WKKA 4OHXA 4XEZA 3FX3A 5JDBA 1M06G 4KWLA 4E2SA 1GQHA 5KHKA 2Y0IA 4C1WA 5DG2A 4IEUA 3QLQA 2ETEA 4QPIC 4FQZA 5D8AB 5CNAA 2PQQA 3O0XA 1IS3A 1RUC3 4H7LA 4IEPA 2YGLA 4N7UA 1EV12 1IQAA 4PDWC 1TME3 5ACA3 4KGGA 1BEV2 1S0BA 4EN6B 2B5HA 5ABJC 3INAA 1UU6A 2WZR3 5GLZA 2JEMA 2I07B 2D6KA 1FPN2 4CP0A 2FMDA 4QQHA 5K7PA 1R083 1OI6A 4HETA 4N53C 5KC6A 2WC2A 3TAYA 2R1BA 1ZBA2 2GNBA 1PVC3 4YW4A 3WT3A 4HMZA 1KFUL 1IZ3A 4XXAA 4A7KA 4W6WA 1S55A 2K9ZA 1EV11 1N3QA 2ES3A 1BEV1 2ZHLA 4A2UA 1HDKA 1FMD3 2YC0A 1LULA 2MEV3 1QJU3 2YUEA 5J96B 4QPGA 1QNWA 1KJRA 1V6NA 4I3GA 2R063 2TBVA 4CEYC 4AQ2A 3M3IA 1ULGA 1OLRA 1IKPA 2NLRA 5EZWA 5BV6A 4JGZB 4WVWA 4S2HA 1ZBA1 2H0VA 4DINB 4OUMA 1UKGA 4R9AA 3FZ3A 3VBFC 4DB5A 1HV0A 5IK5A 3JQWA 4WVVA 1XYPA 3R0RA 5D8AA 1EY2A 2X5IC 3UKVA 1VALA 2QVSB 4RHV2 3NSTA 3T1LA 5JAXA 1MQTB 2BBVA 4XJZA 4FPKA 4IV3C 4DY5A 1A8DA 3ZSMA 4SBVA 1AVBA 3VBHB 1Q3EA 2WZPP 3ZFFC 1OA2A 2WA3A 1MEC1 5FTTC 3MFCA 1LB2A 1VBE3 4Y1ZA 1LOBA 4GB32 2JXAA 4EN8B 5SV5A 1BQPA 4PBOA 1DU3D 1EYBA 3I54A 1PIV2 4OI2A 1RIRA 1KS5A 1F5FA 3ZSKA 1IOAA 3RPQA 1PO12 4L99A 3R6SA 4RHV1 2GC1A 4YM3A 3NAPB 2ZX2A 2VVDA 2XVGA 3N4MA 4Q4W1 4Y1YA 2XBO3 1H1AA 4KWKA 2V09A 4XW3A 4MX3A 1S0CA 3WP3A 4LULA 1MS9A 2OUHA 2AGSA 2HWB2 3BOWA 2XJQA 3HMYA 3QBQA 1WLDA 2VQAA 3WP6A 4L9BA 4P5HA 5FPZA 4JGZA 1XU1A 4Q1RA 4MZUA 4QPYA 1MS3A 2PFWA 4AFCA 1TMF2 1PIV1 4X8PA 5CFCC 4MSVA 3NJZA 4XFFA 4GWMA 1DGLA 4GH4B 3VZNA 1DFQA 2D3SA 4L11A 5I93A 2A71A 2PELA 4AFMA 1GNHA 1AR93 2A3WA 5DZFA 1GZ9A 5CBLA 5K0UC 2ZJCA 5I8YA 5I0RA 1MQTA 4RSUA 5CG8A 4XFHA 5D1IA 4OUSA 2UURA 3J26N 3ZYIB 2HWB1 3ZXJA 5KXDA 3VBHA 3FFZA 2D43A 1RUE2 1AR72 1HRV2 3UJQA 2RE9A 3WVJA 5BYNA 3O0VA 2R072 5IK4A 3OJBA 1WBFA 3ZFGC 1IS4A 4OFGA 1YCIA 2I2SA 4HT1T 4OVEA 1CAXB 2XG3A 3HWJA 3WHTA 2PLV2 4Y1UA 4K1ZA 1ZBE2 3A0KA 2K0GA 2RS52 3NAPA 1YYNA 4TSVA 2BYVE 2NQYA 4XETA 3H1YA 3DF0A 3J4UH 3B93A 1DQ6A 1KDMA 3VV1A 3WDTA 3U4XA 1IHMA 1ENSA 1V9U2 3WW1A 1RUE1 1AR71 3IPVB 1FOD2 4JQRA 2AZ5A 4LO7A 4FVVA 1G7YA 1QDOA 5KXCA 4D3WA 5BXXA 5DDJ1 4LBOA 1DGWX 1RB8G 1XRUA 1CVNA 2A73B 1X7NA 2GC0A 3THPA 4GH4A 3BCWA 2EA7A 1QU0A 2PHTA 2EXHA 1ZBE1 2WQ4A 4COVA 3E6CC 1V6MA 4M0NA 1RUH3 2IXKA 2R49A 4META 3E5XA 1V9U1 3RJRA 3RYRA 4M00A 1FOD1 3VZOA 2P3KA 4AVTA 2DUQA 3WHUA 2DU1A 2UYBA 1OMIA 4AVCA 5C6CA 3KSCA 1C8M2 5KHHA 5HXVA 1RUF2 2EXKA 5A32B 3RRDA 1U5ZA 1CAXA 2YGMA 1SLLA 1CD3G 4L97A 1GLHA 4DOUA 2OA2A 4G9SB 3D0SA 2DVAA 5FMOS 1WW4A 4Y4YA 4IESA 1NXMA 1PGL1 3PNAA 3VKLA 1K5MB 1ENXA 2WT1A 4XFIA 2WT2A 1G9DA 3NL1A 2FMYA 1URXA 3IPVA 4Q27A 2E51A 4LT5A 1QJU1 2XGXA 3OPZA 2DTWA 1C8M1 2SBAA 1IKQA 4ISRA 3GHMA 1NA1B 2V73A 5GKAC 1PHMA 1AF9A 2GNTA 2E7AA 2ZACA 4XZPA 5K8SA 2DVFA 1NY72 2PHWA 4LLFA 2ZMKA 1SDWA 1DQ2A 4YVSC 3O0WA 2FZ2A 1WD4A 2D44A 1B09A 2YV8A 2ZHKA 4JC1A 1QF3A 4JDMA 4E2GA 5LEKA 4YNIA 1AYN1 1AR83 2ILMA 2XKOA 3AYCA 2DF7A 3D4KA 2NP0A 1REDA 2LM3A 5HI0A 5A32A 1FI2A 3KT1A 2OZJA 5FFOC 1W2UA 1SQ4A 2XWJB 2GNDA 3PMSA 2O8QA 4K9SA 4QMAA 4GA9A 3WDUA 3MGUA 3GBWA 2WWSA 2D6LX 3WV6A 1K5MA 1G6NA 2XL9A 3AMPA 1VRH2 1SLIA 1J3RA 4NPRA 5JPMB 3C2UA 4CDUB 2IXIA 3CNAA 1IPKA 5FQ0B 5F5QA 1LU1A 1YUDA 4C0BA 1VBA2 2O8OA 4Q4Y2 3PVEA 1A8MA 4DRVA 1NA1A 2XLFA 1LTEA 4YYOA 4XQWA 3LZZA 3E6BA 3FE5A 1RJ8A 4I0WB 3KCXA 2GN3A 4NHLA 4IEQA 5L7OB 3PMEA 1VBD3 1BZWA 3AX4A 2FZ1A 2ET1A 1QQP2 3JBG3 4CEWC 3E5QA 1D0GA 5FREA 3ZYJB 2VW1A 2SLIA 1VRH1 1A3KA 3ZMOA 4FXKB 3AYEA 3O12A 1O3TA 5KHJA 4YZ2A 2VQ0A 3S6PA 1B35B 4AEKA 3IMNA 3KCYA 4RQPB 1TE1B 2FQPA 3MIHA 3R4DB 2Y38A 2YROA 4HVOA 1SBEA 1JHNA 1LHWA 3AYAA 3O5SA 1BMV2 2WT0A 2CNAA 2K2SA 1NQJA 4YG3A 1ONAA 2PHFA 1XXNA 3VHOA 1BJQA 1OQEA 1U12A 4ZU7A 5T5PA 3OF1A 1O4YA 1W0OA 4CDUA 1F9KA 1O3RA 3RDIA 2WS92 5FQ0A 3VHRA 4U2AA 1RC6A 1MACA 1VIWB 1J1TA 3KLSA 3IBMA 3AB0A 5DUVA 1YIFA 2QQPA 1DLLA 1FATA 1ND2C 1BMV1 5L7OA 3WZ1A 4AFAA 3WY6A 3VBOC 4AI2A 5H9SA 1WMEA 3N36A 3WOGA 2PAKA 4MXVA 1VBC2 2ATFA 1HRI2 3B5LB 2WS91 1DGRN 2Q0AA 4Z1VA 4ATEA 4DS0A 1B35A 1TQ5A 5BUVA 1DZTA 2MHFA 4XJUA 4MLOA