The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
16
|
sequence length |
65
|
structure length |
65
|
Chain Sequence |
NQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVKGYAA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Ice-binding protein
|
molecule keywords |
HPLC-12 TYPE III ANTIFREEZE PROTEIN
|
publication title |
The Structure of Type III Antifreeze Protein from Ocean Pout
rcsb |
source organism |
Macrozoarces americanus
|
total genus |
16
|
structure length |
65
|
sequence length |
65
|
ec nomenclature | |
pdb deposition date | 1996-10-25 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Type Iii Antifreeze Protein Isoform Hplc 12 | Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain |
#chains in the Genus database with same CATH superfamily 1B7J A; 3QF6 A; 4UR4 A; 1B7K A; 2ZDR A; 3FRN A; 1AME A; 1HG7 A; 2SPG A; 3CM4 A; 1EKL A; 3AME A; 1XUU A; 2MSJ A; 1C8A A; 2JIA A; 5MSI A; 6MSI A; 2WQP A; 2MSI A; 9AME A; 6AME A; 3G8R A; 9MSI A; 8MSI A; 3MSI A; 8AME A; 1GZI A; 4MSI A; 2LX3 A; 2LX2 A; 1JAB A; 1C89 A; 1WVO A; 4IPI A; 4AME A; 1VLI A; 3NLA A; 4IPJ A; 4NY6 A; 4UR6 A; 1MSI A; 1MSJ A; 2AME A; 1XUZ A; 7MSI A; 7AME A; 1KDE A; 1OPS A; 1UCS A; 1B7I A; 3RDN A; 1KDF A; #chains in the Genus database with same CATH topology 1B7J A; 3QF6 A; 4UR4 A; 1B7K A; 2ZDR A; 3FRN A; 1AME A; 1HG7 A; 2SPG A; 3CM4 A; 1EKL A; 3AME A; 1XUU A; 2MSJ A; 1C8A A; 2JIA A; 5MSI A; 6MSI A; 2WQP A; 2MSI A; 3LAZ A; 9AME A; 6AME A; 3G8R A; 3K3S A; 9MSI A; 8MSI A; 3MSI A; 8AME A; 1GZI A; 4MSI A; 2LX3 A; 2LX2 A; 1JAB A; 1C89 A; 1WVO A; 4IPI A; 4AME A; 1VLI A; 3NLA A; 4IPJ A; 4NY6 A; 4UR6 A; 1MSI A; 1MSJ A; 2AME A; 1XUZ A; 7MSI A; 7AME A; 1KDE A; 1OPS A; 1UCS A; 1B7I A; 3RDN A; 1KDF A; #chains in the Genus database with same CATH homology 1B7J A; 3QF6 A; 4UR4 A; 1B7K A; 2ZDR A; 3FRN A; 1AME A; 1HG7 A; 2SPG A; 3CM4 A; 1EKL A; 3AME A; 1XUU A; 2MSJ A; 1C8A A; 2JIA A; 5MSI A; 6MSI A; 2WQP A; 2MSI A; 9AME A; 6AME A; 3G8R A; 9MSI A; 8MSI A; 3MSI A; 8AME A; 1GZI A; 4MSI A; 2LX3 A; 2LX2 A; 1JAB A; 1C89 A; 1WVO A; 4IPI A; 4AME A; 1VLI A; 3NLA A; 4IPJ A; 4NY6 A; 4UR6 A; 1MSI A; 1MSJ A; 2AME A; 1XUZ A; 7MSI A; 7AME A; 1KDE A; 1OPS A; 1UCS A; 1B7I A; 3RDN A; 1KDF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...