1GZSA

Crystal structure of the complex between the gef domain of the salmonella typhimurium sope toxin and human cdc42
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Reversible Activation of a Rho Protein by the Bacterial Toxin Sope
pubmed doi rcsb
source organism Homo sapiens
molecule tags Toxin/cell cycle
molecule keywords GTP-BINDING PROTEIN
total genus 60
structure length 178
sequence length 178
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gzsA00
1NG9A 3FMOB 2CEAA 4DCNA 2WWYA 1IJEA 4LYJA 1QG4A 4TQ9A 2OCAA 2ZSFA 4O3MA 3K09C 2ZRCA 3C41J 3IEUA 4AYTA 2J0VA 2QAGA 1FNNA 3MWLA 4P0TA 2G0TA 4ZV4A 1IXSB 3WXMA 1OKKA 4QGAA 8OHMA 2C96A 1N6LA 1QHXA 1TF2A 1D9ZA 1FTNA 3LBNA 2FN4A 5FL7D 1HA3A 5TDHA 3KTAB 5FI1B 3K0FB 2FFQA 1NP6A 2ZANA 3U3MA 3W5JA 2AD1A 3I61A 4DLUA 3IBGA 3Q9LA 3R20A 3F3YA 1NVUQ 3CZPA 1JXOA 1M2OB 3SFVA 5KU1A 4PHTA 1S3SA 4URVR 2J0SA 1E9SA 1UF9A 4W9MC 2AXPA 1OH5A 4XWKA 1US8B 4G5OA 3KKNA 3KB2A 2O5VA 4Q4HB 3AVOA 4POAA 3S1AB 4PPNA 4Q03A 5EUQB 1G17A 2P3SA 1X8LA 1GTVA 3SN6A 1Z08A 2I1QA 2VP2A 4FCVA 1GNPA 1OYWA 3RRNA 4DUGA 2GVZC 4JLPA 4D80A 4XD7D 1Z63A 1RVDA 2J7PA 3PQCA 2AL7A 4GBMA 4KV9A 4LC1A 2QENA 3TMKA 4YMUA 1S1CA 3L0SA 1XRJA 1ZBDA 3ZD6A 2QT1A 3Q3JB 3EZ7A 4QGGA 2DR3A 3WRXC 2JCSA 5CK5A 1OH6A 2ZI4A 4OQXA 3T15A 5IT5A 4BRWA 2P6UA 3L2OB 3T1OA 4KXFB 2ZAMA 2A30A 1JPNA 1KKLA 1NKTA 2QMUA 2YOGA 3X1WA 1PV4A 3FHCB 3KB1A 4KSBA 5JLJA 3CBQA 3NWJA 2AWOA 3D3QA 2HT1A 2GK6A 2IHBA 3M1IA 4FN5A 1W0KA 4P33A 3B2EA 3QBTA 4CEIA 3V4FA 2FF7A 2A2ZA 4QBIA 4TMKA 3DEFA 1XB2A 4A6PA 1YZLA 3P1JA 1ZJ6A 3LAWA 4OI4A 3WBJA 3ZVRA 1KI4A 1G8HA 2BV3A 2PMKA 1IQPA 4OK5A 1W5SA 2B8TA 1PUIA 3BH7A 3TUJC 3BWDD 4CVNA 2ZIAA 2ZYTX 3EARA 2G88A 2AHOA 2OO7A 4HDOB 1E1QA 4IOKA 2O0HA 3QKRB 3SJCA 2VSOA 3SU8A 1W49A 4UNRA 5GVSA 3FMIA 4JLAA 4A4DA 2OBMA 3GLGB 1R5BA 1MO6A 2NG1A 3QF4A 1OF1A 2OT3B 1E32A 3QKSA 3H1TA 2CJWB 1ZCAA 4V0ME 3QXCA 5JJLA 5JBQA 3K9LA 3GJ4A 1KDOA 3TKLA 1SVLA 1WBBA 2OHFA 1QHGA 2ZUBA 3GJ3A 1UKZA 2IXGA 4GOXA 3IO3A 4UXHA 1VG9B 3K09A 1YJ5A 2HT6A 4XVQA 5CLQA 4EKDA 2C9CA 4ASUD 2JATA 2QNRA 4G01B 3PUYA 3RS2A 2ZJYA 2CK3D 1U94A 4R9UC 1ZNYA 4DLZA 4TQUS 1WMSA 2C9YA 5FUVA 2REXB 2GAAA 2QROA 3HU1A 5EE5B 3B7GA 1E2LA 3QENA 1LY1A 3DKVA 3WMFA 1IN6A 2GEUA 3KJEA 4L16A 3KX2A 3KFVA 1RRCA 3V00A 4AKEA 1KO1A 4KBFA 1OB2A 1H8HD 3IUYA 3KTAA 4HZUA 4DC9A 4Q9IA 2O8BB 2YOHA 1NMZA 3VX4A 2UKDA 1XCGB 2YWFA 1AA9A 1NJFA 4KFSA 3SJAA 2YC2C 4NCKA 1E1QD 2K5UA 4W5WA 3TJZA 1Z2CA 3L0OA 2PL3A 2ZRFA 5JS7A 1COWD 2QM8A 2VHTA 3TSWA 4IVPA 4M9XA 4D0GA 4NYJQ 4BPBA 3QKSB 4C9BA 2O8DB 4TN1A 4EIWA 3AH8A 4H9GA 4HYYA 4D0LB 4JYBA 1TU3A 2IUSA 2J59A 3QBVA 4PZZA 5KSOA 1GP2A 3HU3A 1F2TB 3U44A 4AC9A 1T5LA 3DOEA 3EPLA 2WKRA 2GXSA 1ZINA 3QPWA 4ZI2A 1Z6YA 1N25A 1R6BX 1F60A 1EGAA 5JHHB 4KFRA 4WZ6A 2IYXA 3PJRA 1KDPA 5F9FA 1Q21A 2XJ4A 1R0XA 2EYUA 2VP5A 1FMJA 4CEHA 1UAAA 3BH6A 4CT5A 4LJAA 5GJBA 1GUAA 2PLRA 4MGYR 4PO9A 4WW0A 4LJ7A 2PT5A 4E07A 4JYCA 4NP6A 3OIYA 2XTZA 3E5HA 5JCZA 4Q01A 4LJ4A 5EP4A 1IXRC 3BB4A 4BFWA 4BFXA 5KO2A 4R2HA 3CF6R 2JLRA 1OLOA 3K0AB 4JBYA 1Q3TA 1P3JA 1G41A 4R2IA 1K5GA 3F8TA 5DIFA 4C3ZA 3WHLA 2ZJ2A 4MGZR 2NPIA 3T5GA 3VNUA 2R2AA 5G53C 3M6AA 4PANA 2KBEA 4B2LA 2KSQA 3LLUA 3A36A 4L4UA 4E5UA 4BFVA 1DAIA 4EQ6A 4XD7A 1NG1A 2P2LA 2CCKA 4CIDA 5AUPB 3LQRA 2ZPTX 4BZXA 1N0UA 1SVMA 4ARZA 3KDSE 2MSDB 3DZDA 3FGNA 1E94E 4GSYA 5A0FA 4BRUA 1KY2A 1SHZA 1XEWX 3FTQA 1EWQA 2ZREA 2YC4C 2CVFA 3OEHA 3QVUA 3VU9B 5CB6A 1G21E 4NTZA 5EE9A 3RSLA 4G3XA 1II0A 2H16A 3W8NA 1NVWQ 1U9IC 1NKSA 4AG6A 4A1FA 2HF9A 5JCPA 4TZ6A 3U3RA 5KOYA 2AKYA 2E87A 4II7A 4XTRA 4DJTA 3AKYA 1GITA 2P5TB 5D3QA 4L9WA 1VTKA 2J87A 4Q7LA 1L4UA 3W3AA 3EAQA 1D6JA 2WJYA 3LA6A 3R9IA 4Q02A 1ZD1A 4HDCA 2WOJA 2J41A 1GL7A 1TX4B 5H1YA 4M1SA 1A7JA 4I4LA 3ETLA 1FOEB 2EU8A 1R0ZA 2WJIA 4RY2A 4BFYA 1VCOA 1T8UA 2BCGY 2F9LA 5J4HA 2ERYA 1KK2A 1J99A 2PJZA 2R6AA 1KDTA 2NGRA 2ZSEA 2ANBA 5JFGA 1G3RA 2JLYA 1SXJC 1Z0IA 3HDTA 2NO6A 1SKQA 3A1TA 5G3ZA 4ZIRB 4QHYA 3WNBA 3QJYA 2GCNA 2ZRLA 4M53A 1HUQA 2NO1A 1W2HA 2RGNA 2QP4A 1YR6A 1LS1A 3B78A 1N5JA 3AKEA 3OHMA 4LHZA 2ZEJA 5F3WB 4G5QA 4UNNA 3RNLA 4RZXA 3AVVA 2R6DA 3B82A 1GVNB 4H1VA 3WYAA 1GZSA 5AJWA 4YLGA 5LD2B 3TSOA 3RVBA 2V3CC 3ZLJA 3CONA 3C4JA 4A2PA 2AFIE 4TL7A 3SE0A 3C15C 4Q66C 4B3FX 4M4SA 1B23P 4LX0A 1RYFA 3ECCA 4HSEA 2EFCB 1Q22A 3IIMA 1KK1A 2C99A 4W7SA 2UZ3A 3R7WA 1QHNA 1E2QA 5EE3A 1NBMA 3O8RA 3ADCA 3PENA 2D3WA 3I8SA 4HATA 3F5FA 1XZQA 2C5LA 4ZCIA 1OXSC 2ODWA 5K8UA 4RD0A 2O8FB 4AKHA 1YQTA 3GLGE 2CVHA 4N1AA 3H4MA 5FUWA 3B1WA 4QKQA 4V0NA 3TQFA 4CF7A 1GNQA 4LCBA 1RRPA 1RJ9B 1W48A 2LKDA 4DLSA 1Z8FA 2JA1A 1M34E 3P4XA 2GNOA 2FEMA 3CR7A 2ZE8A 3EC2A 2RMKA 1G18A 2QM7A 4B48A 4F4JA 3GJ7A 3RS4A 5KPDA 1JJ7A 4B3CA 4BLTA 2G83A 2PH1A 3KJGA 4UJ5A 1NSTA 1XTJA 1XD9A 3VHLB 4PAMA 2ZRDA 2Q9AA 3A4NA 3WBKA 4TSFD 2A5YB 3QXJA 1KSGA 2QT0A 4LV8B 1ZU5A 1OHHD 4C0SA 1E9DA 2HYIC 1AS2A 1LV7A 3TVTA 1JJVA 2IEYA 3MCAA 2WAYA 2FEOA 3PIRA 1QVRA 5JHGB 1CRPA 2X19A 3GMTA 1Q3HA 3LW8A 1T6NA 2YOFA 4CZ2A 5G3YA 5E3HA 1NLYA 1MT0A 4WA7A 4C0BA 1E2NA 1TUEA 3L8ZA 3PXGA 4GNKA 1L7VC 1Q1ZA 1LFDB 2WJVA 2W0MA 1EX7A 1Z06A 3NH9A 2XNSA 3K70D 1U98A 3G82C 2VHJA 2Y8EA 3U61B 2ZE7A 5J47A 1FQJA 3QPUA 4HZUB 5KYKA 2CBZA 2VF7A 4U02A 1YRAA 1OJLA 2GDJA 3MD0A 4DXAA 2PT7A 4XIGS 1W0JD 1TF5A 2ZJZA 4H1UA 3Q8XB 1N6IA 4PZYA 3WMEA 4HEJA 2DPXA 2X2FA 5A4JA 1II9A 2Q3HA 1MO4A 5L3SB 1Z29A 1Z0JA 2B7BA 2CLSA 1J70A 5DISB 5BYKA 1E0JA 2OAQ1 2XEXA 3AVUA 2GXAA 3CZQA 1X3SA 4ZCLA 2XZOA 5HZHA 1FTSA 3TNFA 4C0KA 3WP0A 3FDIA 3ZS9A 2ZS8A 4JLDA 4GOKA 2FNAA 3AP1A 4B35A 4QM6A 4TLEA 1E2MA 2QE7A 1A1VA 4NYIR 4A9AA 4DB4A 1P72A 4O0MA 3PUXA 4GT1A 4PQRA 2QPTA 4AYWA 1PVOA 1XBTA 2D62A 3KQUA 2WPDA 1TQ2A 3SQXA 3GJ6A 2XZLA 3K9NA 3D31A 2VTKA 3VR1A 3LX5A 2WM9B 5L3SA 1VG1A 3RWMB 4OI2A 3I8XA 1E9FA 4LUCA 4Q7MB 2CNWD 2OLKA 4HUQA 4HAYA 1Z6AA 4TL8A 1YVDA 1E2KA 1ZCBA 4XJXA 2FWRA 3AVPA 4TSFA 3AF1A 2HYDA 3I3SR 2JLWA 1J2JA 1TQ4A 1CR4A 2ZRMA 2IUUA 4DIEA 2H57A 3CNOA 3KFXA 3SFZA 3TK1A 1I2MA 3R8FA 3CRMA 5CYOA 4V0OA 3VNVA 2LKCA 3BK7A 5KSZA 1M1YE 2EFHB 4KVGA 1ZD8A 4JVNA 1AIPA 3TAHA 4HZIA 3SYKA 3U7HB 3LBHA 3OIWA 3CRW1 3WYFA 5KNCA 4K46A 1BMFA 2ZUDA 1KJYA 1IM2A 2P6RA 2Q0HA 2WKQA 2OE2A 4Q00A 3A6PC 2FPMA 1CJVC 2IYYA 1XTIA 1YE8A 2GJSA 2WMOB 2C9OA 4F7WA 3GPLA 3MWKA 2EWVA 4FXPA 1SXJD 1KNQA 1X6VA 5AUQA 2FGKA 5AWFC 3WMGA 3L82B 1GRNA 3GEIA 1XEWY 3NIBA 4JJZA 4AWXA 2ZSBA 4B3GA 3S1AA 2V6IA 2AXNA 4LBWA 1MRSA 1RKBA 4KAXA 4QJ3A 3IPXA 1S96A 4LBZA 1RYHA 2AK3A 4PC6A 3IQWA 3KJHA 3MG9A 2Z5FA 4HAUA 2VIIA 1FZQA 4B6FA 1E9BA 1R4AA 2IK8A 1E79D 2WAXA 1F2UA 4M8NE 1MO5A 3VMFA 4NCHA 1S9HA 1RZ3A 2GF9A 2GKSA 5FFMA 1XD2A 2EVWX 4A36A 4E03A 2QI9C 1Z6TA 3LX8A 3QE0A 1Y3AA 2DFKB 1F5NA 4MYTA 1ZM4A 2XX3A 3KKPA 4TYQA 1UKYA 1QHHA 4URXR 2FDCA 1C9KA 1EFRA 3RS5A 1U99A 1IAQA 2FGJA 1G4AE 5EXTA 1SXJB 1CULC 2R65A 2BEKA 2PBRA 4LY6A 2JLSA 2W2XA 2PJRA 4FMCF 4BZPA 2KE5A 1YRBA 1ZNWA 4XSGA 1S3GA 1SQ5A 2FZLA 3BORA 4M1KA 3LBIA 4NPHA 1O3YA 1SZPA 4YXWA 1TADA 3HPRA 2KJQA 1T3SA 2IWHA 1MKYA 3D6TB 2VEDA 2F43B 5JEDA 5K8TA 3SC3A 1XWIA 2G1KA 2XITA 1FPMA 4MDEA 3UMSA 1WE2A 1G64A 1KO5A 1KO7A 2BDTA 2E1RA 2H5EA 2ZI7A 4Q4AA 4NCNA 1N6OA 3GQBA 4RZ3A 1G291 3GLHE 3QKUA 4B73A 1M7GA 5SZIA 3SJBA 3NC1C 2BMFA 3T1VA 5JEEA 4KYUA 2WWFA 1DELA 1GSIA 1HH4A 1P62B 3KKQA 2FG5A 1Z07A 2OCBA 2MMCA 1MABB 4PO1A 1N6PA 4LOAA 3IQXA 2B21A 4IOJA 4JLVA 3I92A 4NMMA 2IUTA 4M0LA 3REGA 4EFNA 4RCZA 1SVWA 1GM5A 3IEVA 4URZR 2IBMA 2X1VA 2F43A 4FIDA 4D6PA 4LHVA 1Z0AA 2ZR7A 1CIPA 4PPGA 1H8HA 3B13B 3OIUA 5C4GB 4A8JC 5CDFA 3QF7A 5AJZA 3VKGA 2ASEA 4DBLC 2EYQA 2ORVA 5AUNB 3EIHA 4LYAA 3X1DA 4C0AC 3VR4A 1DG1G 4DDWA 1W46A 2WZQA 3VKHA 4PQYA 1AQUA 1Q1BA 1ZM2A 2GXUA 4PZLA 2OAP1 2JJ1A 2D7CA 2CK3A 2VP9A 3Q72A 3ZVNA 2ZU6A 2XOKD 3U2QA 3E70C 4TT3D 2ZITA 3FMPB 4YMSA 1QG2A 2FH5B 4TT3A 3THOA 4MYCA 3V9PA 2J7KA 5DYIA 4ZI3A 5FOUA 1JR3A 3HU2A 2QY9A 5LB4A 4P3YA 3R8CA 3B9QA 4X8MA 1IXZA 2UZIR 4QGFA 1RFLA 3B60A 4TLCA 4UNPA 4I1VA 4I1UA 3WYGA 3IIJA 1MR3F 5TY0A 4ARZB 4A8JA 5IK2D 3GJ0A 4BASA 3U60B 1YZGA 121PA 4JKIA 4EJSA 3CM0A 1DVRA 3U7GA 4C30A 1OFHA 5DN6D 4E22A 4PXAA 1JAIA 2AK2A 1CBUA 4PO8A 5G41A 4Q1AA 4GPTA 3U3OA 5LDDC 1QVAA 4LBYA 2HV8A 1BO6A 5FOWA 3W34A 1VKJA 2BOVA 2J1LA 2QPAA 2ZI5A 2J3EA 3O8DA 3PVSA 3K1JA 2CDNA 1ZMXA 1K6MA 3SHFA 5FPHA 1N6KA 4IOLA 1XTKA 1VPLA 2BKUA 4DT1A 1TPZA 4Z54A 1PLJA 3N5CA 4RJLA 4PHGA 4D25A 2EFGA 4XVRA 3QXHA 2NO9A 4I1OA 2AWNA 5FI0B 4NONA 4BE7B 1JR3D 4GOJA 1BYUA 4KSCA 3SEAA 1VYTA 4OHWA 5KNBA 1JXMA 2QORA 4QBHA 3ZGXA 4F93B 1FL9A 4UXIA 3IDQA 1G3MA 2G3YA 4DKXA 1W36D 1ZUIA 4EJSC 2GBLA 3MJRA 1A4RA 1CU1A 4MA4A 4LJYA 4JIMA 3VQTA 4BWYA 4FMDB 4DDTA 4QRHA 4W5JA 1ODFA 2ZRIA 2XOKA 5F98A 2BKEA 2CLDX 3C16C 1VDZA 2VLIA 2F9MA 4N0DA 4B32A 2I3BA 3ZH9B 4BQSA 2GF0A 3QXXA 1T8TA 3SJZA 1Z6XA 1OW3B 4B74A 1P9RA 3ZIAA 3QKTA 2V55B 4B3BA 1CS4C 1R2QA 2V6JA 2ZU0C 3BFKA 3B1ZA 3FFBA 4FD2A 3CWZA 5FTLA 2AX4A 1ZVQA 2WWIA 4XH9B 4G1UC 1T9HA 2CE2X 3ICQB 4JL8A 1Q0UA 2J0UA 2XJ9A 2RKOA 1OT3A 1JAHA 3MAAC 4KITB 1OH8A 1CJKC 3I72A 4PHFA 3MWYW 4PC7A 2XSZD 3CKLA 5FBVB 4JJKA 3AUXA 5KTYA 1JNYA 1XD2B 3HPQA 1UJ2A 4YONB 2O8EB 4RD4A 1IY0A 1P4SA 4C2UA 1DAFA 1P75A 4I99A 1F3OA 3UG7A 1SVIA 1XNJA 1OXUA 4IDHA 3W90A 2MMGA 4XTCS 3CRVA 2BMEA 5F9HA 1S2MA 3L8YA 3DL0A 2GEDA 4YQFA 3MUFA 3OZXA 4O2LA 2IS6A 1I4TD 2GJAA 2JJ2A 5TMPA 2WJGA 2CMKA 4X8HA 1D2NA 3A58B 4DSUA 2ATVA 3BAFA 2VA8A 2O8DA 2WWWA 3PEWA 2JIZD 2ATXA 2GCOA 3ASYA 3AF2A 1KIMA 4PC1A 5HCIA 4C0LA 3EWSA 1PLKA 1D5CA 4HDQB 2JLUA 4MKFA 1IN4A 2V1XA 2A5GA 3BD9A 3KUCA 2H17A 4F38A 3O47A 1NSFA 4IDPA 3OAAA 2C2HA 2RCNA 2GXQA 4BLPA 4BLOA 1EFRD 1NVVR 3A1WA 3TW8B 3ZDQA 4A0GA 1AKYA 4IVQA 3QKRA 2YHSA 3UK6A 2G6BA 5CJ2A 4PTLA 3GCGA 1UFQA 3NXSA 3A1SA 3M4YA 1AZSC 3U3KA 3GLFA 1NBME 3AVYA 3O8BA 2O8CA 4GI7A 5SZJA 3K0SA 2WWHA 4EUNA 2HEIA 2YKGA 3RHFA 2XXAA 1W47A 3PEYA 2HCBA 2P5SA 3K0FA 3KJIA 1G6OA 5JJKA 1HURA 2B92A 2NQ2C 1EG7A 3I62A 1Q20A 2MSCB 1KZGB 2B8WA 3RLFA 4F4IA 3LO5A 1IBRA 1ELOA 1ZM3A 5FBQB 5B2ZA 1EX6A 2YWEA 4R98A 5FR1A 3B85A 3NHAA 3AVWA 1UBFA 1RW4A 1HEIA 2Z4SA 3EC1A 5EP3A 2X77A 4B43A 2P0EA 2IF2A 2F1RA 4EQ6B 2ZI9A 3H86A 5J4LA 1MABA 4ILEA 1J8MF 3RC3A 1TL7C 3J81k 2VH5R 4MGIR 1FP6A 2FSIA 4M1YA 4QJ5A 4TYWA 3B9PA 1BMFD 1TQ6A 1W44A 1WP9A 1SVSA 4ON9A 4ZKDA 2ZTSA 3BERA 5KUTA 2QMHA 4LJ9A 4FWTA 5FBWB 3VX3A 4A82A 1JR6A 2CL7X 4JLOA 1U90A 3AVQA 1SXJE 1N0WA 2ODEA 3SDZA 2V7QD 4DCSA 1R5OA 4TMZA 4HLCA 3EIQA 2V9PA 4NL4H 1ONBA 2FSFA 3UMFA 3K0CA 2NPFA 2V54A 2BJWA 1BKDR 4LV5B 1ESMA 3LRPA 2ZRBA 2XZPA 4DLWA 3B1VA 2H92A 4UNQA 3ZQ6A 2WWGA 4JSYA 3TR5A 3NBYC 3P32A 5LPNA 4QM7A 1UDXA 2P67A 1ZUHA 5IF9A 4ZKEA 4RCYA 1S0UA 4TLBA 4B44A 2CCJA 1QHIA 2GZAA 1G8GA 3BH0A 1IN5A 2VP0A 3SS8A 5JSZA 1GWNA 5HKKD 5JI2E 1E2EA 1VECA 3LWNA 5EXSA 3O8CA 4Q9LA 1FQKA 2Q3MA 3B1YA 1LVGA 1VHTA 5DNYB 1IY1A 5GJWC 1XXHB 2O8CB 1WXQA 5TV2A 3AGQA 3P26A 3QXSA 4I81A 5J40A 1AS0A 2OM2A 4JBXA 4WZAE 3KQHA 3CRQA 4CT4B 2N1BA 3W6OA 2BVNA 4K81B 1C1YA 4NCJA 1H8EA 4JBWA 5CLLA 2BBWA 2BHRA 2ZUCA 2QQ0A 1N5IA 1G5RA 2IYRA 421PA 1W7AA 3CUEF 1Z6GA 2OV2A 2P65A 2A5DA 5L3VA 5E7MA 2RGCA 4ERNA 4Q7KA 4JZKA 4OQLA 3ZD7A 4Y0VA 4URUR 4A0RA 5KSPA 3TUIC 4CRWB 3RS0A 4D4JA 3KQNA 5FBLB 3K8YA 1VIAA 1E2HA 2ORWA 3GP8A 3NBZC 5HTKA 1E3MA 4KLZA 3EW9A 3K0EA 4MKGA 3ZZUA 1EESA 2HDNB 4B2PA 4B33A 5ELXA 3LV8A 3FKQA 1KYIA 2W0SA 3AKCA 4Q18A 4Z8YA 1FP7A 4MKHA 3IGFA 3KXLA 5AJVB 5KDDA 2WKPA 2ZROA 1AS3A 3FB4A 4D26A 4NDZA 1KO4A 1R8SA 1YZTA 1ZRHA 3FE2A 3D8BA 2KI5A 4HAWA 4IRUB 1BOFA 2DFTA 2A5JA 2GTPA 5IDVA 1DS6A 2H18A 2V4ZA 2EFDB 3GFPA 2HJVA 4RD2A 5JMTA 1WBDA 4ZDWA 1D8TA 1OHHA 3IPYA 2Z43A 3CPJB 4B3DA 3SOPA 2A3RA 1DTSA 3LNCA 3K9HA 5FOTA 3IILA 1U0HC 3RRYA 3LY5A 2QA5A 1GAJA 1KDRA 4MRVA 3OFND 1P2TA 2J45A 2ZSDA 5FL3A 3VFDA 1G5TA 2IYUA 3HJNA 3WHKA 2NTYC 2C03A 5B57C 2IHYA 3EIEA 1V5WA 5D3MB 1RRGA 1VYUA 3H0KA 3QPVA 2VP4A 1VCNA 1XJ0A 1AGPA 1KSFX 1OYYA 4Q19A 1G3IA 2Z4RA 4J0QA 4TMWA 1W36C 2DFLA 4KHZA 5BXQC 3ZJYA 1E0SA 2IYSA 2HUPA 1P2UA 2AN9A 2GZHA 4QJ4A 1JQLB 4O2RA 3T5DA 3ZQJA 4EAQA 2QTFA 2ZS9A 3TQCA 4ZCMA 1G8PA 1VIYA 4FMDF 4G5GA 1A2BA 2WBLC 1N6NA 2WWXA 3RABA 2BBTA 5JSZB 4Z8XA 3K0CC 5AJYA 4LSGA 1P2VA 1UEJA 2C77A 4KCGA 2YNMA 4MITA 5FPKA 3G0HA 3SR0A 3I1FA 3CRRA 3PEVA 3WRYC 4DEXA 2OLJA 2Q21A 2W2TA 5HE8A 4LYHA 4NKRA 3QEJA 1DAHA 3HP1A 1I4DD 4PC2A 3EPHA 1E2JA 4OQMA 4LHWA 3FVQA 4QHTA 4KODA 4JSTA 2J5XA 4I1SA 1F2TA 4BFZA 3U44B 1ZIOA 2V8OA 2YYZA 1GDDA 5DI9A 1ZD9A 1GOTA 1F48A 3HYTA 2O8EA 2J0QA 4OHVA 1XU4A 3PFIA 4HAXA 2QAGC 3FHOA 1N5LA 2BWJA 2W6IA 3RRMA 5C18A 4Q9KA 3U6KA 4KFUA 1HY3A 1E99A 2JLQA 2OFXA 1T3HA 2FPLA 2QU8A 3N2EA 4KFTA 1XXHE 4NYMR 2XGJA 3H2YA 2TMKA 3AEZA 2ZRAA 5H70A 1Z0KA 1D9XA 1L2TA 5BYJA 1Q44A 2FPKA 5BQ5A 4Q1CA 4FMCB 4A15A 3QG5A 3T1QA 2B7CA 3LD9A 1HT2E 1AZTA 1E6CA 2PLFA 3E2IA 5DI3B 5EP1A 2I1VB 3NHBA 2DHRA 1VYVA 2JIZA 3CB4A 1CR0A 4TL9A 1CF4A 2FV8A 5TVKA 4Q47A 4RD6A 1IONA 1EK0A 4AK9A 4AD8A 2JJ2D 1HYQA 3X1XA 4MQBA 3LFUA 5JI3E 4Q1DA 4V0MA 2ZYWX 3KXKA 3MGCA 1NY6A 3KKOA 4JMPA 2WIBA 1R10A 1E2GA 4AURA 4OHZA 5CDFE 1WF3A 2FOLA 1DEKA 4BEJA 1KJWA 4EDHA 5H68A 4BUJA 5L3QA 1DO0A 1PZNA 5P21A 4IVRA 3KL4A 1T0HB 3VR5A 2JLZA 4XWAA 3AVTA 3X1YA 2AKAB 4YMVA 4CEJA 1II8B 4FMBB 2CXXA 2G0NA 1COWA 2R6GA 4NBSA 3ZZTA 1RC8A 2GCPA 3KZ1E 4JLMA 4US1R 1IN8A 1W4RA 2X2EA 3UG6A 4C7OB 1XX6A 2IF0A 3OEHD 3TVDA 4ZIRA 3FYHA 4N3NA 2ZRGA 1WCV1 4C0JA 2O52A 3CW2A 4JLKA 2KBFA 4OHYA 1KKMA 1XCMA 4BLSA 4RFSA 1VMAA 3GLHB 3RANA 3QVVA 2N42A 5JJIA 2GILA 4US0R 4MRNA 3PITA 2ZR9A 1M74A 3GFTA 1KMHA 3AQ4A 1TTTA 4G5SA 3EA0A 1P61B 1SKYB 3TBKA 3C7KA 2ZRKA 3P27A 4OKSA 5FPTA 4TMTA 3T12A 1ZAKA 2H7VA 2VSFA 4MRRA 721PA 4ASUA 4E09A 1TAGA 1P7CA 1WRBA 1Z0FA 4RZUA 1QHYA 4OL0A 3I5YA 2DY1A 2GJKA 5L3RA 1ZC3A 3PUVA 1OV4A 2ZYVX 2EFEB 4M21A 4M9SA 1P9WA 2CHGA 4EPTA 3F0TA 5B64A 1UDWA 1Z28A 1GRRA 5LD2C 3NTUA 4QBGB 4RKEA 2F1IA 3IBYA 4G5RA 3I73A 1Z22A 2ZYUX 2CL6X 3FKSA 4ACAA 4U5XA 2CE7A 5J5CA 5G40A 3CPHA 3BXZA 3MRSA 3T06B 2ZE5A 3RAPR 1DARA 1G7RA 5KHOC 1G3QA 2FU5C 3A1UA 1NJGA 2J0UB 3T34A 3TW4A 1U8AA 5EZ6B 4EFMA 4KO8A 1AKEA 3CF2A 5EXPA 1OE0A 3QY0A 5J4KA 2KB0A 1MH1A 2BCJQ 3GLHA 3HR7A 1VHLA 1XMIA 1QBKC 4HB4A 1PUJA 5TB5A 1T5IA 4UXJA 3K0AA 3PUWA 4U7DA 1IHUA 3RYTC 2ANCA 4R71A 4Q4HA 4ACBA 1X8KA 3NKVA 4JL6A 3GJ5A 4IJMA 5IK2A 4HUTA 5CM9C 1NNEA 2BM0A 2HLDA 2IS1A 1FNMA 4BLQA 1I4LD 4HAZA 2W00A 2ZETA 2AR7A 1XPUA 2IXEA 4F91B 3DM5A 2RGDA 2QTVB 2WOOA 4CEJB 1XCPA 2C95A 2VQSA 3AM1A 3FHTA 1YU9A 1DAGA 3NC0C 3PCRB 1TMKA 2EQBA 4JVMA 5KPJA 4IXNA 1KI1A 2IA5A 2QMOA 4TYNA 3AKDA 3B5JA 5EXXA 4OJKA 3BE4A 1UM8A 2CCGA 1UADA 3RC8A 1T91A 2YJTD 4B75A 1GRQA 4QBFA 4B34A 2Q3FA 2RHMA 3QNUA 1W2GA 2QSZA 1UPTA 4URWR 3PR1A 3AF0A 5E95A 1MO3A 2DWQA 2FA9A 3BIFA 4P4UA 2MSEB 4C7OA 1KI2A 1JECA 2QAJA 3WP1B 2NOAA 2J7PD 2J9RA 2QL6A 3CNLA 3GLGA 1BYIA 3GLIA 5FPYA 4NE2A 5JWHA 4P32A 1CR1A 1LW7A 1XEXA 4RKFA 4B76A 1E79A 5DHFA 1J8YF 4LPKA 5D3MA 5AR1A 521PA 5CB8A 3GEEA 3EPKA 3REFA 1M7HA 3K53A 2ZQ5A 5FUYA 3BS4A 3WY9A 2ZI3A 4B2IA 1SULA 1XJCA 2W6JD 4D4MA 1GL6A 1ZU4A 4IDQA 4NH0A 1ETUA 2QMEA 4PX9A 3NEYA 4PSAA 4FI3C 4NU0A 1CKEA 1XD8A 3CH4B 3PUZA 4BGDA 4CEHB 5TARA 2D7DA 4WVFA 2OBLA 3D7MA 4JT2A 4DCTA 4FWIB 5FOVA 1S1MA 4IHQA 5EJEA 2JASA 4W5HA 3QUSA 2IYZA 5CM8B 2R62A 4M1OA 1E0AA 2GA8A 3H84A 4TMVA 4C4PA 3PEUA 3UXMA 5UKDA 4K8OA 1JEDA 2XTNA 4EJSB 4MH0R 3U7EB 4D2IA 2LCFA 4BFUA 5HCNA 1AJEA 1YR9A 1BS1A 1VCMA 2PX3A 621PA 3T35A 4DDUA 4UKDA 1E2DA 1XJQA 1Y63A 2QN6A 4GZLA 4RD1A 4TTPA 5FTJA 3AF3A 4Q1EA 3M0EA 3OFNA 2VHUA 3I5XA 2DYKA 2OUKA 1J90A 1U81A 1S4QA 3U5ZB 4ZDKA 3THXA 1U9IA 2QP9X 1TEVA 1HE8B 4QGHA 5FOSA 1E98A 3ASZA 1SVOA 3AB3A 1VG8A 2BBOA 2CNWA 1N0VC 1RE0A 1FUUA 5DO9A 2ZM5A 3KQLA 3K70C 1EFUA 1CTQA 3W3ZB 1YHNA 4CDGA 3TAUA 2WMNB 3ONWA 4IFEA 3X1ZA 4Q21A 2GJ8A 1E9EA 4HI0E 1U0LA 2PEZA 3CIOA 1W36B 2ODNA 1RIFA 2SHKA 1YR7A 1HT1E 4DSNA 1G20E 3BJIC 2IC5A 3Q7PA 2QE7D 4PSVA 4Q1BA 5TXGA 4Q7JB 5JS8A 3GLIB 4XVUA 3QF4B 2R6FA 2HCJB 5SZHB 1D2MA 3QG1A 4WXRA 1PJRA 1ANKA 2N46A 1Z47A 3LXXA 4RSGA 5B58C 5FTNA 2CHQA 5K8IA 3FFAA 2NZJA 4LI0A 4DHEA 2O8FA 1P2SA 4NCIA 4XOIA 1SXJA 2OXCA 3TR0A 4FCWA 3T61A 1TQDA 2JDIA 2QSYA 3DZ8A 2ZJOA 2D2EA 4IW3B 5BN5A 1XPOA 1MRNA 3OE7D 4LBVA 2RGNC 3CR8A 4WBSA 2REBA 1H8ED 4ZPXA 2G1JA 4BFSA 5K8LA 3AGPA 1AGRA 1NMYA 5HZKA 1QHHB 3TUZC 5L3QB 2QRNA 4DCUA 1UBEA 5DSZA 1E2PA 1G4UR 4TMXA 4TLDA 5FBRB 2IYQA 1Q57A 1S9DA 4PPFA 3TLXA 4LV6A 4PAOA 5BW8A 2YWGA 3BGWA 4NHOA 4A0HA 1CEEA 4L15A 2XNDD 2QEQA 2JJ8A 1OIWA 4EPXA 1SGWA 3UMRA 1CP2A 1CJMA 1OXXK 3HR8A 1U0JA 1XP8A 4A2QA 3E1SA 2ZSAA 2FFAA 2ZJAA 2VSXA 2WSMA 1U2RA 2G77B 3DPUA 3OEEA 5FTMA 4MGKR 4CW7A 1F6BA 2IS2A 1QDEA 2BEJA 5FTKA 2OCPA 4CGZA 1CXZA 4MYUA 2EWWA 4G0NA 1KMHB 2WJJA 4DCVA 1JBKA 1Q12A 5HPYB 2ECKA 1NVVQ 2ZR0A 2NO7A 3K9GA 1G6HA 3ZVMA 1CJUC 1CJTC 3CX6A 2ZXUA 1C4OA 2QZ4A 1GL9B 3CX8A 1P6XA 1SVKA 1W1WA 3NG1A 3Q85A 4PC3A 1ESNA 1US8A 3DMNA 1E2FA 2A7QA 4F4CA 4HAVA 2GJ9A 1KSHA 3ADDA 1KZ7B 3CNNA 4M9QA 3CPEA 3OE7A 4LRWA 3L0PA 6Q21A 1X8JA 1FX0B 2IYTA 4OI1A 5KDOA 1KK0A 4TYPA 1NLFA 2OG2A 3LW7A 2C04A 5JECA 3IHLA 3EZFA 1TF7A 4OHXA 4HUQB 4HLQB 1TEXA 2QG6A 2P6NA 4D4KA 2I4IA 3IO5A 3BB1A 1XFAA 1JQJC 2PCLA 2RGEA 4JS0A 1OPXA 2VYFA 4CEIB 2IYLD 3AVXA 4PAQA 4RD3A 1XEXB 4Q48A 3U4QA 5J4VA 2R8RA 5DLQC 3R7WB 1QHSA 4DSTA 4N0EA 3RSOA 2J46A 4Q5IA 2VL7A 1OXTA 3GLFE 2YWHA 2QAGB 1KI6B 3W8RA 1Z5ZA 4LGMA 4V02A 1G8YA 3SQWA 1KTVA 1UKVY 3PV0A 1GNRA 1R7RA 1NN5A 2JLVA 1DE0A 4OQFA 2F3TA 1Q1QA 5DYGA 3THWA 2H8KA 1KI3A 2XNDA 4NYIQ 4JLBA 1KMQA 5JRZA 1XMVA 5JWRA 1ZYUA 3A1VA 3UPUA 4JKYA 1WA5A 2JEOA 3FMFA 2GK7A 4DVGA 2FFHA 3UWKA 1HE1C 3Q5DA 4M1TA 2HXYA 2GRJA 2WVJA 1IOZA 4OBEA 4EPRA 4LC0A 4DEYA 4OK3A 1XEFA 2V7QA 4O25A 4DLYA 2GZDA 3Q5EA 4TWZA 1XMJA 2YVUA 2ZJBA 1G8FA 1UBCA 1E1RD 2PMDA 4DRZA 4UQOA 4EPVA 4KI0A 1KHTA 5CIQA 1G7SA 4NYJR 1NI3A 2OILA 2JLXA 3OIVA 3W9YA 1GFIA 1KI9A 3EASA 1N3BA 2QGZA 2WSSA 3BOSA 3DHWC 1EFHA 2PEYA 3P4YA 4LK2A 4HB2A 3UATA 4A8JB 1G7CA 3MLEA 4WXPA 1AK2A 1W5TA 5CK4A 1E9CA 4QNMA 1B0UA 1M6NA 5CJPA 3QI2A 1H65A 1VG0B 1OFTA 4LHXA 3UANA 4DZZA 1IN7A 3ADBA 1A82A 2AFHE 4C2TA 1OIVA 2Q9BA 3CF0A 3FOZA 1OXVA 2XSZA 3X2SA 5AUOB 4QG7A 4RVCA 3MFYA 4DLXA 3OESA 2W6JA 2ZVPX 1G16A 2CHVA 2C8VA 5C46F 1CR2A 2ZJ8A 2IEZA 3B8HA 1HQCA 3RWOA 4ESVA 4ZDIA 2Z0MA 5C2JB 3SNHA 4AKIA 4Z51A 4EPYA 5CYPA 3C8UA 3I32A 2FE4A 2QBYA 1I2DA 2YV5A 1K5DA 1NL3A 3AP3A 4TYYA 5GADl 1GKYA 1DG3A 221PA 1DOAA 1Z3IX 1EWRA 4YDSA 1E4VA 4DIDA 1Z0DA 3QOFA 2Q6TA 3OAAD 4B47A 2BM1A 2W83A 3BFXA 1YZUA 1L4YA 1XTSA 3QQ5A 1FW6A 1J7KA 1KAGA 3VKWA 5J4YA 4IFBA 4LDJA 1T4GA 3W5IA 1G3UA 2ZS7A 2F1JA 4JVSB 1JB1A 4V03A 1MOZA 3NBFA 4MDFA 2ZRJA 2B6HA 4LJ8A 2D06A 2GEVA 5HR5A 2GBLC 1T0JB 2OCYC 3LDAA 4WZBE 4BZQA 1RRFA 2RGAA 2IWRA 1AM4D 2WHXA 3UIEA 1XZPA 2Z6VA 4OJQA 2IYVA 4LJ6A 3TGPA 2H1LA 1N5KA 2DWOA 2PZFA 5AK0A 3NVAA 1KK3A 1P9NA 2HLDD 1JEEA 4QL3A 3MWJA 2BIFA 4UJ3A 1KOFA 3V4RA 2WIAA 4OQNA 5KNDA 2BBSA 1YZNA 4PR0A 1NN0A 1YZQA 1N6RA 5A5GA 4BFTA 4M2LA 1GG2A 3GFOA 3UWOA 4DLRA 3R9XA 3GJXC 3LH5A 4C0QC 3C14C 1BH2A 4QOSA 5IRCD 4LWZA 1KI8A 4TLAA 4US2R 2QQEA 2W58A 3FPAA 1M7BA 4LJ5A 4Q9JA 3C5CA 3L0IB 1W4BA 2ODBA 4IXMA 3PG5A 3GJ8A 3EZ2A 2E9SA 1RPZA 2BMJA 3VR2A 2KWIA 2ZJ5A 3RDPA 3ND8A 1NLZA 3FKSD 1R5NA 3ZIAD 4IEIA 4GZMA 1OH7A 2O8BA 3K70B 1R0WA 2VP6A 1XMSA 4AY2A 3CLVA 3ICEA 2XAUA 2QPOA 1KO8A 2A9KA 3BFVA 4MKIA 3GEHA 1NN1A 1XTRA 2JGNA 3ND9A 3JVVA 3SBDA 1V43A 2NO0A 2A5FA 5DGXA 1LB1B 4BLRA 2IL1A 4HB3A 4IDNA 4PSKA 1LS6A 4DWJA 3JVUA 1UBGA 3EPJA 3C5HA 5EUMA 1M8PA 4L5BA 5EQTA 3SYLA 4MRPA 2R44A 4TL6A 4AI6A 2JJ1D 2RGBA 3DVLA 3ZZ0A 1NF3A 3EZ6A 2RGXA 4GFDA 4A92A 4V0LA 4BEBA 2FJUA 4EFLA 5L8VA 4L9SA 3HWSA 3GD7A 5DHAA 3U4QB 2LWIA 4ABYA 3LVRE 3THXB 1UKEA 2D4HA 4AKGA 1E0KA 2GCOB 2L0XA 4YC7A 3W6PA 2DB3A 3TH5A 1WDTA 3MMPA 3SHWA 1G19A 2GVDC 4Q1FA 2XB2A 1DAKA 3AV0B 2RHDA 4C0HA 4D82A 5FR2A 2GESA 1FX0A 5ANRB 3T1TA 1AN0A 1EFCA 3NBXX 1NIJA 5DN6A 5BN3A 2ZI6A 3U3JA 1QRAA 2OESA 2X8AA 4PPQA 4JLJA 5BN4A 4HB0A 2IYWA 2ORIA 1F2UB 2IT1A 3A37A 3IIKA 3B6EA 1W0KD 4YDHB 1DADA 2VO1A 2ONKA 4KVAA 3CWQA 1HTWA 4IOMA 5E7JA 3A8TA 4QHSA 3TSZA 3VR6A 3NEJA 4YXWD 3LLMA 1WQ1R 2JAQA 4Q4JB 4GDFA 3AUYA 1KAOA 2DWPA 4Q4AB 1G5PA 1XF9A 3AF4A 4QFMA 1U8YA 1OFUX 2GWHA 5LBIA 1NN3A 4OYHA 4WOPA 4QXAA 2GAOA 4GMXA 1YZKA 4Q4LA 4NZYA 5E4FA 4GP7A 4RFSB 2NMVA 3DMDA 3G5UA 1ZP6A 1E96A 2FZ4A 2WV9A 2NZ8A 3THYB 3NH6A 3DOFA 1CRQA 1N2CE 1MV5A 2W2VA 3EXAA 4JVLA 4R7ZA 2ERXA 4PHHA 1NRJB 1JPJA 3MJHA 3N2IA 1L8QA 4LYFA 1P73A 3CX7A 4PFSA 2WJHA 1R8QA 2UVQA 1BIFA 1HV8A 4Q4JA 5CITA 3U6BA 3RS7A 3VR3A 3ZVLA 4DT1B 2HF8A 3R9WA 1LTQA 1RJ9A 2QBYB 3BC1A 1ZW6A 1YKSA 5E7IA 4P4TA 4RZ2A 1G1MA 2Z83A 2O0JA 3BRWD 5EP2A 3THWB 4Q9HA 4GMDA 3VTKA 2PZGA 5EE1A 1G7TA 1KSJA 1VCIA 3TE6A 3U7FB 2FMXA 1HQYE 3AP2A 3WNDA 2F1HA 2A78A 3B1XA 4B71A 2VHCA 1OKKD 5FPSA 1XXHA 4A0FA 2OXRA 2IX3A 5JZVA 2VHQA 2VF8A 2ZRNA 4D0NA 4AG5A 1E1RA 1NVXQ 5F2EA 4WAUA 1GKIA 2RB4A 2YZ2A 1DAMA 2BJVA 1ZM7A 1P60A 4GP6A 5FH9A 2V1UA 2FSHA 1NIPA 3QIAA 4JT4A 2F6RA 1K8RA 4A6XA 1XTQA 3WNCA 2AD5A 4FW9A 3SYNA 5H8WA 4HLUC 1KGDA 3L43A 2W6ID 4U00A 2ZAOA 3TRFA 2XB4A 3SI7A 4CYMA 1OFIA 1OB5A 3RS3A 4DUGD 1DPFA 2OFWA 5HE9A 4LHYA 2XTMA 3KQKA 3VAAA 1O87A 5C4MA 4P31A 3ADKA 5AJXA 4MRSA 1JI0A 4M1WA 5FUXA 4JLNA 1G9XA 4MUAA 4OK6A 3KXIA 2CJWA 1ZUNB 3RRZA 3UKDA 3THYA 1DO2A 2IS4A 4KU4A 3KKMA 1Z83A 4XWOA 3IKJA 4P4SA 1E69A 5GJCA 3EA5A 3HYRA 4LPSA 1E2IA 2F7SA 3BB3A 4D81A 4XSHA 2IXFA 2CL0X 1LNZA 3DO6A 1Z2AA 5FL7A 4IEEA 5LB2A 2RH5A 4GL2A 3EZ9A 2WSSD 4QC2A 4FCTA 4PQFA 2CLCX 3LVQE 2XXAB 1A2KC 2OBNA 821PA 1LF0A 2OSBA 3W6NA 2F55A 4URYR 1OIXA 4HLDA 2GETA 5GJVC 5B30A 1DAEA 5KSYA 1CLUA 1ZNZA 3EX7C 1E4YA 4RFVA 2NIPA 4ITRC 4TTQA 1IJFA 5KDLA 4MYHA 2Q9CA 1XDBA 4EPWA 2D2FA 1X1RA 2QP3A 4DLTA 4A2WA 2D74A 1NY5A 4ESHA 5DH9A 3IHWA 3I4LA 4Z1MA 1KJZA 2G9NA 1W4CA 1A5TA 4X8LA 1NMXA 1PLLA 2C98A 3A4MA 5HKKA 1GKUB 1TNDA 2RAPA 1EXMA 2BC9A 3LQQA 4IDOA 1QZXA 3OEED 4DDVA 2C78A 4B6EA 2ZRHA 1T3LA 3N70A 4UNSA 1TU4A 2OEPA 2DCUA 5SZKB 4Y0AA 1SKYE 2FSGA 1DBSA 1KNXA 2WPDD 4D4LA 1W4AA 4P4SB 1XPRA 1X1SA 2O0KA 2FFBA 2PZEA 4Z1MD 1ZC4A 1FUKA 2DBYA 3EG5A 4AIIA 1D2EA 4IKEA 3ZYCA 2F3RA 1JR3E 5GVRA 2QTHA 1TUIA 4MUBA 5IHPA 1E9AA 2R9VA 5DE3A 2ONJA 3QSYA 1WB9A 4TZ0A 3LXRA 5CIWA 1ZM9A 4YMTA 3NDBB 2R6CA 3A4LA 3JZMA 2OZEA 2VBCA 3DM9B 2BMDA 5JRJA 1N6HA 3P20A 4V0KA 4YMWA 1FMLA 2VPPA 4M9ZA 4DSOA 5EE0A 4KBGA 5BWMA 2HJGA 5JWOA 4DLVA 2JDID 1W0JA 2GHIA 1R0YA 4AYXA 4S35A 1SHKA 3SBEA 4KJZA 4S2EA 1NBMD 1KI6A 2EW1A 2OFOA 3MSXA 2YINC 3BBPA 1E9RA 3SZRA 2ZRPA 3OF5A 1EFTA 4HLUA 4X8OA 3GLIE 1AQYA 2QRZA 3KUDA 3CH5A 2RGGA 1QF9A 3DKPA 5C1BA 1ZIPA 2DFNA 2REOA 1YR8A 2QUZA 4NYMQ 2WTUA 1X86B 5DI3A 3TIFA 4WIAA 2PX0A 4B3XA 4L8GA 2ZVQX 4LZZA 5EZ5A 4QNRA 1Q1EA 1OSNA 1P5ZB 3FWYA 2PCJA 1JALA 5FOXA 4JL5A 4M22A 4OI0A 4TTRA 1KY3A 4GRAA 2WICA 3CO5A 2IW3A 4ZO4A 1FFHA 1II8A 3Q7QA 3EWAA 4ZDJA 3VU9A 1KI7A 2VRWA 1U8ZA 4KYIB 4F92B 1GIAA 3VHXA 1IY2A 1ZNXA 2HXSA 2QGNA 3JZAA 3NDPA 4M1MA 5M04A 1GILA 2ZE6A 4TQAA 3ZS8A 4DB2A 4FINA 3GLFB 1LF5A 2FX3A 3QEOA 1UEIA 4KLNA 4BECA 3DDCA 1S8FA
chains in the Genus database with same CATH superfamily
1XZAA 1QXSA 4CQNA 2RAVA 1NG9A 3FMOB 2CEAA 3GOHA 4MUKA 4O3MA 4MWTA 5I45A 3DYIA 1V3QE 4CM9D 3JSAA 3IEUA 3HDHA 4AYTA 1IMOA 1M2JA 2J0VA 2XE6A 3H4TA 3MWLA 3MBIA 3P0EA 4UFNA 5DGTA 4ZV4A 2CSXA 1Z8DA 5A62A 1RJEA 1IXSB 1A9XA 4DMCA 4QGAA 2C96A 2PMCA 1UKBA 1GPAA 1D9ZA 4LN1A 1IVSA 3LBNA 4OA8A 1HA3A 1F14A 2DUMA 1CQXA 2TMGA 5FI1B 3K0FB 4F4HA 1NP6A 4K9KA 4IF6A 1OA0A 4R54A 1UFOA 5CVTA 4XIFA 1FFBA 4IVNA 4NQZA 3UH1A 4CCYA 3UO8B 1FDTA 1JXOA 1N2GA 1DIAA 1ZMRA 3O8LA 4N5LA 4OM8A 6YASA 5JZSA 1N9KA 2FWNA 3ZUGA 3E9RA 1E9SA 4W6ZA 3MTDA 5CPBA 3S5UA 2VZEA 3BJRA 3EVNA 4LF5B 1BXGB 2ZZKA 1US8B 2G40A 3HY4A 3M1YA 4FDAA 3VPFA 2J3LA 1TZMA 1FJXA 2YXEA 3VO2A 2AG6A 4LJRA 1LJUA 3AVOA 1TCVA 3NV9A 4MV0A 1SCUA 2CXTA 2GM4A 1B8UA 4D3YA 4YJ3A 2Z1MA 4NZPA 16PKA 1X8LA 1C7RA 4TS3A 4K03A 4BGIA 1NXQA 1OYWA 3U26A 2FOIA 4YAGA 2GVZC 2LCIA 3EEYA 3GU3A 3GRYA 2GZ3A 3JWPA 3PSHA 4GEGA 1EK1A 1HOTA 1GKKA 3I45A 1I1HA 1XQ6A 1PKEA 2P5UA 5AKJA 4YUYA 5JXGA 5KNBH 2YWJA 1CY0A 1V16B 4U8HA 4ANFA 1E60A 1KRWA 1GUYA 2KX7A 2QT1A 1B1AA 1YE5A 2WC1A 2Z58A 1CHDA 5KHAA 4MUHA 3H6HA 1IQRA 2E6UX 4ZZ1A 3FCOA 5CK5A 6NULA 5LOVB 1OH6A 4PXYA 4JLWA 1IE3A 1SN7A 4NG5A 5IXJA 3G0BA 4DGQA 3L2OB 2ZG6A 3TOXA 5B3JC 3H8VA 5DRTA 1ZVKA 1M76A 3NP7A 1IBMB 5GV7A 2I7TA 4EMUA 1KKLA 1O8BA 5CNJA 3Q0IA 2NQTA 1NKTA 2QMUA 2RHLA 3FHLA 1J4AA 6ABPA 4KSBA 2H06A 1F8XA 2Y05A 3FOAA 4I5FA 4D3XA 1JTEA 2B20A 4JYZA 4OB6A 1I2AA 1QQ7A 1O6ZA 1CY2A 2HAEA 4FDMA 2GK6A 1BVYF 3E27A 4CEIA 3AVUA 2JI4A 5D5PA 2BLLA 2FWAA 4I5DA 4QBIA 3O4FA 5L51A 1JI3A 3VGPA 4TMKA 1X7ZA 5AKHA 1AH2A 2CNBA 3N53A 3KELA 2QHXA 3IKLA 3K1AA 4GVPA 5HBGA 3RYFA 3OQNA 5FA6A 1QPZA 2ZYSA 5KVCA 2PUCA 2Y0BA 4ZZ3A 3QHAA 4D96A 1QMPA 1IQPA 2W2KB 2X2OA 1PBNA 3ZWPA 1M0WA 3AJRA 2V4UA 4E5MA 4TSKA 4ZYTA 5CX4A 3BJEA 3PS9A 4JOSA 3GAZA 4IOKA 3F3SA 3SJCA 3FNIA 2FKAA 1KF0A 2V7GA 2Y2VA 5IAEA 1ZSNA 3T8YA 5GVSA 2HSZA 1XTBA 3NZEA 4IIVA 5CDSA 3FSEA 2EP7A 3GLGB 1D5WA 1R5BA 3H5TA 1Z4JA 1NVTA 1OF1A 3LLSA 4XQ9A 3RJ9A 1E32A 1KIFA 4KJXA 4C7VA 2GK3A 4R0VA 5K0LA 4JVOA 1O6BA 4INJA 2BEUA 3OQMA 5CU7A 4FT2A 4GQBA 2WDZA 3A10A 1KDOA 3TKLA 3OZWA 4P82A 4F6RA 1O5TA 1QHGA 3TLBA 2D5CA 1N8TA 3V7FA 3F6BX 3PQ3A 1VSUA 3HO6A 4UHFA 4P92A 1VG9B 4UXHA 2R6ZA 3PQEA 4LYGA 4XVQA 4MMYB 4JOCA 5CLQA 1ENPA 1F0PA 2FPGA 1CQIB 3O82A 2OBFA 2EGGA 2YW9A 2CMDA 2XCLA 3W06A 2JATA 1SRQA 1WUKS 3X3HA 3PUYA 5B1SA 2LCQA 1U94A 1E6UA 4BQOA 3RVNA 4ER0A 3C24A 3PXDA 4I1YA 5JR3A 2C9YA 5FUVA 3EGEA 1PP4A 3O3CA 3B70A 5AM2A 4W8HA 4UUAA 3HU1A 4JB8A 3B7GA 2CFCA 3C3YA 4FFWA 1E2LA 4RWEA 1PU2A 3QENA 4YJHB 3QSGA 2H3HA 3T9EA 2GEUA 1DBVO 1H2ZA 3KX2A 1T0BA 2C7VA 1KO1A 4AKEA 3IUYA 4XVHA 3BGOS 4Q9IA 2YOHA 3V4VB 4DC9A 3OZTA 3BD6A 5U9CA 4O3FA 4E33A 1J42A 1XCGB 4G0QA 5CT4A 3V4LA 4ALIA 1CYDA 2WJZB 4R2MA 2YC2C 2Q0SA 2V8BA 2UUOA 5ENVA 4NCKA 1E1QD 2K5UA 4W5WA 2VPQA 4BV9A 4WY2A 1Z75A 4FHFA 2PL3A 1ML3A 2QYTA 3E7FA 4QICA 4M9XA 4RJKA 3KQQA 1Z2EA 4YQEA 1XZCA 3D3JA 1NBOA 2RDMA 5B6IA 1ATZA 4DMHA 5CYGA 1Z33A 4JYBA 5KSOA 1QIGA 3QBVA 1N5MA 4GQAA 4UVDA 4QPNA 1UMKA 3HFRA 2JGRA 4BLWA 1XRNA 3RSGA 3T4PA 4EUHA 5HQ3B 3MJTA 4IJWA 1ZCJA 1CB0A 1KDPA 3WMWA 4CKBB 3L40A 1AY0A 4NBNA 4EVQA 1R0XA 3D3NA 2OBYA 3FI0A 1JKXA 3BCSA 1IIBA 2P3OA 7MHTA 2VP5A 1TGVA 2MIIA 3CLSC 4N7MA 4B1FA 5HM6A 1F9AA 1H66A 3GUZA 3R44A 2WJ3A 1I2BA 2O2JA 4LJAA 7MDHA 3TF5A 2PT5A 4E07A 2OWEA 1R6AA 1W76A 5TMEA 1RXVA 3RYFB 1JF8A 1E1CB 3ZOZA 1IXRC 3ODGA 2ZYHA 4UVEA 4BFXA 5TS3A 2ISCA 1BU8A 1IOVA 1ZH2A 2CLKB 2Z2ZA 3FPJA 4HGRA 4L9RA 1KXZA 1OLOA 3EUFA 2BYTA 2UUCB 3IP9A 1GTRA 2EHJA 1UBLS 5JCOA 1UFKA 2ZJ2A 1P3Y1 3T5GA 4H6WA 5DNAA 1GZ3A 1TXGA 4BP3A 5K8VA 5CNKA 2R2AA 2J5BA 4RQUA 1IBSA 3M6AA 4EATA 4ZU3A 1T36B 1VLZA 2A1TS 4FC7A 4YGYA 3T99A 4JB2A 1K8QA 2V74B 4GDMA 4L4UA 4M9UA 4EQ6A 4KO1S 4DG5A 1JG6A 5AUPB 5IVIA 2V0NA 1DC4A 3LQRA 3BIOA 2IXTA 1SBIA 4Q3DA 1XNQB 1VRCA 4BZXA 4AUMA 3WBFA 1BVRA 1MV8A 3PLNA 2ZIZA 3KDSE 1OYOA 3DZDA 1E94E 3FGNA 4GSYA 2JIRA 4LXHA 4BRUA 4EI2A 1TEZA 1SHZA 2ZJ3A 1EWQA 3IL2A 2J48A 2JD0A 2VK8A 2WIFA 3OEHA 4J1TA 5DWVA 2H1VA 5EE9A 4XVCA 1I7DA 3KYIB 2OORA 3TM5A 4FUTA 3GVCA 4OA5A 2HK6A 5JCPA 4PX3A 3U3RA 3TB6A 3K8QA 3UGKA 3UN1A 3DL4A 4QO8A 2G9VA 2V7PA 3FIUA 3H5VA 3JTEA 2ORYA 3AKYA 3MILA 2FLVA 3UJPA 5C9ZA 5D3QA 3P9ZA 1WD5A 2IP1A 3EFOB 3EH1A 5G4KA 1L4UA 3W3AA 5MHTA 4DNPA 1RYYA 2C5GA 3L41A 1D6JA 4G89A 3RUIA 1ZD1A 4YAJA 1IBCA 2WOJA 3QX9A 1XIVA 3UPDA 4IZ6A 2I4TA 1PJ3A 2GN2A 2Z8XA 1EBUA 5JMWA 5JV5A 1ACMA 3AEUA 1A7JA 1R12A 3NGLA 1EXDA 5C5DA 2OENG 2XCQA 4MP3A 2EU8A 3E9MA 2WJIA 4WHMA 3DOOA 3KB6A 1XUOA 2Z5VA 4K9DA 4IUYA 1VCOA 4X1KA 4BFYA 4RTJA 5IYZA 3EEOA 1HQDA 2Y0CA 3F2IA 3R76A 1J99A 2I4OA 3LE8A 1TM7E 1NRWA 2YWBA 1J0AA 4IV8A 3QZUA 1G3RA 5JFGA 4N82A 3U4CA 1Z26A 2WLTA 3R77A 4MO2A 1ST3A 4XM2A 2H4JA 4AMGA 1JKJB 3VXKA 1L5FA 2NO6A 4ZP1A 5JAHA 3EXG1 2SKEA 1KZ1A 3I0NA 4ZIRB 4FR5A 2HU7A 3QJYA 1ZGHA 5FWYB 4CKZA 3BXFA 2NAFA 5CLIA 3RLFA 1UP7A 1YR6A 2Q2OA 3OHMA 1OILA 5EWMA 2O06A 1NX9A 1N7IA 2FPOA 4I6GA 3WYNA 3HJGA 3ZWWA 1G20B 2HPHA 3AVVA 1QRRA 2EL9A 1TZKA 1YJAA 1GZSA 2GEKA 3WYAA 2CFRA 5LZ8A 3DG9A 3RVBA 2NZWA 2IU0A 3VSDA 4EW6A 4DJEC 5DSTA 1FS5A 1LX7A 1WKCA 1U2QA 1JJIA 4MW1A 1ESEA 4TL7A 2OCGA 4LX0A 1RYFA 4NJEB 5K01A 1TT5A 3UW1A 4FYWA 3V6LA 1RQNA 1U9JA 2DVMA 1E6EA 1QKKA 1SH7A 3IIMA 5CX1B 3PICA 2UZ3A 1NASA 1DNPA 1E1LA 1Y7TA 2QN9A 3R2JA 4OEHA 1F6DA 3DBIA 3R7WA 3HNRA 4WOKA 1U7TA 2R6HA 1ZDMA 3RVSA 2ORED 3PENA 4NRDA 4JELA 2B98A 5A06A 4ND1A 5K6TA 4L28A 5REQA 1XZQA 2C5LA 2DJIA 1N7HA 5M2QA 1NULA 3ANNA 1YQTA 2GJ4A 1W581 1A27A 3F7MA 8MHTA 3O2JA 1JU4A 5FUWA 4CF7A 4QKQA 1GNQA 4LCBA 5KI6A 1QR2A 1RJ9B 1CUSA 1VKRA 2QLNA 2HV9A 3OA0A 3B2QA 4WZAB 3TM4A 3HP4A 1H94A 2M6KA 5J5VA 1TKBA 4J1QA 4BV8A 1GPNA 4KR0A 1ZIXA 4B48A 4F4JA 3ROTA 1ZA2A 3VTFA 1YDFA 1GHTA 5CLHA 3ROZA 2V6MA 1YL7A 3LYLA 1JAXA 4UJ5A 4BN5A 1XD9A 1X39A 2DTXA 4L5JA 2Y1DA 4PAMA 4C2BA 2J9FB 3WB1A 2WYVA 3QFRA 3WBKA 3V4ZA 3QBDA 1BE0A 4HNVA 1RXSA 3KQWA 2Y27A 4P98A 1ZU5A 2B25A 3RHZA 4RKYA 2G08A 1LV7A 1JJVA 2PS1A 3MCAA 4PVCA 4F8EA 4LG1A 3JASB 3ZGVA 3OJFA 3B9BA 5D8DA 2O19A 4RA9A 1QVRA 5IH3A 4V1CA 3AY6A 5B1IA 1NZJA 3AI7A 1UKAA 3GMTA 1A8HA 1SZDA 1T6BY 1UIMA 2W7TA 3TRKA 2C7QA 3MUEA 2Q6KA 3L8ZA 2Q8QA 3V8PA 2HIMA 3WIOA 2A4KA 3PXGA 1RPNA 4EL5A 1MJGA 3OX3A 2L82A 2X3YA 1EX7A 1LV8A 4FU0A 4FDTA 5CT5A 3RVJA 2I7DA 2XNSA 4J7CA 3ZXIA 1R0SA 4YUZA 4RH3A 3K70D 2VHJA 3CZCA 4GE0A 2HIGA 4PV7A 4CM3A 4C5AA 1NUTA 3KL2A 4YRZA 3ANXA 3GW8A 5JXIA 4U02A 1SBHA 3NIDB 1PEKE 5U4QA 3W5HA 4RENA 3JWEA 2GDJA 2QZ9A 3EK2A 3MD0A 3T7AA 1QANA 2XWQA 3K2IA 2CFTA 2VATA 3UK1A 3R1IA 2X3UA 4AZ3A 1BQEA 1N7GA 2P9ZA 4PZYA 2YYYA 4LZLA 1SIOA 3KLOA 2Z2JA 1DGQA 1Y6QA 3KK0A 4ZMBA 3F74A 3OIDA 4NJMA 1MO4A 3FPFA 4L1KA 3V7YA 1Z29A 4R2LA 1Z0JA 1XPJA 4RLFA 1WP4A 4J91A 3M3HA 4Y1GA 3TZBA 4CKCB 2XEXA 2H2WA 3NT2A 5H4HA 5FBKA 2F9FA 4CHGA 5J63A 2VH1A 1HNNA 1X3SA 2QRQA 1ECBA 4HWGA 2XBMA 3TNFA 4C0KA 5I6DA 4LKOA 3TPZA 5DTMA 2CVOA 5I7UA 5EJ8A 3EZXA 2IHZA 3KAPA 2ZS8A 4WXHA 5HWSA 4LNUB 5DTRA 3WSWA 4EX6A 2H0RA 3JQAB 2FNAA 5KIAA 1BVUA 3CLRC 3FLBA 4QM6A 3V42A 2WWVD 5KINB 1P72A 4N18A 3DE5X 2VLBA 1QV9A 1ZGJA 1P7VA 3HN7A 3NRCA 3P2IA 4HFMA 1QV6A 4PWZA 1PVOA 2UZ1A 4FGLA 1QO9A 4X6UA 3ISVA 3NB0A 3ZQ4A 4F3KA 2AQIA 3K9NA 1GSOA 1SUDA 3ITKA 2VTKA 3ZHXA 4AUKA 1VJ0A 1YC2A 4G4SO 3UCXA 3VR1A 4E5NA 1DUVG 1L7XA 3DMRA 4OI2A 3NTOA 2DQKA 2AZTA 4WFQA 3W4IA 1WSAA 1CW2B 4GOMD 5L53A 1E1NA 1Z6AA 1WXWA 4HAYA 3G5TA 4QQ8A 4C43A 3JQ7B 4FZ5A 3GMIA 1YVDA 4ZCSA 3KEGA 3BWXA 3PDIB 4LRUA 5LJIA 3AF1A 1H6BA 1HX7A 2JLWA 3I3SR 1UMBA 2ILVA 3PRYA 4CV0A 1ZISA 2ZRMA 1CR4A 1EVZA 3BBLA 3ZDRA 1QOPB 3CNOA 4X66B 1I4OA 1U6IA 4HHEA 3DOHA 2W98A 1MO2A 2N47A 2REQA 3VNVA 2LKCA 5DTIA 5BRJA 4OB8A 4KVGA 5D5HA 4ZC8A 4FM9A 3N2GA 3LF2A 1RACA 1BMDA 1AD2A 3OBIA 1PT8A 1T2FA 1CZNA 3DWGA 3VPAA 3W3AH 2JRCA 1XK6A 1B6SA 3A6PC 5FWNA 2P6RA 3C6YA 2WKQA 4Q00A 1T9GS 1PSZA 5E6SB 2FPMA 2H2HA 4NIMA 1ODSA 3ND5A 1YE3A 2WMOB 4NBWA 2GJSA 4YRCA 1MUUA 2VT2A 1C2YA 1Q7CA 2C9OA 3EZGA 1L5NA 4AU1A 4CR8A 4F1KA 3GPLA 2FRDC 2O07A 3HXKA 3PNYA 1SXJD 1NFFA 1C29B 3FPLA 2AX3A 2G5GX 3R6TA 4UZEA 2PUGA 3W3AD 3L82B 3WMGA 4D9HA 2R2GA 3ZZNA 1T13A 2HMWA 2C88A 1G38A 4JJZA 3N8NA 2C2GA 2Y4OA 2ZWMA 2OQRA 5KX5B 1CUHA 3I30X 3B6MA 4BQFA 2I2CA 3HB5X 1OOEA 3ZHCA 2AXNA 4HWTA 4LBWA 4K87A 1MRSA 1DCMA 3PQ7A 4QJ3A 1YVUA 2NTEA 2FR8C 1S96A 2GZSA 4RLQA 1QH8A 1I0ZA 1RAFA 1RYHA 3GFSA 3NBAA 4PC6A 3RJZA 1VMIA 3ZYZA 4IIBA 1CJCA 3RC9A 3H2GA 1SEVA 3FUVA 1R4AA 1O94D 3VI4B 1C9EA 1E79D 2IK8A 5JFTA 2WG1A 3KAJA 4NBKA 4P34A 2Q4EA 4AS3A 1S9HA 2BKXA 2GF9A 1D3AA 1DB3A 4YCDA 1AG9A 4A36A 2HDOA 2QI9C 1Z6TA 1PFGA 3DMYA 3LX8A 5EMLA 1L3IA 3V46A 3ZK9A 3N7TA 4EELA 4QT4A 3AHJA 2XX3A 1UKYA 4HQLA 2FDCA 3SD7A 5JWOA 2UXBB 3IT0A 4FP9A 5LMZA 4YS6A 2K2WA 1IAQA 1XHEA 1G4AE 2NLOA 2NVWA 2QM3A 2R65A 4RPHA 4KWTA 5HTOA 1PJ8A 1N2EA 2ZWOA 5KMGB 4GS5A 4DM7A 1CK4A 1YRBA 1ZNWA 3TECE 4DA0A 1SQ5A 4HN9A 3M9XA 4MCIA 5EKSA 5T67A 4YRBA 2O2IA 4NPHA 1W4LA 3ENZA 4YHBA 4ZI7A 4YXWA 3S1SA 4YIKA 2KJQA 1YIOA 2IWHA 1TO6A 1A8UA 1MKYA 3OM1A 5JEDA 5K8TA 2P7IA 1IFXA 1GN8A 1NF8A 2WTXA 3PFBA 1QAOA 4E7OA 1RLTA 2ZWVA 2UUAB 4XYBA 1Y8QA 4MX8A 4OHCA 2XWSA 5HIJA 3PVZA 4H59A 5TRTA 1HFEL 2E1RA 1JR4A 2H5EA 4D8VA 3GRRA 4Q4AA 5KC8A 1C5KA 1N6OA 3PUHA 4S1WA 3SM9A 2Z2KA 5DBFA 1A7KA 1KJQA 4A5OA 1B73A 1E92A 2O57A 3GLHE 5HF9A 3BUSA 3L1VA 3UAZA 5EWMB 3KJXA 1MAUA 1CRWG 2NU9A 1TTPB 2RC5A 5SZIA 1D04A 3SJBA 3ZXUB 4B3SB 2JIPA 2BN4A 4I5EA 3EZNA 1E3JA 3KT6A 1Z56C 1H2EA 1S01A 2ZYDA 3AY7A 4ZZ0A 5AYVA 4ZMSA 4GKBA 9ABPA 4BRZA 4ZOLB 1CG6A 4KUHA 3I92A 2ZUSA 3MIIA 1CX9B 4JLUA 3PRJA 3G49A 5T57A 5TQJA 1SVWA 5K09A 1GM5A 1QJCA 4URZR 3IEVA 3EFHA 4R6WA 3EQ7A 2F43A 1BXKA 3PGA1 4BQRA 4CM6A 1VMDA 3Q3IA 2EJVA 1EZZA 1Z0AA 2C0CA 3TRIA 4NOKA 3LG2A 2WJAA 3OIUA 5C4GB 3H3XA 1M5UA 4YY3B 1U0SY 1JKIA 1KQ3A 3AHDA 3K5WA 5AJZA 5CDFA 1MW9X 1F4LA 5IDXA 3VKGA 1HKHA 2EYQA 4LYAA 1R0BA 2YY6A 1R27A 3L7JA 3OJ0A 2FQYA 3WAGA 1VGRA 4TTSA 3D3WB 3J80A 3VKHA 4M9RA 4LGYA 1ZVMA 3O9MA 3K30A 2A84A 2PUAA 2JJ1A 1OA1A 1QSGA 2D7CA 1WG8A 1J9EA 2PKQO 3DB2A 5F76A 3LY9A 5F7XA 1XDUA 1RC1A 4L5CA 1NE7A 2Z98A 3B89A 5EIOA 3WL7A 4OFBA 2C61A 3AY3A 5F78A 4RIHA 1W8DA 3EYWA 4MLDA 3V9PA 3AWIA 3GQBB 2IE8A 4Z4FA 1MF7A 2OZLA 4FD3A 4Y2GA 4W1RA 3PI6A 2QY9A 1VP3A 5DPMA 3TLMA 4YAIA 1KQFA 1JWAB 3R8CA 3B9QA 2EZTA 1OVMA 2Q62A 2UZIR 3GIDA 2J33A 4ZVTA 4TLCA 5AM4A 2FEPA 4GOOD 4I1UA 4E1AA 1C9YA 3EXFB 3EDCA 2Y1OA 5LP1A 1QIDA 1YO6A 4ARZB 4A8JA 5IK2D 3FH0A 3K05A 3U60B 1NVGA 2E85A 5IULC 1KHHA 1ZOOA 4N76A 4W5RA 5KTTA 2B0CA 3H2JA 3AYXB 4YMGA 2C3UA 4PO8A 4EY6A 3OOEA 3ANSA 3U3OA 1UBKS 4NENA 4EMBA 5LDDC 1QVAA 4OQYA 1YONA 3PUJA 3VKFA 2HPZA 1NHWA 3TW0A 5T8KA 5JC1A 5BSFA 3ZV6A 1J1UA 3NC4A 3NMUF 1GADO 4DKXA 2QPAA 2CWWA 2NXWA 1S02A 3O8DA 4C7MA 2II6A 3G9XA 5L7WA 2CDNA 5JVDF 4Z0PA 5ES3A 4IX1A 1C1DA 2BH9A 2DHQA 3QRWA 4DQKA 4IOLA 1Z18A 3BPSA 4RUKA 4CCAA 2RHCA 1UP4A 4G0WA 4CDMA 4CF4A 3O3OB 4PHGA 3B1JA 3WL4A 3RT1A 3QXHA 2O20A 1YIDA 2X4IA 4C4RA 5JALA 1JSLA 5FI0B 4ABTA 1YL6A 4BE7B 5JH7A 2GO1A 3ZGLA 4NICA 4KSCA 1VYTA 3V8QA 2CBGA 3H83A 1MMFB 1G3MA 4KOAA 1FRZA 3AEKB 3MJRA 5I9NA 4JI7B 2B0JA 3ZWBA 2NTVA 3LRTA 4LJYA 1FUIA 4MQLA 5JANA 1SQ6A 4MUJA 5EWJB 2BKEA 2O2SA 1U5BB 3TN7A 5BW5A 4DMUB 1UFRA 4GYYA 1UJBA 3HCWA 5WRFA 1W4ZA 3RAFC 1KFJB 2W4QA 1J9GA 1SWVA 2HIHA 4BN4A 1KAMA 4ZV7A 4UTNA 1OXMA 3EVCA 1P9RA 3ZIAA 2X6TA 3AJDA 2B9EA 5CPFA 4D9CA 5K0NA 4EHLA 2EOAA 2TSYB 2ZU0C 3FFBA 4I66A 4XQEA 1WOMA 3CWZA 5FLYA 5FTLA 4AZWA 1QWSA 5JAOA 1DRWA 2R5FA 2Z9BA 2IP4A 1T9HA 3L7YA 4XH9B 4JL8A 4RPLA 3TCXB 2AZMA 1ESDA 4UATA 1H9BA 1TW3A 1DJPA 1ULUA 2HU5A 1YZVA 2XYQA 2O8CA 3Q0TA 2V5AA 4RJJA 3VPGA 2VWGA 5T4BA 1CJKC 1BX0A 4L85A 3MWYW 4PC7A 4CM5A 4HEQA 3UAVA 5LP6B 4JJKA 4UTPA 4H16A 1K7FB 3INGA 3FNRA 4W99A 4HCJA 4M54A 1GNVA 2D5AA 2A9FA 3N1UA 4HNRA 5EINA 1ID1A 2ZTHA 2XRZA 2C92A 3GF4A 4N6NA 1OLXB 4NFSA 3DH0A 1SVIA 1OXUA 5KNCH 5E0KB 1B76A 2C7PA 2PBZA 4WBNB 3R23A 3MOSA 3CRVA 5JAUA 1ZN7A 4BX3A 4CG0A 1EZ1A 1T9CA 2GEDA 3MUFA 3ZWNA 5C81A 2DH5A 2AW3A 5TMPA 2JJ2A 4KMRA 2CMKA 3NWPA 4E14A 1D2NA 1Y6ZA 2ZCVA 4QPJC 4UDYX 4TKVA 5A5EA 1LJLA 4Z4HA 2PKXA 2VA8A 1HZZA 4CM9A 2JIZD 1UZAA 3L7OA 4YAEA 1M1YB 2AOTB 1DIRA 1WETA 3NTLA 4WADA 2X8LA 3Q1LA 2OG1A 2HQRA 3T3NA 1BAPA 1M5RA 2PWPA 2JLUA 1JGTA 1JE0A 1L7MA 3D8NA 3KUCA 2H17A 4J29A 5IM4A 1XNGA 5BUQA 3BGVA 2BGUA 3G2JA 4IDPA 4X7RA 5JDIA 3OAAA 3PHBE 5CXQA 1RQ7A 5KTSA 3HWX1 3RGWS 4DAEA 4H4DA 3H9EO 1IWOA 2FPIA 2FYTA 4HXEB 2G6BA 1PQWA 1UXGA 4M0DA 1XNRB 4RM3A 1A4XA 3IQEA 1UFQA 4L7QA 1KPIA 4JSRA 3A1SA 4WCFC 1A4UA 2NTNA 3GLSA 3U3KA 5DGIA 4M1QA 1U2PA 5E9JA 1C3LA 4WZAA 3P4UA 1O94A 3ONDA 1LBTA 3KKLA 1NBWB 1UJMA 2YKGA 2E82A 3MJCA 4MV8A 2FUKA 5A4FS 2B92A 3ELYA 2AOUA 2IV7A 3RYIA 4H3SA 5K0BA 3DDWA 4AW9A 1KZGB 4R3NA 4HLNA 2UZ1B 4F4IA 5A9RA 3KEFA 3QYAA 3H11A 3B3FA 3EXEB 3Q9NA 1QK3A 4KQMA 4E5SA 1K7XB 1RI3A 2HHAA 2YY5A 1B74A 2YWEA 4R98A 3ES9A 5E1BA 3ZDFA 1Z7EA 4EK9A 4R83A 1ADBA 3URMA 3I6IA 2AJ8A 1F9EA 2G80A 1JU3A 2F1RA 5IDYA 3KOWA 2X7XA 2ZI9A 4HDKB 5HF5A 4KQ2A 2O7RA 3BJZA 2IQ5A 2J08A 3Q7EA 3BICA 1J8MF 1TL7C 2GSWA 3OJLA 2AFIB 4MIYA 1PJ4A 2FSIA 3E61A 4O5OA 4TYWA 1GGKA 5IN5A 1TQ6A 1W44A 1WP9A 3B6ZA 3CUSA 5AKIA 1HEYA 2ZTSA 3BERA 4P7FA 3U4GA 2VHWA 4GNRA 3V7NA 3RYIB 1JR6A 3IUPA 3R3JA 1KVUA 2QNBA 4KN8A 1UK9A 4S0ZA 1U90A 2J6CA 3EY9A 3NIFB 1SXJE 1VLVA 2YJ4A 4QPPA 3SQLA 5JS2A 2ODEA 2XOXA 3IEKA 1Y5RA 2DHCA 2V7QD 1B3BA 3T3MB 3ZX5A 4DPKA 4EA8A 4HLCA 3EIQA 4KL8S 1ONBA 4WZBB 1Q50A 4YBZA 5F77A 3ESYA 1SY7A 4JBIA 2VHVA 4JDUA 1K7SN 2BGNA 4L73A 1U8XX 3NR2A 4X1IA 5LLSA 2BJWA 3NIWA 1QDUA 3ABRB 4F5EA 5KNLA 5KYXB 1CP3A 2W8BA 1ESMA 2OYCA 1CE8A 3HN6A 3TAXA 4DLWA 2FPPB 2UUBB 2I66A 2H92A 4MS4A 3ZQ6A 4D4GA 2XD4A 4R2WA 2R8PA 4JLSA 4O2AB 5LPNA 4QM7A 1EE1A 2W4MA 1ZUHA 5C80A 5IF9A 1INLA 2B61A 2WU1A 1THGA 5K0FA 2BFDB 1NVAA 4GX1A 1IN5A 4GC9A 3SS8A 4J0GA 4GKKB 4XARA 3U3DA 4EJFA 4ZXFA 4QREA 1GWNA 4EO9A 5JSZA 4Y6OA 2IXAA 3IQGX 3KT3A 3UVEA 3C7CB 3U1BA 1NYRA 1N4DA 1FRQA 4ZEOA 3B1YA 3HBMA 1AK1A 1A8QA 1ORIA 1YH3A 5CA0F 5GJWC 1GDTA 3AR4A 3OTGA 2FP4B 4GIBA 1A2OA 2CN1A 3AGQA 3QXSA 4AJ1A 2Z5LA 4GP9A 1KFKB 1AS0A 4K40A 3QQPA 4XFDA 1GV1A 1L5HB 4GX5A 4OXQA 4UC0A 4RTNA 3KQHA 2JK0A 3AKZA 3W04A 4XQ0A 5ILGA 3GUCA 4K26A 1C1YA 2FUG6 4JBWA 2EGHA 3CKYA 1YSCA 3X43A 4MTLA 4I6EA 1TJNA 1YDEA 3AIKA 5L3ZA 2OHOA 2BHRA 5KTMA 3IULA 1N5IA 1HDRA 2IYRA 4J3JA 421PA 2CKDA 2OV2A 3JRWA 2IZOA 3OZIA 4ENWA 3VISA 3ZGOA 3GRFA 3TI9A 5BUZA 2RGCA 3OZEA 4ERNA 4Q7KA 5CD1A 4OQLA 3JALA 3HJCA 2IOFK 2G5TA 4M89A 4GGMX 4ITVA 3RS0A 4RTOA 1O57A 1F20A 1X7HA 5EWLB 3D2CA 1B8VA 4WSOA 3ROFA 3O31A 3NBZC 4YROA 3UMGA 3V8RA 3GP8A 5A4IS 4B6RA 2Z8YM 4MKGA 5CHEA 3ZZUA 5HMLA 5IBPA 3WJ7A 1SBQA 3BQ9A 5D2CA 5ELXA 1UL1X 2A9OA 3LV8A 5HG0A 1I7PA 3F49S 4RVNA 4Z8YA 3IGFA 5JPDA 1UANA 4NJOA 1DTWA 2ZROA 4IJQA 3ZWQA 1Y48E 3DV0B 4C7JA 3IEIA 3RUCA 4D26A 5EIBD 2NVBA 1R37A 1WKVA 4RVSA 5B3KA 3U7GA 2XZDA 4BMPB 3WWDA 2SBTA 1BQ4A 2KI5A 2D0DA 3FPGA 4QPCA 3RH0A 4BAGA 4MAFA 5A9SA 2CZCA 2V4ZA 1E3WB 1ZPDA 2ST1A 4M0FA 4JB0A 1JEAA 2G0AA 2C3PA 3DTVD 2ZRQA 1RHQA 2VHEA 2Z43A 4PRZA 1NHGA 4ZDWA 5MDHA 1CUZA 3IESA 4ZVOA 1PD0A 2A3RA 3KD3A 3LLVA 4CKCA 5JAZA 1H2YA 2COKA 1H3FA 4FKBA 4FZRA 5FOTA 1MT3A 3FRJA 3SX4A 2JA2A 1OZFA 1U0HC 3HE3A 4X0EA 1TVCA 2CF6A 2X7HA 2WYIA 4WACA 5HGJA 1IJBA 1L5ZA 1P2TA 5KREA 2ZSDA 4IH1A 1WDWB 5FL3A 1G5TA 3T9FA 3WHKA 3ZR4B 4KDCA 4OMFG 2IHYA 3CJQA 5B57C 1HNZB 5ALZA 4BNHA 1YS9A 4IUCS 4KQWA 4WL0A 5CP8A 3QPVA 2D59A 3FCYA 3H9BA 5HUQA 1O9HA 1VCNA 3DAFA 3N6VA 4RVFA 1TRKA 5EEHA 5JROA 4QARA 3M6LA 1W36C 1ZN8A 3NUQA 4IIYA 1P0IA 3N07A 4KHZA 3ZJYA 2CLFB 5ERGB 3UT0A 4G24A 4X94A 5BXQC 3GX1A 2Y1WA 1P2UA 2AN9A 2GZHA 3AEKA 1JQLB 2GYYA 2BW0A 4OGGA 1IB0A 5ALHA 2VUTA 3TNJA 4EM6A 2IOHA 1G8PA 4G5GA 2WWXA 2PH7A 1N3LA 3N76A 4HPJB 4Z8XA 1LZLA 3K0CC 4LSGA 1P2VA 3ZK7A 1PR9A 4BMVA 2YNMA 2BI4A 5A4MS 5D6NA 4DEXA 3QKIA 5B3JA 3L0DA 3COSA 3EQ9A 3W2GA 3E9YA 1SUPA 5HE8A 1OZ0A 1W94A 1V6SA 3OT4A 3QEJA 4LYHA 1KR5A 1DAHA 1LBSA 4NKRA 1Z5OA 5DFAA 5JBIA 5LP6F 4LDPA 3UMJA 3WOHA 3LGSA 3WX0A 1JHAA 2WYOA 4OIMA 4TTTS 1HDCA 2VT7A 2J5XA 3CEJA 4FJ0A 1L5HA 1F2TA 2G4CA 3HJRA 1ZIOA 2V8OA 2PWBA 4ZVPA 1GOTA 1LDBA 1LH0A 3C1TA 2HSEA 4KRYA 4TMYA 4D99A 4DR3B 1JEOA 3OHSX 2VT6A 2WAMA 3K35A 5BSVA 4J1SA 1IL0A 3SS9X 2W6IA 3N58A 3GNQA 4JJ6A 4KFUA 2JLQA 3I5MA 2JBAA 4NYMR 2O2XA 2AF3C 2H3EA 2QU8A 2Y66A 3JPWA 5EMNA 4DQXA 4EG5A 1XNHA 4ZO8A 2I7VA 3CT6A 2PLAA 4HJRA 5IXSA 2F8LA 2ZQYA 4R05A 3KQPA 3O83A 4OL9A 4PLVA 2Q8PA 5EESA 4RSHA 3JQ8A 3V48A 5BYJA 2YICA 4EG6A 3LHKA 5BQ5A 2P2YA 3UB4A 3AHFA 4V3BA 3UWOA 4R1UA 2BFFB 1HXHA 3PX2A 2B7CA 3E2IA 1E6CA 2PLFA 4C4YA 5BV1A 2NNLD 5E1DA 3HMQA 3OKPA 2I1VB 3N0VA 1JQEA 3NHBA 2ZBDA 3CB4A 1GG9A 3COZA 3N75A 1V8BA 1WTAA 1R6UA 5TVKA 2O7NA 2VP3A 3T4XA 4Q47A 1PT6A 1RHJA 1RJFA 3O1HB 4MEBA 4ZAGA 4G0UA 1H4SA 4YACA 3DVQX 4AD8A 4UTOA 1RZRA 1DJOA 3X1XA 3QEMA 3P9KA 2HMSA 4XEUA 3VPBA 1SUSA 2OAGA 2C2ZA 1FK8A 3ZHOA 3HSYA 3LKZA 2VJYA 2HCFA 2ZYWX 3M6FA 5IWCA 3ZU4A 3L8HA 3IQFA 3SZOA 1R10A 1E2GA 4N5HX 4KO4S 5CDFE 1WF3A 4Q05A 4P0QB 4KK4A 4BEJA 4BUJA 5L3QA 1DO0A 5P21A 4DY4A 5L4NA 2I03A 2IP2A 3O94A 4UHHA 3OY7A 2JLZA 3AFGA 5DLEA 3X1YA 2C29D 1GARA 4YMVA 4CEJA 2OB1A 3WG9A 4XFKA 5EVCA 1COWA 4KTTE 4NBSA 1RC8A 1SUFA 1Q6ZA 3KZ1E 4RL4A 3KJQA 4IINA 3VR3D 2P77A 1E18A 1L1RA 4V38A 3OEHD 3TVDA 1Q2XA 4RHXA 2DXIA 4OHYA 2KBFA 5BW6B 5LBTA 4RFSA 4EGFA 1OWOA 4XGKA 1C0IA 4YP9A 1QG6A 4DJJA 3IS3A 3JQ9C 2VF4X 4KMOA 3C3BA 4HQRA 5JJIA 2Y0PA 3M89A 3KYDB 2ZATA 3CRZA 1SOAA 4MRNA 3T3EA 1S7CA 3PITA 1XA4A 1M74A 2ZR9A 3DE7X 1PTJA 4G5SA 3I2FA 1NM5A 3IP6A 4Q6BA 3T6KA 3C7KA 3TBKA 3U81A 4BNZA 4OKSA 5FPTA 4DM3A 1CPYA 1DUSA 3GO4A 2Q0XA 4ZK6A 2OGWA 2VSFA 4MRRA 1QU2A 2QTTA 1NI4B 2Q7DA 1TAGA 1H22A 1PN3A 3JD3A 2XMQA 4FFVA 5KQPA 3KE8A 4RZUA 2VYVD 3ZV7A 1X0VA 4MDYA 2Q07A 3HI4A 2EEPA 4OL0A 4ZJYA 5BR7A 3I5YA 2DY1A 2RD2A 1AB5A 1XDGA 5L3RA 2YV1A 1ZC3A 1OV4A 2JHCA 3ZXYA 1T3ZA 1QCYA 2IHJA 2OCXA 2CHGA 4G0PA 2FJ0A 1UDWA 5G2OA 1OI2A 1GYPA 2Q2NA 3NEPX 3H5LA 1CSEE <