1H0BA

Endoglucanase cel12a from rhodothermus marinus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
226
structure length
226
Chain Sequence
TVELCGRWDARDVAGGRYRVINNVWGAETAQCIEVGLETGNFTITRADHDNGNNVAAYPAIYFGCHWGACTSNSGLPRRVQELSDVRTSWTLTPITTGRWNAAYDIWFSPVTNSGNGYSGGAELMIWLNWNGGVMPGGSRVATVELAGATWEVWYADWDWNYIAYRRTTPTTSVSELDLKAFIDDAVARGYIRPEWYLHAVETGFELWEGGAGLRSADFSVTVQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Rhodothermus Marinus Cel12A, a Highly Thermostable Family 12 Endoglucanase, at 1.8 A Resolution
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
molecule keywords CELLULASE
total genus 61
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h0bA00
3AKQA 2JEMA 3VHNA 3WT3A 1H0BA 4NPRA 1OA2A 1OLQA 4HK9A 2DCJA 3VZLA 2VG9A 5EJ3A 3WQ1A 1XYNA 2D98A 1UKRA 1H4GA 2QZ2A 1T6GC 2B45X 3VHPA 1XNDA 3B7MA 1OA4A 2DFBA 2QZ3A 3AKSA 3VZMA 2JENA 3WQ7A 1AXKA 1H8VA 5HXVA 1KS4A 3AKTA 4HKOA 5K7PA 1UU4A 1XXNA 1XYPA 1UU6A 4HK8A 3WX5A 3MF6A 1M4WA 1BCXA 2B42B 3WQ0A 1C5IA 3VGIA 4XQWA 4S2FA 3WP6A 1F5JA 2Z79A 2DCZA 4S2HA 1XYOA 3EXUA 1REFA 3HD8B 3WP5A 1H4HA 3VZJA 1UU5A 2BW8A 2BWAA 4S2DA 3AMNA 1OLRA 3AMMA 3AKRA 3VHOA 2BVVA 1HV1A 1QH6A 3WY6A 3WR0A 2C1FA 1HIXA 3VZKA 3O7OA 3WP3A 1IGOA 2JICA 2DCKA 3RI8A 3AMPA 2DFCA 2NLRA 1NLRA 4S2GA 3ZSEA 4IXLA 2VULA 4XPVA 1XNBA 4XQDA 1PVXA 1REDA 2F6BA 1HV0A 3AMQA 3LGRA 3AMHA 3M4FA 1BK1A 4HKWA 3MFCA 3LB9A 1REEA 2B46X 2VUJA 1H1AA 3VL8A 3VZOA 3MFAA 2BWCA 2NQYA 1OA3A 1XNKA 2D97A 3WP4A 2VGDA 4HKLA 3AKPA 3B5LB 1KS5A 3RI9A 1BVVA 1YNAA 3VL9A 2DCYA 3VLBB 4XQ4A 1W2UA 1XNCA 4H7MA 1TE1B 3VZNA 3WXPA 3MF9A 1QH7A 1ENXA 5K9YA 1C5HA
chains in the Genus database with same CATH superfamily
2WUHA 3FC0A 4R4XA 3RWNA 4XABA 3Q8CA 5JZGA 3AXDA 3VB9A 3RZLA 3OEAA 3P3PA 3JD72 3WQ1A 1I6XA 3AC0A 1LHUA 4J6GA 2RHPA 1OKOA 5B4NA 1F2NA 3GZTB 5T5OA 4LLFA 4R9DA 1JOJA 4M4RA 4XUOA 2EVXA 3M1HA 1QU0A 5FXXA 1GP6A 3FZ3A 5T50A 1CONA 5CFCB 3OYWB 2ENRA 5DQ0A 5FPBA 2ZZQA 2VU9A 1GBGA 4JGYA 1KFXL 1VPHA 2ZGKA 4XURA 3I2FA 2FCTA 3MYXA 4MOAA 4GZ9A 4QB6A 5LWBA 1BHGA 1UKGA 2E33A 3NAPA 2VZTA 4R9AA 5A3TA 4AVVA 1EPZA 5FK7A 4HONA 4L11A 5LCWL 1PZ9A 4D7TA 3BB6A 4BQ2A 2DVDA 2ZACA 4OHVA 2D6NA 3FE5A 4PF5A 3AJYA 1G9AA 1ZRRA 4IE6A 1ND2C 1JMUB 5CFDC 1LGCA 3C7HA 1ZREA 3PHMA 3W5NA 1BEV2 4XF4A 3ZKYA 1RL3A 1PGL2 1UY2A 4GWNA 5JPNB 2W94A 2YBSA 1VRH1 2Y6LA 3DEMA 4S2HA 2DU1A 2MEV2 2ARXA 2FDFA 2I07B 3N7LA 2FMDA 4NRQA 3HD8B 2VR4A 2G1MA 4Q0QA 3CL1A 4BISA 5K0UC 3GDBA 2VNVA 4IUGA 2XKOA 1YIFA 1HQNA 3C8XA 4LTAA 4COUA 4D6RA 4IE4A 4BXSV 3NV2A 2FDGA 4YZ1A 5IATA 2AR6A 4AL9A 2ILMA 1A8MA 1XSQA 2QVSB 4XUTA 4PQQA 5FZLA 1QH6A 4Y33A 1QXRA 4LHLA 3T2OA 5FXZA 4BHPA 3KHBA 1KDKA 3FLTA 2A1XA 2BRTA 5F5CA 3IAQA 2E53A 2D7FA 5C3OA 5J48A 4DEQA 3LSDA 3H1MA 2WINB 3APBA 4K8RB 4O7XA 4MLOA 1JS9A 3BCWA 1A3KA 4LK6A 5KC5A 4ISRA 2QE3A 2RS53 1N3QA 5HCAA 1PVXA 1W9TA 2D5FA 2F6BA 4AK3A 1JYNA 5A6QA 5ISLA 1QJFA 2K46A 4QD2A 1YXWA 2OKXA 1TMF1 1RIRA 4DY5A 3W59A 4L8QA 1R1A2 3EBRA 2QQUA 1BBT3 3N9LA 3VBHC 1GZWA 3H8UA 3N7KA 3U11A 1AR62 2BWCA 4FVVA 2WWJA 3MIBA 4AFDA 3WP4A 4BQXA 4HKLA 1RUH3 1QJU1 5TSWA 1UNBA 1JZ4A 2XR4A 1GZCA 2A71A 1PVC3 2CGOA 3WNMA 3NQHA 1RUOA 1C3HA 2FZ1A 2JG9C 1LCLA 2WS91 1UPIA 3MIGA 2GP3A 2W95A 4KU7A 4OUMA 4QGLA 2XVKA 2VTFA 5EHDA 2AGSA 3GBGA 1W8HA 4E9KA 4J1XA 4XUNA 1DHKB 2EIDA 1WMDA 4KI5M 1JODA 1OQ1A 4M0NA 2VTXA 3T08A 1AL23 3BGAA 4FFFA 3HOBA 3OUJA 3ZKUA 1S2EA 2XJQA 3TEYA 1RB8G 4MXVA 3V65A 2VG9A 1CN1A 5EJ3A 3I2KA 1CD3G 1RUF1 4CUAA 1N47A 2C5DA 3KVAA 3WDVA 1UKRA 5IVBA 1JYCA 1YI9A 1QJY2 2YFZA 3KS7A 1VR3A 3LEMA 1FOD2 4YW4A 4XCBA 1V6KA 3DGTA 3P6BA 1RUD2 3I97A 2OQ6A 4OLLA 5T55A 3VHPA 1AXZA 3CF6E 3SQOA 3TEWA 3ZMOA 2XLFA 4FOYA 4A3ZA 3J9SA 4Y1XA 1H2MA 5ACA2 2BVBA 1I5ZA 2RS11 2YG0A 5DZEA 4Q0PA 2HWB2 4TWTA 4AQSA 4C0HA 4NJ4A 1K5JA 4HPKB 4LBQB 4JKLA 4WM8C 1HJFA 4AHZA 2D6PA 1DQ2A 4Y20B 1BEV1 1V9U3 2B9VA 5LEKA 5L7OC 4RHV3 2QJVA 4GKYA 4BB3A 1K3IA 3MUZ1 1ZBA2 5CEHA 1QOTA 1GP4A 1QXPA 3AYDA 3KT1A 5J36A 1UAIA 3N9OA 4QKBA 1M4WA 3H9AA 3HJRA 1BCXA 4YVSA 5IAVA 4MV2A 1OLME 2PTMA 1VE0A 3IKWA 1OHFA 4LBLA 4UFHA 5FY1A 4TTGA 2WNUB 3ZPOA 1ZZCA 2XG3A 3I8TA 4G9SB 3NNJA 1MR5A 2WDBA 2GU9A 1B09A 1LOEA 1SDWA 2DVFA 3BVCA 1UY3A 4CU7A 3POWA 3ILFA 4KNCA 4P14A 1PIV1 4CP9A 3FHQA 1SMVA 2D40A 2VBBA 3IDCB 1JZ7A 3LIHA 4GWJA 4AQ2A 1COV1 3NV4A 2L9LA 5KR7A 1V00A 1YQ5A 1KGYA 4W65A 3J7HA 5DG2A 1MPXA 1G8WA 3J8F3 1ZZ9A 2HLEA 3L2YA 5F5IA 3ACFA 1VMJA 4BMEA 5J37A 1NLRA 1LAJA 2VW2A 2CY6A 3MBWA 5K4LA 5GALA 5FREA 1W2NA 3ATGA 1GP5A 4QX7A 3WHUA 5DUXA 1DQ0A 3KVBA 3OEBA 4XF3A 1S0DA 2K2SA 3ZFGA 1E5HA 3ME2A 4XUQA 4PCRA 4AGRA 2ZMLA 1S55A 1TQ5A 5KC6A 4BIOA 4AFMA 1A6CA 4QKFA 4RR3C 4CCDA 1PO23 2FDKA 2BNOA 4UAPA 4XFBA 4CU9A 1U5XA 3IAPA 3NRUA 3ZYGA 4AEDA 1VBA2 1LRHA 4AGGA 5FZEA 2HYKA 1MZEA 1GQGA 2WZR2 2I74A 3I3DA 4KL1A 1TG7A 1JUHA 2AYHA 4E4DX 4BK4A 1XNCA 1ZRCA 4XZPA 4KGGA 3WG3A 4NWWA 3POYA 5BXXA 3DCQA 5ABJB 4A3XA 2HWD1 5FY4A 3TN93 4GD4A 4IE5A 2NN8A 4CEYB 1Z78A 2E7AA 1W8TA 2IVIB 1GFF2 3MW3A 4HXCA 4ZS3A 3ZIWA 1MEC1 4IGQA 5CFDB 5L19A 4WM7B 3M3EA 2RM22 3HNBM 1ND2A 4R9CA 4YW3A 3M3OA 3R05A 4CU6A 3A23A 4OVEA 4FQ4A 2DVBA 1U0AA 3FBMA 4YZ3A 1VMHA 4YNIA 1F4HA 4I02A 4ZS2A 4AFBA 2CGPA 1OPMA 2R0HA 3M3IA 1RYYA 2ZGMA 3JCIA 3HBZA 1W6MA 1WA6X 2OPWA 3LDBA 4C1WA 4DXZA 1JZ3A 2BFUS 1SLTA 2Y60A 5F8PA 5A1AA 3B9CA 3KGLA 4XDPA 4EROA 3BI3A 2VQ0A 4UW6A 4XJ8A 5LRRA 4CUGA 2CGNA 2XUMA 1SLCA 3AYEA 1FOD3 4MADA 1KJRA 2QQMA 1RUD3 3NNLA 4NUBA 4RS5A 1YWKA 4XTPA 3AZVA 4PBPA 1IPJA 3INAA 4A7YA 5JOZA 3O1TA 3VKMA 2AACA 2VOWA 5IVCA 2BPA2 2FZ2A 5DZFA 2D3RA 5B4XA 1DLLA 4JZRA 3LAGA 1HQWA 1HXS1 1NE6A 3KD4A 4GMP1 1DGLA 4V1PA 4XQWA 1AR83 1BQPA 2DCZA 5F3EA 4QPGB 1EV13 1H9WA 1ND2B 5JOWA 4M3CE 1SCSA 1AZDA 3I2JA 3S7EA 1DZQA 3WDWA 4IGOA 1COV2 3FHIB 5FBZA 1DGRN 5JZGB 4LO6B 2BW8A 3N9QA 4LOTA 3VBHB 4HLTA 4QKDA 1WLCA 1AYN2 1RXFA 5KHKA 4BOWA 2Q5TA 2N7GA 1NQDA 1D4M1 1ASJ3 2XUEA 1CVNA 1IKQA 2J1VA 4QDRA 1NOVA 1W05A 2C1FA 1HIXA 3M3QA 5JI9A 1ND3A 2BGOA 1AR73 3S5AA 3UGFA 3M7AA 1AHSA 1STMA 5FLIA 3OTFA 1VB2A 3K75B 5FJHA 5C33A 4I2OA 3J7NA 4KWLA 2VMEA 5H9RA 3QBQA 4MX3A 3B69A 4MO3M 5DAXA 3ZSEA 4V2WA 4LBOA 4LK7A 4XPVA 5EXOA 1J3QA 2ZGRA 3LEGA 1WA4A 2JKBA 4N53C 2JD9A 2D6KA 3RMYA 4AVCA 1FMD1 1J3PA 1R083 1C4RA 1W9FA 3ILRA 1D2SA 4OHXA 5FIXA 3GXUA 4AFCA 1DGWX 2IXHA 1FATA 1CIWA 1YCIA 1BYHA 2W47A 2YHJA 2XWJB 5GJ6A 2J22A 3WDXA 1S0BA 3NKGA 2A7AA 1YFYA 1UQXA 5FWJA 3EYPA 4ASLA 3AKPA 3WW2A 3DECA 1EAH3 3GZAA 4GA9A 4XFGA 1HB3A 1RVF1 4OHYA 1VIWB 4PI2A 1V6IA 1NG0A 2A6ZA 5FPZA 3ZFGB 4XQ4A 1AR61 4LBKA 2WZ8A 4OHZA 1C8M1 2Q30A 3HPNA 4XFAA 1DDLA 1ALYA 5K9YA 2VMHA 2EAAA 3BODA 2AREA 5LA0A 1CESA 5I0UA 3CU7A 4Z1VA 5JIUA 5LK5A 3MLKA 4FQZA 1H0BA 2WZR3 1ZM1A 4UF0A 1YJKA 1AJKA 2JDNA 4GJYA 3TNQA 1VBB2 1RUI1 4AVBA 4KGQA 2ZGTA 5D21A 1GWMA 3PL0A 3T09A 4ATEA 4YVSC 3MIEA 3GJAA 1HLCA 4PDWB 4AEJA 1R091 2C9KA 1SLAA 3H8OA 1JH5A 2AUYA 2D5HA 4QX8A 3OGJA 4LHSA 5FYHA 1NCQA 2O14A 3PTYA 1DQ1A 1RUJ3 3AKSA 3BPZA 2J1TA 2P3KA 1AYM2 2E7QA 3OY8B 1UIJA 4PDWC 4ITCA 5F9TA 3I2HA 1H8TC 3M70A 4AAPA 1V6LA 1WD4A 1US3A 5A7QA 1GWLA 5KXBA 3I2OA 3RS6A 5CB7A 4X8NA 5G04L 3LFMA 3HVDA 3ORJA 1ULDA 2VNGA 3HBKA 3DPRA 4HVQA 5A3WA 5DAVA 4YVWB 4CU8A 2RE9A 3GHMA 2PHDA 3J4UH 1W90A 2AENA 2VZ1A 4ONUA 4OI1A 1ZVFA 4S2FA 5IW0A 3WP6A 1ZZ6A 4LA2A 4KWUA 3EXUA 2I45A 4Y1VA 3UT0A 2VQUA 4JGYC 1RHI2 1W04A 5GLTA 1ZBE2 2A3XA 3IDEA 1OVPA 1QNYA 4N43B 2ZGQA 2RR12 3B00A 1LHNA 2BWAA 1YQ6A 2R061 3ZVXA 2JX9A 3O12A 5LBFA 5LK7B 3VBSA 3LA2A 1WW5A 4SLIA 1AR82 2BUKA 2D6OX 5FZ9A 3HT1A 2W1SA 1JU4A 3RJ2X 5FPUA 4Q4Y3 3RQ0A 2LS6A 4TSVA 4FT8A 3WW1A 3PVOA 3UYJA 5DAQA 4UYBA 5JDBA 2XPJA 3BUCA 2OYZA 3Q8EA 1CAUB 4H14A 3ZOIA 1ONAA 1F31A 2DCKA 1OMIA 1AYN3 4I0BA 4KBBA 1N1SA 1RXGA 1LU1A 4FPOB 4XXAA 1REDA 5J7MA 2GC2A 4NRMA 1JZ5A 1A78A 2WFF1 2H0VA 3HEIA 4Y4RA 1LENA 4PI0A 2E63A 2HH9A 3CBNA 1YJLA 5CADA 2UURA 4IEWA 1U12A 3I49A 4D0QA 5KHJA 4NAOA 3VDAA 5LY1A 5FZOB 2WQZC 1UWWA 4Y5TA 1CZVA 1C1FA 2QQLA 3RWKX 3PNAA 3W5MA 1OH3A 1VAMA 2A6XA 2ZEZA 4HOOA 3J26N 4QQHA 5SV8A 1EY2A 2O1QA 4COZA 2E26A 3VLBB 1NZIA 5CAZA 4WZFA 4DFSA 1S0EA 1IQAA 4PQ9A 4CEWA 5DUVA 4MGTA 4YGCA 3RZHA 5FP7A 3VBOB 5GZCA 2RS13 4UBHA 1BKZA 3K3NA 4BQ3A 5IK7A 5BUVA 4YWAA 1DYKA 4CCMA 3R0RA 1GWKA 1POV3 1SPPB 5H9PA 4RQPB 4LKEA 4N8MA 3RJRA 1V9U1 4YM0A 5FPAA 4YFZA 3VZLA 1PO12 3BU7A 4A7KA 3HNYM 2PFWA 1URXA 4H55A 2WKKA 4RHV1 3ZYPA 2JIJA 2ZOEB 4GB32 3RSJA 1C57A 4XOGA 1W6QA 1N3PA 2Z5WA 4YW1A 4BYYA 3W21A 1R1A1 2YPJA 2Y0OA 1HKDA 4XHXA 1Q56A 3ON7A 1MEC2 1OLMA 2VW0A 4FPJA 4YFWA 3A22A 3PVNA 4FOQA 2QCSB 5A1FA 2DUPA 1QKQA 4XJ9A 4NRPA 3RZJA 3ITQA 4GWMA 2VBPA 3HR9A 4FPEA 2CSGA 3ELNA 4ASKA 3USUB 1H1MA 5GLVA 2EALA 1WCSA 2RJKA 5A3LA 1NY71 5GKAC 2OPKA 3NW4A 3X29B 4ZXEA 3ZDSA 3POGA 1ZRIA 4EN8B 5DDJ1 1JHJA 1PGL1 1MQTC 2HWE2 1UU6A 1SFNA 1PIV3 1RJ7A 4MZUA 3QH6A 1ZNPA 4XFIA 3MF6A 3FFZA 2WZPP 1RHI1 1YI7A 3ZXKA 4DEVA 5FO8B 3GBWA 3N4MA 1COV3 2XQXA 1RUC2 1S2KA 4FAHA 1W2TA 2B42B 3OY8A 2V72A 4N7IA 2QQNA 3IBMA 1TME2 3ZIXA 5JOYA 1QEXA 3KM5A 4Q2FA 5ANQA 5FJKA 2VZUA 3ACHA 2HEVF 1W9YA 4WZCA 1K5MB 1EP0A 2W46A 4N53B 5FUIA 4WBBA 1QJY1 2WT2A 5L9RA 5IK4A 3K77A 1HXS2 4IERA 2QQWA 5DAPA 4HZFA 2PHLA 5FZBA 3ZXEA 2AC1A 1MQTA 2XBO2 4BJ0A 1O5UA 2WQ4A 3AFKA 2P6CA 4NHKA 1W0OA 3I2IA 3K3OA 1W6PA 4XYXA 1UYPA 5FZIA 5K0UB 2RS52 1YIPA 4A6OA 1JZ8A 4QXHA 3WR0A 1NLQA 2ZJCA 3POFA 2RR13 5JR7B 4YM1A 3JZVA 4LKDA 4P9LA 1IGOA 4IETA 3VBUB 1VBC3 5IVJA 1HN0A 3NO8A 3H7JA 4MXWA 1NXMA 2PAMA 5F32A 2VW1A 3VBSB 1CIYA 3VDDC 1X7NA 2PA7A 5C3RA 2R073 1X8MA 5T3NA 1K5MC 2UU8A 2Q1MA 5F3IA 2QQPA 1I3HA 1BK1A 2ERFA 3VD3A 1H1IA 1X9PA 4A44A 4BDVB 4RN5A 4XHBA 2WAOA 2JECA 2VO5A 3OPWA 3PIGA 5BNPA 2R6QA 1US2A 2GNDA 4AQ6A 2XL9A 4PIXA 4B4RA 1DBNA 2NPIA 1YO8A 2OS2A 3D4KA 1LOFA 1OOPA 2EXJA 2WT0A 3CIHA 5C7GA 1DGRA 4FCAA 3UETA 5FMDA 4BCUA 4LJHA 3UKTA 1V0AA 3WG2A 3WOGA 4IV3A 1NCQC 4CUCA 4YPJA 1RMU1 2QQVA 1TNFA 4Y26A 2VMFA 4UW5A 1WCDJ 1S0IA 3TEXA 3NSTA 4G3YC 3MIFA 1G7YA 5FYSA 2ZS6B 3B01A 1J3RA 2ZGPA 3OB8A 2ZGUA 3ZFGC 4CTEA 1JW6A 3WT3A 5F1RA 4CYDA 2KM2A 1FOD1 4WVWA 1KQRA 4CDWA 2OA2A 2VCBA 2JD4A 2ADDA 1AX1A 2P3YA 1RJ8A 4B8EA 5FLJA 2E7TA 1OI6A 2XDVA 4IEQA 1B35A 1UN1A 2O8OA 3KCYA 3MLLA 5F6KA 5FYZA 2R042 4PLOA 1XRUA 2PHTA 5C8CA 4IE0A 4GMP0 3FBYA 4QX0A 3OGSA 4GMP3 3ASIA 2YC2A 4I0AA 4QXKA 4RGGA 4E2GA 3NNFA 3CLPA 1WUVA 4GB33 3WVJA 1VBA1 1NAEA 1ULOA 5FUPA 5FZ0A 5L9VA 2X09A 4NAMA 3FLPA 4HKOA 5A6YA 5FP8A 5A80A 5IFTA 2GDFA 4ZY9A 1GOGA 5HPOA 3JB4C 3ZYHA 4AWDA 4CDWC 4QKNA 3C2UA 1ASJ1 2EICA 4P9YA 3IB3A 2GMPA 4LQRA 5FMBA 3WCSA 1HRI2 4A7ZA 4QQPA 4EWDA 1QOSA 1JHNA 2A6YA 3OBAA 3USUA 3WQ0A 3MPPG 3IDAA 4P9JA 2XQRA 5E6HA 5C8CC 1MS9A 3FJSA 2XBO1 5JMOA 3LDKA 4Q4Y2 1JN2P 4Q4V2 5I0TA 3OUHA 1ND3B 2JDZA 1TVGA 2X8KA 3CJXA 3IIIA 5FYIA 1PGSA 3VDBA 1WLTA 2YY1A 2VC9A 3LA7A 5T5LA 1W8ZA 5GZFA 4MSVA 1DG6A 4CP2A 3J8F2 2BNMA 4RS5C 2WL1A 4K21A 1FMD3 1HDKA 2WWSA 4A6SA 5FQ0A 1QJEA 1OXCA 2IXCA 1O3SA 2GALA 5BNNA 1N1YA 1CAWB 1WW6A 2QKDA 4B4QA 2HBTA 3NWKA 5CFCA 1OH4A 3UL2A 1O3QA 2ZGSA 4RS5B 4NIGA 2IXKA 2XJTA 3LFIA 4BLIA 1FYUA 5FZAA 4OFGA 5DG1A 3DYMA 4LR4A 1BBT2 1HN1A 2VTXJ 3NNMA 5K8SA 2RDSA 3N3HA 1M06G 4FFGA 4OMCA 5ABJC 4N9HA 4QHOA 1SACA 5CKQA 4AHXA 3ZYFA 1HV0A 2HWF2 2XJSA 3T1MA 5K7PA 4XE9A 4URAA 4ZHNA 2X10A 1UW8A 2HEWF 3OGVA 3POEA 5LBBA 4NIHA 3PMSA 1I1EA 1VBE1 4LKSA 5LA2A 1T6BX 5IHRA 3RI9A 2VBDA 2Q0AA 1OT5A 1YNAA 3KZ4C 3D6EA 4QM9A 4IEYA 3JBG2 2JWPA 1BXHA 1UF2C 5GZEA 2RM23 1W6QB 2J1UA 3ILNA 1DQ4A 1RUJ1 1LR5A 1YFXA 2XHKA 5J1XA 3RZKA 4FTBA 5FYYA 3AZXA 4QU2A 4WM8A 4XAAA 5JXHA 1BBT1 1CAXA 4K8FA 1ZRFA 5IT6A 1JU3A 4NPRA 1OA2A 1SZBA 2JKXA 2NMOA 5FUNA 1QQP1 5KHGA 5IAXA 3O1MA 4WV8A 3ZLIA 1NYWA 4BMBA 1W3XA 2OIIA 5C5TA 4L99A 4QWNA 5CG9A 3GZUC 5DZGA 4JGZB 4EJRA 4LULA 1QJU3 5HI0A 3ETQA 2F17A 3V64A 2JJ6A 3AZWA 2PELA 4OI2A 1NLSA 3AB0A 1S4CA 4M00A 4MGZE 4DXTA 1PK6B 1TZOA 1V9U2 1FI2A 3IZOA 2JE7A 2JB8A 1F9KA 1O8PA 3E5UA 2BBVA 1SHWB 3SC7X 1AUYA 3B93A 2VXJA 3VD5A 4YVWA 4GH4A 2C0ZA 2Y6KA 2YPDA 1JYXA 4FPFA 5E89A 5GZGA 2Y33A 4UT5A 2PHXA 4YRDA 1RC6A 1XJAA 1JYVA 2R063 5A6ZA 3OUIA 2ID4A 1OFNA 2LM3A 4LO5B 3I59A 3WW4A 4C90A 3O1UA 1RUF3 1WCUA 3UESA 4HSLA 3LOBA 1RUJ2 1IG0A 3PTRB 4XBLA 4LO8A 1SDDB 4Q4Y1 4ASMB 3HN1A 4H7LA 2YB7A 1NA1C 3UJOA 4Y24A 1LJ7A 1XE7A 4MGIE 4K9SA 2VMCA 4W6XA 5J09A 2GC3A 4IESA 3VGIA 3ZYIB 4MUVA 2W39A 3JD71 1AYN1 5DN2A 3S57A 2X5IC 4N7UA 1OPOA 4XACA 4C1XA 3S30A 2A75A 4PDWA 4RYDA 1OUXA 1BMV2 1UU5A 3WUDA 1LODA 2YYOA 3LF7A 2JE8A 4QPYA 4NPMA 4QX5A 2RS31 1HB2A 4NOTA 4RGAA 1SFYA 1JXNA 3AKRA 1EV12 4YGBA 4GWIA 5G05L 2QTWB 3B3QE 5LA9A 4Q4V3 2DVAA 3IIAA 4HL0A 2G9FA 2FDJA 2IC1A 2PHWA 3MGUA 5E88A 5LBCA 4AZZA 3KHCA 2A6WA 3TBDA 4CCKA 3O7OA 2VCCA 3WG1A 3S0MA 4W4ZA 2HWF1 2EA7A 4QM8A 4IV1C 4Z2WA 5JOXA 3WINE 2XVGA 1RUE3 3FN9A 4B7KA 4EYUA 3THCA 2XL7A 4LIUA 3EO6A 4YG6A 3RMXA 3VBRB 5D1IA 3VKFC 3WW3A 4FSJA 4XEZA 3K4DA 3EMRA 5F5AA 5I0DA 4P5YA 2UY8A 3CJIA 1VRH2 3KV5A 1D2QA 1QF3A 5CNAA 2W9XA 1TNRA 3SH4A 1JYIA 1F15A 2UY9A 4LBJA 4OZXA 2TEPA 5IK8A 3UKNA 1K12A 1N3OA 4F7ZA 4FTEA 1ZYBA 3NVCA 2J1RA 4GJZA 5ANNA 5FYTA 2A73B 4YZ2A 2ET1A 3G7DA 5BNNC 5I91A 2VZOA 1BMV1 3LQCA 4DINB 3KSCA 3IPVB 2OQ7A 4D69A 3ZN5A 5KBFA 2DU0A 2AH2A 3ZXDA 3OBZA 4WVVA 4JDMA 5FZ1A 3NJXA 4Q29A 4XJUA 4W6WA 4DB5A 3C7FA 1UZYA 1TE1B 3RPQA 2DBNA 2YU1A 3JUUA 4QGNA 5FY0A 4AEMA 4Y5SA 4L0PA 1IPKA 1G9CA 2JDHA 3LPFA 3ZN6A 4CDXB 4UFLA 1E5SA 1NCRA 2WYFA 1FXZA 2AZ5A 1KRIA 5CG8A 1NT0A 4FBFA 2MNGA 1OLQA 2VOVA 2VUCA 3JBG3 5FBJA 1R092 4IEOA 4PF1A 5DDJ3 1RMU2 2BOIA 2DCJA 3LWCA 3WDTA 2DV9A 2C4XA 2WFF2 3I3BA 1LHWA 3VBUA 5A3PA 2LROA 4PLMA 2LALA 5A70A 2EXKA 3MPBA 4WM8B 3VDCA 5FO7B 4ET7A 2JG9A 3NL1A 2FDHA 4IEVA 2YC4A 2WQ8A 3A4UA 4Z92B 4P9XA 1KS4A 4XFHA 5EJ1B 2R041 2Q8DA 3AYCA 4FPYA 1MEC3 5EPAA 2KXLA 3RYRA 2VZVA 4A4AA 4JDOA 4DOUA 2MEV3 2VMGA 4K40A 4AOCA 3VBOA 4KG0A 5FTTC 3SLIA 1GNZA 5FPXA 4QX1A 1HW5A 2XVLA 2P34A 2SLIA 2NZ9A 3A21A 4D8MA 2VQTA 1SFPA 1W0NA 1AX0A 3ZFEC 3HT2A 4O61A 4AI1A 2RR11 2XB6C 3NMBA 4E2QA 1W8UA 1AVBA 1F5JA 1ST8A 4DY3A 2G9ZA 1REFA 1IPSA 5ABJA 4CE8A 4TXWA 4ZONA 1QJX3 4CSWA 3U4XA 1XU1A 2ZPXA 4O65A 3V0BA 5F3CA 3WHTA 1AF9A 2CYFA 4I0WB 1RUD1 2VE1A 3K4ZA 4PLNA 3VBHA 4ZXKA 2IFRA 3PIJA 3M3CA 4N43C 4XBQA 3WEZA 4Q1PA 3UGHA 4AVSA 1L3JA 2ZX1A 3ZSLA 4D7SA 1DGWA 5JMCA 3WP3A 1W0PA 4LNVA 4HG6B 3AMPA 3T0BA 2DVGA 4TN7A 3AX4A 1DLCA 3KQRA 3ZDVA 4BIFA 3SEEA 4META 3PUAA 1JZ2A 1QIQA 1JOPA 4NPLA 3ZMNA 2W2IA 5T5JA 4A41A 1NX9A 4DUWA 4NMIA 3JU9A 4OI4A 1BK0A 2QFEA 3KF3A 1PX3A 3WDUA 3ZPYA 4MHUA 3I3EA 3ZFEA 1H1AA 2OXBA 3E5QA 4KG8A 4Y4YA 4N43A 1S1AA 2WO7A 3V0BB 2NQYA 2BQPA 1OA3A 4D7YA 1XNKA 2RS12 2VGDA 3AFGA 1OVSA 3I3MA 1NE4A 5CU1A 5A3MA 2A70A 4BA6A 1AL22 2P37A 2HWC2 1WBFA 3CJIB 4OUEA 4M3CB 1VAVA 5A33B 2VQAA 4MG2A 3KV9A 4OULA 4RQPC 4HN1A 4DUVA 2ARCA 1MS3A 4RSUA 4BU2A 1WCKA 1W06A 1QY4A 4QXBA 2XKPA 2VZPA 4GB31 5C5UA 3LGRA 1T2XA 1XC6A 2LW8A 1O4ZA 2GNBA 2PAEA 5CYYA 1W99A 3WDYA 4X6QB 2J1AA 4XUPA 2PAKA 4Y1UA 2UYAA 4BQ5A 2D98A 3ZXAC 1BZWA 2WO1A 3FL7A 3HAGA 1RVF3 2HWB1 4MGQA 1CZTA 3N35A 1LOFC 1NY72 3ZN6B 3AVRA 4CDXA 2HWE3 5CIRA 5E1RA 3WNOA 4YYOA 2QZ3A 5LW9A 4Y22A 1O5LA 2OX0A 1YHFA 1GNYA 1C1LA 2X05A 3WG4A 1A34A 1CAVA 5HBAA 4CRQA 1CPNA 1UOFA 3LIGA 4Y1ZA 2WZR1 3WNNA 1NA1B 1XXNA 1MZ6A 1DZRA 1TME1 1RUI3 1U5YA 3R4SA 1W8WA 3CDZB 2ZMKA 1ULPA 2RDRA 1LULA 1YRZA 3UV9A 1OD3A 5FPLA 3WUCA 1LKNA 2VZRA 2ZGLA 2ZX0A 3A0KA 5EQUA 4TLGA 3VBUC 1FT9A 3DN7A 5FQ0B 2ZHNA 2WWUA 4UBGA 4Q27A 3NJVA 3HMYA 1SBEA 2QQOA 2Q1FA 2X29A 4UFKA 5FXWA 2Q8OA 1PIV2 2WNEA 2G4IA 2QUOA 4FP3A 4L92A 2ZX2A 1UX6A 2CTVA 3ZYBA 5KWRA 1ZZ8A 2VMDA 3THPA 1L7RA 3NAPC 4RFRB 1OKQA 2MPFA 3KB5A 4IQPA 3KGZA 1DIWA 3GBFA 4CCJA 2RDQA 1W6NB 4L2NA 4CPBA 1LGNA 2VNRA 3RZZA 2JDYA 2CAVA 2RMU2 1DQ6A 2Z2SB 2DUOA 1Y4WA 5A3OA 4AHYA 2VZ3A 4HVOA 4OCTA 3ZR6A 4AQTA 5J98B 2R072 5GLUA 5CFDA 2SBAA 1PZ7A 1J83A 2J1SA 4JAAA 2E51A 4Q4W3 4RGKA 2PQQA 3IM0A 1VBE3 4Q4X3 4BQ4A 3J7MA 5FZMA 4FPLA 2E32A 1W6MB 5E8AA 3FHAA 3RI8A 1RINA 2OZ6A 2LUWA 1WMXA 2EXIA 3O1VA 1GZ9A 3ZO0B 2ZAHA 4JHZA 4H2AA 4NVPA 2VULA 4KWKA 4UFIA 2D6LX 4XQDA 5HV0A 4XJWA 2RM21 3HN3A 1RUNA 4XETA 5FYCA 1MS0A 4IV1B 1X50A 5L9BA 4INDA 2R32A 3DXTA 1GZWB 1YQ2A 2PHFA 3POBA 1OC1A 4BM8A 3U0ZA 1BLZA 2OVUA 3Q8AA 2BERA 3VL8A 4AG4A 2B4KA 3CNAA 4EZHA 1JYTA 5DMYA 3QD6A 1CQ9A 1GSLA 1HRV1 5D2AA 4ZPIA 2DYCA 1VAKA 3HWJA 3TN92 3WF4A 3D5OA 4XVHA 3FUOA 3R6SA 1Q8QA 2B8MA 1D4M2 5AVPA 2DTWA 4EN0A 4AE2A 5JIAA 5C6CA 4QHZA 2GN7A 5E16A 1SQ4A 4TYSA 1AR93 2P6HA 1E5IA 1DYOA 2WA3A 2WFF3 3JXSA 3OD0A 2Y8KA 5LATA 4KH9A 1Z7S1 3AKQA 3P3NA 3I2DA 3TAYA 1DP0A 1NCQB 2D3SA 3WNPA 3GHNA 3KT4A 1SBFA 2ET7A 2H0BA 3HNMA 5H9QA 5KXEA 2WR9A 2B9UA 3PUHA 2DBIA 4J25A 4CXWA 1ZZBA 4LA3A 1YEWA 4H3WA 1G9FA 3VKLA 3BIWE 4W6YA 4JKMA 3TRSB 1WLDA 1OA4A 1SG3A 3DPRB 4AI9A 5DAWA 2C26A 5FOBB 3JD73 1H2LA 3DUIA 3W9AA 2Y0IA 3FLRA 1AXKA 3N9NA 1HRI3 3H1WA 3ZFFC 4DRVA 1APNA 5HXVA 2B39A 2Q8CA 1HQLA 2JDAA 5F2SA 2R1DA 4LBQA 5HCFA 1HX6A 3MDPA 2XXZA 2RS33 4YW2A 1J84A 3AJZA 2O8QA 2ORXA 3OD4A 1Q3EA 1JBCA 3NNGA 4Q4V1 4YW7A 1ND3C 4M3CF 1Q8VA 5L7OB 3ZM8A 4LO4B 2PXJA 1C5IA 5FP9A 2YDEA 1V6MA 5A7OA 1QQP2 1VLNA 5SV5A 2ZZJA 3T2QA 4CP1A 4XMIA 2VL4A 5FZCA 3VDDA 4EE2A 2YFUA 4ORFA 1RGSA 4YVWC 4EN9B 1FPN1 2TBVA 2VD7A 2VZSA 5BNOA 5F37A 1JTZX 2LRPA 3SCHA 1VBC2 4XCAA 3NV1A 4IL7A 1BVP1 1UCXA 4CCCA 4NIDA 1HV1A 1RHI3 2RDNA 4QPWA 4NHYA 3QCWA 3ACGA 1R1ZA 1ZA4A 2ZAAA 5FY7A 2ZXQA 4YW5A 5J3UA 3RYPA 2VVEA 2YGMA 2H6CA 4MGYE 1QJZA 2Q1ZB 4XIOA 2RMU3 5HCHA 2EIBA 3K48A 5A32A 1O8SA 4O9EA 5A7NA 5IVEA 4B4PA 2G9GA 4XBNA 1UIKA 5FYUA 5BNOC 5FZDA 5JWPA 3T30A 4ARYA 1EAH2 2WBKA 2ZMNA 3MFCA 4BK5A 3WLUA 4FPHA 4CCEA 4E27A 4WVZA 3CMGA 4QQ2A 4XIKA 1EUTA 1PM7A 2EXHA 1SEFA 2R16A 2W08A 5JLVA 2VOTA 1O91A 2P3JA 3PUSA 4DPNA 2AEYA 3UNPA 4BQWA 3LEIA 3H42B 4KWJA 1N1TA 3ZYJB 2D97A 2D3PA 2Q8EA 4AW7A 4LUMA 4R8HA 1VBC1 1B35C 3KWVA 4Z8BA 2BNNA 2ZHMA 2OUJA 1IS5A 2DCYA 4IV1A 5A3NA 1KDMA 1GYKA 3POIA 3PUQA 3K46A 1UY4A 1VBB3 1VP6A 4CXXA 3PU8A 2HJIA 3MF9A 1YUDA 2VVFA 2Z69A 3E5XA 3PDQA 4AAXA 5F6LB 2UWBA 3H7YA 3CJIC 1F35A 5APAA 3A0NA 2R043 4AFAA 4BLJA 4IW3A 4DNYA 4OQ9A 4FP2A 2VECA 2ZTNA 1GQHA 2MEV1 2VUAA 3GZEA 3KLSA 4O9GA 4XJZA 1XE0A 3D8CA 1AYM3 3NKTA 1E57A 4F8AA 1KD7A 3GCXA 5A7SA 2QZ2A 4JC1A 1OUSA 1YLLA 1J1LA 2BDRA 4GALA 5IUQA 2WNVC 4EZ4A 3AVSA 5FY9A 5FY5A 2V09A 5FAXA 2WJSA 4B29A 3MZHA 1LB2A 1RMU3 1NKGA 5C8WA 4Q0VA 4JX0A 2XJVA 1ZRDA 1UPSA 4LXLA 4XJAA 2TNFA 4FOWA 4EV0A 1J59A 3MO4A 1QJU2 3GNEA 4FO9A 1QJX1 1H30A 2FMYA 5H9SA 3U75A 5B2GB 1Q8PA 3WQBA 1UOGA 3ZFEB 4NO4A 4RFT0 1W03A 1JOBA 4I09A 5GLWA 2BJSA 4P02B 3RRDA 3UKVA 3GM8A 2W5FA 1CAXB 1F5FA 3OBTA 1O4YA 4XF0A 3F2ZA 1W8FA 4YLZA 1L7QA 2VM9A 4QB2A 1XQNA 2WABA 3O0VA 5C3QA 1PO11 1GV9A 2A5ZA 4RHV2 5CISA 1VALA 2RS32 1ULGA 2YMZA 3MHZA 4JGZA 4FPKA 3P1IA 5IK5A 1YYNA 1IOAA 2W52A 1K42A 4P9IA 3T4VA 1PK6A 5FZ6A 4FFHA 1JYWA 1UMIA 2DTYA 5EZWA 4NN0A 3T0DA 5JSRA 1E5RA 5L7OA 5IJRA 3K2OA 4QDQA 5FMOS 5HXMA 3HQXA 2IXIA 1C8NA 3NJYA 3BKZA 3VDDB 3CQOA 3OPZA 4E8CA 1UMZA 4XILA 4AHWA 5CZKA 1Y9GA 2XBO3 2NM1A 2BU9A 4P9WA 3BTZA 1NZCA 1ZBA1 4BQ1A 4KMQA 4IXLA 4QPGC 1NQJA 2X5IB 1GZTA 1RUC1 2QQKA 4FI9A 3USSA 4LITA 3M4FA 4JDNA 5A7PA 4M4PA 1WW4A 3NAPB 3MV01 3QACA 4LT5A 4M3CA 4MH0E 5A33A 3WNLA 4K1ZA 4OI0A 2XLAA 2FHRA 2VUJA 1XOYA 2WLQA 5EIYB 1RUG2 4MGKE 1DYPA 2EIGA 4OHWA 1D0HA 4UW4A 1AR92 4YVSB 3ST7A 1IKPA 2CWSA 1DU3D 3T2PA 3TYJA 4ZZ5A 4YG0A 1U5ZA 3N36A 2ZABA 3EHKA 4CXYA 1MACA 5FZ4A 4B3NA 1HRV2 3ACIA 1S0GA 2YU2A 5DUWA 2W87A 3JQXA 1ENXA 3I7DA 1K5MA 4GULA 5FYBA 1WLWA 2GP5A 4P08A 4N53A 3LA3A 4JTOA 4E4ZA 1H9PA 1O4TA 2WRAA 3AP4A 3V0AB 2VPVA 2QNKA 3DXUA 2VCAA 4WVMB 2Z4FA 1O59A 1CAWA 3IT8A 2IXJA 3DPRC 5CKNA 3LD8A 1VBD3 5JUVA 1FAYA 2FQPA 1CJPA 3KF5A 3SCFA 3RZGA 1UL9A 1XNAA 2KR2A 3D82A 2Y34A 2VH9A 2PN5A 1H8TB 5DDJ2 5I0RA 2ADEA 4QMAA 4RL7A 5LRSA 3SH5A 4AR2A 1Y9QA 3AZYA 2JENA 3S6PA 2V4VA 5L73A 4EWEA 3MI8A 1G6NA 1QGLA 1X8EA 4YZ5A 4GIQA 3AKTA 4LBMA 1CX1A 4XZUG 1UU4A 1VRBA 1QQP3 2GMEA 5AFEA 4IDZA 4QXCA 1Q8SA 2E6VA 4UW3A 3WCRA 4ES8A 4DRRA 1PMHX 2CAUA 2ZGOA 1GQPA 5EYYA 3V0AA 3ETPA 4I3PA 4Q4W1 4FPCA 1AJOA 5FZHA 1DF0A 5HV4A 1X82A 1ULEA 1WGPA 3HIFA 3A7QA 4COVA 1MZFA 2BOJA 3MICA 2WNVA 2ZEWA 2PQSA 2WO3A 4AVAA 1QXJA 2UYBA 5BNQA 1A8DA 2J42A 3WP5A 3U1XA 1SBDA 2RV9A 1LGBA 1H4HA 4I01A 2RS51 1CX4A 1H6XA 4J1WA 5EYXA 3TOJA 4HMZA 3VZJA 4CP0A 1WBLA 5JI7A 4E8DA 4K1YA 1YQ8A 4AI8A 3ZFFB 4U2AA 2OT7A 1YQCA 1UZZA 2WNOA 3WD5A 5FY8A 3CZJA 5LASA 3LE0A 2D43A 2W92A 4M0HA 2DWRA 1G9BA 2QBXA 2B5HA 2YC0A 1G86A 4LIVA 2F4PA 3WY6A 5CA6A 1FPN2 4CDWB 3GGLA 5IFPA 5JXIA 5FMOL 3VZKA 3MUY1 5KXCA 3GALA 4N9IA 2E9QA 4UOJA 5I93A 2PHRA 3KV6A 2JG8B 2VUDA 3N9MA 1IHMA 1N1VA 3AP9A 3WF0A 2FDIA 4YM3A 2Z42A 4GH4B 5C8CB 1O3TA 1UYXA 3N9PA 1PX4A 5JXJA 1OFSA 1PO22 5LY2A 2WS93 3GF6A 5T54A 4C91A 1AX2A 4NWVA 1W9WA 4MVTA 4Q4W2 5D8AC 2FCVA 1AR91 2JG8C 3EQEA 4Q4X2 3B94A 5DABA 1UZ0A 4JCKA 1RITA 3I59B 5DPNA 4UFMA 1OD5A 3J7LA 5EV7A 3K51A 2HWC3 2PHUA 1AL21 4IGPA 2J7MA 1GUIA 2VOKA 4R52A 2WN3A 1UOJA 4Y1YA 5A7WB 3W20A 2HEYF 5CFCC 1P8JA 1PGW1 4LPLA 3B5LB 4F3JA 2HWF3 2IXLA 2WLPA 3I3QA 3SHRA 1J58A 2P5BA 2ZA9A 3ACLA 1RUE1 2PYTA 4NE9A 1QDOA 3O5SA 2CWMA 1OQEA 1W2AX 4FAGA 1H2NA 4H7MA 1KEXA 4E4HA 4QPGA 4Y5Z0 3WXPA 2C9AA 4CEWB 2C24A 3RVHA 3ZXJA 3KT7A 3HQRA 3VV1A 3WNKA 2XJUA 1HRI1 1PHMA 1UXZA 2YXSA 5GZDA 1PZ8A 1UO9A 1PVC2 3PJYA 2H6BA 4FXGB 3T1LA 3T0AA 4LHNA 1UY1A 3LCPA 3THTA 2VOXA 3IWZA 4UF0B 4BH9A 1ULCA 1W3VA 1NXD1 4LLOA 5C4WA 2W91A 3LZZA 5F5QA 3I2GA 2P1BA 1W6OB 3VD7A 1LEDA 2P17A 4LE4A 1OBNA 2K9ZA 1ZA7A 5LA1A 1JZ6A 2DFBA 4CEYA 4JRAA 4M01A 1JUIA 2W1WA 4HFSA 4JGZC 3VZMA 4DUXA 4HPKA 1PGW2 2FD8A 3WQ7A 1GKBA 1UYYA 1C28A 1H8VA 2BFUL 2EIEA 5F2WA 3ZR5A 1OOPB 1XPWA 2ZGNA 1UYZA 1PK6C 3BOPA 4F83A 2WA4A 2LTNA 2JE9A 3JBG1 4E4SA 2B7YA 2G19A 4NHXA 1Y43B 1CAUA 1S0JA 1I5PA 3FUQA 3ZYRA 2NP0A 4Q5OA 3R4DB 1H2KA 2HYXA 3BU0A 2YZ4A 4KBZA 5ACA3 1XSRA 3WSOA 2BGPA 2BZDA 5ERLA 1QJX2 4EQVA 4QPIC 5L36A 1LESA 2NYYA 4KQ7A 4K3UA 4Z07A 4A42A 2IZWA 3IMMA 2ZEXA 2DF7A 1FMD2 3J8F1 4OUSA 1PMIA 3FWEA 2W1QA 2RMU1 4BQYA 2BEOA 2W68A 3TEZA 1GMMA 1XE8A 3AK0A 3THDA 1LOAA 2QDNA 1LNSA 2PLV3 4A45A 1W6NA 3FFQA 3HQUA 4QU1A 5AC91 4JQRA 2WO2A 4CP9B 2PMWB 3ES1A 5EP9A 3BTYA 5AFBA 2D44A 3AMNA 4IE7A 4NHMA 4UXAA 5LBEA 1OLRA 3AMMA 3C3VA 2BGCA 1ZBE1 4CUBA 3UJQA 4BPZA 1CAVB 3D0SA 1MZ5A 1OURA 3AZZA 4WM7A 2CHHA 3H3UA 4UI9L 3TNPB 1VMFA 2QQIA 2V5DA 4CDQB 3UGGA 4P9GA 1R082 1GICA 2JXAA 4XMAA 3NV3A 3R4UA 1QNWA 1O3RA 3SXWA 1UMHA 1KFUL 4IV3C 3U14A 1CJDA 1OF3A 3LDRA 3E1F1 1HB1A 1VBB1 4JQTA 5F39A 2Y38A 2YUEA 1UOBA 4CDQC 3AMQA 5F7UA 1VBE2 3AMHA 1ODMA 2HWD3 3D0JA 3VKOA 3VBSC 3TN91 4YSFA 5BNPB 5JVVA 2RJ2A 2UWCA 3Q8BA 1OSGA 2Y6FA 3W58A 4BXFA 3RGBA 1TEIA 1IS3A 5FKCA 4Q0SA 1YC61 3N7JA 2YGLA 3AP7A 3OJBA 3AYAA 3BN6A 4DXRA 2DURA 2J1EA 4MYEA 1BVVA 3RFRA 1LECA 1G9DA 5FZ8A 3VL9A 1RUG1 4CDXC 4LE3A 3VD4A 1WCQA 3WV6A 4I3GA 4XC9A 1UZVA 1W2UA 2XONA 4LUKA 5IYYA 2P2KA 2IFWA 3U4SA 4Z2AA 3O14A 3VZNA 4JKKA 1SLBA 4CCNA 4DMIA 4AGVA 4Q1RA 3VBFB 1J1TA 1EPWA 1QH7A 2ZEYA 4IV3B 4CDQA 4QGMA 1HB4A 3QOPA 1MS8A 5EJZB 1VBD2 3H8RA 4CCOA 1Q43A 2RVAA 4AI0A 4L97A 3VHNA 1H8TA 4FOVA 5A3UA 5FYVA 2JG9B 3WF1A 1EYBA 5FP4A 3MLJA 3P5BA 3VBFC 4EWAA 5BNPC 3LPGA 5EWSA 4RR3A 4AI2A 4YGEA 2JIGA 5FOJB 4ZKTB 5C9AB 2VAUA 3SITA 2QDRA 1DQ5A 1SLLA 5FXVA 2YBPA 2R0FA 4K20A 3U07A 2R062 5FCCA 3DKWA 3AXEA 4GQ7A 3U37A 1W8NA 3PVBB 3MV11 4HVRA 1RUF2 3H1YA 3C7OA 2X5IA 1PO13 4B7EA 3B02A 4OMDA 5FPVA 5C70A 5C9AC 5CBLA 5CVRA 2IWGB 4JTNA 5JXGA 3CZUA 5LB6A 4QX3A 3OGGA 1W6OA 4CCLA 3U78A 2ORZA 5BYNA 5C71A 5FWEA 3RG0A 1CPMA 2OW4A 3EJKA 2JDPA 2HWB3 3CEWA 3H0OA 3MEPA 4PIZA 2ZKNA 2BBAA 4ZU5A 3T3YA 2HWE1 3O0XA 4DIQA 4XF1A 5AC92 5M0TA 1DFQA 2IVJA 1FV3A 2GMMA 2P3IA 4D6QA 2BYVE 3RNSA 2NMNA 3KQ4B 1ZBA3 3WF3A 3L2HA 5D8AA 5JR2A 4NROA 4FPGA 2JG8A 4HBNA 4XW3A 2CL2A 1RUC3 5LZ6A 4AEKA 4AYUA 5C3PA 1TME3 2V5YA 4YW6A 4TLFA 3ZSJA 1PM4A 2XJRA 3DF0A 1R081 3IMNA 3VHOA 2BVVA 4CPBD 4QAWA 5DXDA 1SPPA 3K4AA 4XAEA 2ARBA 2WC2A 3VD9A 1KJLA 2WSVA 5T52A 5EFUA 4CA9A 5I8TA 4PIYA 2JDKA 3MW2A 1VRH3 5A1LA 5A32B 1EAH1 1POV0 2XOMA 2VZQA 4JVAA 4BWOA 3BYWA 2E31A 3ROUA 1GLHA 4CEWC 2Q4SA 5CKMA 3F95A 2WNUC 3M8LA 4HSJA 4CDUA 1AR63 2ZHLA 4GAZA 1XNBA 3RYKA 3WZ1A 4JGYB 1GOFA 1F4AA 4W8JA 1C8M3 5DUUA 2Y6GA 4Q26A 5FP3A 4YARA 1RUH2 2XMLA 1AR72 2QQJA 4HKWA 1IS4A 1NCRC 3H3LA 3LB9A 1REEA 3BIEA 1UXXX 2B46X 2GNMA 1XU2A 3E6BA 1GU3A 1W2OA 3SKVA 3CHXA 5D8AB 3MFAA 2ATFA 3IPVA 5BNOB 3QLQA 4ZU4A 2EAKA 4Q4X1 1UZWA 5C4WC 3DV8A 5HCBA 1IS6A 1ENQA 1H6YA 1KS5A 1U5IA 2WNVB 1VBD1 4L9BA 2EF6A 4SBVA 4NIAA 1X9TA 1R093 4XF9A 4CEYC 4DZGA 1S0FA 4YGDA 2D6MA 4CDUC 4Q8LA 5C4WB 2XH6A 2KD7A 3D3AA 3ABZA 4GH4C 4YM2A 3OSDA 1TMF3 2BV4A 3POSA 4LEJA 3S7IA 4ARXA 3OBRA 1MQTB 4LMFA 5FMCA 4XFCA 2JEMA 4NR1A 2FCUA 1V70A 3URFA 1GR3A 4HANA 3VUOA 5J96B 4Y22B 1GOHA 4HK9A 4CDUB 5FV3A 4D6SA 1HRV3 3VBOC 1Y9MA 4QB1A 4ES9A 1Q5OA 1XYNA 1W6PB 1RUH1 2I2SA 4X8PA 4YG3A 1H4GA 3S5QA 1NA1A 2RJLA 4B1LA 3H3ZA 1LOGA 1T6GC 1EUUA 3DL3A 4LBNA 4MXWB 1POQA 1OOPC 1PVC1 1Z0HA 2ZBJA 4X6RB 1K45A 1XNDA 3O1SA 3B7MA 1B35B 4DO0A 1LOCA 5KHIA 2W1UA 4LKFA 2CDPA 4A2UA 4W50A 2VXRA 5FZ3A 1WW7A 5KXDA 4GKXA 5F3GA 1Z7S3 2WAAA 1XB9A 3O1RA 4B1MA 1YFUA 2JDMA 1IG3A 1PMJX 3ZXGA 1X36A 2A3YA 3SNMA 1QWRA 1XYPA 2P4EA 3DYOA 5FK8A 3E6CC 4HK8A 2GZWA 3WX5A 3POJA 3I4IA 4R9BA 2CDOA 2DDUA 2HKXA 2ZHKA 3T2TA 3U10A 4WM7C 2HBUA 4U36A 4N90A 4YZ4A 3OPTA 1ENSA 4Q8KA 3TWIA 1ACCA 1AL0G 4WVMA 2D93A 5FZKA 5FFOC 1AXYA 4GXLA 2Z79A 3Q9OA 3ZXLA 1ASJ2 3GJBA 2V73A 2WSUA 4QPIB 2Y6JA 3SKJE 1OF4A 4NHLA 2GSYA 5FZGA 2CV6A 3ZXFA 4HN0A 3VN4A 3ZN4A 3FX3A 3AP5A 3BALA 4KU8A 2FBEA 4MHRA 1BEV3 2R7EB 2Y6HA 2W3JA 3DYPA 5FR3A 4AEDB 5AVAA 1MS1A 1D7PM 4AXOA 2HWC1 1VJ2A 1LEMA 3LKJA 3V56A 5FDBA 2YV8A 3KMHA 2AEZA 3VKNA 2DCTA 1X33A 3PVEA 4AEDC 4MGSA 1D0GA 2Y26A 3IDBB 1XBFA 2WZEA 4IEXA 4K6BA 2DFCA 4URTA 2XGXA 3SH3A 3Q8FA 5BV6A 1LTEA 2XHNA 1YFWA 5A7WA 2ZKLA 1FPN3 2GC0A 3ENRA 2BP6A 5GM0A 5K0UA 3NJZA 5T5PA 3O0WA 1Y3TA 3H8XA 3VBRA 5JSPA 3OF1A 4NIIA 3UK9A 2WIIB 3PURA 5JZGC 3BOWA 5IVFA 1R64A 1V6JA 3AM2A 1LOBA 1I9RA 1POV1 4HT1T 5FZOA 3VBFA 3VZOA 4COYA 1W28A 1MVQA 3N7MA 1S2BA 2WS92 3M2MA 4DS0A 3E97A 3BTAA 4XFFA 5FZ7A 3AL6A 4K7JA 1DCSA 1KITA 5FLHA 1FV2A 4XTMA 5I8SA 4AI3A 1ENRA 2WN2A 2YBKA 3E6DA 1Q8OA 4DXSA 4LHKA 5A6XA 3QH7A 4XDQA 1R1A3 4D3WA 1QOOA 2WNUA 4OZOA 1WMFA 2VY0A 4QQOA 5C9AA 4FTSA 1V6OA 3RZMA 2DUQA 2OUHA 2WYSA 3VBRC 1RVF2 1C5HA 5FZFA 3OYWA 1UY0A 4XDOA 1BJQA 1V6NA 1W39A 2Y64A 5I8YA 2V4AA 4P00B 2TUNA 4AF9A 4FXKB 1RTVA 5BPXA 1PO21 1SLIA 4ZZ8A 4Z82A 1QDCA 4JRLA 1LU2A 3CO2A 1VB4A 2OZJA 4QQLA 5ACA1 1CWPA 3OCPA 5BNNB 1O7FA 4R4ZA 3O1OA 2ZX4A 5C3SA 1FNYA 2B45X 2XLGA 2ETEA 3C7GA 1ZZ7A 1RUI2 4AVTA 1DZTA 4UFJA 3T4HB 4Y3OA 1IZ3A 4HETA 5FRAA 4RA0A 1LHVA 5GLZA 3TB0A 4BZ4A 4ZU7A 3G6JB 3SMHA 2IUWA 1CZSA 1WD3A 3SEPA 4E2SA 1GNHA 4EN7B 3FMGA 1MVEA 1QJY3 2PLV1 2RG4A 3AP6A 3B9IA 3KCXA 4QDSA 5IWFA 1FNZA 2C6SA 3EB7A 3ES4A 3SISA 5AC93 1ODNA 3AL5A 5KHHA 5I0SA 4V2VA 3RDIA 4CVUA 2GH8A 3OG2A 5FO9B 4LO7A 1SCRA 1AYM1 1FX5A 1ZBE3 1WZXA 1QHDA 1Z7S2 2ARAA 4PJYA 3ZSKA 3PUIA 4QT6A 4TZDA 3OGRA 4Q0UA 2VVDA 2WT1A 4JHTA 4QX2A 3MIDA 3H50A 4Y20A 1XYOA 2A6VA 2A3WA 2R30A 3LOIA 5BY5A 3C7EA 2ZX3A 2K0GA 4LORA 5IVYA 2GAUA 2VMIA 4D94A 5JSOA 3ZFFA 2R071 3PMEA 4PBOA 1ZX5A 1KXGA 4LOSA 4S2DA 3L9JT 4ATFA 4C0BA 1XNTA 3KV4A 3PJQA 2X53S 3WF2A 1F8VA 1NUKA 5FYMA 1Y7BA 2W0XA 5FKBA 2ZCWA 4QPIA 1C8M2 1MS5A 1IQDC 2PLV2 3WNXA 1HXS3 2UWAA 1UD1A 1O6UA 3ZX7A 1AR81 1PNFA 2R49A 4I30A 2JICA 2CNAA 2VNOA 4XXPA 5JCTA 1EV11 1L7LA 2NLRA 4CZSA 1NCRB 3CKHA 3GCWA 3MW4A 4IEZA 1RUG3 2XJPA 4PHZA 4S2GA 1D4VB 3GYDA 2ES3A 1WKYA 3I54A 3KCCA 3MIHA 4RQPA 1OQDA 3JQWA 3ECQA 2XWBB 2CU5A 3O1PA 1QMJA 4RD7A 2YROA 3IN9A 3VHRA 4COWA 2BTVC 3OOXA 1D4M3 4EN6B 3JB8A 4OYUA 4UWDA 5LEJA 1RUE2 1W9SA 4P5HA 2F4LA 4FFIA 4JV4A 1LHOA 2JDUA 2O0OA 2VJXA 2WFPA 1AR71 1TMF2 4LBQD 2VCMA 4BE3A 4IEUA 5JPMB 4IEPA 3PLQA 4QHBA 2JB4A 1ULFA 2HWD2 3ALQA 4DQAA 2GN3A 1HJGA 3LEKA 3BTXA 4OQ8A 4RR3B 5JAXA 1UX7A 2GNTA 2GC1A 1CR7A 3DKQA 1WMEA 3ZSMA 4ISQA 5IVVA 1CGPA 3PU3A 1MS4A 1PNGA 1JI6A 2MHFA 3BPSA 3LSEA 4C8DA 1WWYA 4PT6A 3SCGA 1W8OA 1GANA 4G4FA 1S0CA 2R1BA 2GH2A 1VBA3 2KA3A
chains in the Genus database with same CATH topology
3FC0A 4R4XA 3RWNA 5JZGA 3AXDA 3P3PA 3JD72 3WQ1A 1I6XA 1LHUA 4J6GA 2RHPA 1F2NA 3GZTB 5T5OA 4LLFA 4R9DA 1JOJA 2EVXA 3M1HA 1QU0A 5T50A 3FZ3A 5CFCB 1CONA 3OYWB 2ENRA 2ZZQA 2VU9A 1GBGA 4JGYA 1KFXL 2ZGKA 3MYXA 1UKGA 3NAPA 4R9AA 4AVVA 1EPZA 4L11A 1PZ9A 4D7TA 3BB6A 2DVDA 2ZACA 4OHVA 2D6NA 3FE5A 4PF5A 3AJYA 1G9AA 1ZRRA 1ND2C 5CFDC 1LGCA 1ZREA 3PHMA 1BEV2 4XF4A 1RL3A 1PGL2 4GWNA 5JPNB 1VRH1 4S2HA 2DU1A 2MEV2 2ARXA 2I07B 3N7LA 2FMDA 3HD8B 4Q0QA 3CL1A 5K0UC 2XKOA 1YIFA 1HQNA 4LTAA 4COUA 3NV2A 4YZ1A 2AR6A 2ILMA 1A8MA 2QVSB 1QH6A 1QXRA 4LHLA 4BHPA 1KDKA 3FLTA 2E53A 2D7FA 5J48A 3LSDA 3H1MA 2WINB 3APBA 4MLOA 3BCWA 1A3KA 5KC5A 4ISRA 2QE3A 2RS53 1N3QA 5HCAA 1PVXA 2F6BA 2D5FA 4AK3A 4QD2A 1YXWA 4DY5A 1TMF1 1RIRA 3W59A 4L8QA 1R1A2 3EBRA 1BBT3 3VBHC 1GZWA 3H8UA 3N7KA 3U11A 1AR62 2BWCA 4FVVA 3MIBA 4AFDA 3WP4A 4HKLA 1RUH3 1QJU1 5TSWA 1GZCA 2A71A 1PVC3 2CGOA 1RUOA 1C3HA 2FZ1A 2JG9C 1LCLA 2WS91 1UPIA 3MIGA 4KU7A 4OUMA 4QGLA 2XVKA 2AGSA 3GBGA 4E9KA 4J1XA 1DHKB 1WMDA 1OQ1A 4M0NA 1AL23 2XJQA 1RB8G 4MXVA 3V65A 2VG9A 1CN1A 5EJ3A 1CD3G 1RUF1 1N47A 2C5DA 3WDVA 1UKRA 1JYCA 1YI9A 1QJY2 3KS7A 1VR3A 1FOD2 4YW4A 3VHPA 1V6KA 3DGTA 4OLLA 1RUD2 5T55A 1AXZA 3CF6E 3ZMOA 2XLFA 4FOYA 3J9SA 4Y1XA 1H2MA 5ACA2 2BVBA 1I5ZA 2RS11 5DZEA 4Q0PA 2HWB2 4TWTA 4AQSA 4C0HA 4HPKB 4LBQB 4AHZA 4WM8C 2D6PA 1DQ2A 4Y20B 1BEV1 1V9U3 5LEKA 5L7OC 4RHV3 2QJVA 4GKYA 1ZBA2 5J36A 1QOTA 1QXPA 3AYDA 3KT1A 1UAIA 1M4WA 3H9AA 1BCXA 4YVSA 4MV2A 2PTMA 3IKWA 1OHFA 4LBLA 2WNUB 1ZZCA 2XG3A 3I8TA 4G9SB 1MR5A 2GU9A 1B09A 1LOEA 1SDWA 2DVFA 3POWA 3ILFA 4KNCA 4P14A 1PIV1 1SMVA 2D40A 3IDCB 4AQ2A 1COV1 3NV4A 1V00A 4W65A 5DG2A 1G8WA 3J8F3 1ZZ9A 3L2YA 5J37A 4BMEA 1NLRA 2VW2A 2CY6A 5GALA 5FREA 3ATGA 3WHUA 5DUXA 1DQ0A 4XF3A 3ZFGA 1S0DA 2K2SA 3ME2A 4PCRA 4AGRA 2ZMLA 1S55A 1TQ5A 5KC6A 4BIOA 4AFMA 1A6CA 4RR3C 1PO23 2BNOA 4XFBA 1U5XA 3ZYGA 4AEDA 1VBA2 1LRHA 4AGGA 2HYKA 1MZEA 1GQGA 2WZR2 2I74A 4KL1A 4E4DX 1JUHA 2AYHA 1ZRCA 1XNCA 4XZPA 4KGGA 3WG3A 4NWWA 3POYA 5BXXA 5ABJB 4A3XA 2HWD1 3TN93 2NN8A 4CEYB 1Z78A 2E7AA 1GFF2 3MW3A 3ZIWA 1MEC1 5CFDB 5L19A 4WM7B 3M3EA 2RM22 1ND2A 4R9CA 4YW3A 3M3OA 3R05A 4OVEA 4FQ4A 2DVBA 1U0AA 3FBMA 4YZ3A 4YNIA 4I02A 2CGPA 4AFBA 1OPMA 2R0HA 3M3IA 2ZGMA 3JCIA 3HBZA 1W6MA 4C1WA 4DXZA 2BFUS 1SLTA 3B9CA 3KGLA 4EROA 2VQ0A 4UW6A 4XJ8A 5LRRA 2CGNA 2XUMA 1SLCA 3AYEA 1FOD3 1KJRA 4RS5A 1RUD3 1YWKA 4XTPA 3AZVA 4PBPA 1IPJA 3INAA 4A7YA 5JOZA 3VKMA 2VOWA 2BPA2 2FZ2A 5DZFA 2D3RA 1DLLA 3LAGA 1HQWA 1HXS1 1NE6A 3KD4A 4GMP1 1DGLA 4V1PA 4XQWA 1AR83 1BQPA 2DCZA 4QPGB 1EV13 1H9WA 1ND2B 5JOWA 4M3CE 1SCSA 1AZDA 3S7EA 1DZQA 3WDWA 1COV2 3FHIB 5FBZA 1DGRN 5JZGB 4LO6B 2BW8A 3VBHB 4HLTA 1WLCA 1AYN2 5KHKA 4BOWA 2Q5TA 2N7GA 1NQDA 1D4M1 1ASJ3 1CVNA 1IKQA 1NOVA 2C1FA 1HIXA 3M3QA 5JI9A 1ND3A 1AR73 3M7AA 1AHSA 5FLIA 3OTFA 1VB2A 5C33A 4I2OA 4KWLA 5H9RA 3QBQA 4MX3A 3B69A 3ZSEA 4LBOA 4XPVA 5EXOA 1J3QA 2ZGRA 1WA4A 2JKBA 4N53C 3RMYA 2D6KA 4AVCA 1FMD1 1J3PA 1R083 1C4RA 3ILRA 4OHXA 1D2SA 4AFCA 1DGWX 2IXHA 1FATA 2YHJA 1CIWA 1BYHA 1YCIA 5GJ6A 2XWJB 3WDXA 1S0BA 3NKGA 2A7AA 1YFYA 4ASLA 3AKPA 3WW2A 1EAH3 3GZAA 4GA9A 4XFGA 1RVF1 4OHYA 1VIWB 1V6IA 1NG0A 2A6ZA 5FPZA 3ZFGB 4XQ4A 1AR61 4LBKA 4OHZA 1C8M1 2Q30A 4XFAA 1DDLA 1ALYA 5K9YA 2VMHA 2EAAA 3BODA 2AREA 1CESA 5I0UA 3CU7A 4Z1VA 5JIUA 5LK5A 3MLKA 4FQZA 1H0BA 2WZR3 1ZM1A 1YJKA 1AJKA 3TNQA 1VBB2 1RUI1 4AVBA 4KGQA 2ZGTA 4ATEA 4YVSC 3MIEA 4PDWB 1HLCA 4AEJA 1R091 1SLAA 1JH5A 2AUYA 2D5HA 3OGJA 1NCQA 3PTYA 1DQ1A 1RUJ3 3AKSA 3BPZA 2P3KA 1AYM2 2E7QA 3OY8B 1UIJA 4PDWC 4ITCA 5F9TA 1H8TC 3M70A 1V6LA 1WD4A 5KXBA 3RS6A 5CB7A 4X8NA 1ULDA 2VNGA 3DPRA 4HVQA 4YVWB 2RE9A 3GHMA 2PHDA 3J4UH 2AENA 4OI1A 4ONUA 1ZVFA 4S2FA 3WP6A 1ZZ6A 4LA2A 3EXUA 2I45A 4Y1VA 4JGYC 1RHI2 5GLTA 1ZBE2 2A3XA 3IDEA 1QNYA 4N43B 2ZGQA 2RR12 3B00A 1LHNA 2BWAA 3ZVXA 2R061 2JX9A 3O12A 5LK7B 3VBSA 3LA2A 1WW5A 4SLIA 1AR82 2BUKA 2D6OX 3HT1A 3RJ2X 4Q4Y3 3RQ0A 4TSVA 4FT8A 3WW1A 3PVOA 5JDBA 2XPJA 2OYZA 1CAUB 4H14A 1ONAA 1F31A 2DCKA 1OMIA 1AYN3 4I0BA 4KBBA 1N1SA 1LU1A 4FPOB 4XXAA 1REDA 5J7MA 2GC2A 1A78A 2WFF1 2H0VA 1LENA 2E63A 1YJLA 5CADA 2UURA 4IEWA 1U12A 5KHJA 2WQZC 1C1FA 3PNAA 1VAMA 2A6XA 3J26N 4QQHA 5SV8A 1EY2A 2O1QA 4COZA 3VLBB 5CAZA 4WZFA 4DFSA 1S0EA 1IQAA 4PQ9A 4CEWA 5DUVA 4YGCA 3VBOB 5GZCA 2RS13 4UBHA 1BKZA 5IK7A 5BUVA 1DYKA 3R0RA 1POV3 5H9PA 4RQPB 3RJRA 1V9U1 4YM0A 4YFZA 3VZLA 1PO12 3BU7A 4A7KA 4RHV1 2PFWA 1URXA 4H55A 2WKKA 3ZYPA 2ZOEB 4GB32 3RSJA 1C57A 4XOGA 1W6QA 1N3PA 2Z5WA 4YW1A 4BYYA 1R1A1 2YPJA 2Y0OA 1HKDA 4XHXA 1Q56A 1MEC2 2VW0A 4FPJA 4YFWA 3PVNA 4FOQA 2QCSB 2DUPA 1QKQA 4XJ9A 4GWMA 3HR9A 4FPEA 3ELNA 3USUB 1H1MA 5GLVA 2EALA 1WCSA 2RJKA 5A3LA 1NY71 5GKAC 2OPKA 3NW4A 3X29B 3ZDSA 4EN8B 5DDJ1 1PGL1 1MQTC 2HWE2 1UU6A 1SFNA 1PIV3 1RJ7A 4MZUA 3QH6A 1ZNPA 4XFIA 3MF6A 3FFZA 2WZPP 1RHI1 1YI7A 3ZXKA 5FO8B 3GBWA 3N4MA 1COV3 1RUC2 1S2KA 4FAHA 2B42B 3OY8A 4N7IA 3IBMA 3ZIXA 1TME2 5JOYA 3KM5A 4Q2FA 2HEVF 4WZCA 1K5MB 1EP0A 4N53B 4WBBA 1QJY1 2WT2A 5IK4A 4IERA 1HXS2 4HZFA 2PHLA 3ZXEA 2XBO2 1MQTA 1O5UA 2WQ4A 3AFKA 4NHKA 4XYXA 1W0OA 3ZFEC 1W6PA 5K0UB 2RS52 1YIPA 3WR0A 2ZJCA 2RR13 5JR7B 4YM1A 3JZVA 4P9LA 1IGOA 4IETA 3VBUB 1VBC3 3NO8A 3H7JA 4MXWA 1NXMA 2PAMA 3VBSB 2VW1A 3VDDC 1X7NA 2PA7A 2R073 1X8MA 5T3NA 1K5MC 2UU8A 2Q1MA 2QQPA 1I3HA 1BK1A 2ERFA 1H1IA 4XHBA 2JECA 5BNPA 2R6QA 2GNDA 4AQ6A 2XL9A 4PIXA 4B4RA 1DBNA 2NPIA 1YO8A 3D4KA 1LOFA 1OOPA 2EXJA 2WT0A 1DGRA 4FCAA 4BCUA 3UKTA 3WG2A 3WOGA 4IV3A 1NCQC 1RMU1 1TNFA 4Y26A 4UW5A 1WCDJ 1S0IA 3NSTA 4G3YC 3MIFA 1G7YA 2ZS6B 3B01A 1J3RA 2ZGPA 2ZGUA 3ZFGC 4CTEA 1JW6A 3WT3A 5F1RA 4CYDA 2KM2A 1FOD1 4WVWA 1KQRA 4CDWA 2OA2A 2JD4A 1AX1A 1RJ8A 4B8EA 5FLJA 2E7TA 1OI6A 4IEQA 1B35A 1UN1A 2O8OA 3KCYA 3MLLA 5F6KA 2R042 4PLOA 1XRUA 2PHTA 5C8CA 4GMP0 3FBYA 4GMP3 3ASIA 4I0AA 4RGGA 4QXKA 4E2GA 3WVJA 3CLPA 1WUVA 4GB33 1VBA1 3FLPA 4HKOA 2GDFA 3JB4C 4AWDA 4CDWC 3C2UA 1ASJ1 4P9YA 2GMPA 3WCSA 4A7ZA 1HRI2 4QQPA 4EWDA 1QOSA 1JHNA 2A6YA 3USUA 3WQ0A 3MPPG 4P9JA 5C8CC 1MS9A 3FJSA 2XBO1 4Q4Y2 1JN2P 4Q4V2 5I0TA 1ND3B 2JDZA 2X8KA 3CJXA 1PGSA 1WLTA 2YY1A 3LA7A 5T5LA 5GZFA 4MSVA 1DG6A 4CP2A 3J8F2 2BNMA 4RS5C 2WL1A 4K21A 1FMD3 1HDKA 2WWSA 5FQ0A 2IXCA 1O3SA 2GALA 5BNNA 1N1YA 1CAWB 1WW6A 2QKDA 4B4QA 3NWKA 5CFCA 1O3QA 3UL2A 2ZGSA 4RS5B 2IXKA 2XJTA 4BLIA 1FYUA 4OFGA 5DG1A 4LR4A 1BBT2 5K8SA 3N3HA 1M06G 5ABJC 4N9HA 1SACA 4AHXA 1HV0A 2HWF2 2XJSA 3T1MA 4XE9A 1UW8A 2HEWF 3PMSA 1I1EA 1VBE1 3RI9A 2Q0AA 1YNAA 3KZ4C 3D6EA 4QM9A 4IEYA 3JBG2 1BXHA 1UF2C 5GZEA 2RM23 1W6QB 3ILNA 1DQ4A 1RUJ1 1LR5A 1YFXA 2XHKA 4FTBA 3AZXA 4QU2A 4WM8A 1BBT1 1CAXA 4K8FA 1ZRFA 5IT6A 4NPRA 1OA2A 2NMOA 1QQP1 5KHGA 4WV8A 1NYWA 4BMBA 2OIIA 5CG9A 4L99A 3GZUC 5DZGA 4JGZB 4EJRA 4LULA 1QJU3 5HI0A 3ETQA 3V64A 2JJ6A 3AZWA 2PELA 4OI2A 1NLSA 3AB0A 4M00A 4MGZE 1PK6B 1V9U2 1FI2A 2JE7A 1F9KA 3E5UA 2BBVA 1AUYA 3B93A 4YVWA 4GH4A 2C0ZA 4FPFA 5E89A 5GZGA 2PHXA 4YRDA 1RC6A 2R063 4C90A 2LM3A 1OFNA 4LO5B 3WW4A 3I59A 1RUF3 4HSLA 3LOBA 1RUJ2 4XBLA 4LO8A 4Q4Y1 4ASMB 3HN1A 4H7LA 1NA1C 3UJOA 4Y24A 1LJ7A 1XE7A 4MGIE 4K9SA 4W6XA 5J09A 2GC3A 4IESA 3VGIA 3ZYIB 4MUVA 2W39A 3JD71 1AYN1 2X5IC 4N7UA 1OPOA 4C1XA 3S30A 2A75A 4PDWA 1BMV2 1UU5A 3WUDA 1LODA 2YYOA 4QPYA 4QX5A 2RS31 4NOTA 4RGAA 1SFYA 1JXNA 3AKRA 1EV12 4YGBA 3B3QE 4Q4V3 2DVAA 3IIAA 4HL0A 2G9FA 2IC1A 2PHWA 3MGUA 5E88A 2A6WA 3TBDA 3O7OA 3S0MA 3WG1A 2HWF1 2EA7A 4QM8A 4IV1C 4Z2WA 5JOXA 3WINE 2XVGA 1RUE3 4B7KA 2XL7A 4YG6A 3EO6A 3RMXA 3VBRB 5D1IA 3VKFC 3WW3A 4FSJA 4XEZA 2UY8A 3CJIA 1VRH2 1D2QA 1QF3A 5CNAA 3SH4A 1TNRA 1JYIA 2UY9A 4LBJA 4OZXA 2TEPA 5IK8A 3UKNA 1N3OA 4F7ZA 4FTEA 1ZYBA 3NVCA 2A73B 4YZ2A 2ET1A 3G7DA 5BNNC 5I91A 1BMV1 4DINB 3KSCA 3IPVB 4D69A 3ZN5A 5KBFA 2DU0A 2AH2A 3ZXDA 4WVVA 4JDMA 4Q29A 4XJUA 4W6WA 4DB5A 1UZYA 1TE1B 3RPQA 4QGNA 3JUUA 4AEMA 1IPKA 1G9CA 3ZN6A 4CDXB 1NCRA 1FXZA 2AZ5A 1KRIA 5CG8A 4FBFA 2MNGA 1OLQA 2VOVA 3JBG3 1R092 4IEOA 5DDJ3 1RMU2 2DCJA 3LWCA 3WDTA 2DV9A 2WFF2 1LHWA 3VBUA 4PLMA 2LALA 2EXKA 3MPBA 4WM8B 5FO7B 2JG9A 3NL1A 4IEVA 3A4UA 4Z92B 4P9XA 1KS4A 4XFHA 2R041 3AYCA 4FPYA 1MEC3 2KXLA 3RYRA 4DOUA 4JDOA 2MEV3 2VMGA 4K40A 3VBOA 4KG0A 5FTTC 3SLIA 1GNZA 5FPXA 1HW5A 2XVLA 2P34A 2SLIA 2NZ9A 1AX0A 3HT2A 4AI1A 2RR11 2XB6C 4E2QA 1AVBA 1F5JA 4DY3A 1REFA 5ABJA 1QJX3 3U4XA 1XU1A 2ZPXA 3V0BA 3WHTA 1AF9A 2CYFA 4I0WB 1RUD1 4PLNA 3VBHA 4ZXKA 2IFRA 3M3CA 4N43C 4XBQA 4Q1PA 4AVSA 1L3JA 2ZX1A 3ZSLA 4D7SA 1DGWA 5JMCA 3WP3A 1W0PA 4LNVA 3AMPA 2DVGA 3AX4A 3KQRA 4BIFA 4META 3ZMNA 5T5JA 3JU9A 4OI4A 2QFEA 3WDUA 3ZPYA 3ZFEA 1H1AA 4Y4YA 3E5QA 4KG8A 4N43A 1S1AA 3V0BB 2NQYA 2BQPA 1OA3A 4D7YA 1XNKA 2RS12 2VGDA 3AFGA 1NE4A 5CU1A 5A3MA 2A70A 4BA6A 1AL22 2P37A 2HWC2 1WBFA 3CJIB 4M3CB 1VAVA 5A33B 2VQAA 4OULA 4RQPC 4HN1A 1MS3A 4RSUA 1WCKA 1QY4A 2XKPA 4GB31 3LGRA 1O4ZA 2GNBA 2PAEA 3WDYA 4X6QB 2PAKA 4Y1UA 2UYAA 2D98A 3ZXAC 1BZWA 3HAGA 1RVF3 2HWB1 3N35A 1LOFC 1NY72 3ZN6B 4CDXA 2HWE3 5CIRA 5E1RA 4YYOA 2QZ3A 4Y22A 1O5LA 1YHFA 1C1LA 3WG4A 1CAVA 5HBAA 4CRQA 1CPNA 4Y1ZA 2WZR1 1NA1B 1XXNA 1MZ6A 1DZRA 1TME1 1RUI3 1U5YA 3R4SA 2ZMKA 1LULA 1YRZA 3UV9A 3WUCA 1LKNA 2ZGLA 2ZX0A 3A0KA 3VBUC 1FT9A 3DN7A 5FQ0B 2ZHNA 4UBGA 4Q27A 3HMYA 1SBEA 2X29A 2Q8OA 1PIV2 2WNEA 2G4IA 2QUOA 4FP3A 4L92A 2ZX2A 1UX6A 2CTVA 5KWRA 1ZZ8A 3THPA 3NAPC 1OKQA 2MPFA 3KB5A 4IQPA 3KGZA 1DIWA 3GBFA 1W6NB 4L2NA 1LGNA 2VNRA 3RZZA 2CAVA 2RMU2 1DQ6A 2Z2SB 2DUOA 4AHYA 4HVOA 4AQTA 5J98B 2R072 5GLUA 5CFDA 2SBAA 1PZ7A 4Q4W3 4JAAA 2E51A 2PQQA 3IM0A 1VBE3 4Q4X3 4FPLA 1W6MB 5E8AA 3RI8A 1RINA 2OZ6A 2LUWA 2EXIA 1GZ9A 3ZO0B 2ZAHA 4NVPA 2VULA 4KWKA 4XQDA 2D6LX 4XJWA 2RM21 1RUNA 4XETA 1MS0A 4IV1B 1X50A 4INDA 2R32A 1GZWB 2PHFA 4BM8A 3U0ZA 2OVUA 4AG4A 3VL8A 3CNAA 3QD6A 1CQ9A 1GSLA 1HRV1 2DYCA 1VAKA 3HWJA 3TN92 3D5OA 3FUOA 3R6SA 1Q8QA 2B8MA 1D4M2 5AVPA 2DTWA 4EN0A 4AE2A 5JIAA 5C6CA 2GN7A 5E16A 1SQ4A 4TYSA 1AR93 2WA3A 2WFF3 3OD0A 4KH9A 1Z7S1 3AKQA 3P3NA 3I2DA 3TAYA 1NCQB 2D3SA 3GHNA 3KT4A 1SBFA 2ET7A 2H0BA 5H9QA 5KXEA 2B9UA 1ZZBA 4LA3A 4H3WA 1G9FA 3VKLA 3BIWE 4W6YA 3TRSB 1WLDA 1OA4A 3DPRB 5FOBB 3JD73 1H2LA 3DUIA 3W9AA 2Y0IA 3FLRA 1AXKA 1HRI3 3H1WA 3ZFFC 4DRVA 1APNA 5HXVA 2B39A 1HQLA 2R1DA 4LBQA 5HCFA 1HX6A 3MDPA 2RS33 4YW2A 3AJZA 2O8QA 3OD4A 1Q3EA 1JBCA 4Q4V1 1ND3C 4M3CF 1Q8VA 5L7OB 4LO4B 1C5IA 2YDEA 1V6MA 5SV5A 1QQP2 1VLNA 4CP1A 2ZZJA 4XMIA 3VDDA 4ORFA 1RGSA 4YVWC 4EN9B 1FPN1 2TBVA 5BNOA 1JTZX 3SCHA 1VBC2 3NV1A 4IL7A 1BVP1 1UCXA 1HV1A 1RHI3 3QCWA 1R1ZA 1ZA4A 2ZAAA 4YW5A 3RYPA 2VVEA 2YGMA 2H6CA 4MGYE 1QJZA 2Q1ZB 4XIOA 2RMU3 3K48A 5A32A 4O9EA 4B4PA 2G9GA 4XBNA 1UIKA 5BNOC 5JWPA 1EAH2 2ZMNA 3MFCA 3WLUA 4FPHA 4E27A 4WVZA 4QQ2A 4XIKA 1PM7A 2EXHA 1SEFA 2R16A 2W08A 5JLVA 1O91A 2P3JA 4DPNA 4KWJA 1N1TA 3ZYJB 2D97A 2D3PA 4AW7A 4LUMA 4R8HA 1VBC1 1B35C 4Z8BA 2BNNA 2ZHMA 2OUJA 1IS5A 2DCYA 4IV1A 1KDMA 1GYKA 1VBB3 1VP6A 2HJIA 3MF9A 1YUDA 2VVFA 2Z69A 3E5XA 5F6LB 2UWBA 3H7YA 3CJIC 4DNYA 3A0NA 2R043 4AFAA 4BLJA 4FP2A 2VECA 2ZTNA 1GQHA 2MEV1 2VUAA 3KLSA 4O9GA 4XJZA 3D8CA 1AYM3 3NKTA 1E57A 4F8AA 1KD7A 2QZ2A 4JC1A 1YLLA 1J1LA 4GALA 5IUQA 2WNVC 1LB2A 4B29A 2V09A 5FAXA 2WJSA 3MZHA 1RMU3 5C8WA 4Q0VA 2XJVA 1ZRDA 1UPSA 4XJAA 4EV0A 2TNFA 4FOWA 1J59A 1QJU2 3GNEA 4FO9A 1QJX1 1H30A 2FMYA 5H9SA 5B2GB 1Q8PA 3ZFEB 4NO4A 4RFT0 4I09A 5GLWA 3RRDA 3UKVA 3OBTA 1CAXB 1F5FA 1O4YA 4XF0A 4YLZA 1XQNA 3O0VA 1PO11 1GV9A 2A5ZA 4RHV2 1VALA 2RS32 1ULGA 2YMZA 4JGZA 4FPKA 5IK5A 1YYNA 1IOAA 2W52A 4P9IA 1PK6A 2DTYA 5EZWA 4NN0A 5JSRA 5L7OA 5FMOS 3HQXA 2IXIA 1C8NA 3VDDB 3OPZA 1UMZA 4XILA 4AHWA 2XBO3 2NM1A 4P9WA 1NZCA 1ZBA1 4BQ1A 4IXLA 4QPGC 1NQJA 2X5IB 1RUC1 3USSA 3M4FA 4JDNA 1WW4A 3NAPB 3QACA 4LT5A 4M3CA 4MH0E 5A33A 4OI0A 4K1ZA 2XLAA 2FHRA 2VUJA 2WLQA 1RUG2 4MGKE 1DYPA 2EIGA 4OHWA 1D0HA 4UW4A 1AR92 4YVSB 3ST7A 1IKPA 2CWSA 1DU3D 3TYJA 4YG0A 1U5ZA 3N36A 2ZABA 3EHKA 1MACA 4B3NA 1HRV2 1S0GA 5DUWA 3JQXA 1ENXA 3I7DA 1K5MA 4GULA 4E4ZA 1WLWA 4N53A 3LA3A 4JTOA 1H9PA 1O4TA 3AP4A 3V0AB 2VPVA 2QNKA 4WVMB 1CAWA 3IT8A 2IXJA 3DPRC 1VBD3 1FAYA 2FQPA 1CJPA 3SCFA 1UL9A 3D82A 2VH9A 2PN5A 1H8TB 5DDJ2 5I0RA 4QMAA 4RL7A 5LRSA 3SH5A 1Y9QA 3AZYA 2JENA 3S6PA 5L73A 4EWEA 3MI8A 1G6NA 1QGLA 1X8EA 4YZ5A 4GIQA 3AKTA 4LBMA 1UU4A 1QQP3 2GMEA 5AFEA 1Q8SA 2E6VA 4UW3A 3WCRA 4ES8A 4DRRA 2CAUA 2ZGOA 5EYYA 3V0AA 4I3PA 4Q4W1 4FPCA 1AJOA 1DF0A 1X82A 1ULEA 1WGPA 3HIFA 4COVA 1MZFA 3MICA 2WNVA 4AVAA 1QXJA 2UYBA 5BNQA 1A8DA 3WP5A 1SBDA 1LGBA 1H4HA 4I01A 2RS51 1CX4A 4J1WA 5EYXA 3TOJA 3VZJA 4HMZA 4CP0A 1WBLA 5JI7A 4K1YA 4AI8A 3ZFFB 4U2AA 3WD5A 1UZZA 2D43A 4M0HA 2DWRA 1G9BA 5CA6A 2B5HA 2YC0A 1G86A 2F4PA 3WY6A 1FPN2 4CDWB 5FMOL 3VZKA 5KXCA 3GALA 4N9IA 2E9QA 5I93A 2PHRA 2JG8B 1IHMA 1N1VA 3AP9A 4YM3A 2Z42A 4GH4B 5C8CB 1O3TA 1OFSA 1PO22 5T54A 2WS93 3GF6A 4C91A 1AX2A 4NWVA 4Q4W2 4MVTA 5D8AC 2JG8C 1AR91 3EQEA 4Q4X2 3B94A 4JCKA 1RITA 3I59B 1OD5A 5EV7A 3K51A 2HWC3 2PHUA 1AL21 2VOKA 4R52A 4Y1YA 2HEYF 5CFCC 1PGW1 3B5LB 4F3JA 2HWF3 2IXLA 2WLPA 3SHRA 1J58A 2ZA9A 3ACLA 1RUE1 2PYTA 1QDOA 3O5SA 2CWMA 1OQEA 4FAGA 1H2NA 4H7MA 4QPGA 4Y5Z0