1H0BA

Endoglucanase cel12a from rhodothermus marinus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
226
structure length
226
Chain Sequence
TVELCGRWDARDVAGGRYRVINNVWGAETAQCIEVGLETGNFTITRADHDNGNNVAAYPAIYFGCHWGACTSNSGLPRRVQELSDVRTSWTLTPITTGRWNAAYDIWFSPVTNSGNGYSGGAELMIWLNWNGGVMPGGSRVATVELAGATWEVWYADWDWNYIAYRRTTPTTSVSELDLKAFIDDAVARGYIRPEWYLHAVETGFELWEGGAGLRSADFSVTVQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULASE
publication title The Structure of Rhodothermus Marinus Cel12A, a Highly Thermostable Family 12 Endoglucanase, at 1.8 A Resolution
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
total genus 61
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h0bA00
2B45X 3RI8A 1BVVA 4S2HA 2JICA 4H7MA 1HV1A 1XYOA 4HKLA 1REDA 1T6GC 1OA2A 3B7MA 2VGDA 1XNCA 2DCYA 4XPVA 1OA3A 2JENA 1REFA 3AKSA 4HK9A 2Z79A 3VL9A 3AKQA 3WQ1A 3AMNA 1XNDA 1KS4A 2DCJA 1KS5A 3VZMA 3WP4A 4XQDA 1HV0A 1OLQA 2F6BA 3WX5A 3M4FA 2DFBA 2DCKA 3AKRA 5EJ3A 2VG9A 1H8VA 1M4WA 2BW8A 1H1AA 1HIXA 1TE1B 3VZJA 2D97A 1ENXA 3AKTA 3AMMA 1AXKA 1PVXA 3RI9A 2JEMA 1UU4A 2D98A 4NPRA 3WP6A 3AMQA 2C1FA 1F5JA 1IGOA 3VZNA 1XNBA 2BWCA 2VULA 3AKPA 3HD8B 3VZKA 3WP3A 3AMPA 1XNKA 4XQ4A 3WP5A 3WQ7A 1NLRA 3VHOA 3WQ0A 3LB9A 3WXPA 3LGRA 3VHNA 3WT3A 3B5LB 3EXUA 1C5IA 3AMHA 5HXVA 3WY6A 1REEA 2BVVA 2VUJA 1XYPA 3O7OA 1UKRA 1OLRA 4S2FA 4S2GA 2DCZA 3MF6A 3MF9A 3VZOA 1H0BA 2QZ2A 1W2UA 3VHPA 4HKOA 3MFAA 1YNAA 5K7PA 1XXNA 5K9YA 3VL8A 4HK8A 1QH7A 1XYNA 2NQYA 3VZLA 4S2DA 3VGIA 3WR0A 1H4GA 1C5HA 1H4HA 1BCXA 2DFCA 2B46X 2NLRA 3VLBB 3MFCA 1UU5A 2BWAA 1OA4A 1BK1A 1QH6A 2B42B 4IXLA 2QZ3A 3ZSEA 4XQWA 4HKWA 1UU6A
chains in the Genus database with same CATH superfamily
4CUAA 1UPIA 1W6MB 1EYBA 3USUA 2VY0A 2YBSA 4GWJA 2WNUA 4Q4Y3 3ZYIB 1REDA 3ZFEC 3AYDA 2UY9A 2PXJA 1Z78A 1MPXA 4Q4X3 4HVRA 3IMNA 4HPKB 4PIXA 4FPCA 2XOMA 4P14A 2JKXA 4O61A 1POV0 1E5RA 3NV3A 1V9U2 4XF9A 4LKSA 4IE7A 4PIZA 4ZONA 2QQLA 2K2SA 2QKDA 3NAPA 2WRAA 3I2DA 3NKTA 5LA9A 4A7YA 4RHV2 4C8DA 3ZYFA 2GC1A 4KBBA 2P37A 2W95A 3U75A 3LEMA 1RUJ3 4RYDA 4ZPIA 2B39A 5J98B 2YYOA 5AVPA 2XL7A 4NOTA 2XDVA 4CUCA 3LA2A 2FCVA 2F6BA 2ZGQA 2ZGSA 5FY1A 2RG4A 2P3JA 5CU1A 5ABJC 3ABZA 3LAGA 2R041 5DPNA 3Q8FA 1MEC1 2B5HA 2E7AA 2WUHA 3MIBA 3ILRA 1WKYA 4J6GA 2VZVA 1SLAA 3K4ZA 5E8AA 5B4NA 5IVJA 4MHUA 2A70A 1HXS1 2FDFA 2VMDA 1GQHA 1ZBA2 4CU7A 5CFCC 1JYCA 4V2WA 1LULA 1NG0A 1JYIA 4GH4B 2C26A 1CONA 1D4VB 1KFUL 1QWRA 2D98A 5EWSA 3TN93 1Z0HA 5CKQA 2ADEA 3CO2A 5JZGC 2GC0A 4QHZA 1C8NA 1N1VA 3I3MA 1QJX1 5F32A 2DVGA 1G8WA 3ZFEA 1TG7A 4A4AA 3OCPA 2Q1ZB 3MBWA 1AL23 1KGYA 3J7MA 3HN3A 2VBBA 1CESA 2WBKA 4WVWA 1BYHA 3I7DA 1UWWA 2AREA 4LIVA 4P08A 5FZIA 4F3JA 1LOFA 2A75A 2JDPA 3IIAA 3SITA 3PJQA 1JU4A 3WCRA 1JN2P 1V6OA 1QGLA 4IGPA 3W58A 1V9U1 5L19A 1PZ7A 3EXUA 4MGZE 4AAXA 5L9VA 3CNAA 1E5HA 1X33A 4YVWB 4OI2A 4I0AA 5JWPA 2J1SA 4E4DX 2XL9A 1DLCA 4RHV1 5ABJA 5KXDA 2VUJA 3NW4A 5FAXA 3MO4A 4KU8A 3FFQA 4UYBA 3DXUA 1DYPA 1EV12 2EIEA 4JVAA 3KF3A 1PK6C 1WCUA 2WZPP 1DQ5A 2DURA 2ERFA 2XH6A 1UNBA 2JG9A 1EAH3 1VB2A 2FQPA 1D0HA 3AJZA 3HT2A 3I2HA 3N7JA 4J1XA 1X7NA 4M3CE 5E1RA 2ZA9A 2JIGA 3BKZA 2QBXA 2B46X 1H30A 3R4UA 1ZBA1 1QMJA 3B02A 4ATEA 4IE6A 1JUIA 4AFMA 4KGQA 4D7YA 4K3UA 2P5BA 4EYUA 4Z82A 2VVDA 4GMP1 4IEOA 2PLV3 1RUE1 2W1UA 4TXWA 1FYUA 1MS1A 3VBHB 1FV2A 4LMFA 4HKWA 2BFUS 2WINB 4IESA 3QH7A 5C5TA 5C9AB 3SH3A 2Z4FA 5FZHA 1I6XA 2PHDA 5IATA 5JOYA 3BI3A 1RUD3 2RS13 4FPKA 4X6QB 3AJYA 2ID4A 3RWKX 2DCYA 4LNVA 1OQDA 4JTNA 2E51A 2ZAAA 4Q4V2 2SLIA 1QXPA 1H2MA 4H3WA 1GOHA 4XBQA 1VAMA 3CZJA 1LU2A 5FXZA 2AUYA 2P3KA 3Q8CA 4QPIC 2CTVA 1LODA 4OZXA 4XOGA 1FOD2 2QQJA 1U0AA 2ZGRA 3FLPA 3KS7A 4QXKA 1U5YA 3UL2A 1F5FA 1R093 3OJBA 4YW1A 1RVF3 1ZZBA 2W0XA 5FP4A 4EN7B 2JDZA 4BPZA 2DFBA 1R1A3 1ZRDA 1EV11 2DCKA 1CN1A 2FMDA 2JXAA 4XYXA 1PO22 4XCBA 3RNSA 1VBA3 2OUJA 1H8VA 4CP9B 1PM4A 1JMUB 4IEUA 2D43A 2Y6KA 2MHFA 3MV01 4Y22B 4LPLA 2O14A 2D3PA 4B4RA 5LCWL 5SV8A 4OI0A 3T4HB 1A34A 4FPEA 4K9SA 2D40A 4UFHA 1UZ0A 3AMQA 2GH8A 3E1F1 1WZXA 1PGL2 4KWLA 4QDQA 3E5QA 5A33A 2V4VA 1FV3A 4N8MA 3WNNA 3ZVXA 3ATGA 5JAXA 1VBC3 2HEWF 2QQWA 4M4RA 4XABA 3AMPA 1MS3A 2IFWA 3UNPA 4Z92B 1ZBE3 4WVMB 4CZSA 4CXXA 3WXPA 2OUHA 2WZR3 3MIFA 4XETA 3GZEA 4AVSA 2YGLA 4Q2FA 4RQPB 1FPN2 2RV9A 3D82A 2G1MA 4GXLA 5B4XA 4DUXA 3QD6A 5IUQA 2X29A 5CKMA 1LESA 1AR93 1QQP3 1FOD1 3LOBA 5LWBA 1CWPA 4GWNA 1UIKA 1JBCA 5D1IA 5JPNB 4FAHA 4XZUG 5I8TA 2WNEA 5FKBA 1H1MA 2EXKA 4AI3A 1YNAA 1FATA 1W8WA 4JC1A 5FY4A 2PHLA 1DQ0A 4NJ4A 4UW3A 2QTWB 1NOVA 3X29B 4BH9A 1HQNA 2HWD2 4I3PA 3OBTA 2GSYA 3R05A 1VR3A 2CAVA 5GZDA 5T50A 4AVCA 3MFCA 3RG0A 3H8XA 1OVSA 4COYA 1XU2A 4K21A 3JD73 4AZZA 2DBNA 3ON7A 2YBPA 2RM23 2UWBA 2VECA 3J7HA 5A3WA 3VDDB 3IN9A 4Y20B 5FK8A 1RUNA 1PGL1 1CAVB 1LOGA 2WN2A 1URXA 4YYOA 4O7XA 3ZXAC 2DU0A 5L9BA 1KITA 1W6NB 4AQSA 2ADDA 2DTWA 3AZVA 1XE8A 5T54A 2ZKNA 4G9SB 4A3ZA 3I2OA 3FMGA 4BYYA 1T6GC 2UY8A 5EP9A 2Y6HA 4NWWA 3LEKA 2JG8A 2XMLA 4Q4Y2 4DO0A 1XU1A 1JI6A 5LBBA 4D6SA 2G9GA 1JZ8A 4Q4X2 2WAAA 3Q8AA 2XBO3 4SLIA 3ZIWA 2JENA 2O8QA 4KWKA 1REFA 3VHRA 2HYXA 2Q0AA 1KDKA 2PHRA 1FPN1 1Q56A 1OURA 3FLRA 4GMP0 3WQ1A 4CPBA 4Z2WA 2GP3A 1PO11 5A7WA 2DCJA 3POYA 1W0OA 4L8QA 5CYYA 2Y33A 3H50A 1OHFA 5BYNA 3WV6A 4J25A 1GMMA 5F3CA 2RS32 2DCTA 1O6UA 1S1AA 3H3ZA 4FOWA 4IQPA 5KXEA 1BMV2 1IS3A 2VUCA 3PLQA 5IK5A 1FT9A 1UL9A 4PLOA 1DFQA 3VBFC 5AC92 2BP6A 4QPGA 4IGOA 2WZ8A 4PQ9A 2JE7A 4NRPA 1N1YA 2BW8A 1GICA 1O4TA 3LIGA 5F3IA 1D0GA 3DPRB 3UK9A 4L97A 4AQ2A 1O5LA 2HWD1 3HIFA 4HSJA 4O9GA 3LSDA 2YC2A 2EXIA 4HSLA 3USSA 2NYYA 4K1YA 3GYDA 1KXGA 3WF1A 4DRRA 4NPRA 3D3AA 4Y24A 2LUWA 5FQ0B 1IGOA 2BGCA 3HJRA 4JGZC 3IM0A 4IV3B 3W9AA 4XE9A 4M3CF 1W2TA 1G9CA 4YG0A 5EZWA 5FYIA 1AYM3 4HBNA 4LA3A 2EICA 4RR3B 4YM2A 3VZKA 4CU8A 2BOJA 3ACLA 3HQUA 1WLWA 4HPKA 1UY0A 4F83A 5GM0A 2RS53 2XONA 1SHWB 2WN3A 3AP4A 1LEMA 4Q4Y1 2HBUA 1SEFA 3PL0A 4Q8KA 1IS5A 4Q4X1 5FJKA 4A6SA 5DG1A 2JD4A 2PTMA 1OT5A 3JCIA 5FMOS 3AZYA 3D6EA 5FZDA 1GZ9A 3DL3A 4KMQA 5JVVA 1QDOA 2DU1A 4QD2A 4KG0A 3VD4A 3VUOA 4BQWA 4CEYB 1ZVFA 2LTNA 4LBKA 4R52A 2UYBA 1QJZA 3UKTA 4URTA 2VZSA 4GALA 2OKXA 5FZ8A 4A2UA 5A6YA 4LOSA 5LBFA 1RUJ1 1PX3A 2B9UA 2WNVC 5A7SA 2AR6A 2VW0A 2JB8A 4KNCA 3HMYA 4BQXA 4DQAA 1BMV1 1MS5A 1RUG3 3KGLA 4YWAA 4XZPA 4XF0A 5G05L 1XXNA 4PLMA 3TAYA 3RSJA 4YGEA 1ZZ8A 3ZXFA 2FCTA 3C3VA 3VZLA 1EAH2 1MZ5A 4BQ4A 4B8EA 5A7OA 5KXBA 3UJOA 2VXRA 4MADA 1S0JA 3JUUA 3SMHA 4GH4A 5FYUA 4UFIA 4YSFA 4QQPA 5D8AA 4IV1C 2GNTA 2W92A 4META 5FOBB 4ZXKA 1W9FA 2J22A 4IEQA 1W2AX 2VUAA 2HWE3 1C8M3 2E6VA 4I3GA 3FE5A 3TN91 2VW1A 3CIHA 5IWFA 4JQTA 2PLV2 2VOTA 1QY4A 2GNBA 4M4PA 1M06G 2XHNA 2ILMA 2P2KA 2W68A 5A3NA 3VBOB 5E88A 4MGYE 4CP2A 1CAXA 4QM9A 4E2GA 1RMU2 5KBFA 2JDKA 3O14A 5A7PA 2HEYF 1QOTA 2RS12 1RB8G 1X50A 1GUIA 4JKLA 5FZ1A 4YVWA 3AK0A 4DPNA 1Q5OA 1HJGA 2D6OX 4MXVA 2Q8CA 5FYYA 2BOIA 4PDWC 3U1XA 3NNLA 1HV0A 4YG3A 2VE1A 3LQCA 4XF4A 5F8PA 3WD5A 2FDGA 3ES4A 2WSUA 4QU2A 1F4HA 1CQ9A 2P1BA 5A1AA 1NT0A 1W8TA 3U78A 1RVF2 2X5IC 4UF0B 1R1A2 4ISQA 5FPZA 1JOPA 1CPNA 2OIIA 1MQTC 3ZYGA 1Q8QA 1CZTA 2RVAA 4IV1A 1EAH1 1FAYA 5AVAA 4AOCA 1BXHA 1YIFA 4TLFA 2OYZA 1PVXA 2XR4A 4QWNA 1OMIA 1XE7A 4P9IA 5FPVA 1IS4A 3LF7A 4CCCA 1VBD3 1HRV2 1UKGA 4KQ7A 1L7RA 3RQ0A 3ZN5A 1OD5A 2C9KA 1XNBA 2R6QA 3WNPA 1LOBA 3VBHA 3B94A 3N7KA 5GZFA 2R16A 1L7QA 1UO9A 1C1FA 2JDNA 5C9AA 3AKPA 3WINE 1X82A 5A1LA 1H2KA 2BTVC 1O8PA 2PLV1 3N7LA 3RJRA 1VE0A 5JUVA 4MGIE 1GWKA 1ZBA3 5EYYA 3N36A 4MGKE 3LB9A 5KHKA 1VB4A 3B93A 3CJXA 4HOOA 2G19A 1OFNA 1W6OB 3HOBA 4NHMA 3LWCA 4QGMA 5LY2A 1KEXA 4DB5A 2X05A 1ZBE2 1EUTA 1RUD1 2A6ZA 2RS11 4PDWA 2HWC2 2PAMA 1H2LA 2WZR2 4GMP3 2W5FA 4UXAA 2Q8OA 4KWUA 1CX4A 2BQPA 4PBPA 4AEDC 4DFSA 3T08A 1GP5A 4NIHA 1HW5A 3IB3A 3CF6E 4URAA 3OY8B 1PMJX 5EIYB 4YG6A 2P3YA 4YVSC 3WCSA 1POQA 2X5IA 2QZ2A 3WNLA 3VHPA 5K0UC 2AZ5A 3VD3A 1AR92 1QQP2 1LHUA 1J58A 4HKOA 3AYCA 2EIDA 2YV8A 3OGGA 4YZ4A 5FZLA 3BPZA 4BU2A 1RUC3 1RVF1 1WCQA 3WUCA 5K7PA 3VDAA 1R1A1 4XDQA 1CJDA 2UU8A 4QQHA 1V6IA 3VBRC 1EPZA 5JZGB 2WJSA 1W3XA 4UBGA 4YGDA 4HXCA 5FV3A 4Q5OA 2P6CA 3IAQA 1NA1B 4Y1XA 3A4UA 3W5NA 1CR7A 3DEMA 3JD72 4HT1T 1CJPA 3BALA 3KV4A 3POJA 1MS8A 2B7YA 3H1MA 3AP7A 4FXGB 4HZFA 4K6BA 2C6SA 4XQWA 4CCEA 1SFYA 4KI5M 4LO7A 2ZBJA 1OF3A 2WWUA 3NJYA 1H6XA 4IGQA 1HV1A 4INDA 4V2VA 2DUOA 3LDBA 4AI8A 4MOAA 1MS0A 1S0BA 1IQDC 1JW6A 1COV2 1QIQA 4WVMA 3KT4A 1BEV3 1QXRA 3P1IA 3O5SA 1IQAA 1US2A 1OUSA 2XGXA 3T2PA 4RQPA 1F2NA 2ZEYA 1MVEA 3DKWA 3WNXA 1ZBE1 2WABA 4XF3A 4HK9A 4YVSA 1SFNA 4P9JA 4CTEA 5C3SA 2HWC1 1JZ6A 2WZR1 2FHRA 1ULDA 2D6PA 1WD3A 2O1QA 2XBO2 3ELNA 5K0UA 3U07A 3U4XA 5H9RA 3PTRB 3DV8A 1GANA 3OGRA 4JDOA 1UZWA 4LBQD 1O3SA 3WUDA 2EA7A 4QX2A 1YFUA 4K20A 3ZPYA 5I8SA 1NLSA 1LGNA 4JGYC 4AHYA 1AR91 1QQP1 3VBRA 1WCSA 1IHMA 2VO5A 1VPHA 3ZN6B 5FO8B 2UYAA 2Z2SB 3POBA 4Q4V3 3LKJA 2C4XA 5T5JA 3AP6A 1H6YA 3I2JA 3O1RA 3AKTA 5DUWA 1SCRA 3SXWA 2PHUA 1SBFA 1W8UA 2VZ3A 1XC6A 1FOD3 2DTYA 3GGLA 1AR63 1IZ3A 4Q29A 4C1WA 2RDSA 4Y20A 5J96B 3BTZA 3OUHA 2VMGA 5FY7A 5FDBA 1F5JA 2ZHNA 5J37A 3VBSC 5C5UA 3JD71 5F5AA 2F4LA 2RM21 2V09A 1PO23 3AB0A 1RUF3 3N4MA 1SDWA 3GZTB 3MEPA 4CXYA 1DGWX 2WO3A 4QKNA 2IZWA 1HN0A 2EF6A 3M3OA 4UI9L 2EVXA 4CEWC 5LA2A 3H7JA 4M0NA 3VN4A 5C3OA 3K75B 4N43C 4CDUC 1AJOA 1K5MB 3I54A 4HFSA 1LHVA 2RS52 3URFA 5HCAA 1N3OA 3OBZA 1QJY2 2OZ6A 1C5IA 4AR2A 3FUQA 5ACA2 2ZTNA 3E6CC 5APAA 4XFCA 3RZZA 1O8SA 1SLTA 2WWJA 4EROA 2XBO1 3JB4C 1SDDB 3O7OA 4OHVA 5F9TA 1OLMA 2ZX1A 3MF6A 2C0ZA 4A7ZA 5BNOB 3JB8A 4H7LA 2ZGPA 4MGSA 4XTPA 3IKWA 5I0SA 2BDRA 1GR3A 2XHKA 3DPRA 3AFKA 2VMIA 3BVCA 4GAZA 4NPLA 4CCJA 5J09A 1SFPA 1RUG2 4UW4A 4I09A 5T52A 4C90A 3UKVA 4FOYA 4AK3A 4GA9A 3W21A 5BNPA 4R9DA 1T6BX 3ZFFC 5H9PA 4LT5A 5FQ0A 4FT8A 4LBNA 4IDZA 3CJIB 1CX1A 5DAPA 3LPGA 4W65A 3LIHA 3U37A 1AR73 2A6YA 3HBKA 1UU6A 3PNAA 1OOPB 5DDJ3 2PQSA 1K3IA 1NQJA 2CYFA 3J7LA 3ZFGB 3ZIXA 2Y38A 1C8M2 5GLWA 4CDUA 4DEVA 2VNOA 4E27A 2P17A 2AENA 2RMU2 2NMOA 5EJZB 2BVBA 3ZM8A 1AYM1 3RJ2X 2J1UA 2JDUA 1LGCA 2IXKA 3T2QA 2YC0A 4I01A 3FHAA 2FDKA 4CUGA 2XWBB 3GCXA 2ET1A 1QOOA 2RS51 1QJY1 2L9LA 3FBYA 2VTFA 1G9BA 1W9WA 1A6CA 1LHOA 1KS4A 2NZ9A 1FI2A 5J7MA 4XMAA 3MUZ1 4XQDA 1OPMA 1HLCA 5FO7B 2CHHA 4BQ1A 4QXHA 4Q4W2 1DGRN 3PVBB 2YFUA 2W1WA 5FZ7A 1B35B 5T3NA 5JXJA 4XURA 1CZVA 2BV4A 2R063 2R1BA 4DXSA 1A8MA 1I5PA 1WA4A 3ZFFA 5EXOA 2E32A 1WMFA 1RUG1 3M1HA 1LOFC 1GZCA 4P9YA 4MV2A 2FDHA 2VQ0A 2BGOA 3AXDA 3W5MA 2WO1A 1NXMA 1NCRB 4H14A 1UMIA 2WT0A 2IUWA 2C1FA 4AF9A 5DQ0A 1ND2B 1VBB2 2R1DA 4LBQB 3IDBB 4AQTA 2ET7A 2OXBA 2RS33 4Z2AA 4QM8A 1VBD2 4CVUA 3Q8EA 3EMRA 2QVSB 3CBNA 5AC93 2IXCA 2HWE1 1LB2A 3ZYPA 2Q5TA 1C8M1 2CL2A 1QJFA 4GKXA 4FPJA 3QBQA 2J7MA 3WF3A 2E9QA 3H9AA 2JD9A 3L2HA 2QNKA 2XQRA 4O9EA 4YLZA 5EJ1B 5FFOC 3WHTA 5CFDB 4OHYA 4BWOA 2W08A 3N9OA 3OEAA 3HNBM 1PNGA 2JG9C 5FXWA 3ZDSA 5IK7A 3T30A 4YZ3A 1VAVA 1APNA 1J83A 4LK7A 4NROA 1OSGA 1GU3A 2R0HA 3KWVA 3H8UA 3VBUB 3WDUA 3SKVA 3POSA 3LEIA 1AR83 1UKRA 3NSTA 3P3PA 5FMOL 5T5OA 1SPPB 4AFAA 3VBFB 1LOAA 1O4YA 4RS5B 2QJVA 2J1EA 3J9SA 5DXDA 4NIIA 1X9TA 4K7JA 5C6CA 1HRI2 1ZRRA 2I45A 1RITA 2R30A 4JRAA 4Q8LA 4UF0A 4L99A 3MFAA 3VD5A 4CDQB 1RUOA 1DQ4A 4G4FA 1OUXA 1GWMA 4BM8A 1BBT3 1GV9A 3M3QA 1X36A 4L11A 4M3CA 2BJSA 4EWDA 1RUC2 1Q3EA 4YW5A 1C5HA 3AP5A 5FYSA 4WBBA 1UX6A 2B9VA 1UU5A 3WOGA 1GKBA 2Q30A 3IAPA 5FZOB 3WQBA 1YWKA 1DLLA 1RXFA 2MNGA 4AFDA 2PAEA 1LAJA 2KM2A 2CGPA 4LR4A 2GDFA 2YXSA 1U5IA 1W8FA 3GHNA 3UESA 4JHZA 3QCWA 4QX3A 4RL7A 5CIRA 1VBB1 3P6BA 1GLHA 1XQNA 2Y6LA 5LEKA 3WHUA 2OVUA 1VBD1 4LJHA 1VMJA 3C7EA 3WW3A 4CDWC 3MIEA 4DS0A 3M3IA 4H7MA 4BA6A 1LRHA 2WS92 4DXZA 2FZ2A 1XRUA 4UFLA 1R083 3EB7A 1NE4A 2N7GA 1UIJA 5FBZA 2W87A 1PZ9A 3H1YA 1W6OA 2EXJA 3KVAA 1OI6A 3V65A 1JYWA 1JODA 3AX4A 5KWRA 1BK0A 4QB6A 4XHBA 1I1EA 5FZ9A 3SHRA 1YYNA 4QAWA 1BEV2 2OS2A 2VPVA 3I49A 3NV4A 4ZS2A 3FHQA 2Z79A 4FPHA 2EXHA 2WNVB 4QHBA 1N47A 1CAWB 2ARXA 1KS5A 2P4EA 4FFIA 4QGNA 2WFPA 3HNYM 3E5XA 2KD7A 3OYWB 5L36A 3S7EA 4ES8A 5J3UA 3PVNA 4HANA 3DKQA 2Z5WA 4FFGA 1SBEA 4DXRA 2ZGLA 2QE3A 4IL7A 4GZ9A 5HI0A 5IJRA 1RMU3 2TUNA 4WM8B 5C4WB 5JSOA 4FTSA 1J84A 4PJYA 4NPMA 1LOCA 3VZJA 5FZGA 1OQ1A 4ZZ5A 5JSPA 1NCQB 2YHJA 1ENXA 2E26A 2PAKA 1ACCA 1RUC1 2K9ZA 2QQPA 1RUH2 4Y1VA 1CIWA 1C4RA 3N35A 1H8TB 1F31A 1NA1A 2ZCWA 4JKMA 3BB6A 1DP0A 1GNYA 4CDWA 3O0VA 5FWEA 4FP2A 3RYRA 1AR62 4I30A 1YHFA 2ZZJA 1CVNA 5FR3A 2GMPA 3LSEA 5F1RA 2Y0OA 4AVTA 1BZWA 2HLEA 3FLTA 2XB6C 3KCYA 3WW1A 1RUF2 4CE8A 5A1FA 3OGSA 1DDLA 2MEV3 1VBE2 4PF1A 1H9WA 2CAUA 2VL4A 5FLHA 3WQ0A 5FZAA 4D94A 3ZYJB 2E33A 4HN0A 4CDXC 2QQOA 2PA7A 2AEZA 1RIRA 4OUMA 1HRV3 5HV0A 1BEV1 4EWEA 1PGSA 1RL3A 3GZUC 3O0XA 5KC5A 3I3EA 1UOFA 4BXFA 1TVGA 5A3MA 1OLRA 3NNJA 3N9LA 5EQUA 4DZGA 2YC4A 4DRVA 3MF9A 2Q8EA 4IEPA 4NIGA 4HVQA 2DVAA 3H8RA 5BNNB 1QU0A 4AL9A 2BERA 1G7YA 4N7UA 3TEWA 5EPAA 4LXLA 4ZY9A 3ZN6A 2HWB2 3UYJA 3T0DA 1XOYA 4JDMA 3M70A 5F6KA 2D5FA 5BNPB 1KJLA 2XJUA 3VGIA 5IT6A 1P8JA 1H4GA 2VM9A 3PMSA 1GP4A 2HWC3 3CMGA 4MXWB 5F37A 2J42A 2ARBA 2ZGUA 3ZXGA 3MZHA 1J3RA 3MUY1 4Q4V1 2JG8C 4CUBA 3V0AB 1JHJA 3I2FA 1LJ7A 2YY1A 1XSRA 4MG2A 4NHLA 1CAUB 1PGW2 4B4PA 4LO6B 1AR61 1YCIA 3JXSA 2GN3A 1Y7BA 2XLAA 2ZHMA 1O91A 3TEZA 3N9QA 1NKGA 1AR72 2XLGA 5DDJ2 1OA2A 1PO21 2QDNA 4CDXA 4XUTA 1RUF1 2W46A 5DUXA 5FZ0A 3O1TA 1VBE1 4N53C 1YLLA 5I8YA 2NP0A 3I3QA 4LO8A 4QDRA 4GULA 3VDCA 1GNZA 3O0WA 2YMZA 4QPGC 3IBMA 4ISRA 3VL9A 3D0JA 2A3WA 2E63A 1W2OA 4FOVA 2W47A 3PUAA 4OI1A 3WP4A 2ORZA 4R4ZA 4JRLA 1IG3A 2Y6JA 3JU9A 4RN5A 1COV3 1W06A 1W9YA 2A7AA 1YQCA 1GZWA 1LHWA 3OGJA 2ZKLA 2VG9A 3S30A 1YFWA 3ETPA 4D6RA 2NMNA 4LUMA 5E6HA 1WCDJ 2HWB1 2PFWA 5LA1A 1N1SA 3ZYRA 2LS6A 1TE1B 1LECA 4LQRA 3E6BA 4H2AA 3PU3A 2R062 4AI0A 2RR12 2VZPA 1LR5A 1ND3B 5A32B 3WG1A 2E7QA 2GMEA 4AEJA 5AFBA 2A3YA 4FXKB 5DAQA 3ZSJA 4LOTA 2HEVF 3IPVB 4Q1PA 1FX5A 5JR2A 1JTZX 4JV4A 5GJ6A 1ODNA 4LKFA 3LA3A 1DGWA 4XVHA 1VP6A 2Q1MA 1QJEA 1OOPA 3ZFGA 1VALA 5JXGA 4W50A 3AYAA 3HD8B 5HXMA 3ZN4A 2VQUA 2WSVA 3ZXEA 4N53A 5A7NA 1XSQA 2CSGA 3WP3A 2FBEA 2GU9A 1AR71 4CU6A 4KG8A 1ENSA 3ZSLA 5IVBA 1WD4A 5DDJ1 3S5AA 5ERLA 3WP5A 1RXGA 1UY1A 3M2MA 5BPXA 4TZDA 1DU3D 1YQ8A 3PUIA 4OZOA 1PMIA 2YPDA 4CU9A 2MPFA 1SMVA 5JI9A 2YU2A 5FOJB 2C5DA 2ZMLA 2Y6GA 1UF2C 4K1ZA 3EJKA 2VAUA 3GHMA 4IETA 2BYVE 5BXXA 1JS9A 3TNQA 2NPIA 4M00A 5KXCA 4S2GA 1W8OA 2DCZA 1OXCA 4GH4C 1AX2A 1UXXX 1W2UA 5D8AC 5JMOA 5FLJA 4YFZA 4WM7B 1AR82 1W6MA 3OD4A 3OTFA 2DF7A 5ANQA 1YJKA 2EAAA 1EY2A 4MGTA 2XLFA 4YW7A 1NUKA 2QQMA 3BTAA 4AHXA 2WAOA 3DYPA 4GB32 2RDNA 1QJY3 4V1PA 2GNMA 1WBFA 3WR0A 1G6NA 1H4HA 1OF4A 2RDRA 1BBT2 1SQ4A 5F5CA 4XAAA 5FYZA 3ZYBA 5ACA3 2R061 3FZ3A 3VBSB 5C33A 1NCRA 2ZAHA 2RR11 4Q26A 4W4ZA 3SLIA 2ZGKA 2VCBA 4IE5A 1UOBA 1S0DA 1ND2A 4LBQA 3MIHA 3M8LA 1GOFA 2PHXA 3OG2A 4YVWC 5LEJA 3BTYA 3D5OA 4F7ZA 3R4DB 4GD4A 3NO8A 4QX5A 5FZ4A 3NWKA 4QGLA 4CEWB 3FL7A 5B2GB 4S2HA 3IMMA 2R073 2OPWA 3RVHA 5CKNA 2PYTA 1NY72 4ONUA 4XC9A 2KA3A 1AUYA 2RS31 1VIWB 2VVFA 2Y8KA 3DGTA 5L7OB 2W94A 5CFDA 1JUHA 5FJHA 3WSOA 4YARA 1JZ2A 1W0NA 5AC91 3A0NA 5A3UA 1YIPA 1MS4A 2BNMA 3OF1A 3D8CA 1R082 5JI7A 4AEMA 2Z42A 3VB9A 3WZ1A 4D7SA 1OPOA 3VKMA 1DYKA 4LLOA 1VMHA 3VBUA 5T5PA 4WV8A 3IDEA 4QKFA 1HDKA 2W91A 4HLTA 3N7MA 1FMD3 1RJ7A 5F5IA 1SPPA 4XFBA 1OKQA 2FD8A 4PT6A 2D3RA 4XJUA 1Q8VA 1C57A 1AR81 4BQYA 4DINB 2RMU3 2YBKA 1AX0A 2WNUB 3N9MA 5F39A 3VBHC 4DUWA 5C3PA 4JHTA 4PI0A 2V4AA 2VNGA 3RRDA 4A44A 1XNTA 5DUUA 1LGBA 3K3OA 4DY5A 5FYCA 5C9AC 2Q8DA 2JE9A 2IC1A 2Y6FA 2D97A 4GB31 3DECA 4D8MA 4ORFA 4A7KA 4D3WA 2YDEA 2XJRA 5GALA 4NMIA 2I74A 4P00B 1VAKA 4XTMA 1AXKA 1BBT1 5EHDA 5FZOA 3RI9A 1HQWA 3NAPB 3WW4A 5JPMB 4NAOA 2PHTA 1YEWA 5JOZA 1V00A 1UU4A 3H7YA 3NNGA 2TNFA 2HKXA 3WP6A 1ZRCA 2XVLA 4Q4W3 2VU9A 5C8CB 4XBNA 1UMHA 4UOJA 4Y5Z0 4B1LA 2HH9A 4BDVB 1Y4WA 2XG3A 2ZABA 4Y33A 1OC1A 5FZEA 1RUI3 4Q0QA 5EFUA 4BQ2A 1ZZ6A 4QXBA 1XPWA 5JOWA 4LBJA 3UGHA 1UY2A 1S55A 4XQ4A 1K42A 1NLRA 1QJU3 4IW3A 2RJKA 3G6JB 4AG4A 4E4HA 3QH6A 4EZ4A 1R081 2G4IA 2MEV2 1ZRFA 1W03A 1YI9A 1UYPA 5C3QA 2AYHA 1VBB3 2XUEA 1REEA 4D0QA 1CAWA 1OD3A 3MLLA 2D7FA 3PDQA 5FREA 4AHWA 4OUSA 2P34A 1JHNA 4TN7A 1QKQA 3ZFEB 5I0DA 1TMF2 5J1XA 1WW6A 2Y34A 3KHCA 3HBZA 4YM3A 1VMFA 4RSUA 5A3OA 2LM3A 1RINA 2ES3A 3VZOA 5KHHA 2WO7A 1W9SA 5C4WA 3IWZA 4BE3A 5KHIA 1UOGA 2CNAA 1XE0A 1QH7A 5HBAA 1NCQA 4ZU4A 5C70A 2WYFA 3TYJA 1RMU1 1QOSA 2YU1A 3ECQA 1H8TA 2WLPA 1RC6A 1QNWA 4MSVA 1JU3A 2C24A 2WFF2 3FX3A 3PU8A 3HEIA 4ZS3A 3OB8A 3RZJA 2VW2A 5ABJB 1WGPA 4BHPA 4BOWA 1AYN2 3FJSA 2B42B 1C3HA 3QLQA 1WMEA 1STMA 1TNRA 1S0FA 3NJZA 1HRI3 2VOWA 4RQPC 4EN9B 4C1XA 4EZHA 3E6DA 3NRUA 1NX9A 1CD3G 2YG0A 4XDOA 1BLZA 2A3XA 1SZBA 2OX0A 3OBAA 3VKFC 1YQ6A 3KT1A 4Y3OA 2JG9B 4PIYA 4Z1VA 2OQ6A 5IW0A 3J8F2 4CP9A 4M01A 5CFCB 4WVVA 5DZFA 5SV5A 5LK5A 3WG3A 4ZXEA 5DUVA 2VCCA 1A8DA 3ZO0B 3KZ4C 1S4CA 4Y22A 1UPSA 3WDTA 1DQ1A 3C7FA 4COVA 3BN6A 3TWIA 2MEV1 4LO5B 3VV1A 1UX7A 1AZDA 4FI9A 4CCLA 1IG0A 3KSCA 3RPQA 4Q0VA 4HMZA 3ST7A 2BUKA 3IIIA 3MGUA 1HB3A 1HN1A 3HT1A 3K4DA 4NAMA 2DV9A 4ZHNA 1HRV1 4QQLA 4XIOA 3VDDC 4Q27A 2WS93 1TMF1 4BJ0A 3ITQA 5IK4A 1J1TA 5FMBA 4DXTA 3QOPA 3HVDA 3K48A 3RZLA 4GKYA 4PI2A 2YPJA 4EN0A 3MDPA 1HB1A 3PIJA 3N9NA 4FPGA 3TBDA 1RYYA 4LE3A 3ACIA 3SKJE 3THPA 1H1AA 1HIXA 4MXWA 1MZEA 3SQOA 4FPYA 4OYUA 5ANNA 2W3JA 4NIAA 4D6QA 3FWEA 1GNHA 1O7FA 1UCXA 1MACA 4ASLA 4LHSA 1CAUA 4LHNA 2ZZQA 2BU9A 1PK6B 5FY9A 3ACFA 5JXHA 1GBGA 1Q8OA 2D6KA 2BWCA 1DQ6A 1QNYA 3FC0A 3ZKUA 4UFMA 5FBJA 4OMCA 3OD0A 2WNOA 4D69A 3B9CA 2GH2A 3E5UA 3POEA 4PHZA 5GZGA 3AL6A 2ZMNA 3R0RA 3WQ7A 1RUH3 1X8EA 5F6LB 3WLUA 4C91A 3E97A 5K8SA 5LRSA 3WT3A 2J1TA 4LHKA 4BISA 5I0TA 1GYKA 3B5LB 5CNAA 1MZ6A 2CWMA 2CV6A 2YGMA 2R49A 3DPRC 4N7IA 1BQPA 3VDDA 4BLJA 4GWIA 4BQ3A 4COUA 4BK5A 1PMHX 2WZEA 2VOKA 4QHOA 5C3RA 5L9RA 2XUMA 3OOXA 4YW6A 1CAVA 4TSVA 4GWMA 1W6NA 2QQVA 4IEVA 1UMZA 3ZSKA 3LCPA 2QQUA 2E7TA 4IV3C 1OH4A 5F7UA 2AH2A 1VBE3 4XCAA 2ORXA 4PQQA 5D2AA 1IOAA 4KU7A 2YZ4A 1O3TA 4RR3C 5IYYA 1W99A 1COV1 4RGAA 4S2DA 4YRDA 3DF0A 4YZ5A 4YGBA 4QPIB 3KCCA 1A3KA 5A32A 2WO2A 4P9XA 3U14A 2VCAA 5LY1A 1W2NA 1XB9A 3WEZA 1W9TA 3IPVA 1OA4A 2J1VA 3GDBA 5FZBA 1QH6A 3I3DA 4BMEA 2VVEA 5FMCA 3OUIA 4A3XA 1O4ZA 1QXJA 3L2YA 1Y43B 4FPLA 2DUQA 1BVVA 2HWB3 4HETA 4P9LA 1S2EA 3RGBA 3AZXA 1JZ4A 2JDHA 4JTOA 2WA4A 3CLPA 2FDIA 5FPXA 3ZR6A 4PBOA 3B7MA 1DZTA 2VGDA 2R072 1W6PB 4ATFA 1J1LA 1DCSA 2ZHKA 5HCBA 3BIEA 3K46A 3GF6A 4Y5SA 3OSDA 3AFGA 4TYSA 4FPFA 4FQ4A 4CCKA 4MGQA 5IAXA 4JAAA 1OKOA 1W28A 4QX0A 3F2ZA 2G9ZA 5FIXA 4MH0E 1PIV2 1ULCA 4IV3A 4WM7A 3WG2A 3WX5A 5A3LA 1WMDA 1FMD2 2SBAA 1AF9A 4PF5A 4RR3A 3UJQA 1UXZA 2X10A 2ZX4A 3PURA 4LBMA 3BYWA 1S0EA 2PQQA 1O5UA 3O1MA 2D44A 3KMHA 1M4WA 4XJ8A 3M3EA 5T55A 3NJVA 2NM1A 4OHXA 2PMWB 3EBRA 4DEQA 5GZCA 3OPWA 3WNMA 2XKPA 5IVVA 4CA9A 2GAUA 5A80A 1H9PA 3WDYA 3JQXA 5FP9A 4WVZA 3VBOC 3HAGA 3R4SA 1LU1A 4XXAA 4AW7A 1OVPA 1UYXA 1ALYA 1MZFA 3D0SA 3A21A 1E5IA 4AVBA 3BOWA 2KR2A 4CEYA 5ACA1 5FCCA 5T5LA 3WF4A 4JQRA 3NJXA 3IDAA 4OI4A 4W6XA 2OA2A 5H9SA 1ULEA 5FP8A 2R042 3UGGA 4N9IA 1I3HA 1WWYA 1BHGA 1VRH3 1W05A 3KM5A 4IEZA 5L7OA 3T0AA 3POFA 4RA0A 4LLFA 1QDCA 4DOUA 3J4UH 1V6KA 2R071 1RUI2 4XFGA 5D21A 2RR13 5IHRA 1KRIA 4OQ9A 2CWSA 5JIUA 2Q1FA 3EQEA 3R6SA 2OT7A 1AHSA 1QJU2 5J48A 1KJRA 2E31A 3C2UA 4ASMB 2FZ1A 3WY6A 2ZGOA 1C1LA 3KVBA 1V6NA 1XYPA 5DZEA 3T1LA 3ZXKA 5FZFA 1C28A 1V6JA 1FMD1 4XMIA 4IEYA 2GC3A 3V56A 1YI7A 2AC1A 3RYKA 3PVOA 2LALA 4BZ4A 2G9FA 3PUHA 3IZOA 3THCA 3M3CA 3VBOA 3KQRA 4XJAA 1YJLA 1TNFA 2RMU1 4CEYC 2J1RA 2Q4SA 3NNMA 2JDAA 4UW5A 1VLNA 5HPOA 5F3EA 2ZEWA 2GC2A 5M0TA 3OUJA 2W2IA 4ZU7A 5FRAA 2A71A 4CP1A 1LNSA 1TEIA 3T3YA 3J26N 2YUEA 3A0KA 3SH5A 4ASKA 5C8CA 3HQXA 4AGGA 3I2GA 2AACA 4EQVA 5I91A 3NL1A 3T1MA 5JMCA 4LEJA 2RDQA 4Q4W1 1UYZA 4DMIA 2IWGB 1SBDA 4GB33 1JOJA 3GALA 2IXIA 2VTXJ 3CL1A 1W6QB 2H6BA 2IXJA 3B3QE 3MIGA 4HG6B 5FWJA 5LBCA 3O1OA 2ZACA 1HX6A 1G86A 5A7QA 1ASJ3 1RUI1 1OA3A 2ARAA 1T2XA 5E89A 3TB0A 2ZS6B 1RJ8A 1QJU1 4QT6A 4JGZB 1YRZA 3N3HA 2W1SA 3AKQA 3ACGA 5D8AB 3ORJA 2PHWA 1PM7A 2E53A 3TEYA 1RUE2 3FUOA 4OHWA 1EUUA 1LHNA 4QMAA 2CGOA 1TQ5A 2VJXA 1K12A 2YB7A 4TLGA 2DVBA 3M4FA 1HB2A 1NA1C 2TEPA 1Y9MA 4QB1A 4LBLA 2PELA 3RZMA 4DIQA 4OQ8A 1IPJA 1Q43A 3ZSMA 1BKZA 3CHXA 2BEOA 3ES1A 3WVJA 2XJSA 4LORA 1Q8PA 1NZIA 1NLQA 4RFT0 3SCFA 4GJYA 1CAXB 4AFBA 4UAPA 5FPUA 4COWA 4JZRA 1AX1A 1I9RA 1UN1A 4W6WA 3ENRA 2VCMA 2QDRA 1UZYA 3AZWA 1ZA4A 4NWVA 1UY3A 2OW4A 5FLIA 4CDQC 2VTXA 3OY8A 2GP5A 4GJZA 4X6RB 3VZNA 3UT0A 4FCAA 4EN6B 3RS6A 5IFPA 3EYPA 1SLBA 1I5ZA 4YM1A 1ZM1A 3BOPA 4FVVA 3TNPB 1D4M3 5CFCA 1HRI1 5FUNA 3ZXDA 5DMYA 4Z07A 2WWSA 3MI8A 3QACA 4W6YA 3MPBA 1VJ2A 3FFZA 4IV1B 4K8FA 5JZGA 1DHKB 1SG3A 2UWCA 3V0BB 2VBDA 3U10A 1WLDA 1J59A 4KH9A 3UKNA 1JOBA 1HJFA 1V70A 3NNFA 3AC0A 4QX8A 3KHBA 1WLTA 3JBG3 4FQZA 3INAA 3A23A 2IVIB 2ZJCA 3K51A 2BNNA 3ZMNA 4BMBA 4NIDA 4I02A 3C8XA 5A6QA 5FZKA 1OFSA 3SEPA 5FY0A 2JIJA 3VD9A 1ZX5A 4AI1A 2JE8A 3K2OA 4Y4YA 3U4SA 4BLIA 2H6CA 1WUVA 1OBNA 3S6PA 1DBNA 2VH9A 3KF5A 1S0GA 4LKDA 3VDBA 2WS91 3UGFA 5FPLA 5FZ3A 3VL8A 4FTBA 1SCSA 5CG8A 4QPWA 2NQYA 4OULA 3K4AA 4R9BA 1N1TA 3T2TA 3THTA 1YC61 4YZ1A 4XFFA 4PDWB 2BWAA 4CXWA 2GNDA 4Q0UA 3ROUA 4CSWA 1SACA 4SBVA 2VXJA 1K45A 2C9AA 1K5MC 1Y3TA 1FXZA 1BK1A 1PK6A 2JWPA 4Q0PA 4R9AA 1TMF3 4L92A 5LB6A 4E2SA 2D5HA 2X5IB 4E2QA 1ULFA 2QQKA 5JR7B 2ZGMA 1GFF2 2B45X 5GZEA 2V5YA 1YQ2A 5F2WA 4RD7A 5L73A 1MQTB 1XYOA 5BNOC 4IEXA 4NHYA 5FKCA 1XJAA 5K4LA 1QF3A 2XVKA 1U12A 3GBGA 2LW8A 2R0FA 2ZOEB 4JDNA 2ZX3A 1S2BA 1PVC3 3H42B 4AYUA 4DUVA 3ALQA 4ITCA 2WFF3 4M0HA 1TME3 4MX3A 5KHGA 4LA2A 1ZYBA 1RUH1 5FYHA 5GLZA 1AYN3 1H2NA 3GJAA 3ILFA 3AMNA 3N9PA 1JH5A 2QCSB 4L2NA 3I97A 4OVEA 3KV9A 5H9QA 1FNYA 1GZTA 2A6WA 2KXLA 1ONAA 3CJIC 1OQEA 1UW8A 2ZGTA 3J8F3 5GKAC 5JLVA 2WQ8A 4NN0A 4BIFA 1POV3 3ZFGC 1OOPC 4QPYA 4QQOA 1L3JA 3I4IA 1IKPA 3PIGA 5G04L 4ES9A 1US3A 4AGRA 2ZEZA 1PHMA 4XAEA 2A1XA 3CDZB 1NZCA 4QPIA 2I07B 4QB2A 4AEDB 1K5MA 2ARCA 5AFEA 5CA6A 5DG2A 1JZ3A 3W20A 1EP0A 3MW3A 2VMFA 4YVSB 1PO12 5FYVA 5C8WA 1ZREA 3TRSB 5K0UB 3ZPOA 2EIBA 4Q0SA 3B69A 3I2IA 2UURA 5JCTA 1ZRIA 3PHMA 2XJVA 2A5ZA 2YFZA 4O65A 1ZNPA 5BNOA 1BJQA 1LOEA 4QU1A 2HWF3 3NKGA 3NV1A 2VMCA 4JX0A 3BU0A 1W3VA 3V64A 5FYTA 1ODMA 4RGKA 4XXPA 3VBRB 5I0RA 1IPKA 1W6PA 3D4KA 5FY5A 1VRH2 5HV4A 1XNKA 2W39A 3HR9A 1RHI2 1B35C 1Y9GA 1GWLA 3ZXLA 2Y0IA 3GNEA 4BCUA 1NAEA 1YQ5A 4FOQA 2XKOA 4AHZA 1YFYA 3MIDA 5FK7A 3OBRA 1JXNA 4NVPA 4JCKA 2BVVA 3CJIA 4YNIA 5FYBA 1V6LA 4S2FA 2GMMA 2R32A 3MPPG 5GLUA 1N3QA 1NCRC 4B7EA 1H0BA 1PGW1 4R4XA 5TSWA 3ZR5A 1CIYA 5EYXA 1ND2C 4AEKA 4UWDA 4COZA 1G9AA 3DYMA 3PMEA 5DAVA 1ST8A 3A7QA 1BVP1 2ZXQA 3LFIA 5LBEA 3TEXA 5IFTA 4XUQA 1DZQA 1F35A 1ULGA 1XYNA 2TBVA 4FAGA 2JDYA 3Q9OA 1WCKA 2VBPA 3ACHA 4XEZA 1G9DA 5CFDC 1ENQA 1UD1A 2V72A 4FPOB 5FPBA 2QQNA 4ZKTB 2CU5A 2VOXA 1EPWA 2R7EB 3B01A 2VUDA 4H55A 2XVGA 1LTEA 3NQHA 4JGYB 1Z7S3 4B4QA 3CKHA 1RUJ2 2VZQA 5KR7A 3VBUC 3RI8A 1JYNA 5IVFA 3I8TA 4LTAA 1E5SA 1FNZA 1B35A 3LPFA 4RS5C 5FZMA 2VZUA 4L0PA 2RHPA 2VZRA 3H1WA 5BNQA 3AVSA 1VRH1 4I0BA 1B09A 1SLLA 4N90A 5EV7A 3WNOA 2F4PA 2WL1A 1KD7A 1RHI1 2NN8A 3MW4A 2V5DA 3UETA 3ZYHA 4BK4A 2VZOA 3HQRA 2DBIA 4IEWA 4NRQA 3B00A 1ASJ2 1DQ2A 1UYYA 3BPSA 3GBFA 2IXHA 3LOIA 5FUIA 4IUGA 1XNDA 4LBOA 3SCHA 2JX9A 4QKBA 1KFXL 5A6XA 3TN92 1X8MA 3FN9A 5C71A 3MLJA 3ILNA 4IE0A 1A78A 3RFRA 4GIQA 4J1WA 3JQWA 1S0IA 3KQ4B 4I0WB 4MO3M 4X8PA 4UBHA 4CYDA 4W8JA 2RE9A 2QFEA 3AKRA 4QDSA 3SEEA 4HN1A 3RYPA 3SNMA 4N43B 3T4VA 4AVAA 2YROA 1AL22 3ZXJA 5LRRA 4CDUB 4DNYA 3HNMA 4E8CA 5FMDA 2ZGNA 1D2SA 1XNAA 4DY3A 2XJQA 5JOXA 3I59B 4BQ5A 1IPSA 2WQZC 3P3NA 3ZDVA 2OQ7A 4K40A 2VQAA 3AMMA 2CDOA 2JECA 3S0MA 2CDPA 3SH4A 3LEGA 2Y64A 3ETQA 3WW2A 1PIV3 3PUQA 3GM8A 3I3BA 3RZHA 4LULA 4FTEA 4A41A 4CCNA 3NVCA 3VBFA 4RS5A 2LROA 2A6VA 1LENA 3BCWA 5FYMA 3J7NA 4YW3A 1YXWA 1WW4A 1ZZ7A 2AGSA 4E4ZA 3AZZA 2VC9A 4XILA 5DAXA 2DUPA 3AYEA 4MZUA 2JB4A 3USUB 4CDQA 1W6QA 2DDUA 1IS6A 4E9KA 5IVEA 2UWAA 1J3PA 1WW5A 1LEDA 3MV11 3O1VA 1LKNA 1D4M2 1W8NA 3U11A 3LGRA 3ZFFB 5JDBA 4RGGA 1V6MA 3Q8BA 4WM8C 5C4WC 2BZDA 4JGZA 5DABA 2LRPA 1R1ZA 2VOVA 1KQRA 3EO6A 1ASJ1 1NCQC 4R9CA 5BY5A 2R043 2Y26A 3S5QA 2QUOA 2A6XA 1MEC3 3OGVA 3GXUA 2VZTA 1H8TC 3I2KA 3POGA 5LASA 4AE2A 2D93A 5LK7B 1JYVA 4Y4RA 1PZ8A 1W39A 5JXIA 3JBG2 4D7TA 2XQXA 4UFKA 4C0HA 5CADA 4C0BA 1WW7A 1HXS3 3CU7A 4L9BA 5CB7A 1AL21 1NY71 1O3RA 4PCRA 1K5JA 1G9FA 5LW9A 2VMHA 4QQ2A 2GZWA 5HCFA 3K77A 1RUD2 2IXLA 2V73A 2JKBA 2NLRA 5F5QA 1GSLA 4LKEA 4UW6A 3S57A 1QJX3 1XBFA 3W59A 5F2SA 1AL0G 3DXTA 1CPMA 3KT7A 3MHZA 4AI9A 2WNVA 4XF1A 2OPKA 3SISA 2Z69A 1O59A 2J1AA 2VQTA 5DN2A 2DVFA 4IERA 5FO9B 3PVEA 3ZSEA 3TOJA 2H0VA 1GOGA 3OYWA 4MLOA 3FHIB 1R092 4R8HA 2JICA 2D6LX 4U36A 5FPAA 3BUCA 1V9U3 3RMYA 3AXEA 1QEXA 4JKKA 4WM8A 5LA0A 1WMXA 1W90A 3NMBA 5BNNC 1XNCA 4XFAA 4CCOA 4M3CB 4XHXA 1MVQA 1D4M1 1MR5A 1VBA2 3CZUA 2CGNA 3RMXA 2IVJA 3C7OA 4RHV3 5CEHA 3V0BA 4MUVA 1ULOA 2ZHLA 3LA7A 5IVCA 3AKSA 4AVVA 5BNPC 4XJWA 1DGRA 5J36A 1PVC2 2Y60A 4QX1A 3O1UA 1TME2 1F15A 3K3NA 3CEWA 4X8NA 1W8HA 1W0PA 2XWJB 4XBLA 4HL0A 5I0UA 3G7DA 3VZMA 1NE6A 5I93A 1X9PA 4P5YA 4MVTA 4RFRB 3VKLA 1RTVA 4XUPA 4KBZA 1R64A 4CP0A 5A6ZA 1HB4A 5IK8A 4MYEA 4QXCA 3JBG1 4P9GA 3B9IA 5FZ6A 3LD8A 1ENRA 5KHJA 4LIUA 5FXVA 1VBC2 4P02B 5IAVA 1YO8A 1U5ZA 1NQDA 4EE2A 5KC6A 1KDMA 4Q1RA 1CZSA 3GJBA 2DWRA 3HPNA 3KB5A 4Y1UA 3H3UA 3RDIA 3ZOIA 5E16A 1V0AA 4NUBA 5CZKA 4EWAA 5DZGA 5JIAA 2BBAA 2XXZA 1Q8SA 3KV6A 1RUE3 2JEMA 4XDPA 2VMEA 3T09A 4BIOA 3ME2A 3POWA 1OH3A 3LFMA 1UZVA 2JJ6A 4YFWA 4CPBD 3CQOA 4FFHA 2AEYA 3APBA 2QQIA 4NRMA 2XPJA 1F8VA 1GP6A 1JYTA 2VULA 5BNNA 3RZKA 3DN7A 1J3QA 1MQTA 4XJ9A 5JSRA 2O0OA 2W1QA 1R091 1AXZA 1AXYA 1DG6A 2A73B 1ZA7A 2HWF2 3WDWA 2DVDA 2ZMKA 3A22A 3MLKA 4NHXA 3MYXA 2WQ4A 2WC2A 2ZX2A 3PUSA 5CVRA 5F3GA 2BPA2 3VHOA 3KLSA 3JZVA 1VBA1 1ZZCA 4NO4A 4ARXA 2EAKA 3VKNA 4YW4A 4NE9A 3ZMOA 3DUIA 3O12A 2BBVA 5ISLA 1HKDA 2ZPXA 2HYKA 3EHKA 3OEBA 2WA3A 3OPTA 4LUKA 3V0AA 4QX7A 4EN8B 3AMHA 3P5BA 4KWJA 5A70A 4YM0A 1PVC1 4PLNA 2WFF1 1DIWA 1EV13 1ND3C 1TME1 2RM22 2VNRA 2WLQA 4OCTA 4XUNA 4CDWB 1GQPA 3SC7X 1UY4A 1AYN1 2I2SA 3WDXA 3C7HA 4B3NA 4K8RB 4AWDA 1JZ7A 1TZOA 3AM2A 3GCWA 1U5XA 2BFUL 3KCXA 4WZFA 5A3TA 2EIGA 2VNVA 4ZZ8A 3H0OA 4OUEA 4NHKA 4UT5A 1S2KA 4FP3A 3U0ZA 3J8F1 3AVRA 3UV9A 1VBC1 4AEDA 5CG9A 2IFRA 1POV1 4Y1ZA 4AFCA 1DF0A 1QHDA 2PHFA 4B7KA 4OFGA 2X53S 5LATA 4ARYA 4EJRA 3DCQA 3O1SA 4OMDA 1WA6X 1YFXA 4FSJA 4A45A 1D2QA 2QZ3A 1L7LA 3AP9A 4P5HA 2PN5A 5FP3A 1UQXA 3O1PA 1DGLA 2ENRA 3LDKA 1IKQA 4N9HA 2WDBA 5CBLA 5FP7A 1Z7S2 2JDMA 5A33B 3BODA 4YGCA 1RGSA 3M7AA 4XACA 5C7GA 4HKLA 2WT2A 1GQGA 1PNFA 2EALA 2HWF1 4WM7C 1YUDA 5FUPA 4LE4A 4LO4B 4CCDA 5HCHA 2WR9A 5FZCA 2RJLA 1CGPA 4FBFA 2CY6A 4LHLA 4XPVA 3KGZA 3LZZA 3BTXA 2K0GA 1ND3A 5LZ6A 1ULPA 1NYWA 4U2AA 3RZGA 1Y9QA 2D6NA 3S7IA 4LITA 2VD7A 2FDJA 2WYSA 4AI2A 2ATFA 3FBMA 1LCLA 3BIWE 2ZEXA 4Y26A 1W8ZA 4Z8BA 1OLQA 4TTGA 4KL1A 1SLCA 1ZZ9A 3ZLIA 4FO9A 3ZX7A 4Y5TA 4YW2A 4CRQA 2GALA 4IE4A 3OPZA 2X8KA 5EJ3A 3VD7A 2FMYA 3T0BA 3WF0A 4E4SA 2X09A 4XUOA 1AYM2 5A3PA 2D6MA 2GN7A 3MW2A 3PTYA 4ET7A 4F8AA 4CDXB 5BV6A 4AXOA 3WF2A 4XIKA 2XJTA 4CCMA 2WT1A 4XFHA 3WDVA 1JZ5A 4HONA 5L7OC 3GBWA 5FXXA 4B29A 2VZ1A 2VR4A 2RJ2A 4BB3A 4Y1YA 4E8DA 4ZU5A 4JGYA 3HN1A 4XW3A 2W52A 3WG4A 5BUVA 4XFIA 1JYXA 5CISA 1UAIA 2B4KA 3LDRA 1UOJA 1WBLA 1D7PM 3ASIA 4AQ6A 3GZAA 1Z7S1 1AVBA 1GZWB 2K46A 3C7GA 4P9WA 1MS9A 2ETEA 2BGPA 4G3YC 5CAZA 3POIA 3DYOA 4LK6A 4TWTA 5FY8A 2H0BA 2JG8B 1FPN3 2WNUC 2W9XA 3MICA 4EV0A 3L9JT 4GQ7A 3VHNA 1F4AA 3IT8A 3WNKA 4KGGA 1PO13 2O8OA 3VBSA 4B1MA 1DZRA 2ZX0A 3H8OA 5DAWA 3PJYA 1F9KA 3BU7A 1N3PA 2D3SA 2DYCA 5HXVA 3AL5A 4I2OA 4A42A 2HJIA 1OLME 3NAPC 4OLLA 5A7WB 3THDA 1O3QA 4OHZA 4AAPA 1NXD1 2HWE2 4CEWA 2OZJA 1MEC2 3NV2A 4N43A 3RWNA 3KD4A 4HVOA 1UZZA 2XJPA 4N53B 4YZ2A 5C8CC 1E57A 1H1IA 2HWD3 1VRBA 1RHI3 1S0CA 2HBTA 3F95A 3I59A 5K9YA 1AJKA 3HWJA 4HK8A 4QPGB 4UFJA 5IVYA 5FTTC 3T2OA 3H3LA 1HXS2 3KV5A 1WLCA 2P3IA 1DYOA 1BCXA 1PX4A 2DFCA 3BGAA 4MHRA 3VLBB 4XJZA 4QKDA 2WIIB 4NR1A 2B8MA 4BXSV 2FCUA 3VKOA 3LE0A 5GLVA 3ZKYA 2WKKA 2P6HA 4A6OA 4AGVA 2BRTA 4FFFA 5GLTA 1QJX2 1SLIA 4WZCA 3SCGA 1W04A 3IDCB 4IXLA 2BNOA 2F17A 1HQLA 4YPJA 1PIV1
chains in the Genus database with same CATH topology
1UPIA 1W6MB 1EYBA 3USUA 2VY0A 4Q4Y3 3ZYIB 2WNUA 1REDA 3ZFEC 3AYDA 2UY9A 1Z78A 4Q4X3 4HVRA 3IMNA 4HPKB 4PIXA 4FPCA 4P14A 4XF9A 1POV0 3NV3A 1V9U2 4PIZA 2K2SA 2QKDA 3NAPA 3I2DA 3NKTA 4A7YA 4RHV2 2GC1A 4KBBA 2P37A 1RUJ3 2B39A 5J98B 2YYOA 5AVPA 2XL7A 4NOTA 3LA2A 2F6BA 2ZGQA 2ZGSA 5CU1A 2P3JA 5ABJC 3LAGA 2R041 1MEC1 2B5HA 2E7AA 3MIBA 3ILRA 4J6GA 1SLAA 5E8AA 2A70A 1HXS1 1GQHA 1ZBA2 5CFCC 1JYCA 1LULA 1NG0A 1JYIA 4GH4B 1CONA 1D4VB 1KFUL 1QWRA 2D98A 5EWSA 3TN93 1Z0HA 3CO2A 5JZGC 2GC0A 1C8NA 1N1VA 1QJX1 2DVGA 1G8WA 3ZFEA 3OCPA 2Q1ZB 1AL23 4WVWA 1CESA 1BYHA 3I7DA 4F3JA 2AREA 1LOFA 2A75A 3IIAA 3SITA 3PJQA 3WCRA 1JN2P 1V6OA 1QGLA 3W58A 1V9U1 5L19A 1PZ7A 3EXUA 4MGZE 3CNAA 1X33A 4YVWB 4OI2A 4I0AA 5JWPA 4E4DX 2XL9A 4RHV1 5ABJA 5KXDA 2VUJA 3NW4A 5FAXA 4KU8A 3FFQA 1DYPA 1EV12 4JVAA 1PK6C 2WZPP 1DQ5A 2DURA 2ERFA 2XH6A 2JG9A 1EAH3 1VB2A 2FQPA 1D0HA 3AJZA 3HT2A 3N7JA 4J1XA 1X7NA 4M3CE 5E1RA 2ZA9A 2B46X 1H30A 3R4UA 1ZBA1 1QMJA 3B02A 4ATEA 1JUIA 4AFMA 4KGQA 4D7YA 4K3UA 4Z82A 2VVDA 4GMP1 4IEOA 2PLV3 1RUE1 1FYUA 1MS1A 3VBHB 1FV2A 4HKWA 2BFUS 2WINB 4IESA 3QH7A 5C9AB 3SH3A 1I6XA 2PHDA 5JOYA 1RUD3 2RS13 4FPKA 4X6QB 3AJYA 2DCYA 4LNVA 1OQDA 4JTNA 2E51A 2ZAAA 4Q4V2 2SLIA 1QXPA 1H2MA 4H3WA 4XBQA 1VAMA 1LU2A 2AUYA 2P3KA 4QPIC 2CTVA 1LODA 4OZXA 4XOGA 1FOD2 3FLPA 1U0AA 2ZGRA 3KS7A 4QXKA 1U5YA 3UL2A 1F5FA 1R093 3OJBA 4YW1A 1RVF3 1ZZBA 2W0XA 4EN7B 2JDZA 4BPZA 2DFBA 1R1A3 1ZRDA 1EV11 2DCKA 1CN1A 2FMDA 2JXAA 4XYXA 1PO22 3RNSA 1VBA3 2OUJA 1H8VA 4IEUA 2D43A 2MHFA 4Y22B 2D3PA 4B4RA 5SV8A 4OI0A 4FPEA 4K9SA 2D40A 3AMQA 2GH8A 1PGL2 4KWLA 3E5QA 5A33A 1FV3A 3ZVXA 3ATGA 5JAXA 1VBC3 2HEWF 3AMPA 1MS3A 2IFWA 4Z92B 1ZBE3 4WVMB 4CZSA 3WXPA 2OUHA 2WZR3 3MIFA 4XETA 4AVSA 2YGLA 4Q2FA 4RQPB 1FPN2 3D82A 4GXLA 3QD6A 5IUQA 2X29A 1LESA 1AR93 1QQP3 1FOD1 3LOBA 4GWNA 1UIKA 1JBCA 5D1IA 5JPNB 4FAHA 5I8TA 2WNEA 1H1MA 2EXKA 4AI3A 1YNAA 1FATA 4JC1A 2PHLA 1DQ0A 4UW3A 1NOVA 3X29B 4BH9A 1HQNA 2HWD2 4I3PA 3OBTA 2GSYA 3R05A 1VR3A 2CAVA 5GZDA 5T50A 4AVCA 3MFCA 3RG0A 4COYA 1XU2A 4K21A 3JD73 2RM23 2UWBA 2VECA 3VDDB 3IN9A 4Y20B 1RUNA 1PGL1 1CAVB 1LOGA 4YYOA 1URXA 3ZXAC 2DU0A 4AQSA 1KITA 1W6NB 2DTWA 3AZVA 1XE8A 5T54A 2ZKNA 4G9SB 3FMGA 4BYYA 1T6GC 2UY8A 4NWWA 4Q4Y2 2JG8A 1XU1A 2G9GA 4Q4X2 2XBO3 4SLIA 3ZIWA 2JENA 2O8QA 4KWKA 1REFA 3VHRA 2Q0AA 1KDKA 2PHRA 1FPN1 1Q56A 4GMP0 3FLRA 3WQ1A 4Z2WA 1PO11 2DCJA 3POYA 1W0OA 4L8QA 3H50A 1OHFA 5BYNA 3WV6A 2RS32 2DCTA 1S1AA 4FOWA 3H3ZA 4IQPA 5KXEA 1BMV2 1IS3A 3PLQA 5IK5A 1FT9A 1UL9A 4PLOA 1DFQA 3VBFC 5AC92 4QPGA 4PQ9A 2JE7A 1N1YA 2BW8A 1GICA 1O4TA 3UK9A 1D0GA 3DPRB 4L97A 4AQ2A 1O5LA 2HWD1 3HIFA 4HSJA 4O9GA 3LSDA 4HSLA 2EXIA 3USSA 4DRRA 2NYYA 4K1YA 3GYDA 1KXGA 4NPRA 4Y24A 2LUWA 5FQ0B 1IGOA 2BGCA 4JGZC 3IM0A 4IV3B 3W9AA 4XE9A 4M3CF 1G9CA 4YG0A 5EZWA 1AYM3 4HBNA 4LA3A 4RR3B 4YM2A 3VZKA 3ACLA 1WLWA 4HPKA 4F83A 5GM0A 2RS53 3AP4A 4Q4Y1 1LEMA 4Q8KA 1SEFA 1IS5A 4Q4X1 5DG1A 2JD4A 2PTMA 3JCIA 5FMOS 3AZYA 3D6EA 1GZ9A 3DL3A 5JVVA 3VUOA 1QDOA 2DU1A 4QD2A 4KG0A 4CEYB 1ZVFA 2LTNA 4LBKA 4R52A 2UYBA 1QJZA 3UKTA 4URTA 4GALA 4A2UA 1RUJ1 2B9UA 2WNVC 2AR6A 2VW0A 4DQAA 4KNCA 3HMYA 1BMV1 1MS5A 1RUG3 3KGLA 4XZPA 4XF0A 1XXNA 4PLMA 3TAYA 3RSJA 4YGEA 1ZZ8A 3ZXFA 3C3VA 3VZLA 1EAH2 1MZ5A 4B8EA 5KXBA 3UJOA 2VXRA 1S0JA 3JUUA 3SMHA 4GH4A 4YSFA 4QQPA 5D8AA 4IV1C 2GNTA 4META 5FOBB 4ZXKA 4IEQA 2VUAA 2HWE3 1C8M3 2E6VA 4I3GA 3FE5A 3TN91 2VW1A 2PLV2 1QY4A 2GNBA 1M06G 2ILMA 2P2KA 2W68A 3VBOB 5E88A 4MGYE 4CP2A 1CAXA 4QM9A 4E2GA 1RMU2 5KBFA 3O14A 2HEYF 1QOTA 2RS12 1RB8G 1X50A 4YVWA 3AK0A 4DPNA 1Q5OA 2D6OX 4MXVA 4PDWC 1HV0A 4YG3A 3WD5A 4XF4A 3ES4A 2WSUA 4QU2A 1CQ9A 1RVF2 2X5IC 1R1A2 4ISQA 5FPZA 1CPNA 2OIIA 1MQTC 3ZYGA 1Q8QA 4IV1A 1EAH1 1FAYA 5AVAA 1BXHA 1YIFA 4TLFA 2OYZA 1PVXA 1OMIA 1XE7A 4P9IA 1IS4A 1VBD3 1HRV2 1UKGA 4KQ7A 3RQ0A 3ZN5A 1OD5A 1XNBA 2R6QA 1LOBA 3VBHA 3B94A 3N7KA 5GZFA 2R16A 5C9AA 1C1FA 3AKPA 3WINE 1X82A 1H2KA 2BTVC 2PLV1 3N7LA 3RJRA 4MGIE 1ZBA3 5EYYA 3N36A 4MGKE 3LB9A 5KHKA 1VB4A 3B93A 3CJXA 1OFNA 1W6OB 4NHMA 3LWCA 4QGMA 4DB5A 1ZBE2 1RUD1 2RS11 2A6ZA 4PDWA 2HWC2 2PAMA 1H2LA 2WZR2 4GMP3 4UXAA 2Q8OA 1CX4A 2BQPA 4PBPA 4AEDC 4DFSA 1HW5A 3CF6E 3OY8B 4YG6A 4YVSC 3WCSA 2X5IA 2QZ2A 3VHPA 5K0UC 2AZ5A 1AR92 1QQP2 1LHUA 1J58A 4HKOA 3AYCA 3OGGA 2YV8A 4YZ4A 3BPZA 1RUC3 1RVF1 3WUCA 5K7PA 1R1A1 4XDQA 1CJDA 2UU8A 4QQHA 1V6IA 3VBRC 1EPZA 5JZGB 2WJSA 4UBGA 4YGDA 1NA1B 4Y1XA 3A4UA 1CR7A 3JD72 4HT1T 1CJPA 3BALA 1MS8A 2B7YA 3H1MA 3AP7A 4FXGB 4HZFA 4K6BA 4XQWA 1SFYA 4LO7A 2ZBJA 1HV1A 4INDA 2DUOA 4AI8A 1MS0A 1S0BA 1JW6A 1COV2 4WVMA 3KT4A 1BEV3 1QXRA 3O5SA 1IQAA 2XGXA 4RQPA 1F2NA 1MVEA 3DKWA 3WNXA 1ZBE1 4XF3A 4HK9A 4YVSA 1SFNA 4P9JA 4CTEA 2HWC1 2WZR1 2FHRA 1ULDA 2D6PA 1WD3A 2O1QA 2XBO2 3ELNA 5K0UA 3U07A 3U4XA 5H9RA 3DV8A 1GANA 4JDOA 4LBQD 1O3SA 3WUDA 2EA7A 1YFUA 4K20A 3ZPYA 5I8SA 1NLSA 1LGNA 4JGYC 4AHYA 1AR91 1QQP1 3VBRA 1WCSA 1IHMA 3ZN6B 5FO8B 2UYAA 2Z2SB 4Q4V3 3LKJA 5T5JA 3AP6A 3AKTA 5DUWA 1SCRA 3SXWA 2PHUA 1SBFA 1FOD3 2DTYA 1AR63 1IZ3A 4Q29A 4C1WA 4Y20A 5J96B 2VMGA 5FDBA 1F5JA 2ZHNA 5J37A 3VBSC 3JD71 2RM21 2V09A 1PO23 3AB0A 1RUF3 3N4MA 1SDWA 3GZTB 3MEPA 1DGWX 2IZWA 2EF6A 3M3OA 2EVXA 4CEWC 3H7JA 4M0NA 3VN4A 4N43C 4CDUC 1AJOA 1K5MB 3I54A 4HFSA 1LHVA 2RS52 3URFA 5HCAA 1N3OA 1QJY2 2OZ6A 1C5IA 3FUQA 5ACA2 2ZTNA 3E6CC 4XFCA 3RZZA 1SLTA 4EROA 2XBO1 3JB4C 4OHVA 3O7OA 5F9TA 2ZX1A 3MF6A 2C0ZA 4A7ZA 5BNOB 3JB8A 4H7LA 2ZGPA 4XTPA 3IKWA 5I0SA 1GR3A 2XHKA 3DPRA 3AFKA 2VMIA 5J09A 4UW4A 1RUG2 4I09A 5T52A 4C90A 3UKVA 4FOYA 4AK3A 4GA9A 4R9DA 3ZFFC 5H9PA 4LT5A 5FQ0A 4FT8A 4LBNA 3CJIB 4W65A 1AR73 2A6YA 1UU6A 3PNAA 1OOPB 5DDJ3 3ZFGB 1NQJA 2CYFA 3ZIXA 2Y38A 1C8M2 5GLWA 4CDUA 2VNOA 4E27A 2P17A 2AENA 2RMU2 2NMOA 2BVBA 1AYM1 3RJ2X 1LGCA 2IXKA 2YC0A 4I01A 2XWBB 2ET1A 1QOOA 2RS51 1QJY1 1G9BA 3FBYA 1A6CA 1LHOA 1KS4A 2NZ9A 1FI2A 5J7MA 4XMAA 4XQDA 1OPMA 1HLCA 5FO7B 4BQ1A 4Q4W2 1DGRN 3PVBB 1B35B 5T3NA 2R1BA 2R063 1A8MA 1WA4A 3ZFFA 5EXOA 1WMFA 1RUG1 3M1HA 1LOFC 1GZCA 4P9YA 4MV2A 2VQ0A 3AXDA 1NXMA 1NCRB 4H14A 2WT0A 2C1FA 4AF9A 1ND2B 1VBB2 2R1DA 4LBQB 3IDBB 4AQTA 2ET7A 2RS33 4QM8A 1VBD2 2QVSB 5AC93 2IXCA 2HWE1 1LB2A 3ZYPA 2Q5TA 1C8M1 2CL2A 4GKXA 4FPJA 3QBQA 2E9QA 3H9AA 3L2HA 4O9EA 2QNKA 4YLZA 5FFOC 5CFDB 3WHTA 2FZ2A 4OHYA 4BWOA 2W08A 3ZDSA 1PNGA 2JG9C 5IK7A 4YZ3A 1VAVA 1APNA 1OSGA 2R0HA 3WDUA 3H8UA 3VBUB 3POSA 1AR83 1UKRA 3NSTA 3P3PA 5FMOL 5T5OA 4AFAA 3VBFB 1LOAA 1O4YA 4RS5B 2QJVA 3J9SA 5DXDA 3VZOA 4K7JA 5C6CA 1HRI2 1ZRRA 2I45A 1RITA 2R30A 4JRAA 4Q8LA 4L99A 3MFAA 1RUOA 4CDQB 1DQ4A 4G4FA 4BM8A 1BBT3 1GV9A 3M3QA 1X36A 4L11A 4M3CA 4EWDA 1RUC2 1Q3EA 4YW5A 1C5HA 3AP5A 4WBBA 1UX6A 1UU5A 3WOGA 1GKBA 2Q30A 1YWKA 1DLLA 2MNGA 4AFDA 2PAEA 2CGPA 2KM2A 4LR4A 2GDFA 2YXSA 1U5IA 3GHNA 3QCWA 4RL7A 5CIRA 1VBB1 1GLHA 1XQNA 5LEKA 3WHUA 2OVUA 1VBD1 3WW3A 4CDWC 3MIEA 4DS0A 3M3IA 4H7MA 4BA6A 1LRHA 2WS92 4DXZA 1XRUA 1R083 1NE4A 2N7GA 1UIJA 5FBZA 1PZ9A 3H1YA 1W6OA 2EXJA 1OI6A 3V65A 3AX4A 5KWRA 1I1EA 4XHBA 3SHRA 1YYNA 1BEV2 2VPVA 3NV4A 2Z79A 4FPHA 2EXHA 2WNVB 4QHBA 1N47A 1CAWB 2ARXA 1KS5A 4QGNA 2WFPA 3E5XA 3OYWB 5L36A 3S7EA 4ES8A 5J3UA 3PVNA 4HANA 2Z5WA 1SBEA 2ZGLA 2QE3A 4IL7A 5HI0A 4FTSA 1RMU3 2TUNA 4WM8B 5C4WB 5JSOA 4PJYA 3VZJA 1LOCA 1OQ1A 5JSPA 1NCQB 2YHJA 1ENXA 2QQPA 2PAKA 1RUC1 2K9ZA 1RUH2 4Y1VA 1CIWA 1C4RA 3N35A 1H8TB 1F31A 1NA1A 2ZCWA 3BB6A 4CDWA 3O0VA 3RYRA 4FP2A 1AR62 4I30A 1YHFA 2ZZJA 1CVNA 2GMPA 3LSEA 5F1RA 2Y0OA 4AVTA 1BZWA 3FLTA 2XB6C 3KCYA 3WW1A 1RUF2 1DDLA 2MEV3 1VBE2 3WQ0A 1H9WA 2CAUA 5FLHA 4D94A 3ZYJB 4HN0A 4CDXC 2PA7A 1RIRA 4OUMA 1HRV3 1BEV1 4EWEA 1PGSA 1RL3A 3GZUC 3O0XA 5KC5A 5A3MA 1OLRA 4DZGA 4DRVA 3MF9A 4IEPA 4HVQA 2DVAA 5BNNB 1QU0A 1G7YA 4N7UA 3ZN6A 2HWB2 4JDMA 3M70A 5F6KA 2D5FA 5BNPB 1KJLA 2XJUA 3VGIA 5IT6A 1H4GA 3PMSA 4MXWB 2HWC3 2ARBA 2ZGUA 3ZXGA 3MZHA 1J3RA 4Q4V1 2JG8C 3V0AB 1LJ7A 2YY1A 4NHLA 1CAUB 1PGW2 4B4PA 4LO6B 1AR61 1YCIA 2GN3A 1Y7BA 2XLAA 2ZHMA 1O91A 1AR72 2XLGA 5DDJ2 1OA2A 1PO21 2QDNA 4CDXA 1RUF1 5DUXA 1VBE1 4N53C 1YLLA 5I8YA 2NP0A 4LO8A 4GULA 1GNZA 3O0WA 2YMZA 4QPGC 3IBMA 4ISRA 3VL9A 3D0JA 2A3WA 2E63A 4FOVA 4OI1A 3WP4A 4R4ZA 4JRLA 3JU9A 1COV3 2A7AA 1GZWA 1LHWA 3OGJA 2ZKLA 2VG9A 3S30A 1YFWA 2NMNA 4LUMA 1WCDJ 2HWB1 2PFWA 1N1SA 3ZYRA 1TE1B 1LECA 3E6BA 2R062 4AI0A 2RR12 1LR5A 1ND3B 5A32B 3WG1A 2E7QA 2GMEA 4AEJA 5AFBA 2A3YA 4FXKB 3ZSJA 2HEVF 3IPVB 4Q1PA 1FX5A 1JTZX 4JV4A 5GJ6A 3LA3A 1DGWA 1VP6A 2Q1MA 3ZFGA 1OOPA 1VALA 3AYAA 3HD8B 3ZN4A 2WSVA 3ZXEA 4N53A 3WP3A 2FBEA 2GU9A 1AR71 4KG8A 1ENSA 3ZSLA 1WD4A 5DDJ1 3WP5A 3M2MA 5BPXA 4TZDA 1DU3D 1PMIA 2MPFA 1SMVA 5JI9A 5FOJB 2C5DA 2ZMLA 5BXXA 1UF2C 4K1ZA 3EJKA 3GHMA 4IETA 2BYVE 3TNQA 2NPIA 4M00A 5KXCA 4S2GA 4GH4C 2DCZA 1AX2A 5D8AC 1W2UA 5FLJA 4YFZA 4WM7B 1AR82 1W6MA 3OD4A 3OTFA 2DF7A 1YJKA 2EAAA 1EY2A 2XLFA 3BTAA 4AHXA 4GB32 1QJY3 4V1PA 2GNMA 1WBFA 3WR0A 1G6NA 1H4HA 5ACA3 1BBT2 1SQ4A 2R061 3FZ3A 3VBSB 5C33A 1NCRA 2ZAHA 2RR11 4Q26A 3SLIA 2ZGKA 1S0DA 1ND2A 4LBQA 3MIHA 3M8LA 2PHXA 4YVWC 5LEJA 3D5OA 4F7ZA 3R4DB 3NO8A 4QX5A 3NWKA 4QGLA 4CEWB 5B2GB 4S2HA 2R073 2PYTA 1NY72 4ONUA 2KA3A 1AUYA 2RS31 1VIWB 2VVFA 3DGTA 5L7OB 4YARA 5CFDA 1JUHA 5AC91 3A0NA 1YIPA 1MS4A 2BNMA 3OF1A 3D8CA 1R082 5JI7A 4AEMA 2Z42A 3WZ1A 4D7SA 1OPOA 3VKMA 1DYKA 4LLOA 3VBUA 5T5PA 4WV8A 3IDEA 1HDKA 4HLTA 3N7MA 1FMD3 1RJ7A 4XFBA 1OKQA 4XJUA 2D3RA 1Q8VA 1C57A 1AR81 4DINB 2RMU3 1AX0A 2WNUB 3VBHC 2VNGA 3RRDA 5DUUA 4DY5A 1LGBA 5C9AC 2JE9A 2IC1A 2D97A 4GB31 4ORFA 4A7KA 4D3WA 2YDEA 2XJRA 5GALA 2I74A 4XTMA 1VAKA 1AXKA 1BBT1 3RI9A 3WW4A 5JPMB 1HQWA 3NAPB 2PHTA 1V00A 1UU4A 3H7YA 2TNFA 2HKXA 3WP6A 1ZRCA 2XVLA 4Q4W3 2VU9A 5C8CB 4XBNA 4Y5Z0 2XG3A 2ZABA 1RUI3 4Q0QA 5EFUA 1ZZ6A 5JOWA 4LBJA 1S55A 4XQ4A 1NLRA 1QJU3 2RJKA 3G6JB 4AG4A 3QH6A 1R081 2G4IA 2MEV2 1ZRFA 1YI9A 2AYHA 1VBB3 1REEA 1CAWA 3MLLA 2D7FA 5FREA 4AHWA 4OUSA 2P34A 1JHNA 1QKQA 3ZFEB 1TMF2 1WW6A 3HBZA 4YM3A 4RSUA 2LM3A 1RINA 2ES3A 5KHHA 5C4WA 3IWZA 4BE3A 5KHIA 2CNAA 1QH7A 5HBAA 1NCQA 4ZU4A 3TYJA 1RMU1 1QOSA 3ECQA 1H8TA 2WLPA 1RC6A 1QNWA 4MSVA 3FX3A 2WFF2 2VW2A 5ABJB 1WGPA 4BHPA 4BOWA 1AYN2 3FJSA 2B42B 1C3HA 3QLQA 1WMEA 1TNRA 1S0FA 4RQPC 3NJZA 1HRI3 2VOWA 4EN9B 4C1XA 3E6DA 1CD3G 2A3XA 3VKFC 3KT1A 2JG9B 4PIYA 4Z1VA 5CFCB 3J8F2 4M01A 4WVVA 5DZFA 5SV5A 5LK5A 3WG3A 3ZO0B 5DUVA 1A8DA 3KZ4C 4Y22A 1UPSA 3WDTA 1DQ1A 4COVA 3TWIA 2MEV1 4LO5B 3VV1A 1AZDA 3KSCA 3RPQA 4Q0VA 4HMZA 3ST7A 2BUKA 3MGUA 3HT1A 2DV9A 1HRV1 4QQLA 4XIOA 3VDDC 4Q27A 2WS93 1TMF1 5IK4A 1J1TA 3QOPA 3K48A 4GKYA 2YPJA 4EN0A 3MDPA 3THPA 5BNPA 4FPGA 3TBDA 4LE3A 1H1AA 1HIXA 4MXWA 1MZEA 4FPYA 3FWEA 1GNHA 1O7FA 1UCXA 1MACA 4ASLA 1CAUA 4LHNA 2ZZQA 1PK6B 1GBGA 1Q8OA 2D6KA 2BWCA 1DQ6A 1QNYA 3FC0A 3OD0A 4D69A 3B9CA 2GH2A 3E5UA 5GZGA 2ZMNA 3R0RA 3WQ7A 1RUH3 1X8EA 5F6LB 3WLUA 4C91A 3E97A 5K8SA 5LRSA 3WT3A 4LHKA 5I0TA 1GYKA 3B5LB 5CNAA 1MZ6A 2CWMA 2CV6A 2YGMA 2R49A 3DPRC 4N7IA 1BQPA 3VDDA 4BLJA 4COUA 2VOKA 2XUMA 1CAVA 4TSVA 4GWMA 1W6NA 4IEVA 1UMZA 3ZSKA 3LCPA 2E7TA 4IV3C 2AH2A 1VBE3 1IOAA 4KU7A 2YZ4A 1O3TA 4RR3C 1COV1 4RGAA 4S2DA 4YRDA 3DF0A 4YZ5A 4YGBA 4QPIB 3KCCA 1A3KA 5A32A 4P9XA 3IPVA 1OA4A 1QH6A 4BMEA 2VVEA 4A3XA 1O4ZA 1QXJA 3L2YA 1Y43B 4FPLA 2DUQA 1BVVA 2HWB3 4HETA 4P9LA 4CEYC 3AZXA 4JTOA 2WA4A 3CLPA 5FPXA 4PBOA 3B7MA 1DZTA 2VGDA 2R072 1W6PB 4ATFA 1J1LA 2ZHKA 5HCBA 3GF6A 3AFGA 4TYSA 4FPFA 4FQ4A 4JAAA 4MH0E 1PIV2 1ULCA 4IV3A 4WM7A 3WG2A 3WX5A 5A3LA 1WMDA 1FMD2 2SBAA 1AF9A 4PF5A 4RR3A 3UJQA 2ZX4A 4LBMA 1S0EA 2PQQA 1O5UA 2D44A 3KMHA 1M4WA 4XJ8A 3M3EA 5T55A 2NM1A 4OHXA 5GZCA 3EBRA 2XKPA 2GAUA 3WDYA 1H9PA 3JQXA 4WVZA 3VBOC 3HAGA 3R4SA 1LU1A 4XXAA 4AW7A 1ALYA 1MZFA 3D0SA 4CEYA 5ACA1 4AVBA 3BOWA 5FCCA 5T5LA 4JQRA 4OI4A 4W6XA 2OA2A 5H9SA 1ULEA 2R042 4N9IA 1I3HA 1VRH3 3KM5A 4IEZA 5L7OA 4RA0A 4LLFA 1QDCA 4DOUA 3J4UH 1V6KA 2R071 1RUI2 4XFGA 2RR13 1KRIA 2CWSA 5JIUA 3EQEA 3R6SA 5J48A 1AHSA 1QJU2 1KJRA 3C2UA 4ASMB 2FZ1A 3WY6A 2ZGOA 1C1LA 1V6NA 1XYPA 5DZEA 3T1LA 3ZXKA 1C28A 1V6JA 1FMD1 4XMIA 4IEYA 2GC3A 3V56A 1YI7A 3RYKA 3PVOA 2LALA 4BZ4A 2G9FA 3M3CA 3VBOA 3KQRA 4XJAA 1YJLA 1TNFA 2RMU1 2Q4SA 4UW5A 1VLNA 2GC2A 4ZU7A 5FRAA 2A71A 4CP1A 1TEIA 3J26N 2YUEA 3A0KA 3SH5A 5C8CA 3HQXA 4AGGA 5I91A 3NL1A 3T1MA 5JMCA 4LEJA 4Q4W1 4DMIA 2IWGB 1SBDA 4GB33 1JOJA 3GALA 2IXIA 3CL1A 1W6QB 2H6BA 2IXJA 3B3QE 3MIGA 2ZACA 1HX6A 1G86A 1ASJ3 1RUI1 1OA3A 5E89A 3TB0A 2ZS6B 1RJ8A 1QJU1 4QT6A 4JGZB 1YRZA 3N3HA 3AKQA 5D8AB 2PHWA 1PM7A 2E53A 1RUE2 3FUOA 4OHWA 1LHNA 4QMAA 2CGOA 1TQ5A 2DVBA 3M4FA 1NA1C 2TEPA 4LBLA 2PELA 1IPJA 1Q43A 3ZSMA 1BKZA 3ES1A 2BEOA 3WVJA 2XJSA 1Q8PA 4RFT0 3SCFA 1CAXB 4AFBA 4COWA 1AX1A 1I9RA 1UN1A 4W6WA 3ENRA 2QDRA 1UZYA 3AZWA 1ZA4A 4NWVA 2OW4A 5FLIA 3OY8A 4X6RB 3VZNA 4FCAA 4EN6B 3RS6A 1SLBA 1I5ZA 4YM1A 1ZM1A 3BOPA 4FVVA 3TNPB 1D4M3 5CFCA 1HRI1 3ZXDA 4Z07A 2WWSA 3MI8A 3QACA 4W6YA 3MPBA 1VJ2A 3FFZA 4IV1B 4K8FA 5JZGA 1DHKB 2UWCA 3V0BB 3U10A 1WLDA 1J59A 4KH9A 3UKNA 1V70A 1WLTA 3JBG3 4FQZA 3INAA 2ZJCA 3K51A 2BNNA 3ZMNA 4BMBA 4I02A 1OFSA 1ZX5A 4AI1A 4Y4YA