1H0BA

Endoglucanase cel12a from rhodothermus marinus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
226
structure length
226
Chain Sequence
TVELCGRWDARDVAGGRYRVINNVWGAETAQCIEVGLETGNFTITRADHDNGNNVAAYPAIYFGCHWGACTSNSGLPRRVQELSDVRTSWTLTPITTGRWNAAYDIWFSPVTNSGNGYSGGAELMIWLNWNGGVMPGGSRVATVELAGATWEVWYADWDWNYIAYRRTTPTTSVSELDLKAFIDDAVARGYIRPEWYLHAVETGFELWEGGAGLRSADFSVTVQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Rhodothermus Marinus Cel12A, a Highly Thermostable Family 12 Endoglucanase, at 1.8 A Resolution
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
molecule keywords CELLULASE
total genus 61
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h0bA00
3VGIA 3WQ0A 1XNKA 1OA2A 4S2FA 2BWAA 3VZNA 3VHPA 3VL9A 5K7PA 3MF6A 5EJ3A 1C5HA 4XQWA 3AMNA 1XXNA 4HKWA 1C5IA 2DFCA 4S2GA 3LGRA 3RI9A 3EXUA 2JICA 1REFA 3VZKA 4HK8A 3RI8A 1UU4A 2DFBA 1H0BA 2QZ2A 3VL8A 1H1AA 1NLRA 3AKPA 2B45X 1YNAA 3AMMA 3WP3A 1PVXA 2VUJA 3VHNA 3VHOA 1BK1A 3HD8B 1OLQA 3WX5A 3WQ7A 3WXPA 3O7OA 1UKRA 1OLRA 1T6GC 1W2UA 3AMQA 3B7MA 2F6BA 1XNCA 4S2DA 1TE1B 2DCZA 1HV1A 2BWCA 2JEMA 4XPVA 3AKQA 1H4GA 1H4HA 1F5JA 3M4FA 2JENA 4HKLA 5HXVA 3WY6A 3WP4A 4H7MA 1M4WA 1OA3A 2DCJA 3AMHA 2B46X 2DCYA 4NPRA 2NLRA 3WQ1A 2VGDA 3VZOA 2B42B 1UU6A 1HIXA 2BW8A 1XNBA 3VZMA 1KS5A 3WP6A 1QH6A 2BVVA 1OA4A 1H8VA 1XYNA 1AXKA 2C1FA 3MFCA 3VZJA 3WP5A 4HKOA 1HV0A 1BCXA 1KS4A 3AMPA 3ZSEA 1REEA 2DCKA 5K9YA 3WR0A 1XNDA 4XQDA 1QH7A 4XQ4A 2D98A 3LB9A 1XYPA 3VLBB 2NQYA 3AKTA 1ENXA 1UU5A 2Z79A 1XYOA 3MF9A 3WT3A 1REDA 2VULA 3AKSA 4IXLA 3B5LB 3VZLA 2VG9A 4HK9A 2D97A 3AKRA 1IGOA 4S2HA 2QZ3A 1BVVA 3MFAA
chains in the Genus database with same CATH superfamily
3HN3A 5FZGA 2YBKA 4RA0A 4E8DA 1OD3A 4GJYA 4QMAA 2XL7A 1ULFA 3O0WA 4WM8C 4WM7C 3MF6A 5FY7A 4XQWA 4AFMA 5T5OA 2ZAAA 3Q8CA 1K42A 4DIQA 4D6SA 4WVWA 1DZTA 1G9BA 3RZLA 3SH4A 3TOJA 1RMU2 3DN7A 3M3CA 1O8SA 5FY9A 5C33A 4XF9A 3LEIA 1J84A 1UF2C 5GZEA 1VLNA 3GJBA 4OHWA 1NCRC 4XFBA 3WCSA 4IV1C 1SFPA 2XVKA 4M4RA 4CTEA 2ZA9A 3POWA 2CGNA 4YFWA 2RJ2A 3THDA 1ZBA2 5JXGA 3B9IA 1W0NA 3ECQA 1MZEA 4LNVA 1OQDA 3RZZA 4A7KA 4Q1RA 5M0TA 3IAQA 4AAXA 4V1PA 3IPVA 4Y3OA 1QDCA 4YG6A 3T4VA 3THCA 3LA7A 5C9AA 2OVUA 2A6YA 2WAOA 2ZGTA 3INAA 1H2KA 4CP0A 4MG2A 3P5BA 2YU1A 4OI2A 1CAUB 3CJIB 4C8DA 5A1FA 2VH9A 2D3PA 2BBAA 2CL2A 2RR11 4HN0A 1D2SA 4YW1A 1SCSA 5FXZA 3USUA 4CDXC 1BKZA 4LK7A 4E4HA 1AL21 5FMOL 3SCFA 1L3JA 2Q8EA 1W6PA 3J7HA 3M4FA 2BQPA 4R4ZA 1D2QA 1QJX3 1YFWA 5B4NA 3WP4A 2VAUA 2PLV1 4E2QA 3VKFC 1ACCA 1QJY2 4OZOA 1DG6A 3NL1A 1IS4A 1D4VB 2ILMA 3MICA 4IEWA 4M3CA 3IDEA 4P5YA 2A6XA 1NXMA 3LA3A 1EV12 3LPGA 3N9QA 2Y6HA 3M8LA 3ZXDA 3N9OA 4ES8A 2OQ7A 1QJX1 3KCXA 1K5JA 4NWWA 3NJVA 3MHZA 3OSDA 5CVRA 4CDUC 3IIAA 4I02A 5F2WA 4EROA 4NIGA 4QXKA 3RZHA 2UYBA 3ZFFA 1VMHA 1OHFA 3DYPA 4B7KA 3V0AA 5HI0A 4PI2A 1W2AX 2G1MA 1TMF1 3MFCA 4AFDA 4A7YA 1WD4A 4L99A 2CDOA 2PQSA 2XMLA 4FTBA 2R1BA 1DHKB 1FXZA 2VMFA 2YXSA 4XFAA 3LDBA 5C5UA 4YM0A 3K51A 3LB9A 3A4UA 4BXSV 1JYNA 1H9PA 1SHWB 3JCIA 3I3DA 3N9PA 5FOJB 1KITA 2W94A 3KHBA 3P3NA 3WOGA 2BBVA 5FZKA 2GU9A 3KGLA 3HT2A 5CKQA 5DN2A 1WCUA 3NNFA 2GMMA 1DDLA 2ZX2A 1BK0A 3ZLIA 1CAXB 1JODA 2RS52 4KWLA 4NHMA 1LKNA 3U4XA 2P1BA 4YVSC 4YRDA 2MPFA 4AHXA 4A3ZA 4K1YA 1UD1A 2HWF2 2Y26A 4Q29A 4YPJA 4KNCA 2GP3A 3OB8A 2BV4A 1RUD2 3NNLA 4CP2A 3WQ0A 5FO9B 2V72A 3U10A 1MQTC 4FSJA 1RUH1 1WCSA 1WUVA 2K46A 2CDPA 2VBDA 1Z78A 4FPYA 3BPSA 5TSWA 1GBGA 3ME2A 4MHUA 4Y5Z0 5CIRA 1G9AA 2WABA 4LKFA 4QDRA 4UW6A 1OFSA 4YVSA 3HAGA 4COVA 4CU8A 3SEPA 1NLSA 4NAMA 1AR63 3VBUB 2R6QA 2IXLA 1OURA 3QH7A 3MLLA 4HK8A 2RS32 1S4CA 1SCRA 1SZBA 2PHWA 2Y6FA 3H3ZA 1DQ4A 5GLZA 1NYWA 3K4AA 2VU9A 1NXD1 1LHOA 4LR4A 2VZVA 1H8TC 1W8FA 1YCIA 3OBAA 2BGOA 1WLCA 3WDTA 4BU2A 1HRV1 1XU1A 2FDHA 2JDZA 3PIGA 3POSA 3DV8A 4HSJA 1BLZA 2WJSA 4JTOA 1JU3A 3ZVXA 4BK4A 3MW2A 2XGXA 3JXSA 5IUQA 2VO5A 5HV0A 3PVBB 3TEXA 4FQ4A 1B09A 4XF3A 4IL7A 5FWEA 1GU3A 3BTYA 2VM9A 3NVCA 1RUJ3 1HJGA 1QNWA 3OPWA 2BWCA 4JDOA 2BOIA 5GLTA 1R093 4PBOA 1O3TA 4N9HA 5KHJA 5F2SA 1HN0A 2DV9A 1BBT3 1W6OB 2JE9A 2VZQA 3HBZA 3FFZA 4AI3A 5JXHA 1RUG3 1AR83 3IMNA 1OH3A 1SLLA 2DCJA 1V6OA 4WVZA 3WF0A 4B29A 1AL22 1FMD1 1HB2A 1SMVA 1KFXL 1VRH1 1X33A 2ARBA 3AZZA 3HPNA 2PYTA 2Y34A 3OJBA 3Q8EA 2RR12 4RS5C 3TN93 2B42B 3CL1A 4DOUA 3V0BB 3MW3A 1OUXA 3RWKX 3ZX7A 3VZMA 1FV2A 1HXS1 4NIIA 3M7AA 4KGGA 3LOBA 1F35A 4B4PA 1NQDA 4HKOA 2DBIA 2XG3A 1HRI3 3HVDA 4MV2A 4K8RB 5BY5A 4LO5B 5LASA 5F3CA 5EIYB 1PO22 2ZXQA 4JHTA 1GANA 5FWJA 1QH7A 3RYPA 3RGBA 5B2GB 1RUE2 4KG0A 3K2OA 4ZS3A 3UJOA 4SLIA 5A3UA 1AYM3 1DYKA 2OQ6A 3FFQA 4IV1A 1JZ2A 3SITA 4WBBA 3WHTA 3W5NA 4YZ5A 2P6CA 2ZACA 1BEV2 4IEQA 4AI8A 4OYUA 1RHI2 1R092 3S30A 5FZBA 1PVC1 3KQ4B 3ZO0B 3RWNA 3ZSJA 3K3NA 2JDAA 4AZZA 1W99A 1KDMA 5T52A 4BOWA 3WLUA 3U78A 3E6BA 3PVOA 1VMJA 1WBFA 2D97A 3AKRA 3KCYA 3O0VA 4UW5A 3WF3A 2JDNA 1HXS2 2VQ0A 3I2FA 1L7QA 2HWE3 4I30A 4WM7A 3LDRA 3FX3A 4XTMA 4DEQA 3WNLA 4ZPIA 2H0BA 2D5FA 2VZ1A 3WNXA 4ORFA 3ZMOA 3VD9A 2VQUA 4S2FA 1LTEA 1Y4WA 4QWNA 1DGLA 3RZGA 1Q43A 2Q4SA 3OGJA 2N7GA 2OA2A 2XJQA 3VDBA 4FPOB 4D7YA 5CEHA 2Y0OA 4M00A 3PIJA 2YBPA 3TBDA 1G9CA 3ETPA 3I3QA 4OI0A 3GBFA 1DGWX 1UMZA 2VMCA 1D4M2 3ZR5A 3GF6A 5LBEA 3SNMA 3U37A 1XBFA 1NCQA 2W5FA 3H3UA 1JZ8A 2QQOA 5IVVA 3ZKUA 3M3IA 1XE7A 5FZFA 5B4XA 4OMDA 2WT0A 2W0XA 3ENRA 2EIEA 3MIHA 1LECA 3ALQA 1W05A 3NSTA 1M06G 2C9KA 2VZTA 3AKPA 5AC91 2VVFA 4PIXA 4PQ9A 2XJVA 4H55A 1FYUA 4D3WA 3DF0A 3O1MA 4C90A 5APAA 2G19A 4P14A 1LENA 4IGOA 1H1MA 1US2A 2P5BA 2X5IC 2ZX3A 3UK9A 3M3QA 1IPSA 2BEOA 5JIAA 4QPIA 4D8MA 1FOD1 4KWKA 4A44A 2DBNA 3HNBM 1AR72 1JUHA 4GMP1 3C3VA 4Z1VA 1YLLA 1RITA 5CFCA 2JXAA 1T6GC 3B7MA 1XNTA 3AMQA 3N4MA 5IATA 3BB6A 2VJXA 1C4RA 1JZ7A 3GZAA 4BZ4A 2VZRA 2OZ6A 4KU7A 2R041 5FREA 3GDBA 1GR3A 4FBFA 3DXUA 3VBHB 1DCSA 4YNIA 4NHYA 4AQ2A 1CAVB 1HB4A 4PLNA 5C4WB 5KWRA 4R8HA 1UZ0A 2R0FA 2FQPA 3E6DA 2JG9C 4BCUA 1OA3A 1SEFA 4AGGA 2GDFA 3VBUC 3OF1A 5FO7B 3NAPB 2B46X 3ILNA 3O12A 4CPBD 1RJ7A 4DS0A 4FP3A 1JTZX 1HB1A 2AGSA 2P17A 3NRUA 1JOJA 1ZYBA 1YI7A 2XLGA 1XNBA 1VBC3 2ZEXA 3ES1A 1SLTA 5FY8A 5LBFA 2WZPP 1WLWA 1H8TB 4DMIA 5K8SA 2EALA 4HL0A 4BQ2A 5EQUA 1MVEA 1W2OA 4SBVA 2HKXA 3OYWB 4UBHA 2C1FA 4JKKA 5K0UA 4QQPA 2RS51 1IQDC 3KGZA 1LODA 1VBC1 1A6CA 1O5UA 1WCQA 3OOXA 1AR92 2OKXA 2BGCA 3BVCA 4CRQA 4ZKTB 5FP7A 3ZXKA 2BDRA 4YW4A 3WR0A 1LRHA 1JYWA 4G4FA 3VBSA 1UNBA 1DZQA 4YLZA 2DCTA 5EWSA 4IEOA 3CEWA 3EO6A 3AKTA 1D4M1 2NPIA 3K4DA 4LE4A 3ROUA 1GNZA 4GJZA 4MGQA 4OUEA 1GNHA 4XIOA 1X36A 3V56A 3VD5A 3WG4A 4GWJA 4I09A 4FPHA 1QJY1 2VULA 4NPLA 2VUDA 1TMF3 1R1A2 3VBOB 3WZ1A 5K0UB 1SBFA 1UZVA 1UMHA 4F83A 4IV3A 2GC1A 4I2OA 4RN5A 3TN91 5T50A 3S5AA 1LOFA 4LT5A 2R062 3I3BA 4Y22B 3QCWA 1W90A 1S2BA 2QQPA 4GWIA 2QUOA 1FNYA 2WDBA 3KHCA 1U5YA 5CFCB 1UWWA 4IE0A 5C9AC 4W6YA 4D6QA 4NJ4A 2PHRA 1EV11 1T2XA 2P34A 4E4SA 4H7LA 2ZGRA 4K3UA 1C5HA 4LOSA 4LQRA 2JD9A 1F9KA 1UY0A 1R091 3IM0A 4O9EA 1NCRA 1RUC1 3TRSB 3WW3A 2D3RA 4WZCA 4ZZ5A 5I91A 3BI3A 4JCKA 5LEKA 4ZONA 2WNVB 1PO11 1AVBA 1LGNA 4O7XA 5F5AA 2IUWA 3QH6A 4RS5B 3MPBA 2OYZA 2QNKA 1POV3 4YW7A 3BIWE 1H1AA 4NRQA 1W3XA 4MGTA 1YO8A 4OHYA 4HN1A 4CEYC 2RS33 3OGRA 4UFHA 4B1MA 1P8JA 1MS3A 4CEWB 3K77A 3GJAA 3VHNA 1A8DA 1Q3EA 4HMZA 5EP9A 1C1FA 4LA2A 1OQ1A 2X09A 4JRAA 4N53B 3VBFC 5C70A 3A21A 5E6HA 2R063 2R1DA 3UJQA 4GH4C 5CKMA 4FP2A 1G9FA 2VNVA 4PLOA 2VW1A 3FL7A 1X9TA 2VUCA 4Q26A 2LW8A 5D1IA 4MX3A 3ILFA 2ENRA 5D8AA 3KS7A 1N3OA 1VRH2 4ONUA 3ORJA 5GZDA 2BGPA 1WLTA 4J1WA 3R05A 4GKYA 1MS0A 1J3QA 4LHLA 1O3SA 2KM2A 2UWCA 1ODNA 3KV6A 1OI6A 5DDJ1 4ZXEA 4K40A 2C6SA 3LE0A 4L92A 4QD2A 2GC3A 5IVYA 2CGPA 1ONAA 2HWD2 2WL1A 3PJYA 1J59A 2VECA 4IERA 1ZRCA 2ET1A 3WNKA 4ZHNA 5FJHA 4Y1VA 3OD4A 4PCRA 1RUG2 5JVVA 3C8XA 3ZFEC 2JDMA 3VZOA 3EMRA 2C0ZA 2ZKLA 4XBNA 4G3YC 1ASJ2 1YQ5A 2UYAA 5AC93 4BISA 1LOAA 2HYXA 3P3PA 2WRAA 1OA4A 1UOBA 2VZUA 1N3PA 2RR13 3I97A 1NT0A 5CFDC 1R1A1 4IQPA 3WP5A 3FLPA 2UY9A 4NOTA 2BFUL 1BMV1 3T1MA 4DUXA 5J36A 1VBC2 1HRV2 4CEYA 5LWBA 2A6VA 2DUQA 4EN0A 2YZ4A 2D6PA 1V9U2 3A0NA 1VBD1 4ZU5A 1UXZA 5H9QA 2QKDA 3KB5A 5F5CA 2WNOA 1LHVA 1AR81 4JGZA 1UYZA 3SQOA 3S57A 2RDNA 3WNMA 4C91A 3VLBB 1JW6A 2A3WA 4JHZA 4LIVA 4PLMA 4WM8B 5T55A 1FPN3 2YPJA 1AR93 3ZYJB 5J96B 1AYN1 1IG3A 3T2QA 3ZSLA 1U0AA 4JGYB 4UYBA 4GQ7A 4Q4Y3 4YG3A 5DXDA 3CZUA 5F8PA 3VBOA 4Q8KA 3NMBA 4XBQA 1KRIA 2B39A 4ATEA 3B5LB 2Q5TA 2RM23 2Z5WA 1MS4A 1GZTA 1KJLA 4DUWA 1NG0A 5EPAA 3O14A 4D7TA 1BVVA 2XUMA 2Y6JA 1DLLA 4IV3C 1YFYA 3AM2A 4YVWA 3U75A 1ULCA 4CDWB 2I07B 2BWAA 4LJHA 2Y6GA 1AR62 4XTPA 2OPWA 3PU8A 3O1TA 2XBO1 5E88A 1XE8A 1UYXA 1QQP2 1WKYA 3FLTA 2EA7A 3KWVA 2VQAA 5A33B 1FI2A 1VIWB 1W8UA 3KZ4C 4FOVA 4QU2A 5IK7A 2IXIA 5FYHA 4YVWB 1UN1A 3ZM8A 4BHPA 2C9AA 1Y9GA 4PI0A 1RXGA 3D0SA 5FTTC 4GXLA 1V6KA 1YI9A 4LO8A 3LIHA 4BM8A 4Z2AA 1JU4A 1NQJA 3VKOA 4Q5OA 2OZJA 1URXA 4ZS2A 4YWAA 2Y38A 1AJOA 4B1LA 4BQ3A 4EV0A 1LOGA 4I0BA 4TLFA 3SCGA 5K0UC 3SCHA 5FPLA 4JRLA 2HLEA 1OVSA 2X05A 4CDUB 4UFKA 5A32A 1LCLA 2YC0A 3UGHA 1ND3B 2Q1FA 2X8KA 5FZ3A 4QPGA 2ATFA 3T08A 3IPVB 3ZN6B 4OZXA 4NPMA 2F17A 3ATGA 4JDMA 3VBUA 5FBJA 1PGW2 1RB8G 1H4GA 2C5DA 2WS93 1QOTA 4ES9A 5IW0A 2QVSB 1GYKA 3S0MA 2PLV2 2WFPA 3OG2A 2R0HA 4E8CA 4CUCA 2A71A 3NV2A 4K1ZA 4DXSA 1XSRA 2HEVF 3ZXEA 2WT2A 4QM9A 2DCYA 1GSLA 2VUAA 2WA4A 3CJXA 4GB33 2XXZA 1RUI1 4E2SA 3V64A 3H8XA 3D0JA 5KR7A 4QB2A 1QHDA 1W3VA 5A7OA 3VB9A 3W59A 3SH5A 1NE4A 4K21A 5JSOA 3OCPA 4Q27A 4QPIC 1CWPA 5I0DA 1E5IA 3C7GA 3OY8B 1GP6A 2ARXA 2VL4A 2X5IA 5FPUA 5L36A 1HV0A 1ODMA 5E89A 2VZOA 2Z42A 4Y20B 3NJYA 2DU0A 2WWJA 1W9YA 1HLCA 3DUIA 4FXKB 3VBFB 5L19A 4K7JA 4N43B 1VAVA 5L7OB 5A7NA 3SHRA 4KH9A 2P3KA 2Q1ZB 2RMU2 1GWMA 1Q8OA 1H6XA 1NCQC 3DCQA 2WFF3 4K9SA 3HBKA 2ZZQA 1QJFA 5JZGA 4NO4A 5DDJ3 3UNPA 2J1AA 1PO21 2WZR1 1FMD2 1XJAA 2ID4A 3HMYA 2Y0IA 4IV1B 1RUC2 3GHNA 1F8VA 1VP6A 4UF0A 1UMIA 2GMEA 1RUJ2 1YJKA 3AKSA 2DVFA 4BQ1A 2AEYA 3S5QA 4Q4W3 5ERLA 1LAJA 1VPHA 5FPVA 2WZR3 2HWE2 4F3JA 3H7YA 3VZLA 4JQTA 4GB32 1PZ9A 2VY0A 3A7QA 1FOD3 1OOPA 4D69A 3RMXA 2VNGA 5H9RA 1LJ7A 5DAVA 1UXXX 3GXUA 2VNOA 5JOWA 2R061 1I1EA 4XFHA 2G9GA 3N9LA 2GH2A 5FRAA 5I93A 2GNMA 4AFAA 5CA6A 3VHPA 5KXDA 5FZ9A 2VR4A 1NLQA 4CPBA 5FY5A 4CP1A 1HJFA 4LIUA 1YQCA 4HT1T 1YQ8A 1Z7S1 3FMGA 1QXPA 2ZMNA 4BLIA 1CX1A 1UO9A 5FUPA 4OULA 1UZWA 3J8F3 2PA7A 2W46A 3OY8A 2XHNA 5E1RA 3PVNA 1NOVA 3JQXA 4LXLA 3RI8A 5A70A 1BQPA 3LEMA 5FYTA 3QBQA 4KWUA 3J8F1 3VD4A 1PMJX 4CXWA 3B02A 3JZVA 2CGOA 5LA2A 3W20A 3WW2A 4FAGA 2VPVA 4LHKA 1UL9A 3OGSA 1OKOA 4LKSA 5GZCA 1A8MA 4QGLA 4W6WA 5LW9A 4M01A 3L2YA 2DVGA 1XE0A 1IKQA 3B9CA 3WW4A 4YW2A 4RR3A 2FDGA 1ND3A 2W1SA 1PK6C 4B8EA 5DDJ2 2VMHA 1Y3TA 1RUH2 2W3JA 4FXGB 4QDQA 4UAPA 5A3NA 5JSPA 1UZZA 3P6BA 4RS5A 3RQ0A 3F95A 2XHKA 2X5IB 4XDOA 1W03A 2JEMA 4XPVA 4X8NA 3ES4A 3WNNA 2VXRA 2ZMKA 4CDQB 4CCCA 3BALA 1A3KA 1QDOA 3TB0A 2VOKA 4H7MA 1AYN3 2CWMA 4BMEA 5IVCA 4LE3A 4U2AA 4AVVA 4Q4X2 3NO8A 3SMHA 2D43A 1JOPA 3K46A 3ZYPA 1EYBA 5BNNB 2VW2A 1O59A 4FO9A 4NHXA 3LKJA 1AX0A 2HWC2 5LA1A 1PGSA 2IVJA 4CDQC 1XC6A 2RM21 1S0EA 3WP6A 1UW8A 2RS53 2DVBA 5A6ZA 1X8EA 2YDEA 1ULOA 3ABZA 1AUYA 5DPNA 5A3TA 4R4XA 5CG9A 5IFPA 4X6RB 4LBQA 1U12A 1W04A 1Y9MA 3ITQA 5BNNC 4LMFA 4IEVA 1JMUB 1RGSA 3AYDA 3H3LA 4JX0A 4RHV2 4IGQA 1EAH3 4LBJA 4A4AA 4AEDB 3B94A 4E4ZA 3BKZA 2DCKA 3POYA 5D2AA 4IEUA 2OXBA 2E51A 3EJKA 4CDWA 5FYSA 4UXAA 1FPN1 1MZFA 1UOGA 3OPZA 1E5HA 1G7YA 1DZRA 5FUNA 1CAVA 1DQ2A 2PN5A 2VZPA 1S0GA 4DEVA 3NKGA 1VAKA 2NQYA 3QACA 2YGLA 3LEGA 3H1MA 3MIFA 4XAAA 3IDCB 3L9JT 4AAPA 4FT8A 5SV5A 3MF9A 2B9VA 4X6QB 1UX7A 4Q4X3 4XXPA 3MUZ1 4UI9L 5FO8B 1A34A 1R1A3 1MQTA 1ZA4A 2EIBA 2BP6A 3HEIA 1ZZ7A 3JU9A 3OBTA 1G6NA 2UURA 5FMCA 4AI2A 3I49A 3N9MA 2HWF3 1I6XA 3WG1A 5F1RA 1EV13 3T4HB 5F9TA 4P9GA 4CU6A 2EIGA 3ZN4A 3ZFGB 2FDKA 2CHHA 1UPIA 2A70A 3I7DA 3IN9A 2QQKA 1LNSA 4QKBA 4AEKA 3RYKA 4O61A 1UOJA 5ACA2 3Q8BA 3FBYA 3ASIA 1KFUL 3DPRA 1ZRIA 3AVRA 4L97A 3VBHA 4COYA 1BEV1 3HQUA 5IK5A 4O9GA 2E7QA 4XJZA 4WV8A 4AHWA 2BOJA 2HWB1 3T09A 1EY2A 1XQNA 3WDUA 4BE3A 4N7UA 2JDUA 2RDQA 4AYUA 1I3HA 2PHDA 3O1SA 2XR4A 3U4SA 5IK4A 4H14A 1BEV3 1W6MB 3VL8A 1F15A 3BOPA 4ET7A 4RFT0 3WHUA 2JX9A 3DYMA 2V4AA 3WV6A 1PNGA 3AZVA 4A45A 1HX6A 4Q2FA 2WR9A 1KGYA 2BVBA 1DGWA 2FZ1A 2YV8A 1ENRA 1MZ6A 2FBEA 3HD8B 1VR3A 1TNRA 1US3A 4E27A 4ATFA 4Q0PA 1KXGA 2Y8KA 3PLQA 5FK8A 4META 2D40A 4XUQA 5C8WA 2YMZA 3FWEA 3GZUC 5IAVA 2WS91 4XDQA 1TE1B 1PVC3 2W1UA 5BPXA 5T5PA 1EUTA 1RMU1 3SKVA 3U0ZA 1V9U3 2D6OX 1NCQB 1VBE2 4FPCA 1QJY3 1QOSA 3HN1A 1CAWB 2ES3A 3E5UA 1MR5A 2W87A 1GQHA 2W47A 3S7IA 2WFF1 2IXKA 2VCBA 1IS5A 2QDNA 5FZEA 5CAZA 1MPXA 4MSVA 1W8ZA 3AJYA 3N9NA 4E4DX 3VBRB 1BVP1 5IHRA 3T3YA 1ASJ3 5AC92 1C28A 4NPRA 5AVAA 3AZWA 2WWSA 5CADA 1BBT2 4PIZA 4LPLA 3GYDA 4HFSA 4UT5A 1K12A 4YSFA 3KVAA 4W50A 1BHGA 5J98B 3TN92 1KQRA 4IEYA 5JOYA 2ZGOA 1RUF3 2F4LA 3K3OA 4URTA 5HPOA 3N3HA 1YFUA 1BCXA 4B7EA 1DLCA 4NIDA 1JXNA 1Z7S2 3M3EA 5FKCA 4AF9A 3KT4A 4RQPB 4GMP0 3IB3A 4CSWA 5BNOB 2FZ2A 5IYYA 4AR2A 5BYNA 3POEA 5GLWA 1GWKA 4PT6A 2L9LA 2D98A 1MS5A 2RS31 4QXHA 4DY5A 3H1WA 4QPYA 5E16A 1VBB1 3ZOIA 4ZZ8A 5JZGB 4UF0B 5C5TA 3K75B 1YXWA 2Y6KA 5FLIA 1EAH2 1FNZA 4XZPA 1G9DA 4X8PA 5BV6A 1N1VA 5JI9A 2VOXA 4CU7A 1X8MA 2PHUA 5J1XA 1KEXA 3ZYRA 4EN7B 4FPFA 1YQ6A 5GLVA 1XOYA 1W6NA 1PVC2 2QQVA 4YGCA 4FPJA 5EHDA 2PELA 2FDJA 1GZWB 2J1TA 2VTXA 5KBFA 1SBEA 2VCAA 2ZGSA 3WDYA 2JE8A 3NQHA 4K20A 4N43C 1AXZA 2CSGA 5FZAA 2Q0AA 4XEZA 5KXEA 3IDAA 1RUE1 4XFCA 3FE5A 4IUGA 1ZM1A 4RGGA 3UGGA 3AYAA 1C8M2 3AC0A 5LA0A 4RD7A 5EJ3A 2X53S 4QX2A 2XJPA 1K45A 2ADDA 2Q1MA 2XUEA 5FZDA 3DKQA 4QX5A 1ZZ6A 3KV9A 2XJUA 4LBQB 3ZIXA 3LGRA 4XCAA 3WSOA 5JMOA 4JKMA 1GNYA 3PL0A 3MIBA 3ZFGA 1ULDA 2WYSA 3SH3A 1ZRRA 3ZYIB 5DUUA 4I01A 2D6KA 3LFIA 3G6JB 4LEJA 3UYJA 5FYBA 4D0QA 2LUWA 4NROA 1RUD3 2OX0A 2WKKA 5IWFA 3RYRA 2VVEA 4NWVA 5AFEA 5C3SA 1GOHA 3VKLA 1ZZBA 4URAA 1YNAA 2VC9A 2PQQA 2XQRA 2E53A 3LDKA 5G04L 1TME3 4L9BA 4EZHA 5A6XA 5CKNA 3AP4A 3I8TA 1AJKA 5F3EA 5HV4A 3POBA 4LBKA 4Y26A 4DXTA 4YG0A 5DAPA 5FYIA 5ACA1 5JXJA 4OFGA 3AYEA 3ZFEB 2DTYA 2J7MA 5KC6A 2EXKA 1VBA3 5JIUA 2YB7A 2PLV3 5HCHA 4C0HA 4LORA 3TEYA 1GQPA 1RYYA 4XOGA 1UKRA 1SDDB 1V6IA 2GAUA 4Q0VA 1OT5A 1G86A 4JGZB 2ZGUA 2JDHA 3HWJA 4EWAA 2FMYA 3PUHA 4XURA 1CIYA 4BYYA 3K4ZA 2HJIA 3BCWA 1S0DA 1UY4A 3AFKA 4HOOA 2PHTA 4RGKA 1DFQA 5GM0A 5LK5A 3WDWA 3WDVA 3PUIA 4EJRA 4TZDA 2I45A 4IESA 1W06A 2ADEA 2XKOA 3JQWA 1I5PA 4QPWA 2A6ZA 2DU1A 2A75A 5DUXA 3ZFFB 4UFJA 2ZBJA 3WQ1A 2WZEA 1J58A 2DVAA 5I0UA 4AHZA 4HBNA 4YZ4A 3I2IA 4NHKA 3UT0A 1H2NA 1MS1A 1ZVFA 4Q4W2 3WINE 4Y1XA 4EWDA 2BVVA 1H8VA 3E6CC 5F7UA 3DEMA 4COWA 3VZJA 1JS9A 3AP6A 4A7ZA 3ZIWA 1RUJ1 1WA4A 4C1XA 3CMGA 2ZCWA 1WBLA 4IE7A 4YGDA 2PAMA 5DAXA 2YC2A 5FZ4A 2QQLA 3MPPG 2E7AA 2Z69A 2D7FA 1FATA 1Z7S3 3N35A 4Q0SA 3DYOA 4J1XA 5CNAA 1WD3A 4MLOA 5D8AB 1HW5A 2J42A 5BNPB 1XYPA 3ZDVA 2YROA 2XDVA 2G9FA 3VDAA 4OCTA 4PDWC 5F37A 2LRPA 1OD5A 1O5LA 1PX4A 2R7EB 5LY2A 3IBMA 5BNOA 5FZMA 5HBAA 5JWPA 2JDPA 5FJKA 3LSEA 1KDKA 4YYOA 3APBA 3J9SA 4JVAA 3H9AA 2ZHLA 4DXZA 3BYWA 1N47A 1YC61 2PAKA 4Y1ZA 5T5LA 5BNPC 3RFRA 3OTFA 3JBG2 1STMA 4M4PA 3R6SA 4E9KA 4AVAA 4AL9A 5JMCA 3OUIA 1ENQA 2Q8DA 1IGOA 3RPQA 1PNFA 4P9JA 4CEYB 2VBPA 4UW3A 4CCLA 1ND2A 2WNUC 1U5IA 3RJ2X 1H30A 1QMJA 1OA2A 2PMWB 4FOQA 3O1PA 4MYEA 3CZJA 3GNEA 4XUNA 1RHI3 4GD4A 1NA1B 3AP5A 4CCNA 1GOFA 4PBPA 1WW6A 1VAMA 2R30A 2E33A 3HQRA 4HVQA 1C8NA 3AMNA 4HETA 4LBMA 1OVPA 1OLME 5LRSA 3CU7A 3ZN5A 3H8UA 1SACA 2A73B 3T2PA 5ANNA 2B4KA 3D3AA 2ZTNA 4A42A 4MGYE 3LEKA 1HXS3 3JB4C 4COZA 1ZZ8A 1H6YA 2XLAA 3BGAA 3JUUA 1PZ7A 1U5XA 3D6EA 3NNJA 4XJWA 2XJTA 2HEWF 3B01A 1NLRA 1OOPB 3ZKYA 2AUYA 2VQTA 5FZ6A 3AXEA 1ZA7A 3WP3A 2WN3A 2VUJA 5JI7A 1FV3A 3R4UA 3HT1A 4R9AA 2ZGQA 3KLSA 3VHOA 3WDXA 4AE2A 3W5MA 2ZZJA 1RINA 3ZXJA 1YQ2A 5AFBA 5DUVA 4LULA 4D7SA 4BMBA 1AYM2 1J83A 5L7OA 4W65A 2J1UA 4AVCA 4XBLA 1F4HA 3VKNA 2OIIA 4S2DA 1UIKA 4GA9A 4BH9A 3CHXA 1GP4A 1QXJA 3V65A 1F5JA 4V2WA 5FP9A 2GALA 4BQYA 3GGLA 4UOJA 4E2GA 3GBGA 4FI9A 3VKMA 5A3LA 2BU9A 4EQVA 2A5ZA 4GAZA 1ZBA1 1NE6A 2MHFA 4NMIA 4XC9A 4CEWC 3I3MA 4QB6A 3A22A 2GSYA 3E5XA 2VGDA 1RUD1 1CQ9A 1UU6A 1GZCA 4JGYC 4CU9A 5C71A 2PTMA 1CZTA 3J7NA 2JDKA 1RL3A 3D82A 3Q8FA 1RMU3 3F2ZA 4TN7A 2JKXA 4Q4Y1 4RFRB 5FLHA 1UYPA 3RNSA 2WINB 1CPMA 3AMPA 1S0CA 4KWJA 4KBBA 2EVXA 1DBNA 1Y9QA 4Q0UA 2YU2A 5I0TA 5FFOC 4AFBA 1Q8SA 2ZHKA 2BTVC 2P3JA 2VMDA 4MGKE 3ZN6A 4BK5A 4AW7A 3OEAA 2YUEA 2B8MA 2HEYF 3AJZA 3P1IA 3KV4A 4P08A 1HRV3 4QQLA 4TYSA 4P00B 3ZXGA 2VOVA 4Z2WA 1H9WA 1GZWA 3RVHA 4EN6B 2QJVA 1CONA 3OUHA 4P9LA 3MDPA 5DQ0A 5KHHA 4OQ9A 3SKJE 4AEDA 3WT3A 3IWZA 2YFZA 3BODA 1UPSA 3AFGA 2VZ3A 3MV01 1R083 3BTZA 3ZXLA 5LCWL 4RQPC 4S2HA 5ACA3 4DFSA 3VBFA 4BLJA 2QQJA 1RVF1 5CB7A 2JG8A 3CKHA 4IDZA 3ACFA 2KR2A 5EJ1B 1ZBE1 1PMIA 3CF6E 3LOIA 1W0PA 1DQ0A 1YJLA 2HBTA 1QJU2 1RVF3 5FMDA 3GCWA 3DGTA 2F4PA 2E7TA 5FDBA 3T0DA 3OBZA 4ZY9A 3RMYA 2A1XA 1FAYA 2DFCA 4S2GA 1ZZ9A 1VRBA 2GC0A 2P4EA 1WLDA 4AVTA 4FQZA 3FC0A 1NAEA 5I8TA 4AQ6A 3EXUA 3URFA 1CESA 2ZHNA 3DL3A 4IE5A 5A6QA 1JZ3A 5C3OA 3EBRA 2WSUA 4XE9A 1GP5A 4ASLA 2XWBB 1QQP3 3T0AA 1YUDA 1PZ8A 1WMXA 3N7LA 4G9SB 1LESA 4DINB 1MZ5A 1B35A 4CP9B 3AMMA 3ACLA 3D5OA 4XFIA 1C8M3 1PVXA 2ARCA 1CAXA 2P37A 4WM7B 3ZYFA 4Z8BA 2V4VA 5L9RA 1QQP1 1ST8A 2AC1A 4Y4YA 4LUMA 2W39A 4JC1A 4UW4A 3VN4A 4BDVB 3WXPA 2DUOA 1K5MA 3O7OA 5A3OA 4QX7A 2D6NA 5C3PA 4QM8A 3VDDA 4CCOA 4XDPA 4QKNA 5FR3A 1IG0A 3ZPOA 2P3YA 1EP0A 2OPKA 4Q4X1 2R073 4BQWA 1NA1C 1AR71 4XJAA 1ZREA 1W9WA 4N53C 4AEMA 5KXCA 1EPWA 1FOD2 2JENA 3MIDA 2EXHA 3LIGA 3AK0A 4I0WB 2YPDA 5FAXA 2QDRA 4PF5A 5SV8A 4MXVA 4LA3A 2Z4FA 5F32A 5ABJC 1UAIA 4YW3A 4HG6B 3UKTA 3AXDA 3U1XA 2VNRA 3KF5A 3K48A 4BIOA 4Y4RA 1WMFA 3MO4A 4M3CB 3C7HA 1JBCA 5IAXA 1PM4A 3J7LA 3D8CA 3E1F1 1RUF1 3CJIC 4EE2A 3PMSA 5FP3A 1ZNPA 2E26A 1APNA 2D5HA 4QGMA 1S55A 2WNUB 1V9U1 1GUIA 2NMOA 3PUAA 4AGVA 2HWB3 1SLIA 2WQ8A 1D4M3 3C7EA 1CAUA 1PIV2 3CJIA 2SBAA 1AL0G 2IXJA 2BYVE 4J25A 1POQA 4DUVA 4DO0A 4LOTA 3PTRB 1O4ZA 2ZEWA 3L2HA 5C8CA 5GLUA 3PTYA 4Z07A 1MVQA 1CJPA 5I8SA 1COV3 2CTVA 4C1WA 1K5MB 3WG2A 2HWE1 1I5ZA 1O91A 1QF3A 4LKDA 1YIPA 2J1SA 4CXYA 3FHAA 3PU3A 1O3RA 2R072 4FFFA 4N53A 2BFUS 2K2SA 5LBCA 4OHZA 3QD6A 2D93A 4ASMB 3AP9A 3W21A 2O8QA 4CA9A 3MIEA 1B35B 1V0AA 4P9YA 5GALA 2Y64A 4MGZE 1K5MC 1RUC3 5FUIA 2OUJA 2QZ3A 3BPZA 4XUTA 5LA9A 1FMD3 1VBA1 2W9XA 3X29B 3ILRA 2D6MA 2O0OA 2XQXA 1JYTA 1L7RA 2WNUA 2RMU1 1VBB3 3PDQA 3M3OA 1D0HA 3ZXAC 5JOXA 2Y33A 2QQWA 1QXRA 5FPZA 1B35C 1GZ9A 1POV1 2DUPA 5FQ0A 4HKWA 4Y5SA 1LHWA 2B7YA 2WZR2 3FZ3A 1IPJA 1DQ1A 1HRI2 5IK8A 3VD3A 2AACA 2R042 3GCXA 4XCBA 2V73A 4XF1A 3FLRA 4YVSB 2RHPA 3ACGA 5F3IA 4ZU4A 1V6MA 2D6LX 2DFBA 2PXJA 3QOPA 5H9PA 4PDWA 4KL1A 1QIQA 1WZXA 1SFNA 1VE0A 4KQ7A 3HR9A 4IV3B 3LCPA 1R64A 2ZGMA 2FCTA 4HANA 4P5HA 4PIYA 3WG3A 4DRRA 1RJ8A 5C7GA 3LD8A 1LU1A 1ALYA 1CJDA 2XWJB 4QPGB 1QJU1 3WX5A 1O8PA 1CN1A 2WWUA 3M70A 4Q1PA 5FV3A 4L8QA 3RRDA 1ZBE2 1BYHA 1IPKA 4BJ0A 5KHGA 2E32A 1PX3A 4Q4V3 1JYCA 4Q8LA 4H3WA 5LY1A 2R16A 1JH5A 2ZPXA 1W6QA 5DAWA 4FPEA 2F6BA 3KVBA 3E5QA 1W2TA 5KHIA 3O1RA 5FK7A 1EUUA 3MLKA 5H9SA 5LEJA 2CNAA 5GKAC 1H4HA 2A7AA 3I2OA 4QHBA 2Z2SB 5HXVA 2W92A 5CG8A 4GMP3 5F6KA 2IZWA 2ZS6B 1YEWA 4NAOA 5A7WA 5JPMB 1W2NA 1ZRFA 3CLPA 5F5IA 3ACHA 1CZSA 2AYHA 1FX5A 4BB3A 3S7EA 2BW8A 1HIXA 1OKQA 1DU3D 5A33A 1R081 3EHKA 5C6CA 2FCUA 5I8YA 2VD7A 1FPN2 3AZYA 3NNGA 1UY1A 3HJRA 3NJZA 3J7MA 3WF4A 3KT1A 1NZCA 4LBNA 2B5HA 4CXXA 1FT9A 5J48A 2WO1A 2ZGLA 5DZFA 1AF9A 5F3GA 1RHI1 2AZ5A 2GNDA 1REEA 1ZBE3 2HWC3 3CBNA 4JGYA 5FZIA 3U11A 5K9YA 3CIHA 4PJYA 5C4WC 1S2KA 3S6PA 3PHMA 2IXHA 2GNTA 3BOWA 4XQ4A 5A7WB 3W58A 1TME1 1W6NB 2WUHA 1DYPA 5F39A 5IT6A 4YW5A 2HWC1 2Q30A 4WVVA 4EYUA 4QHZA 1HRI1 4FOWA 4KBZA 5CZKA 3ZFEA 5BXXA 5A7QA 2H0VA 2YC4A 2QCSB 4NHLA 4YGEA 4BQ4A 4KGQA 4M3CF 1XYOA 2AREA 4QHOA 1TQ5A 2XBO2 4P9IA 4MZUA 2XJSA 5LBBA 3I2GA 2AENA 2FCVA 4XJUA 4PHZA 3V0AB 4OMCA 1H2LA 3BU0A 3ST7A 4YZ1A 4HK9A 5L7OC 1AX2A 4LITA 3MFAA 2ET7A 4LKEA 3GM8A 3AP7A 5D8AC 3POIA 4UFIA 1UX6A 1WGPA 4MOAA 5FYCA 3OD0A 1Q56A 4MO3M 4HPKB 1H1IA 2XH6A 3VHRA 1CX4A 1GOGA 2JD4A 5K7PA 2CAUA 4PDWB 4NVPA 1V00A 2VMGA 4RSUA 5FPXA 4L2NA 3B3QE 2ZGNA 1HN1A 1UQXA 2R071 4QKDA 4V2VA 5A7SA 1C5IA 4OUSA 3THPA 4AHYA 1CD3G 1JHJA 2NYYA 5FZ0A 3WW1A 1QU0A 1ULGA 2TEPA 4YM3A 1NZIA 1WA6X 5DG2A 1VBB2 1W9SA 3J8F2 4WVMA 3MW4A 1D7PM 5FQ0B 1LULA 1H0BA 4TSVA 2JIGA 3GHMA 1ULEA 1AYM1 2QTWB 4N9IA 2EAKA 4AG4A 4OQ8A 2E9QA 1BMV2 3KF3A 4GALA 1QKQA 3H42B 2VCMA 3WQ7A 1OF3A 5FYMA 4CCDA 5G05L 2GN3A 3UKNA 4DQAA 2GP5A 3N7MA 2OT7A 1OFNA 5A7PA 4JQRA 4W8JA 1OXCA 3WNPA 2FD8A 4CCJA 1OLRA 2VCCA 4GIQA 5FIXA 3H8OA 2DTWA 5BNPA 3ZSKA 2WNVC 1WW4A 3NV4A 4QGNA 3ZYGA 2G9ZA 3ON7A 1L7LA 3IT8A 1RUI3 4RYDA 2V5DA 1HQLA 3JBG1 5DG1A 3W9AA 2MNGA 1COV1 2RE9A 1XB9A 2GNBA 5JSRA 2WFF2 2LALA 1DGRA 4KG8A 2DURA 2XB6C 3M1HA 1CR7A 3MI8A 3VBSB 3BIEA 4ZU7A 2WNVA 5HCFA 1YHFA 3OPTA 1VBE1 4EN8B 4COUA 2NLRA 2IVIB 2QQUA 1OSGA 4QU1A 3H7JA 1NCRB 2VTXJ 1HQWA 1VBD3 2RG4A 2J1RA 2YGMA 1OLMA 3FUQA 3OUJA 1AL23 4OUMA 4UWDA 3MLJA 3OEBA 5EZWA 4DY3A 5GZGA 4N90A 5HXMA 5J3UA 1JYXA 1XU2A 2C24A 1AXKA 3MV11 3ZYBA 4AI1A 2GH8A 2Y60A 3IKWA 4QKFA 3TYJA 4QX8A 1JHNA 1XSQA 4OHVA 3MEPA 1XNAA 1UCXA 2EIDA 2W95A 3KT7A 4TXWA 5FZOB 3FHQA 2W52A 4Q4V1 2ZJCA 1MEC1 2EF6A 4RGAA 4XQDA 1LHNA 4AVBA 2I2SA 4TTGA 2CYFA 1HDKA 3ZPYA 3FN9A 1O4YA 1MEC3 3AL6A 4QAWA 3VD7A 3VDCA 5A3MA 2YY1A 3BTAA 4AXOA 3I2DA 5FZHA 2ZMLA 3LAGA 1SPPB 5EXOA 3TNQA 2JG9A 4DB5A 3R4SA 3UESA 2XVLA 1DYOA 1TMF2 4IXLA 3RDIA 4CP9A 5IFTA 2OS2A 4CZSA 1GFF2 1XRUA 5JPNB 3O5SA 4NRPA 1K3IA 2Q8OA 2BNNA 5A80A 3WUCA 1QJU3 1RVF2 3WD5A 4A3XA 5ISLA 3FBMA 2DF7A 2W68A 4R9DA 5IVBA 3VGIA 2ZGKA 2VZSA 4MUVA 1AHSA 1S0JA 4OLLA 1BXHA 4FAHA 5CFCC 3VL9A 3J26N 2FMDA 3Q9OA 1N1SA 2O8OA 1MS9A 3OBRA 4JAAA 1AR73 4RHV1 5FLJA 3WVJA 4IE4A 5T5JA 3LQCA 2ZX0A 3CNAA 3ZDSA 1IKPA 1PHMA 2GN7A 3U14A 4U36A 2R49A 2TNFA 4N8MA 1UYYA 4Y5TA 4BWOA 1OQEA 1PK6B 4B4QA 3I2JA 4AWDA 5C4WA 4R52A 5AVPA 3JD71 4LLOA 4QXBA 1MEC2 3PMEA 1R1ZA 2B45X 2TBVA 2J1EA 2WBKA 4L0PA 3SXWA 2YFUA 1HQNA 4FFGA 1LOEA 1AR91 1OF4A 1O6UA 1N1YA 3CQOA 3M2MA 1D0GA 2QE3A 4LK6A 2PHXA 5DABA 4Q4Y2 4CDWC 2CV6A 2YBSA 3T1LA 4DXRA 5BUVA 3KM5A 4LO6B 1W9FA 4Z82A 5FCCA 1S1AA 1NX9A 2DYCA 5FZ8A 3RG0A 1LB2A 2J22A 4YM2A 3UGFA 5KC5A 2RM22 2LROA 4R9BA 2EICA 3WNOA 2JG9B 4NR1A 3KSCA 1WWYA 2MEV1 4LUKA 4QPIB 4XAEA 2D3SA 2DCZA 4F8AA 3BU7A 1O7FA 3MYXA 4XJ9A 3ZR6A 3KCCA 3GBWA 1NUKA 1OC1A 4MVTA 4XVHA 5FZOA 4Y1UA 3THTA 3WY6A 1S0IA 3DXTA 1COV2 1O4TA 2BJSA 4YGBA 5I0SA 1E5SA 1SLAA 5JR7B 1SBDA 5DZEA 2GZWA 3WEZA 2R32A 3AMHA 4XIKA 2JG8B 4JTNA 5ANQA 4ZXKA 5A3WA 3SEEA 1SDWA 3B69A 2XPJA 2BPA2 1S0BA 5LB6A 1EAH1 2BUKA 2XONA 5F6LB 5FZCA 3POJA 3ZMNA 1PIV3 5JCTA 1KS5A 3I59A 3AL5A 1LEDA 2PAEA 1V70A 1VB4A 1W8WA 2HWD3 5DUWA 2XVGA 2EAAA 3DECA 3USUB 5K4LA 1UY3A 2BNOA 1KS4A 1TG7A 1PIV1 4B4RA 1PGL1 1PO23 1QGLA 1O3QA 2ORZA 2WLPA 2WSVA 2RJLA 2ZGPA 4BQ5A 3TEWA 5A3PA 1ND3C 1VRH3 1TZOA 4RR3C 2B9UA 3GALA 2W91A 5FBZA 4JKLA 3B00A 1XNDA 1V6JA 3ETQA 2DVDA 4LBLA 2ZX1A 4KU8A 4ARYA 2AR6A 5C9AB 1QEXA 2WZ8A 4QDSA 5DZGA 2WO2A 3PVEA 2YHJA 2BZDA 4Y22A 4I3GA 3OGVA 4QX1A 2Q8CA 3T0BA 4CCMA 4DZGA 2IXCA 3FHIB 4YZ3A 1QJX2 2RDRA 4A6SA 4LHNA 2FHRA 5L73A 5JOZA 4D94A 2JJ6A 2IWGB 5IVFA 1KD7A 1SLCA 4A41A 4HVOA 4IEZA 4FTSA 1LU2A 2LTNA 2X29A 2VG9A 1NY71 4L11A 3T2OA 5C3QA 4BPZA 1RUOA 2X10A 1UKGA 4R9CA 3EB7A 5FP8A 5FZLA 4GB31 2PHFA 4YZ2A 1OUSA 3TWIA 3VZNA 4P02B 3GZTB 2HH9A 2JB8A 3LPFA 2ZKNA 3LSDA 1W6OA 1XXNA 4GH4B 4LHSA 4WVMB 5FYZA 4D6RA 3V0BA 1N1TA 1TNFA 3JBG3 3N7KA 4GKXA 2E31A 2A3YA 5I0RA 1LOBA 4FFHA 3OGGA 4CDXB 5EYYA 2JICA 1H8TA 3VZKA 3ACIA 1TME2 5FKBA 4PQQA 2MEV2 2CAVA 3AZXA 5FPAA 5C8CC 1UU4A 2UU8A 1IQAA 3DPRC 2QZ2A 3VBHC 5DMYA 5KXBA 3AB0A 2HWB2 5L9BA 2A6WA 1QJEA 2EXIA 1S0FA 3ZSMA 4M0HA 1RUE3 4FFIA 4QXCA 4DPNA 5GJ6A 2W08A 5F5QA 3T30A 4LLFA 2OW4A 3C7FA 1DGRN 2VXJA 3D4KA 3ZXFA 1ZRDA 4Q4W1 1PM7A 1R082 1S2EA 4FPLA 3WF1A 5C3RA 1RUI2 1LHUA 5A6YA 1IZ3A 1WCDJ 4ISQA 3HNYM 2DWRA 2RDSA 1DF0A 5ABJA 2BERA 4QQOA 4BA6A 1TVGA 4P9XA 4QQHA 4AQSA 4XZUG 3RS6A 1E57A 4NN0A 4ASKA 5FOBB 2UWAA 3HOBA 3I59B 5DAQA 4AOCA 4CUGA 2YYOA 1SG3A 2XL9A 1M4WA 5IVEA 1OBNA 3PUSA 3UL2A 5CBLA 1NA1A 5D21A 4BIFA 3MGUA 3OYWA 1GLHA 5JLVA 1J3RA 4XMAA 4YW6A 3VDDC 3LA2A 3AVSA 4XHBA 2WQ4A 1IS6A 1LOCA 4XXAA 1JZ5A 1TEIA 1QH6A 5J09A 3USSA 5BNNA 3B93A 1AXYA 2ZHMA 4ISRA 2V5YA 1F2NA 1ENSA 4A6OA 2JE7A 3H1YA 3PJQA 3RZMA 1GV9A 2LM3A 4AEJA 3O1OA 3QLQA 3DKWA 2I74A 2VE1A 2VMIA 4IETA 4CDQA 2ARAA 4ITCA 2VTFA 1YWKA 1DIWA 3UKVA 5A1LA 4JV4A 4XYXA 4FOYA 1RUH3 1U5ZA 3ZFFC 3H8RA 3POGA 4HVRA 4XFGA 2HWF1 1GMMA 3CO2A 3H50A 4LO4B 3EYPA 4CDUA 4XJ8A 4C0BA 2XJRA 1JZ6A 4Q4V2 3T2TA 3Q8AA 2C4XA 2PFWA 5FXVA 3BTXA 2R043 1C3HA 2P3IA 4NUBA 4TWTA 2JG8C 1AR61 4XACA 4HZFA 1C1LA 4RQPA 5JAXA 2H6BA 3IZOA 4RL7A 4AGRA 1CVNA 1VB2A 1PK6A 2IC1A 4YVWC 1AR82 4CDXA 2K9ZA 4XUOA 4FVVA 4B3NA 1CGPA 4IGPA 3E97A 4ARXA 2BNMA 1SLBA 5KHKA 4HSLA 4W6XA 2WT1A 2G4IA 4AEDC 3KV5A 4I0AA 4MHRA 3C7OA 2YG0A 4K8FA 5FPBA 2WA3A 3TEZA 1QOOA 3PNAA 4UBGA 1VALA 5FZ7A 5ABJB 2WO3A 3VBOC 1QY4A 1LGBA 1REFA 1RTVA 2JECA 5FY1A 1IOAA 1SPPA 2QQMA 3NV1A 1QNYA 4M0NA 2NM1A 4YARA 3MZHA 1POV0 1NKGA 2QBXA 3GZEA 1AX1A 5FYVA 4A2UA 5LZ6A 1W8OA 1W6PB 3WCRA 4MXWA 3IIIA 4AQTA 4JGZC 2JWPA 2FDFA 2PHLA 1Z0HA 2WAAA 5IVJA 3AX4A 2EXJA 4XW3A 5FY4A 4CUBA 1N3QA 4GZ9A 4XETA 1ZZCA 4Y24A 1OOPC 1GWLA 1PO13 3SC7X 1MACA 4WM8A 1W2UA 3O1UA 2BRTA 2QQNA 3C2UA 3JB8A 2HBUA 1WMDA 5FZ1A 1X7NA 1XPWA 1C57A 2E6VA 2E63A 1XNCA 4HLTA 4IEXA 5CFDA 1HV1A 1Y7BA 4XF4A 2IFWA 4CEWA 4DNYA 2NMNA 1Y43B 2H6CA 3I2HA 4OVEA 2W1WA 4OI1A 1UOFA 3KMHA 5FXWA 2XLFA 1H2MA 1G8WA 1W6MA 4J6GA 4LBOA 1J1TA 5FY0A 5JDBA 4JZRA 3NNMA 4XILA 2P6HA 5JR2A 2A3XA 1MS8A 4NIHA 1JI6A 2QQIA 4EN9B 4MXWB 4AFCA 5JZGC 1UZYA 2RMU3 4LBQD 3RJRA 4KI5M 3DPRB 4XABA 2ORXA 3IMMA 4F7ZA 3NKTA 5A1AA 3KQRA 4MGSA 2ZEZA 4XHXA 5FMOS 1XYNA 3VBRA 2MEV3 3N7JA 2LS6A 4CUAA 3O0XA 1JOBA 4QQ2A 4XF0A 2XOMA 4QX3A 2WO7A 2NZ9A 1EPZA 2VW0A 3G7DA 1WCKA 4H2AA 3KD4A 4RHV3 3NWKA 1SFYA 5JUVA 2D44A 4OHXA 1MQTB 2WIIB 1QWRA 4NRMA 1VBE3 5EYXA 4CYDA 2ETEA 2DDUA 1PO12 2XKPA 3NAPC 4CE8A 4XUPA 1ZBA3 2GC2A 4INDA 3H0OA 3ZYHA 5C8CB 4BXFA 1NY72 1CPNA 4CVUA 3FJSA 1ZX5A 1GKBA 1W39A 3LZZA 4NE9A 5A32B 2GMPA 5FP4A 1OPMA 3JD73 4Y33A 3PUQA 2VMEA 5BNQA 2RV9A 2K0GA 1REDA 1QJZA 2UWBA 4LTAA 4P9WA 1ULPA 2FDIA 5CU1A 4NIAA 5HCAA 2ZEYA 4AK3A 1ND2C 4IW3A 1E5RA 2WLQA 2WN2A 3HNMA 4QPGC 2V09A 4WZFA 5FXXA 1JUIA 3I54A 2CY6A 4Y20A 4GULA 3I2KA 5FYYA 4FTEA 3CDZB 4DRVA 2ZABA 5LK7B 1JYIA 1XNKA 1RUNA 1GQGA 3UETA 3BUCA 4OI4A 3I3EA 3R4DB 1ND2B 1X50A 2ZAHA 5HCBA 1CIWA 1LOFC 1T6BX 1HB3A 4MADA 1PGL2 5BNOC 2JIJA 2CWSA 2RVAA 3LWCA 1CAWA 3UV9A 4BQXA 4HPKA 1PGW1 3RI9A 4HONA 1OH4A 1RUF2 4Q0QA 5J37A 4XMIA 4K6BA 2O14A 1RIRA 4N7IA 5IJRA 1OMIA 4QB1A 4QX0A 3VDDB 1WW5A 4FPGA 2P2KA 2TUNA 1YIFA 2RS11 4MH0E 1VMFA 1Q8PA 2C26A 3I4IA 3NW4A 4I3PA 5J7MA 3WQBA 4FPKA 4JDNA 2XBO3 1IS3A 2AEZA 3VBSC 2WNEA 3IAPA 1OPOA 1KJRA 1Q5OA 5JXIA 5CISA 1BK1A 1Q8VA 1WW7A 1OLQA 2RS13 2HYKA 2RJKA 1JZ4A 1JN2P 1J3PA 3SISA 3RSJA 3AYCA 4HXCA 4YM1A 5EJZB 1V6LA 3J4UH 1DQ5A 1F4AA 4KMQA 5L9VA 2AH2A 2WQZC 3LFMA 3R0RA 3HIFA 1VJ2A 4EZ4A 1JYVA 1UY2A 1WMEA 1UIJA 2VOWA 3AKQA 5LATA 2Y6LA 4Y1YA 1A78A 3O1VA 1W9TA 3LF7A 4LO7A 3SLIA 1W0OA 4HKLA 1YRZA 1W28A 5EV7A 3PURA 1IHMA 1YFXA 2ZOEB 2ERFA 2W2IA 4GWMA 3RZJA 3U07A 4UFMA 4AI9A 4CCEA 5E8AA 1W8NA 2IFRA 2J1VA 1C8M1 1AYN2 2KD7A 2QFEA 3JD72 2NN8A 3POFA 1VBA2 5CYYA 4XFFA 3NAPA 4CCKA 3MIGA 4MGIE 4YFZA 3FUOA 4GWNA 4O65A 1RC6A 2W1QA 2VBBA 1J1LA 3TNPB 1LEMA 1F5FA 3ZSEA 4AVSA 3VV1A 1PMHX 4W4ZA 2RS12 2CU5A 1W8TA 3ELNA 3HQXA 5T3NA 1V6NA 3RZKA 1LR5A 5FYUA 3VBRC 5LRRA 2OUHA 3TAYA 1I9RA 3WUDA 3ZFGC 3BN6A 1F31A 2KA3A 2VOTA 4FCAA 1BBT1 1BJQA 1DQ6A 2UY8A 1AZDA 1BZWA 1RXFA 1W6QB 1X9PA 5GZFA 2VVDA 3WF2A 1RUG1 2NP0A 2JDYA 1VBD2 1YYNA 3MBWA 4M3CE 3VUOA 1ENXA 4EWEA 5EFUA 4IEPA 1UU5A 4RR3B 1LGCA 1W8HA 2Z79A 2JB4A 3IDBB 5FMBA 5T54A 2WYFA 2HWD1 3N36A 3MUY1 3EQEA 3NJXA 5CFDB 1DP0A 2O1QA 1GICA 2WC2A 2ZX4A 2JKBA 3NV3A 4UFLA 2SLIA 4QT6A 3A0KA 4Z92B 1SQ4A 4IE6A 1CZVA 3A23A 4N43A 4TLGA 4GH4A 1ASJ1 2KXLA 4AI0A 4PF1A 1HKDA 1Q8QA 1X82A 2WS92
chains in the Genus database with same CATH topology
4RA0A 4QMAA 2XL7A 1ULFA 3O0WA 4WM8C 4WM7C 3MF6A 4XQWA 4AFMA 5T5OA 2ZAAA 4WVWA 1DZTA 1G9BA 3SH4A 3TOJA 1RMU2 3DN7A 3M3CA 5C33A 4XF9A 1UF2C 5GZEA 1VLNA 4OHWA 4XFBA 1NCRC 3WCSA 4IV1C 2XVKA 4CTEA 2ZA9A 3POWA 2CGNA 4YFWA 1ZBA2 3B9IA 3ECQA 4LNVA 1MZEA 3RZZA 1OQDA 4A7KA 4Q1RA 4V1PA 3IPVA 1QDCA 4YG6A 5C9AA 3LA7A 2OVUA 2A6YA 2ZGTA 3INAA 1H2KA 4CP0A 4OI2A 1CAUB 3CJIB 2VH9A 2D3PA 2CL2A 4HN0A 2RR11 4YW1A 1D2SA 4CDXC 1SCSA 3USUA 1BKZA 1AL21 5FMOL 3SCFA 1L3JA 1W6PA 3M4FA 2BQPA 4R4ZA 1D2QA 1QJX3 1YFWA 3WP4A 4E2QA 2PLV1 3VKFC 1QJY2 1DG6A 3NL1A 1IS4A 1D4VB 2ILMA 3MICA 4IEWA 4M3CA 3IDEA 2A6XA 1NXMA 3LA3A 1EV12 3M8LA 3ZXDA 4ES8A 1QJX1 3KCXA 4NWWA 4CDUC 5CVRA 3IIAA 4I02A 4EROA 4QXKA 2UYBA 3ZFFA 1OHFA 4B7KA 3V0AA 5HI0A 4AFDA 3MFCA 1TMF1 4A7YA 1WD4A 4L99A 4FTBA 2R1BA 1DHKB 1FXZA 4XFAA 2YXSA 4YM0A 3K51A 3LB9A 3A4UA 1H9PA 3JCIA 5FOJB 1KITA 3WOGA 3P3NA 2BBVA 2GU9A 3KGLA 3HT2A 2GMMA 1DDLA 2ZX2A 1CAXB 2RS52 4KWLA 4NHMA 1LKNA 3U4XA 4YVSC 4YRDA 2MPFA 4AHXA 4K1YA 1UD1A 2HWF2 2Y26A 4Q29A 4KNCA 1RUD2 4CP2A 3WQ0A 5FO9B 3U10A 1MQTC 4FSJA 1RUH1 1WCSA 1WUVA 1Z78A 4FPYA 5TSWA 1GBGA 3ME2A 4Y5Z0 5CIRA 1G9AA 4UW6A 1OFSA 4YVSA 3HAGA 4COVA 1NLSA 1AR63 3VBUB 2R6QA 2IXLA 3QH7A 3MLLA 4HK8A 2RS32 1SCRA 2PHWA 5GLZA 3H3ZA 1DQ4A 1NYWA 2VU9A 1NXD1 1LHOA 4LR4A 1H8TC 1YCIA 1WLCA 3WDTA 1HRV1 1XU1A 2JDZA 4HSJA 3DV8A 2WJSA 4JTOA 3ZVXA 3MW2A 2XGXA 5IUQA 3PVBB 4FQ4A 1B09A 4XF3A 4IL7A 3NVCA 1RUJ3 1QNWA 4JDOA 2BWCA 5GLTA 1R093 4PBOA 1O3TA 4N9HA 5KHJA 2DV9A 1BBT3 1W6OB 2JE9A 3HBZA 3FFZA 4AI3A 1RUG3 1AR83 3IMNA 1SLLA 2DCJA 1V6OA 4WVZA 1AL22 1FMD1 1SMVA 1VRH1 1KFXL 1X33A 2ARBA 3AZZA 3POSA 2PYTA 4RS5C 3OJBA 2RR12 3TN93 2B42B 3CL1A 4DOUA 3V0BB 3MW3A 3ZX7A 3VZMA 1FV2A 1HXS1 3M7AA 4KGGA 3LOBA 4B4PA 1NQDA 4HKOA 2XG3A 1HRI3 4MV2A 5BY5A 4LO5B 1PO22 1GANA 1QH7A 3RYPA 5B2GB 1RUE2 4KG0A 3UJOA 4SLIA 1AYM3 1DYKA 3FFQA 4IV1A 3SITA 4WBBA 3WHTA 4YZ5A 2ZACA 1BEV2 4IEQA 4AI8A 1RHI2 1R092 3S30A 1PVC1 3ZO0B 3RWNA 3ZSJA 5T52A 1KDMA 4BOWA 3WLUA 3E6BA 3PVOA 3KCYA 1WBFA 2D97A 3AKRA 3O0VA 4UW5A 1HXS2 2VQ0A 2HWE3 4I30A 4WM7A 4XTMA 3FX3A 2H0BA 2D5FA 3WNXA 4ORFA 3ZMOA 4S2FA 1LTEA 1DGLA 1Q43A 2Q4SA 3OGJA 2N7GA 2OA2A 2XJQA 4FPOB 4D7YA 2Y0OA 4M00A 3TBDA 1G9CA 4OI0A 3GBFA 1DGWX 1UMZA 1D4M2 3GF6A 3SNMA 3H3UA 1NCQA 3M3IA 1XE7A 2WT0A 2W0XA 3ENRA 3MIHA 1LECA 3ALQA 3NSTA 1M06G 3AKPA 5AC91 2VVFA 4PIXA 4PQ9A 2XJVA 4H55A 1FYUA 4D3WA 3DF0A 4C90A 4P14A 1LENA 1H1MA 2ZX3A 2X5IC 3UK9A 3M3QA 2BEOA 5JIAA 4QPIA 1FOD1 4KWKA 1AR72 1JUHA 4GMP1 3C3VA 4Z1VA 1YLLA 1RITA 5CFCA 2JXAA 1T6GC 3B7MA 3AMQA 3N4MA 3BB6A 1C4RA 3GZAA 4BZ4A 2OZ6A 4KU7A 2R041 5FREA 1GR3A 4FBFA 3VBHB 4YNIA 4AQ2A 1CAVB 4PLNA 5C4WB 5KWRA 4R8HA 2R0FA 2FQPA 3E6DA 2JG9C 4BCUA 1OA3A 1SEFA 4AGGA 2GDFA 3VBUC 3OF1A 5FO7B 3NAPB 2B46X 3ILNA 3O12A 1RJ7A 4DS0A 4FP3A 1JTZX 2AGSA 2P17A 4EWAA 2XLGA 1JOJA 1YI7A 1ZYBA 1XNBA 1VBC3 3ES1A 2WZPP 1SLTA 1WLWA 1H8TB 4DMIA 5K8SA 2EALA 4HL0A 1MVEA 4SBVA 2HKXA 3OYWB 4UBHA 2C1FA 5K0UA 4QQPA 2RS51 3KGZA 1LODA 1VBC1 1A6CA 1O5UA 1AR92 2BGCA 4CRQA 4ZKTB 3ZXKA 3WR0A 4YW4A 1LRHA 4G4FA 3VBSA 1DZQA 4YLZA 2DCTA 5EWSA 4IEOA 3CEWA 3EO6A 3AKTA 1D4M1 2NPIA 4LE4A 3ROUA 1GNZA 4XIOA 1GNHA 3V56A 1X36A 3WG4A 4I09A 4FPHA 1QJY1 2VULA 3VBOB 1TMF3 1R1A2 3WZ1A 5K0UB 1SBFA 4F83A 4IV3A 2GC1A 4I2OA 3TN91 5T50A 1LOFA 4LT5A 2R062 4Y22B 3QCWA 1S2BA 2QQPA 2QUOA 1FNYA 1U5YA 5CFCB 5C9AC 4W6YA 2PHRA 1EV11 2P34A 4E4SA 4H7LA 2ZGRA 4K3UA 1C5HA 1F9KA 1R091 3IM0A 4O9EA 1NCRA 1RUC1 3TRSB 3WW3A 2D3RA 4WZCA 5I91A 4JCKA 5LEKA 2WNVB 1PO11 1AVBA 1LGNA 3QH6A 4RS5B 3MPBA 2OYZA 2QNKA 1POV3 3BIWE 1H1AA 4OHYA 1YO8A 4HN1A 4CEYC 2RS33 1MS3A 4CEWB 3VHNA 1A8DA 1Q3EA 4HMZA 1C1FA 4LA2A 1OQ1A 4JRAA 4N53B 3VBFC 2R063 2R1DA 3UJQA 4GH4C 4FP2A 1G9FA 4PLOA 2VW1A 4Q26A 5D1IA 4MX3A 3ILFA 2ENRA 5D8AA 3KS7A 1N3OA 1VRH2 4ONUA 5GZDA 1WLTA 4J1WA 3R05A 4GKYA 1MS0A 1J3QA 4LHLA 1O3SA 2KM2A 2UWCA 5DDJ1 1OI6A 4K40A 4L92A 4QD2A 2GC3A 2CGPA 1ONAA 2HWD2 2WL1A 3PJYA 1J59A 2VECA 4IERA 1ZRCA 2ET1A 4Y1VA 3OD4A 4PCRA 1RUG2 5JVVA 3ZFEC 3VZOA 2C0ZA 2ZKLA 4XBNA 4G3YC 1ASJ2 2UYAA 5AC93 1LOAA 3P3PA 1OA4A 1N3PA 2RR13 5CFDC 1R1A1 4IQPA 3WP5A 3FLPA 2UY9A 4NOTA 2BFUL 1BMV1 3T1MA 5J36A 1VBC2 1HRV2 4CEYA 2A6VA 2DUQA 4EN0A 2YZ4A 2D6PA 3A0NA 1V9U2 1VBD1 4ZU5A 5H9QA 2QKDA 3KB5A 1LHVA 1AR81 4JGZA 4C91A 3VLBB 1JW6A 2A3WA 5T55A 4PLMA 4WM8B 2YPJA 1FPN3 1AR93 3ZYJB 5J96B 1AYN1 3ZSLA 1U0AA 4JGYB 4GQ7A 4Q4Y3 4YG3A 5DXDA 4Q8KA 3VBOA 4XBQA 1KRIA 2B39A 4ATEA 3B5LB 2Q5TA 2RM23 2Z5WA 1MS4A 1KJLA 1NG0A 3O14A 4D7TA 1BVVA 2XUMA 1DLLA 4IV3C 1YFYA 3AM2A 4YVWA 1ULCA 4CDWB 2I07B 2BWAA 1AR62 4XTPA 2XBO1 5E88A 1XE8A 1QQP2 3FLTA 2EA7A 2VQAA 5A33B 1FI2A 1VIWB 3KZ4C 4FOVA 4QU2A 5IK7A 2IXIA 4YVWB 1UN1A 4BHPA 2C9AA 3D0SA 5FTTC 4GXLA 1V6KA 1YI9A 4LO8A 4BM8A 1NQJA 3VKOA 2OZJA 1URXA 2Y38A 1AJOA 4EV0A 1LOGA 4I0BA 4TLFA 3SCGA 5K0UC 3SCHA 4JRLA 4CDUB 5A32A 1LCLA 2YC0A 1ND3B 2X8KA 4QPGA 2ATFA 3IPVB 3ZN6B 4OZXA 4JDMA 3ATGA 3VBUA 1PGW2 1RB8G 1H4GA 2C5DA 2WS93 1QOTA 4ES9A 2QVSB 1GYKA 3S0MA 2PLV2 2WFPA 2R0HA 2A71A 3NV2A 4K1ZA 2HEVF 3ZXEA 2WT2A 4QM9A 2DCYA 1GSLA 2VUAA 2WA4A 3CJXA 4GB33 1RUI1 4E2SA 3V64A 3D0JA 1QHDA 3W59A 3SH5A 1NE4A 4K21A 5JSOA 3OCPA 4Q27A 4QPIC 3OY8B 2ARXA 2X5IA 5L36A 1HV0A 5E89A 2Z42A 4Y20B 3VBFB 2DU0A 4FXKB 1HLCA 3DUIA 5L19A 4K7JA 4N43B 1VAVA 5L7OB 3SHRA 4KH9A 2P3KA 2Q1ZB 2RMU2 1Q8OA 1NCQC 2WFF3 4K9SA 2ZZQA 4NO4A 5DDJ3 1PO21 2WZR1 1FMD2 3HMYA 2Y0IA 4IV1B 1RUC2 3GHNA 1F8VA 1VP6A 2GMEA 1RUJ2 1YJKA 3AKSA 2DVFA 4BQ1A 4Q4W3 2WZR3 2HWE2 4F3JA 3H7YA 3VZLA 4GB32 1PZ9A 2VY0A 1FOD3 1OOPA 4D69A 3RMXA 2VNGA 5H9RA 1LJ7A 2VNOA 5JOWA 2R061 1I1EA 4XFHA 2G9GA 2GH2A 5FRAA 5I93A 2GNMA 4AFAA 5CA6A 3VHPA 5KXDA 4CP1A 4HT1T 4BLIA 3FMGA 1Z7S1 1QXPA 2ZMNA 4OULA 3J8F3 2PA7A 3OY8A 5E1RA 3PVNA 1NOVA 3JQXA 3RI8A 1BQPA 3QBQA 3J8F1 3B02A 3JZVA 2CGOA 3WW2A 4FAGA 2VPVA 4LHKA 1UL9A 5GZCA 1A8MA 4QGLA 4W6WA 4M01A 3L2YA 2DVGA 3B9CA 1IKQA 3WW4A 4YW2A 4RR3A 1ND3A 1PK6C 4B8EA 5DDJ2 2VMHA 1Y3TA 1RUH2 4FXGB 5JSPA 1UZZA 4RS5A 3RQ0A 2XHKA 2X5IB 2JEMA 4XPVA 4X8NA 3ES4A 2VXRA 2ZMKA 4CDQB 3BALA 1A3KA 1QDOA 3TB0A 2VOKA 4H7MA 1AYN3 2CWMA 4BMEA 4LE3A 4U2AA 4AVVA 4Q4X2 3NO8A 3SMHA 2D43A 3ZYPA 5BNNB 1EYBA 2VW2A 4FO9A 3LKJA 1AX0A 2HWC2 1PGSA 4CDQC 2RM21 1S0EA 3WP6A 1UW8A 2RS53 2DVBA 1X8EA 2YDEA 1AUYA 5CG9A 4R4XA 4X6RB 4LBQA 1U12A 5BNNC 4IEVA 3AYDA 1RGSA 4RHV2 1EAH3 4LBJA 4AEDB 3B94A 4E4ZA 2DCKA 3POYA 4IEUA 2E51A 3EJKA 4CDWA 4UXAA 1FPN1 1MZFA 3OPZA 1G7YA 1DZRA 1CAVA 1DQ2A 2PN5A 1S0GA 3NKGA 1VAKA 2NQYA 3QACA 2YGLA 3H1MA 3MIFA 3IDCB 3L9JT 4FT8A 5SV5A 3MF9A 4X6QB 4Q4X3 4XXPA 5FO8B 1R1A3 1MQTA 1ZA4A 1ZZ7A 3JU9A 3OBTA 1G6NA 2UURA 4AI2A 2HWF3 1I6XA 3WG1A 5F1RA 1EV13 5F9TA 4P9GA 2EIGA 3ZN4A 3ZFGB 1UPIA 2A70A 3I7DA 3IN9A 4AEKA 3RYKA 5ACA2 3FBYA 3ASIA 1KFUL 3DPRA 4L97A 3VBHA 4COYA 5IK5A 1BEV1 4O9GA 2E7QA 4XJZA 4WV8A 4AHWA 2HWB1 1EY2A 1XQNA 3WDUA 4BE3A 4N7UA 4AYUA 1I3HA 2PHDA 5IK4A 4H14A 1BEV3 1W6MB 3VL8A 3BOPA 4RFT0 3WHUA 2JX9A 3WV6A 1PNGA 3AZVA 1HX6A 4Q2FA 2BVBA 1DGWA 2FZ1A 2YV8A 1ENRA 1MZ6A 2FBEA 3HD8B 1VR3A 1TNRA 4E27A 4ATFA 4Q0PA 1KXGA 3PLQA 4META 2D40A 5C8WA 2YMZA 3FWEA 3GZUC 2WS91 4XDQA 1TE1B 1PVC3 5BPXA 5T5PA 1RMU1 3U0ZA 1V9U3 2D6OX 1NCQB 1VBE2 4FPCA 1QJY3 1QOSA 3HN1A 1CAWB 2ES3A 3E5UA 1MR5A 1GQHA 3S7IA 2WFF1 2IXKA 1IS5A 2QDNA 5CAZA 4MSVA 3AJYA 4E4DX 3VBRB 1BVP1 1ASJ3 5AC92 1C28A 4NPRA 5AVAA 3AZWA 2WWSA 5CADA 1BBT2 4PIZA 3GYDA 4HFSA 4YSFA 5J98B 3TN92 1KQRA 4IEYA 5JOYA 2ZGOA 1RUF3 4URTA 3N3HA 1YFUA 1BCXA 4B7EA 1JXNA 1Z7S2 3M3EA 4AF9A 3KT4A 4RQPB 4GMP0 5BNOB 2FZ2A 5BYNA 5GLWA 2D98A 1MS5A 2RS31 4DY5A 3H1WA 4QPYA 5E16A 1VBB1 5JZGB 1YXWA 5FLIA 1EAH2 1FNZA 4XZPA 1G9DA 4X8PA 5BV6A 1N1VA 5JI9A 2VOXA 1X8MA 2PHUA 4EN7B 3ZYRA 4FPFA 5GLVA 1W6NA 1PVC2 4YGCA 4FPJA 2PELA 1GZWB 5KBFA 1SBEA 2ZGSA 3WDYA 4K20A 4N43C 1AXZA 2Q0AA 4XEZA 5KXEA 1RUE1 4XFCA 3FE5A 1ZM1A 4RGGA 3AYAA 1C8M2 4RD7A 5EJ3A 2X53S 2XJPA 2Q1MA 4QX5A 1ZZ6A 4LBQB 2XJUA 3ZIXA 3LGRA 3MIBA 3ZFGA 1ULDA 3SH3A 1ZRRA 3ZYIB 5DUUA 4I01A 2D6KA 3G6JB 4LEJA 2LUWA 1RUD3 2WKKA 3RYRA 2VVEA 4NWVA 5AFEA 3VKLA 1ZZBA 1YNAA 2PQQA 2E53A 1TME3 4L9BA 3AP4A 3I8TA 1AJKA 4LBKA 4Y26A 4YG0A 5ACA1 4OFGA 3AYEA 3ZFEB 2DTYA 5KC6A 2EXKA 1VBA3 5JIUA 2PLV3 4C0HA 4XOGA 1UKRA 1V6IA 2GAUA 4Q0VA 1G86A 4JGZB 2ZGUA 3HWJA 2FMYA 4BYYA 2HJIA 3BCWA 1S0DA 5GM0A 3AFKA 3WDVA 2PHTA 5LK5A 1DFQA 4TZDA 3WDWA 4EJRA 2I45A 4IESA 2XKOA 3JQWA 2A6ZA 2DU1A 2A75A 5DUXA 3ZFFB 2ZBJA 3WQ1A 1J58A 2DVAA 5I0UA 4AHZA 4HBNA 4YZ4A 4NHKA 1H2NA 1MS1A 1ZVFA 4Q4W2 3WINE 4Y1XA 4EWDA 2BVVA 1H8VA 3E6CC 4COWA 3VZJA 3AP6A 4A7ZA 3ZIWA 1RUJ1 1WA4A 4C1XA 2ZCWA 1WBLA 4YGDA 2PAMA 3MPPG 2E7AA 2Z69A 2D7FA 1FATA 1Z7S3 3N35A 4Q0SA 4J1XA 5CNAA 1WD3A 4MLOA 5D8AB 1HW5A 5BNPB 1XYPA 2YROA 2G9FA 4PDWC 1OD5A 1O5LA 3IBMA 5BNOA 5HBAA 5JWPA 3LSEA 1KDKA 4YYOA 3APBA 3J9SA 4JVAA 3H9AA 2ZHLA 4DXZA 5BNPC 1N47A 2PAKA 4Y1ZA 5T5LA 3OTFA 3JBG2 4E9KA 3R6SA 4AVAA 5JMCA 1ENQA 1IGOA 3RPQA 1PNFA 4P9JA 4CEYB 4UW3A 1ND2A 2WNUC 1U5IA 3RJ2X 1H30A 1QMJA 1OA2A 4FOQA 4MYEA 3GNEA 1RHI3 1NA1B 3AP5A 4PBPA 1WW6A 1VAMA 2R30A 4HVQA 1C8NA 3AMNA 4HETA 4LBMA 5LRSA 3CU7A 3ZN5A 3H8UA 1SACA 2A73B 2ZTNA 4MGYE 1HXS3 3JB4C 4COZA 1ZZ8A 2XLAA 3JUUA 1PZ7A 1U5XA 3D6EA 4XJWA 2XJTA 2HEWF 3B01A 1NLRA 1OOPB 2AUYA 3AXEA 3WP3A 2VUJA 1FV3A 3R4UA 3HT1A 4R9AA 2ZGQA 3KLSA 3VHOA 3WDXA 2ZZJA 1RINA 3ZXJA 5AFBA 5DUVA 4LULA 4D7SA 4BMBA 1AYM2 5L7OA 4W65A 4AVCA 4XBLA 3VKNA 2OIIA 4S2DA 1UIKA 4GA9A 4BH9A 3V65A 1QXJA 1F5JA 2GALA 4E2GA 3GBGA 3VKMA 5A3LA 2A5ZA 1ZBA1 1NE6A 2MHFA 4CEWC 2GSYA 3E5XA 2VGDA 1RUD1 1CQ9A 1UU6A 1GZCA 4JGYC 2PTMA 1RL3A 3D82A 1RMU3 4Q4Y1 5FLHA 3RNSA 2WINB 1CPMA 3AMPA 1S0CA 4KWJA 4KBBA 2EVXA 1DBNA 1Y9QA 4Q0UA 5I0TA 5FFOC 4AFBA 1Q8SA 2ZHKA 2BTVC 2P3JA 4MGKE 3ZN6A 4AW7A 2YUEA 2B8MA 2HEYF 3AJZA 4QQLA 4TYSA 1HRV3 3ZXGA 2VOVA 4Z2WA 1H9WA 1GZWA 4EN6B 2QJVA 1CONA 4P9LA 4AEDA 3MDPA 5KHHA 3WT3A 3IWZA 3BODA 1UPSA 3AFGA 1R083 3ZXLA 4RQPC 4S2HA 5ACA3 4DFSA 3VBFA 4BLJA 1RVF1 5CB7A 2JG8A 1ZBE1 1PMIA 3CF6E 3LOIA 1W0PA 1DQ0A 1YJLA 1QJU2 1RVF3 3DGTA 2F4PA 2E7TA 5FDBA 3RMYA 1FAYA 2DFCA 4S2GA 1ZZ9A 2GC0A 4AVTA 1WLDA 4FQZA 3FC0A 5I8TA 4AQ6A 3EXUA 3URFA 1CESA 2ZHNA 3DL3A 3EBRA 2WSUA 4XE9A 4ASLA 2XWBB 1QQP3 1YUDA 1PZ8A 3N7LA 4G9SB 1LESA 4DINB 1MZ5A 1B35A 3AMMA 3ACLA 3D5OA 4XFIA 1C8M3 1PVXA 2P37A 1CAXA 4WM7B 4Z8BA 1QQP1 4Y4YA 4LUMA 2W39A 4JC1A 4UW4A 3VN4A 3WXPA 2DUOA 1K5MA 3O7OA 2D6NA 4QM8A 3VDDA 1EP0A 2OPKA 4Q4X1 2R073 1NA1C 1AR71 4XJAA 1ZREA 4N53C 4AEMA 5KXCA 1EPWA 1FOD2 2JENA 3MIDA 2EXHA 4I0WB 3AK0A 5FAXA 2QDRA 4PF5A 5SV8A 4MXVA 4LA3A 5ABJC 1UAIA 4YW3A 3UKTA 3AXDA 2VNRA 4BIOA 3K48A 1WMFA 4M3CB 1JBCA 3D8CA 1RUF1 3CJIC 3PMSA 1ZNPA 1APNA 2D5HA 4QGMA 1S55A 2WNUB 1V9U1 2NMOA 4AGVA 2HWB3 1SLIA 1D4M3 1CAUA 1PIV2 3CJIA 2SBAA 1AL0G 2IXJA 2BYVE 5C8CA 1O4ZA 3L2HA 5GLUA 3PTYA 4Z07A 1MVQA 1CJPA 5I8SA 1COV3 2CTVA 4C1WA 1K5MB 3WG2A 2HWE1 1I5ZA 1O91A 1QF3A 1YIPA 1O3RA 2R072 4N53A 2BFUS 2K2SA 4OHZA 3QD6A 2D93A 4ASMB 3AP9A 2O8QA 3MIEA 1B35B 4P9YA 5GALA 4MGZE 1K5MC 1RUC3 2OUJA 2QZ3A 3BPZA 1FMD3 1VBA1 3X29B 3ILRA 2D6MA 2O0OA 2WNUA 2RMU1 1VBB3 3M3OA 1D0HA 3ZXAC 5JOXA 5FPZA 1QXRA 1B35C 1GZ9A 1POV1 2DUPA 5FQ0A 4HKWA 1LHWA 2B7YA 2WZR2 3FZ3A 1IPJA 1DQ1A 1HRI2 5IK8A 2R042 2V73A 4XF1A 3FLRA 4YVSB 2RHPA 4ZU4A 1V6MA 2D6LX 2DFBA 3QOPA 5H9PA 4PDWA 4KL1A 1SFNA 4KQ7A 3HR9A 4IV3B 3LCPA 4HANA 2ZGMA 4P5HA 4PIYA 3WG3A 4DRRA 1RJ8A 1LU1A 1ALYA 1CJDA 2XWJB 4QPGB 1QJU1 3WX5A 1CN1A 3M70A 4Q1PA 5KHGA 4L8QA 3RRDA 1ZBE2 1BYHA 1IPKA 4Q4V3 1JYCA 4Q8LA 4H3WA 2R16A 1JH5A 2ZPXA 1W6QA 4FPEA 2F6BA 5KHIA 3E5QA 5H9SA 3MLKA 5LEJA 2CNAA 5GKAC 1H4HA 2A7AA 4QHBA 2Z2SB 5HXVA 5CG8A 4GMP3 5F6KA 2IZWA 2ZS6B 5JPMB 1ZRFA 3CLPA 2AYHA 1FX5A 3S7EA 2BW8A 1HIXA 1OKQA 1DU3D 5A33A 1R081 3EHKA 5C6CA 5I8YA 1FPN2 3AZYA 3NJZA 3KT1A 1NZCA 4LBNA 2B5HA 5J48A 1FT9A 2ZGLA 5DZFA 1AF9A 1RHI1 2AZ5A 2GNDA 1REEA 1ZBE3 2HWC3 4JGYA 3U11A 5K9YA 4PJYA 5C4WC 1S2KA 3S6PA 3PHMA 2IXHA 2GNTA 3BOWA 4XQ4A 3W58A 1TME1 1W6NB 5IT6A 1DYPA 4YW5A 2HWC1 2Q30A 4WVVA 1HRI1 4FOWA 3ZFEA 5BXXA 2H0VA 2QCSB 4NHLA 4YGEA 4KGQA 4M3CF 1XYOA 2AREA 1TQ5A 2XBO2 4P9IA 4MZUA 2XJSA 2AENA 4XJUA 3V0AB 1H2LA 3ST7A 4YZ1A 4HK9A 5L7OC 1AX2A 3MFAA 2ET7A 3AP7A 5D8AC 1UX6A 1WGPA 3OD0A 1Q56A 4HPKB 1H1IA 2XH6A 3VHRA 1CX4A 2JD4A 5K7PA 2CAUA 4PDWB 4NVPA 1V00A 2VMGA 4RSUA 5FPXA 4L2NA 3B3QE 2ZGNA 2R071 1C5IA 4OUSA 3THPA 4AHYA 1CD3G 2NYYA 3WW1A 1QU0A 1ULGA 2TEPA 4YM3A 5DG2A 1VBB2 3J8F2 4WVMA 3MW4A 5FQ0B 1LULA 1H0BA 4TSVA 3GHMA 1ULEA 1AYM1 4N9IA 2EAKA 4AG4A 2E9QA 1BMV2 4GALA 1QKQA 3WQ7A 3UKNA 2GN3A 4DQAA 3N7MA 1OFNA 4JQRA 1OLRA 4GIQA 2DTWA 5BNPA 3ZSKA 2WNVC 1WW4A 3NV4A 4QGNA 3ZYGA 3IT8A 1RUI3 5DG1A 1HQLA 3JBG1 3W9AA 2MNGA 1COV1 2RE9A 2GNBA 5JSRA 2WFF2 2LALA 1DGRA 4KG8A 2DURA 2XB6C 3M1HA 1CR7A 3MI8A 3VBSB 4ZU7A 2WNVA 5HCFA 1YHFA 1VBE1 4EN8B 4COUA 2NLRA 1OSGA 3H7JA 1NCRB 1HQWA 1VBD3 2YGMA 4OUMA 3FUQA 5EZWA 4DY3A 1AL23 5GZGA 3MLJA 5J3UA 4N90A 1XU2A 1AXKA 4AI1A 2GH8A 3IKWA 3TYJA 1JHNA 4OHVA 3MEPA 1UCXA 3KT7A 2W52A 4Q4V1 2ZJCA 1MEC1