1H0BA

Endoglucanase cel12a from rhodothermus marinus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
226
structure length
226
Chain Sequence
TVELCGRWDARDVAGGRYRVINNVWGAETAQCIEVGLETGNFTITRADHDNGNNVAAYPAIYFGCHWGACTSNSGLPRRVQELSDVRTSWTLTPITTGRWNAAYDIWFSPVTNSGNGYSGGAELMIWLNWNGGVMPGGSRVATVELAGATWEVWYADWDWNYIAYRRTTPTTSVSELDLKAFIDDAVARGYIRPEWYLHAVETGFELWEGGAGLRSADFSVTVQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULASE
publication title The Structure of Rhodothermus Marinus Cel12A, a Highly Thermostable Family 12 Endoglucanase, at 1.8 A Resolution
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
total genus 61
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h0bA00
1XYOA 1UU5A 3VZKA 2VGDA 1TE1B 1AXKA 1REDA 1YNAA 3WY6A 3MF6A 2DCYA 5K9YA 1OLQA 1HIXA 3WR0A 1KS4A 3WP3A 2BWAA 1OLRA 2QZ3A 2DCKA 3HD8B 4H7MA 3VHOA 3VL9A 4NPRA 3VLBB 3VZMA 2JEMA 1C5IA 2BVVA 4IXLA 3AMPA 1HV1A 1KS5A 3M4FA 5K7PA 1UKRA 3AKSA 1IGOA 1XXNA 3VL8A 3WQ7A 1OA4A 3B7MA 2B46X 1XYPA 2C1FA 1H4GA 3AKQA 2DCZA 2VULA 1QH7A 1UU6A 3WQ1A 1H1AA 3WX5A 1REFA 1XNCA 3VHNA 2D97A 2VUJA 3WP6A 2NLRA 1XNKA 3WP5A 1BCXA 3LB9A 1REEA 3AMNA 3AMHA 3AKPA 2B45X 5HXVA 1HV0A 2BW8A 1H4HA 1BVVA 2F6BA 1XNDA 3RI8A 4XQ4A 2B42B 1OA3A 4HKOA 3AMMA 1XNBA 1C5HA 2BWCA 4XQDA 1F5JA 4S2HA 3B5LB 3AMQA 2D98A 3O7OA 2DFCA 3VZLA 3ZSEA 2DCJA 2NQYA 1T6GC 3LGRA 3VGIA 4HKWA 2DFBA 4HK9A 4S2DA 1OA2A 3WQ0A 1H8VA 3RI9A 4HK8A 3WP4A 5EJ3A 1UU4A 3WXPA 3MFAA 3EXUA 1PVXA 1BK1A 4S2FA 3VZJA 3MF9A 1QH6A 3WT3A 2JICA 4HKLA 1ENXA 1XYNA 4XQWA 1H0BA 3AKTA 3VZNA 2QZ2A 3MFCA 2JENA 3AKRA 1W2UA 1M4WA 3VZOA 2Z79A 3VHPA 1NLRA 4S2GA 2VG9A 4XPVA
chains in the Genus database with same CATH superfamily
2D44A 2JDKA 2XJVA 5CFDB 2XKOA 5FQ0A 4R8HA 2QBXA 2Q30A 2RJLA 4JDOA 4JX0A 5FY4A 4AFDA 2FMYA 4LMFA 3I2OA 4IL7A 2YDEA 4K1ZA 3BU0A 4DXSA 4R9BA 5L73A 5F1RA 1DGWX 3CNAA 4QQHA 3AP5A 4YZ4A 2OUHA 3JBG3 3BUCA 1V70A 1DBNA 1PVC1 2H0BA 1LHUA 2P3YA 2VZQA 2WN2A 2YHJA 3JBG2 3KVAA 2PQSA 3KT4A 4GH4A 4QGNA 5FFOC 4BPZA 3AFGA 5FMOS 1KS5A 2A3XA 2ZPXA 4QQLA 4NVPA 5A7WA 1URXA 5T3NA 3O1RA 3A23A 4QHOA 3VBSB 3C7HA 1QOTA 1DCSA 3B7MA 1XYPA 2JG9C 1EUTA 4HXCA 1VBC2 4DNYA 5GZGA 1ST8A 3D82A 4UBGA 1QH7A 4KG8A 3SCFA 1HB1A 3OF1A 3WHTA 2Q8OA 1GSLA 2YMZA 4KBBA 4M3CF 4OQ8A 5FO8B 3NNFA 2DV9A 1TQ5A 4AI9A 5CG9A 5BNOA 2VR4A 1LAJA 2EIGA 2AREA 4IEWA 2IXJA 2Y0IA 4JTNA 4Q0QA 2Z4FA 2WS93 4PDWB 3FHIB 4CE8A 1XU2A 5IJRA 4AEJA 3MPPG 1UOGA 2PLV3 3M8LA 3I3EA 2O0OA 1JZ3A 4Y33A 2WS92 4V1PA 3DGTA 3H1WA 3OCPA 1DYKA 5T50A 5JR2A 5JZGA 1XE0A 4AQSA 2CGOA 1YHFA 1UQXA 2RJ2A 3U10A 3ZPOA 1KD7A 3VD7A 3WF1A 2R072 5C9AA 1O3SA 1RUE2 1ZBA3 2WNVB 4XURA 4HKOA 2NZ9A 4OI4A 5FKCA 4FPGA 1XNBA 3H8XA 3RZJA 5KXDA 2MPFA 4AZZA 2XWJB 4LO7A 4QXCA 4BK4A 1YC61 1W0OA 5C3PA 1VRBA 3NJVA 4DB5A 2JDYA 5FUIA 5L7OC 3ZX7A 4LORA 1BHGA 5FQ0B 3WVJA 2PN5A 4O9GA 2PHUA 3H1YA 4P08A 4CP1A 5C70A 3I2FA 3I2IA 4TN7A 3ZXGA 1KRIA 4YW3A 1UY2A 1N3QA 4ZU7A 1MQTC 3JD73 2DBIA 5GALA 4LHKA 1PGW2 3MIGA 3IKWA 4LQRA 3WXPA 5FWEA 4YW2A 1J83A 3N7KA 4KI5M 4KMQA 2R063 2VAUA 4C1XA 1QNWA 3SEPA 3T0BA 4CDUA 1V6KA 1KQRA 1F4HA 1V6LA 2DF7A 3I3QA 1LEDA 1W8ZA 2R062 3DYOA 3GGLA 3MICA 1W6QB 3VD4A 1UD1A 5C4WB 4RQPA 3KHCA 4D8MA 4JTOA 5B2GB 4GALA 3JCIA 1WCSA 2G19A 1J3RA 1FATA 1U5XA 2ETEA 3SCGA 5FYSA 1NZCA 5IFTA 4F7ZA 1H8TB 4GB32 4YVWC 1PMIA 1BJQA 4WM8C 5LRSA 4YZ1A 3BU7A 4B4QA 1DZRA 2BGOA 5A32B 1O8SA 4RGAA 4YZ3A 2VCAA 3GBGA 2FMDA 4AOCA 4JGYC 2JG8B 1C8M3 3Q8EA 4A3XA 2EVXA 1L7LA 1REDA 5LBBA 1F15A 3WY6A 4XF4A 5C71A 3MI8A 4XILA 4KWUA 4WVWA 2P37A 2DCYA 4AAXA 1POV1 3M3IA 3N9MA 1ZA7A 3DL3A 2ZGTA 3MLLA 4FT8A 5T5PA 2XL7A 5JAXA 4XBNA 4PQ9A 4Q8LA 1SHWB 4C91A 3I3DA 3LDKA 3ZKUA 3DKQA 4MLOA 4Q5OA 1Y9QA 2K9ZA 4IEOA 2RR13 1STMA 4A7KA 5CYYA 1PO23 3M4FA 2RR12 1RUH3 4YVSA 3WDYA 2QDNA 1H2LA 1NXMA 4JAAA 5FZ4A 3I2KA 3RDIA 3WINE 4LEJA 4HONA 4YNIA 3VD9A 2C1FA 1LCLA 4K8RB 1G86A 1NOVA 1NUKA 2ZZJA 4META 1UU6A 4JRAA 1O7FA 3T2PA 2B5HA 2O1QA 2AACA 2VVEA 2D3RA 3ZFFA 3J7NA 2AEZA 1FMD2 3A0KA 3FL7A 4FPYA 2JB4A 4MGZE 3VUOA 1GZWA 2YC4A 1RUC3 2NLRA 3HQUA 2ZJCA 3MV11 4QQ2A 5GM0A 3IIAA 4Q4W3 2BGCA 1CIWA 4CU7A 3AYEA 4CTEA 5BNPC 2Y6JA 2I45A 5GLZA 4XJUA 2CGPA 1VMJA 5GZFA 5FY9A 1CAVB 3PTRB 3T09A 1D4M2 3UETA 3ENRA 2P2KA 2VZSA 2BYVE 2TEPA 4E4ZA 1A78A 5FP4A 3DUIA 4PIXA 5FZIA 4EWDA 5L9BA 3MO4A 4FTSA 1L7RA 1OOPC 1XBFA 4QQOA 3CZUA 4WVZA 4D7SA 1EUUA 1QJEA 4SBVA 1K5MB 4INDA 3B5LB 3E5UA 2XQXA 4HSJA 1LOFC 1EV11 4LPLA 3VDDA 1LHOA 1AX2A 1EY2A 2CSGA 2AR6A 2XONA 3MDPA 4YZ2A 4LLFA 3JXSA 2JDPA 2PHWA 4RGKA 5FZLA 4CCJA 1FAYA 2DFBA 5JWPA 5EYYA 1KEXA 3PIJA 2H6BA 3WP4A 5C9AC 3OBTA 5F3IA 1AR63 1H1MA 1N1TA 4HN1A 1WLDA 2G9FA 4P9JA 3USUA 4YLZA 5DUXA 4JQTA 1Z7S2 1J58A 3C7OA 4R9DA 4AGRA 3MF9A 1AR62 4RA0A 2AUYA 2PYTA 3DV8A 2WZR3 3FFZA 3USSA 2HWF2 4AAPA 2E7QA 5FYYA 4MYEA 2UYBA 1RUD3 2ZTNA 3T0DA 2PFWA 2V5DA 1MEC2 5BNNC 2OVUA 2A6VA 4RHV1 1PK6A 1IKPA 3MW3A 3ZYGA 1A8MA 2VOXA 3CDZB 4K20A 4LLOA 2ZAHA 4LITA 3LD8A 3LIHA 4OFGA 3RG0A 3W21A 2IXCA 5JMOA 3MIHA 5J37A 1MS8A 1SEFA 3HNYM 5L36A 1RMU3 3WF2A 2XBO3 3ZN6B 2PHXA 1PX3A 4NRMA 4CDUC 3VBFA 3FUOA 3GDBA 1RMU2 1GOFA 3K75B 3AP9A 4A45A 4TYSA 4AEDB 4GWNA 3HAGA 4NHXA 3ZXLA 1LENA 4BOWA 5KHGA 2ERFA 2Q0AA 1YFWA 4N53A 1VRH1 3OPTA 2B9UA 1SCSA 2GH8A 5C8CC 4QPIA 1NQJA 3HMYA 4RSUA 3D3AA 3M7AA 3WQBA 1MZFA 1PIV3 5IVFA 4OUMA 1GP5A 3TNQA 4AK3A 2JDAA 3T4VA 1GR3A 5A6YA 2DUQA 3O0VA 4OHWA 5A3MA 4M00A 3DN7A 2RMU1 2Y64A 4MG2A 5I93A 2GNMA 3WG4A 3VL9A 3A22A 5F9TA 3PMSA 2XVLA 1LKNA 1L7QA 1SPPA 2WO3A 4XUQA 4M0NA 1DP0A 3CZJA 1OSGA 3S5QA 1US2A 1UKRA 3ZFEB 1H9PA 2GNTA 4XUPA 3QOPA 1A34A 2UYAA 4MZUA 1RUF1 3RPQA 1FPN1 2ARXA 2WDBA 4KU8A 2RS13 2VXJA 4RGGA 4ZPIA 1CVNA 4K9SA 2GC3A 4P00B 4DRVA 4FAGA 2P3KA 3NL1A 1G9CA 1MS1A 1V00A 3PL0A 4JZRA 4P5HA 5G05L 1IPJA 1LR5A 2A3WA 5DDJ1 5FCCA 1X7NA 4YG6A 4FQ4A 2ZGQA 1I1EA 5FMOL 3KT1A 3OUJA 4LJHA 1WLCA 2VZPA 2BZDA 1PMHX 4IDZA 4ES8A 4DEQA 1AR73 3QCWA 1IS3A 3WDTA 2WNUB 4L8QA 1SQ4A 4D6RA 3AKPA 4MXWA 5E88A 5LBCA 2CYFA 3ZXKA 4CZSA 1PK6B 3FHAA 3J7LA 1GOGA 2YZ4A 1G8WA 3ZMNA 5FZFA 4QQPA 4LBQA 2ZX4A 3W9AA 1DLCA 3TBDA 3WW1A 4G4FA 5HCAA 3ZKYA 4O9EA 3D6EA 4BIOA 5ABJA 1D2SA 1VBB2 2GSYA 1FYUA 4GAZA 2BJSA 3MIDA 3VBFB 3LPGA 4NHLA 1OC1A 3VKLA 4QX2A 4E8DA 2CHHA 4NO4A 1UXZA 3POWA 2WAAA 1QNYA 2PQQA 3K48A 2VNGA 1HXS3 2G9ZA 2B9VA 3KM5A 3ITQA 2IXHA 3HWJA 2HWC3 4GMP1 3RI9A 3ZYPA 1W0PA 2WQ8A 5DUUA 1J3QA 2HWC2 1V0AA 2WQZC 4P02B 3OYWA 5FZ8A 1AR83 3MFAA 2DU0A 1ULGA 2XVKA 2YYOA 1DYPA 4YFWA 2ADDA 1UY1A 2VTXJ 1ZYBA 4P9XA 5BXXA 5EJ1B 4GXLA 2K0GA 2VBDA 2JDMA 3GBWA 1CESA 1UNBA 3ELNA 2WSUA 1W9WA 4CEWC 4Q29A 1ENSA 1JOBA 5DPNA 3WV6A 1MVQA 1SFNA 2XWBB 5AC93 1FOD1 2VMIA 3AKRA 4YW1A 5JCTA 2BQPA 4MGYE 5AC92 2WO2A 1UMHA 2LRPA 2QKDA 3U0ZA 1LOGA 3ST7A 5IATA 5GZDA 2BNNA 4B7EA 4NAMA 5ACA1 3KCCA 4K1YA 1WCUA 4MGKE 2V5YA 2PHDA 3V56A 4GJYA 2MEV2 3KSCA 3P3PA 5EFUA 1HRV1 5FZHA 3BI3A 3I2GA 5E8AA 2ID4A 1NX9A 1OLMA 3KGZA 4ATFA 2XH6A 4LO5B 3MF6A 4LE3A 3DCQA 2WNOA 1JN2P 1ZRRA 4XJ9A 3DPRB 5K0UA 4B7KA 5KWRA 1QOSA 2ZGSA 1VBD3 3MIBA 4Q4V2 3LZZA 5GJ6A 2VVFA 3WF0A 5LY2A 3H42B 4XFIA 1RXFA 2J1EA 5FMBA 3AP4A 1D0HA 4JHTA 1GNZA 3U11A 1IQAA 1A6CA 2UURA 3L9JT 1Z78A 5IHRA 4N53C 4CCKA 4IV3A 4XZUG 1Y3TA 1HV1A 4MUVA 4AHZA 2QQVA 4Q4Y3 3AKSA 4QPIC 2PAMA 3RMYA 5A3TA 5FPUA 1RJ7A 1CAWA 5FKBA 1QJX2 2ZGRA 3OEBA 4FPOB 1OURA 2RE9A 2RS53 1S2KA 1ZNPA 2VOTA 3I2HA 1AJKA 3LAGA 3SH4A 3O1VA 3AYCA 2CGNA 1HRI3 4HPKB 4RYDA 5KR7A 1JHJA 3PNAA 4W8JA 3WOGA 4CXXA 1X8EA 1TMF2 1OQDA 1REFA 1UX6A 2J1RA 3CBNA 4P14A 4JRLA 1JZ2A 3GHMA 5JPMB 3UGFA 5DAVA 4FOYA 1EAH1 4XMIA 4RR3A 2VMFA 1HB2A 1XOYA 3JB8A 3GHNA 2Q8CA 3AMNA 1MS0A 3CJIC 4Y20A 2JD4A 5FPAA 3KD4A 4FFIA 4WM7C 1MZEA 4A6SA 1NCQB 4MGSA 2ARAA 5JOXA 1C3HA 1CAXB 1COV3 4CYDA 1FT9A 4QT6A 2GU9A 3RZLA 2BERA 5IUQA 4QKNA 1DGLA 3POEA 3NJYA 4AL9A 2BFUS 4CDXC 1VBE3 5EWSA 3VBUC 5LK5A 5F8PA 2ZEYA 3TN92 4DEVA 4DY3A 1RXGA 1ZVFA 4BQ5A 1T6GC 3ZFGB 1JYWA 1BBT1 2PMWB 4Y24A 2P4EA 1B09A 1IS4A 1V6IA 4AEMA 2R0FA 4ZXKA 3O1MA 4YGDA 5D8AC 4F3JA 2Q8EA 3RJRA 4L97A 1LGBA 3FE5A 1AJOA 3J8F2 5JOZA 4RS5B 3FHQA 1J1TA 5C8WA 3OY8B 3H1MA 2Y26A 3BYWA 5AVPA 4AGVA 4EQVA 1QH6A 1GICA 5FXVA 3ZSJA 5M0TA 2BOJA 2GP3A 1GYKA 1GWLA 1PO12 2J1SA 4D3WA 2C26A 1GP6A 4EN7B 2C9KA 2O14A 2HWE1 1JYIA 5FOJB 1AHSA 1ULOA 2GH2A 1WKYA 1RYYA 2RDRA 3OGSA 4NAOA 3WDWA 4AVBA 4BXFA 3B69A 2XLFA 4PJYA 5F2WA 4LBKA 2EXHA 2W95A 4TWTA 4NIAA 3O1TA 3V0AA 5FK7A 2QQLA 2F17A 3Q8AA 4Q0UA 5E6HA 3U37A 1YJKA 1L3JA 1SACA 2P6HA 3LQCA 1LHVA 2BU9A 3ZYBA 2QJVA 4EN0A 5L9VA 4EYUA 1IS6A 3K2OA 4CDWB 2R041 3AYDA 1G9DA 3K77A 2PTMA 4QGMA 4BXSV 3BTZA 4HZFA 1TG7A 4FI9A 3ZXFA 5KBFA 4PHZA 2RM21 3UJQA 3IN9A 3O0XA 4DFSA 4XFGA 3MLKA 5FK8A 2VCBA 4QHBA 4CDQB 1NCRA 3OUIA 4KL1A 3PLQA 1GOHA 3D5OA 1ASJ2 4ITCA 1OVSA 2R6QA 2BTVC 2XLGA 3HD8B 4H7MA 4ZXEA 1RHI2 3NV1A 5FZCA 2ZX0A 3HNMA 4OHZA 4NPRA 4NHKA 1NLQA 1LU2A 2GN3A 3ACHA 1C5IA 3NWKA 5FXXA 2RG4A 2ARBA 2XOMA 4GWMA 4J1XA 2F4PA 3SISA 1H2MA 1UY3A 2CY6A 3NKGA 3H0OA 1NQDA 2ZZQA 2D5HA 3LOIA 2ZAAA 1AXZA 2IVIB 1J84A 4B4PA 1W8OA 3NV4A 2VQ0A 4W4ZA 1W9SA 3MW4A 4AVTA 4K8FA 5DG1A 2Q1MA 2VUAA 2EAKA 4L2NA 1DQ6A 2KA3A 4ASKA 3OGVA 1TNRA 4MGTA 1BMV2 5DQ0A 2AEYA 3LOBA 1ND2A 3OBRA 1KFXL 1YQ2A 4IV3C 2V4AA 1DGRN 1W2TA 1XPWA 4JQRA 2WWUA 3WP6A 1B35A 2O8OA 2Z2SB 1U5YA 3JB4C 3NAPB 1ENRA 1ZBE3 4P9IA 5JUVA 2J22A 3AZYA 3AMHA 4IGPA 5D1IA 2Q8DA 2Y6HA 3FN9A 2YXSA 4GQ7A 3T2OA 2JKBA 4AQ6A 2QQPA 2RS31 4IV1A 3E5XA 3QD6A 4AWDA 3LEIA 2VMHA 5FZKA 2WLPA 5CFCC 3LFMA 4PLNA 5F3CA 3KQRA 1V9U2 1JW6A 2OQ6A 3OPWA 1ZZ9A 4I3PA 3BTXA 3V0AB 3ILFA 3N7LA 5A70A 1U12A 4HG6B 3W59A 1RUJ1 3MIFA 4RR3C 5ERLA 1VBA2 3GALA 4I02A 3WNPA 4AYUA 4AI1A 3INAA 1GUIA 3M2MA 1GQGA 3NMBA 1YIFA 1WW4A 4QHZA 4QX7A 3RS6A 1WZXA 1LULA 3ABZA 3IMMA 4K6BA 1BEV3 3SMHA 1W6NB 4C1WA 2ORXA 1Y43B 1BVP1 1CAUB 3N9QA 1BEV2 3HOBA 4M4RA 5JR7B 4D69A 1XE8A 4QU2A 3CL1A 1OVPA 1VJ2A 1RVF3 2GMEA 1OBNA 1DU3D 2OZJA 5CNAA 1GU3A 2XJQA 2O8QA 1CJDA 2VUCA 5LB6A 4ZS3A 2VMEA 4XQWA 1YRZA 3OGJA 3POIA 3MFCA 3UGHA 3K4AA 1MACA 1RITA 1E5SA 3BCWA 5CBLA 4QPGB 1AL23 5DZEA 1RUG3 2EXIA 1UZWA 2X10A 4IGOA 4OHXA 3VBSA 1DZQA 3A7QA 1QY4A 1WCKA 1DDLA 2HJIA 2QUOA 3B3QE 1W3XA 4EROA 3EYPA 2EALA 4K7JA 5ANQA 3I3MA 1AYM3 4CP9B 5F6KA 1ONAA 2P3IA 2WA4A 3BOPA 4XIOA 5JVVA 1YNAA 3VBRB 3FX3A 4TXWA 5H9QA 1R093 2WQ4A 4NHYA 4IETA 4ZKTB 4PDWA 2ZMNA 1YI9A 4R9CA 5K9YA 3CQOA 1GZ9A 4FFGA 2SBAA 1OF3A 2EF6A 4FXKB 1D7PM 4QXHA 3AZWA 1PVC2 3O14A 4AHYA 2BBVA 1OLRA 1I3HA 2YBKA 2OX0A 2JKXA 1JTZX 2FDKA 2XJUA 4FTBA 2WNVA 2HWB1 4D6SA 4EV0A 1PGL1 2BVVA 2E7AA 1XE7A 2ZGKA 3H8UA 3OGGA 2LROA 2ZMKA 4TLGA 3VV1A 1K5JA 4F8AA 3B93A 2J1AA 5GLUA 1QJU3 4JGZC 4XFFA 1R081 1UCXA 2R16A 2X5IB 4G9SB 2PA7A 4Q4X1 4QKBA 2ES3A 1LESA 3DYMA 3T1MA 1TZOA 4N43C 5DAPA 4ISRA 2FCUA 4SLIA 5A3OA 4LKSA 1FV2A 1O6UA 2R7EB 3ES4A 2WT0A 4LHNA 1G6NA 4QDRA 3WX5A 5T5JA 4DRRA 2DVFA 2YV8A 3POYA 3R0RA 2R1DA 4NR1A 4QM8A 3QBQA 2GC2A 2VUJA 1JMUB 2A6YA 4NRQA 4BH9A 2FCTA 2CWSA 2WN3A 2J1UA 2WT2A 2XKPA 3N7MA 4IEPA 1KDKA 3K4ZA 5F5CA 5A1FA 1REEA 5IFPA 4IEUA 1W6QA 5HCHA 5C4WA 5L19A 2W1WA 3B9IA 2B45X 1H1IA 4URTA 3ZIXA 2Y6KA 1H6XA 1W0NA 2GNDA 1SLIA 5FTTC 5F32A 2J7MA 1VBC3 4Y4YA 2QVSB 1QWRA 1H8TA 5FLHA 4KH9A 3K3OA 1W6OB 4JKKA 5CKMA 3WUCA 1JZ6A 4XQDA 3C7EA 1B35C 2FQPA 1I6XA 2BUKA 2VNVA 3PIGA 1ND3C 3CEWA 5A32A 5C3SA 1NA1B 1W8UA 2D98A 5A6ZA 1TEIA 3UESA 2DWRA 2JG8A 2VE1A 3F2ZA 3I97A 4IE4A 2BVBA 1R64A 1MQTB 3ZN4A 2V09A 4HKWA 1YFUA 4XF0A 4BQ4A 2E9QA 4LBMA 1AZDA 1LNSA 1QJY1 5SV5A 2VTXA 3L2HA 3TRSB 5A6XA 2ZKNA 1NXD1 3H8OA 4DINB 1X8MA 2ORZA 2AH2A 1PVXA 1BK1A 1QHDA 2R073 2XMLA 3SKJE 2BFUL 1ZRCA 1POV0 1RUE3 4OYUA 5FPZA 1KDMA 4Y22B 2A73B 4CCMA 2YPDA 3JQWA 2JJ6A 1XYNA 2L9LA 5DAQA 2AC1A 1O8PA 5CFDC 1F4AA 3PUAA 2GDFA 3UNPA 3WEZA 4O65A 5GLTA 4WM8B 4X6RB 2VOWA 4NMIA 3GM8A 5L9RA 4W50A 4EZ4A 3QLQA 3V65A 2VMDA 1K45A 4YFZA 3P3NA 1IQDC 2C9AA 4COWA 3TB0A 1VR3A 2C24A 3NJZA 1HJGA 5FZGA 1UPSA 4FXGB 3WW4A 2ZHKA 5E89A 5JXIA 1YEWA 1POV3 3KVBA 1AUYA 2B4KA 4B8EA 4XABA 4BA6A 5A80A 2VOVA 4K3UA 2VGDA 1TE1B 2FDJA 1PMJX 3D0JA 5FYZA 4W6XA 4FQZA 4E9KA 2LS6A 2XHKA 4B4RA 2DTYA 2YGMA 1KGYA 4QPWA 3AL6A 1CAVA 5LA9A 3VBHC 4GB33 4MADA 3ASIA 4XJWA 1VB2A 3NKTA 3SH5A 4AHXA 4BM8A 2WYFA 3CO2A 4OMDA 5IAVA 1AYN1 2VZVA 2P34A 2FZ2A 4UF0B 4UW3A 1O5UA 1K5MA 1VMFA 3AVSA 3POSA 4H55A 2BGPA 1BYHA 1PGSA 4BE3A 1O4TA 4OHYA 3T30A 1D2QA 1WMEA 5FYUA 5I8SA 2HBUA 2PLV1 2ET1A 3Q9OA 1GFF2 4MVTA 4AF9A 5TSWA 2DCZA 2OQ7A 3VKOA 1EYBA 1UIJA 2E53A 1FNZA 2P5BA 2ZACA 3UJOA 1APNA 2WFF1 2Q5TA 4FP2A 1ZBA1 1Q56A 2G9GA 5DABA 2JX9A 5FPBA 5KXEA 3E6DA 5DUWA 2RV9A 4NPMA 1QU0A 4HOOA 1YI7A 3CKHA 3DXUA 3GYDA 5G04L 4NHMA 4IE5A 4A44A 2VD7A 3LB9A 4QXBA 4E2QA 3V0BB 1O4YA 2PHTA 4H14A 1HV0A 3HEIA 2E6VA 2RDSA 1H4HA 3HVDA 4AXOA 1DFQA 1UZVA 1X9PA 1N47A 2EIEA 1G7YA 3ACLA 4LO8A 3BIWE 3FFQA 4N8MA 2WIIB 1NE4A 4XFBA 4BQWA 3N36A 4N9HA 3JD71 4JDNA 1GNYA 4FP3A 4MX3A 4Q2FA 1F9KA 1EV12 2MHFA 2UWCA 4A42A 4QX1A 3ZN6A 4DIQA 1LGCA 3BTYA 3ZM8A 4WZFA 1FMD3 2R061 3WSOA 4GH4C 3BPSA 4AEDA 5LA1A 2E26A 4BLJA 3MUY1 1S2BA 5C4WC 2IXIA 4OMCA 3V64A 1WCQA 4LIUA 4COVA 4HETA 3PVNA 1OQ1A 4LO4B 4EN9B 3B01A 2DU1A 1H8TC 3WLUA 3FBYA 4EE2A 5EJ3A 5DAXA 1D4M3 3R4SA 3S7EA 1P8JA 3N35A 1RJ8A 2EXKA 3NNJA 5BNNB 4HKLA 3BTAA 2ZKLA 3WDVA 2A5ZA 3WNLA 2RJKA 2MNGA 5A1AA 5BNOC 1JH5A 2ARCA 1AL0G 2WFPA 3OTFA 3R4UA 4Q0SA 1C8M1 3VB9A 2QZ2A 5GKAC 3ZFEA 3GCWA 3IIIA 3R6SA 1X50A 3BODA 3S7IA 4TLFA 5JZGC 1ZRIA 3VHPA 3E6BA 1GZTA 2QQKA 1CQ9A 4CP0A 2EIDA 3W20A 1DYOA 4HVRA 3OUHA 4Y1XA 1CX1A 1VRH2 4DQAA 1Z7S3 3ZN5A 1QXJA 1UMZA 2W52A 4M0HA 2WWSA 5C8CB 5LCWL 3PUSA 4AFBA 1WMDA 2HWF3 4OLLA 1X9TA 1PO21 1Q8VA 5JIUA 1K42A 2XPJA 1RUH1 1T2XA 2C4XA 2DUPA 5EYXA 4CUCA 3GCXA 4E4HA 5IK4A 1MEC3 3OOXA 3URFA 3B9CA 2WNUA 3UKNA 4CU8A 2RMU2 2VMGA 3SH3A 1C57A 2PELA 1QF3A 2GC1A 4FPLA 3IPVB 1GMMA 5IT6A 1BZWA 5A3UA 3KT7A 5I0SA 4CU6A 2YB7A 5FP3A 1WGPA 4LNVA 1UO9A 1WBFA 5F6LB 3GJAA 5DXDA 2NM1A 3VD5A 4CEYB 4ARYA 4IXLA 4YGBA 2AYHA 4UYBA 3WW2A 1UYYA 3E5QA 1RUF2 1NY71 1FPN2 1RUC1 1TVGA 3HT1A 1IGOA 1O3RA 2YBSA 2QQUA 2ZABA 4Q4W1 4R52A 4RQPC 4Q1PA 4F83A 2LM3A 3MIEA 1H9WA 1H4GA 3LEGA 2HYXA 4N90A 5DDJ2 5A33B 3HBZA 1GKBA 5F37A 2WAOA 1SFPA 1AR93 4MXVA 4FOQA 4YG0A 1YWKA 1K5MC 5EZWA 1AR92 4HLTA 5FYTA 4LXLA 1RUI1 1ENQA 4NIDA 1TME1 2J42A 4TSVA 2A6WA 2KM2A 3SITA 1ALYA 4FPEA 4CVUA 3S57A 5CKNA 1VE0A 1E5HA 2X09A 2Y33A 3THTA 1LOBA 2A1XA 2D5FA 4Y1YA 3PJQA 4YZ5A 2VL4A 4JKLA 4YGCA 2D3SA 3RZKA 1DG6A 4MOAA 3VKFC 1GBGA 3U07A 1AR61 3RI8A 2WYSA 1V6MA 3ILNA 4YRDA 5FUNA 2B7YA 3O1SA 3IT8A 1HJFA 5LASA 4Z07A 2UU8A 2VBPA 2BP6A 1YIPA 2WZR1 4DZGA 1W6PB 2UY8A 3MLJA 3ZSEA 4AHWA 2NMNA 3VGIA 1RUD1 4YVSC 3RGBA 1S0JA 4UW5A 1OFSA 3PTYA 5IAXA 3PU8A 5FWJA 3E97A 5LWBA 1JOPA 3DPRA 1KXGA 3OSDA 2CDOA 4AQTA 4B1LA 4DO0A 1LEMA 3N9NA 4OVEA 3V0BA 4FTEA 2E7TA 4Y5SA 4UW6A 4P9LA 1GZCA 3N7JA 4JV4A 4S2FA 2BDRA 1PHMA 1FOD3 4UFMA 3T3YA 2BOIA 4CEWB 2XBO1 5FMDA 5I8TA 5JSPA 3IBMA 4AEDC 5LZ6A 1OT5A 1FOD2 5FPVA 1OPOA 3ZFFC 5D21A 1VBB3 1SCRA 3RYRA 5FBZA 4EN6B 3RWNA 4EWAA 3C7GA 3ZLIA 3OB8A 5FO7B 4XIKA 5A3WA 3ILRA 4XC9A 1S4CA 2Z79A 1PIV1 4ZY9A 4J25A 3THDA 5ACA2 3F95A 3POBA 1OHFA 1NKGA 3IZOA 4AI0A 1NYWA 4HPKA 4S2GA 4ASLA 1HRV2 2CWMA 3N9OA 4BJ0A 2VW2A 2W68A 5J96B 1NLSA 3GZTB 3AZVA 4ZZ5A 2WJSA 3LIGA 4EJRA 2ZEWA 3VKMA 3NNLA 1G9AA 5E16A 5FBJA 3OJBA 3FLTA 3HQRA 1UY4A 2W0XA 2TUNA 3VDDC 2P1BA 3CJXA 1YXWA 3EMRA 2VMCA 1DGWA 5IYYA 1XB9A 5FUPA 4PIYA 1NCQA 2DURA 1CAXA 1CJPA 2RS11 3PUHA 4LUMA 2J1TA 5FYIA 2DCKA 4FOWA 4ZONA 4BWOA 3H3LA 3I59B 1F5FA 5A6QA 2D6PA 4IEXA 2FDFA 2V4VA 5FZOB 5FR3A 2JEMA 1BKZA 4QX3A 2VBBA 1DQ1A 4WZCA 4X8NA 5FRAA 2E51A 3I7DA 4ORFA 2MEV3 4CRQA 2FCVA 1MR5A 1W6MB 2W5FA 2JE9A 1AR71 2IVJA 5EQUA 3ZFGA 1OKOA 4Z8BA 1QDOA 3CU7A 4J1WA 3PVOA 1PK6C 1ZZ8A 2ATFA 3S6PA 4GA9A 4IE6A 4QU1A 4XBLA 1SLAA 4Q4V3 2VO5A 3SHRA 1EAH2 4RS5A 3ZMOA 4TTGA 3OY8A 4YG3A 2QNKA 4EZHA 1SLTA 3CJIB 1Z0HA 4Q0PA 1YQCA 2F4LA 4WM7B 2XJRA 3VBFC 4TZDA 4PF5A 3AJZA 4NIGA 4M01A 4XYXA 1JZ7A 2HYKA 4Q27A 5FAXA 5CG8A 3RSJA 1DGRA 1HXS1 4XHXA 1SMVA 1QJX3 2A70A 2JIGA 4FPJA 1D4VB 1R1A1 2HWC1 4CDXB 5FZ3A 2BV4A 3WZ1A 3VBUB 4MHRA 3KB5A 3ZYJB 3H50A 1BXHA 2B42B 3KHBA 1AF9A 1BBT3 3FBMA 4YM0A 1AR81 4C8DA 4RFRB 1TMF3 3HPNA 3KV9A 1BBT2 1DLLA 3UYJA 3J9SA 1W2OA 5C3QA 3AZZA 4UWDA 5D8AB 4ATEA 4CDWA 2Y6FA 4CCNA 4WBBA 4H3WA 2WZEA 2XJTA 4FVVA 4I30A 3E1F1 5IVYA 2FDHA 1A8DA 5LW9A 1XU1A 4DMIA 1F8VA 1XNAA 2W2IA 3P5BA 4CDQA 5HCFA 3B02A 1CR7A 1LGNA 2G4IA 2LUWA 2K2SA 1LOCA 2LW8A 1F35A 3HJRA 3LA3A 4QB1A 4XETA 1JYXA 2D6LX 5JPNB 3H8RA 3LSEA 2NYYA 2HWE3 4LKFA 2E32A 1SLCA 2ZX2A 5FP7A 3ZXDA 2HWE2 3LSDA 3LCPA 1H0BA 3AKTA 2Y8KA 5LK7B 4N7UA 3TN93 1OMIA 4FSJA 1JBCA 2JENA 4UAPA 5BPXA 1LU1A 1M4WA 2H0VA 1E5RA 2JDUA 3D4KA 3ZDVA 2X05A 3AXEA 1Q8OA 2ZX3A 5C3RA 3WNNA 4OHVA 3TAYA 4W6WA 3PUIA 2PAKA 1VBD1 2W92A 3J8F3 2R042 2QQIA 3WG1A 1LECA 1DF0A 2VY0A 2WINB 3BOWA 3IDBB 2BEOA 5JLVA 3FC0A 4J6GA 4A3ZA 4BQ3A 4C0HA 1CGPA 2RM22 1OF4A 4I3GA 4D7TA 5HV4A 1W2NA 3U75A 1QEXA 1VAKA 1W2AX 5ABJC 1AXYA 4JVAA 3NAPA 4Q4Y1 5KHJA 1O3QA 1PO13 3J7MA 5I0UA 3ZR5A 2N7GA 2WZPP 1MVEA 4DUXA 1IG3A 2IXLA 1JZ8A 1UXXX 2RS51 2XUEA 3TWIA 3WP3A 5FDBA 4XF1A 1EPWA 5JXGA 2ZX1A 1HRI1 1UAIA 2JWPA 4IUGA 1K12A 1AX1A 3MGUA 5EXOA 4HN0A 1CONA 2GP5A 2HLEA 3QH7A 4LE4A 4M3CB 4EN8B 4BMBA 3S30A 4COUA 1W99A 2TBVA 2GZWA 5LBFA 4PBOA 2VZ1A 3MBWA 3DECA 5JOWA 1S0EA 3NNMA 3VL8A 1IPSA 1UY0A 1LHWA 3R4DB 1NCQC 4RL7A 3THPA 4MHUA 3H3ZA 4MGQA 3MZHA 5J36A 4P9GA 1X82A 1COV1 3BALA 3CIHA 1SLBA 4CPBD 4LA2A 1W6NA 1H1AA 4GIQA 1ASJ3 4QMAA 1CAUA 5DUVA 4FCAA 2VU9A 4QXKA 4LBNA 1RHI3 4L99A 3N9PA 4OI2A 3ZYHA 2KXLA 3ZDSA 5FJKA 1VBE1 2RS32 3JZVA 5FZ1A 5GLVA 2XG3A 2HWD1 3ZFGC 2ZXQA 3AM2A 2JE8A 3JQXA 1UYXA 3H7YA 3KF5A 4QPGA 4R4XA 3A21A 2V72A 5K0UC 5AFBA 1RUJ2 1S0CA 2RVAA 5AFEA 4LK6A 3AMMA 3QACA 4QM9A 1QQP3 4LOSA 3NQHA 3EJKA 4NIIA 3MUZ1 3TEXA 2V73A 4DUVA 1N3PA 4CP9A 1QQP2 3RNSA 4LOTA 1C8NA 4PF1A 3OEAA 3LKJA 5IVCA 3SC7X 1S0BA 3LGRA 4M3CE 5APAA 5IK8A 2ZEZA 3VBRA 2RHPA 3LFIA 5FZ9A 2YFZA 4N7IA 2X8KA 1JU3A 1W3VA 4XBQA 1OA2A 4YARA 2C6SA 3T1LA 2IUWA 4D0QA 3LEMA 4UXAA 5T5OA 2YU1A 3VKNA 3IWZA 3VDBA 5FY1A 1UU4A 1V9U3 1HB4A 3KF3A 3OD4A 5FY8A 5CB7A 1J1LA 5K4LA 5IK7A 2WR9A 4BLIA 2ENRA 3AB0A 4C0BA 3LPFA 1HB3A 4KU7A 3WT3A 4ARXA 2VZUA 1S1AA 2JDZA 1LRHA 2QQMA 3VBOB 3NSTA 1VBA3 3VZNA 2VQUA 4QB2A 2X5IA 4XDPA 4YM3A 5JMCA 4CDQC 2WABA 2VJXA 3PVEA 4JHZA 5SV8A 1WUVA 4NE9A 2QFEA 4AW7A 1OUSA 3RVHA 1GWKA 4UFKA 5C3OA 1YYNA 2OW4A 3FWEA 4A2UA 5T5LA 5DMYA 3W5NA 5KC6A 1JYCA 3FUQA 4XXPA 4ZS2A 5F7UA 3SQOA 1JYNA 2YPJA 1XYOA 3J26N 2CU5A 1N1SA 4RN5A 2XLAA 1J3PA 1HW5A 2OIIA 3NW4A 1SBFA 5A1LA 5BUVA 5FOBB 3WHUA 1HIXA 5HV0A 2YBPA 3M70A 3AP6A 4MGIE 4Z1VA 2HWB2 4QB6A 2QZ3A 4U36A 1PGL2 4OZOA 4COZA 3IAPA 3LEKA 4H7LA 4JGZB 4ONUA 3HT2A 4PI2A 3VLBB 3VZMA 3ZVXA 1WA6X 3L2YA 5C5UA 1R082 1W6OA 5I0RA 4P9WA 4Q4X2 1I5ZA 1XC6A 2DDUA 4I01A 4N43B 1NA1A 2Q1ZB 2VM9A 1OKQA 4AI8A 1ZBE1 2ZEXA 4DUWA 1VLNA 1OA4A 4JDMA 2J1VA 4R4ZA 1MQTA 2Y6LA 3LA7A 4XTMA 1JYTA 3I54A 3UV9A 5IK5A 1PVC3 2ET7A 5FY0A 2VC9A 2QDRA 4LT5A 1QJFA 4E2SA 3TEYA 2D97A 3B00A 4UW4A 1HQNA 4BMEA 4BU2A 1UN1A 4Y22A 3K51A 4ZHNA 3H7JA 2JDNA 4W65A 4K21A 3VDCA 4LULA 3FMGA 4FPHA 4KGQA 3EB7A 4WM8A 2JG9B 4ASMB 4UFJA 4ISQA 1NAEA 2ILMA 1VPHA 1NCRC 1ND3B 5FPLA 2ZA9A 1OA3A 1YLLA 4YM1A 3SKVA 5IVJA 2QCSB 1O4ZA 1RVF1 1OXCA 4FO9A 4S2HA 2XUMA 2EXJA 4BDVB 3ZYRA 3ZXJA 1ZZCA 2D40A 2UWBA 2X29A 2ZHNA 4WVMB 2R32A 2DCJA 2YROA 4HL0A 1LTEA 2WKKA 1QJY2 5A3NA 3M3QA 3O5SA 4QPGC 5C33A 1IOAA 3CLPA 3SCHA 1AL21 4WVVA 1RUG1 1XSQA 4HK8A 2VZTA 4OI0A 1Q8QA 1HKDA 5FZDA 3EXUA 3VZJA 1GLHA 1WWYA 1ZA4A 4YW6A 5J48A 4BQ1A 4L9BA 5FV3A 1OQEA 1U5ZA 2E31A 1V6OA 2JICA 3ALQA 3BN6A 5HXMA 1ENXA 1AYM1 2WZ8A 4XFCA 1ND2C 3NJXA 4O61A 4UF0A 5FZ6A 4YPJA 4BK5A 2YC2A 3VBRC 3ZSKA 1BQPA 1W04A 2W3JA 4FFFA 5D2AA 5BV6A 1R091 5L7OB 3N9LA 4RFT0 4XDOA 3ZYFA 4XOGA 4LUKA 5F3EA 2UWAA 4IV1C 1PZ8A 1O59A 2BBAA 4IESA 3AK0A 5LA0A 1YJLA 4KWJA 2VZOA 4UI9L 1H2KA 1V6NA 3WDXA 4A7YA 4DPNA 4D94A 3SXWA 4E2GA 5HPOA 4GJZA 4CUAA 4Q8KA 2Y60A 5BNPA 3ZYIB 5C6CA 2DCTA 2ZBJA 5EJZB 2X5IC 1QJU1 1ZRDA 1DIWA 4GD4A 5CAZA 1R1ZA 3GZAA 3CMGA 4V2WA 2R30A 1Q43A 1YQ5A 3GZUC 3VBHB 5C7GA 1AYN3 2DVGA 1QGLA 2A71A 2BWAA 4YVWB 4PCRA 1OOPA 1AYN2 2GN7A 4XW3A 3U14A 3W5MA 2W1QA 3WNOA 2OPWA 5FLJA 3PMEA 4FFHA 1LOFA 3KV6A 4GKYA 4Z2WA 1WD4A 2I74A 4JGYB 4IE7A 2VCMA 5JI9A 2PAEA 2PLV2 3JBG1 2VH9A 2YFUA 4LIVA 4LO6B 1ZM1A 4XZPA 1T6BX 1WA4A 4KG0A 3WQ7A 5H9SA 2WFF3 3DF0A 3WG2A 2ZHLA 1VALA 1YFYA 4FAHA 3AKQA 1W90A 1JZ5A 2WFF2 2WBKA 1ZBA2 1J59A 3WQ1A 3VBSC 3C2UA 1LB2A 1VBC1 3E6CC 1LOEA 1YUDA 3VHNA 1HLCA 1IKQA 3OPZA 2BRTA 1SDDB 2ZGUA 1OH3A 1NE6A 3FZ3A 1NA1C 5IWFA 5BNNA 3KZ4C 5EP9A 4BQYA 5CISA 2B8MA 3CF6E 3C3VA 1HQWA 4HT1T 2VUDA 2HEVF 3TOJA 4BISA 2Q1FA 3U1XA 1N3OA 5JSOA 1SDWA 2BPA2 4PDWC 3JD72 4KWKA 1QDCA 4QPYA 5CZKA 2A6ZA 4LKDA 2WS91 4Q26A 2YY1A 3AYAA 3JU9A 1XJAA 3KV4A 4OCTA 5FYBA 4QX5A 1WMFA 4GH4B 4XQ4A 4HANA 4JCKA 2EAAA 3OG2A 3GF6A 4MSVA 2R071 4QKDA 3POFA 1XNTA 2XL9A 3SEEA 1RUE1 2IXKA 2VXRA 2WC2A 2TNFA 2WNVC 3ACFA 1TNFA 5C8CA 1IG0A 5A7WB 4OQ9A 2I2SA 1CX4A 2QQNA 1MPXA 1SZBA 2HEYF 1Q3EA 4IEZA 5EV7A 3MPBA 1Q8PA 2D6KA 4NN0A 3THCA 5FZAA 3ZPYA 5BNPB 4S2DA 1MZ6A 1O91A 4DXZA 5A7PA 2C0ZA 3ZSLA 1OPMA 1CZTA 1PX4A 2DBNA 3I8TA 1H6YA 3AVRA 2FDIA 3IPVA 1RB8G 4L11A 4OULA 5BNOB 2ZCWA 1RUNA 3PURA 1MS3A 4P9YA 1OOPB 1HDKA 4D7YA 1QMJA 5FZBA 1C8M2 1PGW1 1EV13 1U5IA 1UF2C 4CEYA 5FZ7A 3RZGA 4EWEA 1LODA 2E63A 2E33A 2IC1A 4I0WB 5JZGB 3M3EA 5EHDA 2HH9A 4LR4A 5F5IA 3BGAA 1WD3A 2JDHA 2XGXA 3G7DA 4CCLA 5FZEA 5C9AB 2R49A 1H30A 1UYZA 1NLRA 3EO6A 2W9XA 2VQAA 2JXAA 4XUNA 2X53S 3ACIA 3RYKA 4YSFA 5A33A 5B4NA 2G1MA 3WD5A 4GB31 1CIYA 3H9AA 3ORJA 4XJZA 1PO22 5LBEA 3M3OA 1VP6A 1RUH2 5FREA 2JECA 3A0NA 5J1XA 1UU5A 3PUQA 2BNOA 1UKGA 1W03A 1WLTA 4RHV3 5IW0A 1JS9A 1RTVA 2ZGPA 3U4SA 1C1LA 1GP4A 3J7HA 2JG8C 4RHV2 4A6OA 4NWVA 4LKEA 2VZ3A 1ZZBA 1OD3A 5FXWA 1GWMA 5J7MA 2PHRA 4N9IA 5HCBA 1KS4A 2IZWA 1VAMA 3ON7A 4NROA 4Y4RA 2W46A 2DYCA 3U78A 2OXBA 1N1VA 2Y0OA 2RDNA 3ES1A 4XCBA 4CDUB 1PM7A 3H3UA 3VHRA 1NY72 1RUC2 2IFWA 2KD7A 3M1HA 1VRH3 3S5AA 1GANA 3K46A 4H2AA 3IB3A 4Q4W2 4RQPB 5BYNA 4ES9A 4I2OA 1YFXA 2XVGA 1W6PA 3OBAA 4HMZA 2RR11 2ZMLA 2D6OX 3GZEA 4NJ4A 3RZMA 3DEMA 1YCIA 4UFLA 2RMU3 4KQ7A 4AGGA 2W47A 1RUI3 4ET7A 3AP7A 2W1SA 5FXZA 1TME3 1DQ0A 4YM2A 4B1MA 2FDGA 2P17A 3RZZA 2HEWF 1S0FA 3D8CA 1RUI2 2XR4A 5H9RA 5I91A 1TME2 2D3PA 4X6QB 4CEWA 2JB8A 5FZMA 4I09A 3SNMA 3GJBA 4JKMA 2B39A 1W8NA 1FMD1 1XNKA 3I4IA 4C90A 3GBFA 4LK7A 4UFHA 2ZGMA 5LA2A 3O1OA 1RUF3 1FPN3 1DZTA 3KMHA 5T52A 3RJ2X 5FMCA 3N3HA 3ATGA 5HXVA 4AR2A 2XHNA 4XE9A 2VTFA 1Y9GA 2BW8A 1W05A 3FJSA 2OKXA 4LBLA 5DZFA 4XF3A 4AFCA 1C28A 5KC5A 5DDJ3 3MW2A 1D4M1 1QKQA 2WZR2 3I2JA 3R05A 4JC1A 3T08A 4QKFA 3KGLA 3KQ4B 3T4HB 3G6JB 4YVSB 1RUD2 3AMQA 5HBAA 4NRPA 4QDQA 3ECQA 5JOYA 2NQYA 2GC0A 4NOTA 4GZ9A 1WW6A 3VDAA 4IQPA 1WBLA 4GMP0 3AL5A 1LOAA 3T2QA 4I0BA 4XUOA 3C8XA 3P6BA 4A41A 3PJYA 1Y4WA 1BK0A 3GNEA 5FY7A 4AVAA 1PZ9A 2QQJA 2XBO2 4Y3OA 1QOOA 3ZFFB 5F5QA 5IVEA 4AFMA 5T54A 4FPKA 4QWNA 3I59A 2XJPA 3RYPA 4BIFA 1GZWB 1V6JA 3RZHA 5FZOA 3Q8FA 2VECA 1RIRA 1ULEA 3TNPB 1Z7S1 3ZXAC 1UOBA 1OI6A 5GLWA 4ZU5A 2HWF1 4Y1VA 1PIV2 1ZX5A 4XMAA 1HN0A 1W6MA 3VZOA 4GMP3 1I9RA 3I49A 4CCCA 1MEC1 2ZHMA 2P6CA 1C1FA 3DYPA 5FPXA 5T55A 3EHKA 3NO8A 2AENA 4KNCA 5KHIA 1AX0A 2ZGNA 1ACCA 3PU3A 5FP8A 4CEYC 3FLRA 4MH0E 4XPVA 1QXRA 3VDDB 1CWPA 1FNYA 4P5YA 3CJIA 4XJAA 5CADA 3VZKA 4Y5Z0 2FHRA 1E5IA 4WM7A 1W9YA 1RMU1 3W58A 5JDBA 3I3BA 2FD8A 5CKQA 3TEZA 4XJ8A 2WO7A 4CCEA 1JZ4A 2RS12 4XFHA 3PDQA 4CCDA 3RFRA 1WMXA 1W28A 1VMHA 3BIEA 4UOJA 2Y6GA 4WV8A 4CCOA 2EICA 3SLIA 1KJLA 2FBEA 3HN1A 3USUB 2PHLA 4IEQA 5ACA3 2Z42A 5KXBA 1FI2A 1W8HA 4CDXA 2W39A 3VBUA 4KBZA 1YO8A 3TEWA 2VCCA 1HRV3 3AX4A 5DAWA 1AR91 3LF7A 4XXAA 1AR72 1DQ4A 2Y34A 1HN1A 1W06A 3Q8CA 5A3PA 2OPKA 5D8AA 4M4PA 5FZ0A 1LHNA 4AI3A 1QJZA 1JHNA 1RC6A 3ZFEC 3WNXA 1W8FA 5FYHA 4RD7A 2KR2A 2OZ6A 3ZO0B 2VNOA 1DQ5A 4N53B 2P3JA 1X33A 1O3TA 1R1A3 1N1YA 4HSLA 4KGGA 4XCAA 4XTPA 4QPIB 1HXS2 3LE0A 4QX8A 2I07B 4BHPA 1R1A2 2Y38A 1GQHA 4XAEA 3WF3A 1W9FA 1BVVA 5FYVA 2WNUC 1AR82 3VD3A 4W6YA 2HKXA 3O1UA 2CAUA 1SPPB 4ZU4A 2WA3A 3EBRA 3KWVA 3UK9A 1SLLA 1EAH3 5EIYB 3BKZA 1GQPA 3UL2A 1VAVA 3AFKA 3LDRA 5KXCA 3O7OA 2Q4SA 3PHMA 3B94A 3AZXA 1VBB1 5FYCA 1F2NA 4XFAA 4XF9A 5AVAA 3T0AA 3IMNA 2A75A 4HK9A 1RL3A 3MYXA 4AVVA 4AVCA 2VQTA 5IVVA 4LA3A 1H2NA 2QTWB 1FX5A 3POJA 4FPFA 2NP0A 1JUIA 2IWGB 5H9PA 2D6NA 3RWKX 4PLOA 1JYVA 2D93A 4E8CA 1JU4A 2HBTA 2ZGOA 4CPBA 5I0DA 2OT7A 4M3CA 4AE2A 2W91A 3BPZA 3DXTA 2YG0A 4LTAA 2VPVA 2DVAA 5LATA 1CN1A 1WLWA 5A3LA 4CXYA 3ZR6A 4MXWB 3WUDA 4G3YC 2W87A 3BB6A 3N4MA 5DN2A 1FXZA 2CAVA 1VBD2 5KHKA 1KFUL 2H6CA 2LALA 2Z69A 2ZOEB 3KS7A 4LBQB 2XDVA 3ACGA 1HX6A 1W39A 2YU2A 4CP2A 3LDBA 5AC91 4FPCA 4LBOA 5A7SA 2DVBA 3AC0A 3ZOIA 4B3NA 5C5TA 5ABJB 1MS4A 4R9AA 5CEHA 4LBJA 4Q4Y2 5FJHA 4AVSA 5CU1A 3HQXA 2ADEA 4YW7A 1AXKA 3UGGA 2PXJA 2ZGLA 2MEV1 3RQ0A 3UKTA 3WW3A 1OUXA 4OI1A 1XQNA 2RS52 2JIJA 4COYA 3TYJA 5CFCA 4LBQD 1ULPA 4XDQA 5A7NA 1YQ6A 1IPKA 1OLQA 1HRI2 4Y26A 1G9BA 2GNBA 4AG4A 4LHLA 1GV9A 3WR0A 5K8SA 4L0PA 3OYWB 4XHBA 1Y9MA 3DPRC 1NT0A 5CIRA 1SFYA 4Q4V1 3OGRA 4HVQA 5BY5A 1CPNA 2R043 2R0HA 1UMIA 5IVBA 2C5DA 3Q8BA 5DG2A 2W94A 2VNRA 2RM23 4AI2A 1KJRA 1OH4A 1PNGA 3OBZA 3BVCA 4U2AA 3IDAA 3WDUA 4CA9A 4Z92B 5JIAA 1POQA 4YW5A 1COV2 2JE7A 3X29B 3O0WA 2A6XA 5EPAA 4DY5A 5JXJA 1YQ8A 3J4UH 1AVBA 1QJX1 5FY5A 2YGLA 1ULFA 1DQ2A 4MV2A 2HWD3 5ANNA 1UZZA 1WW5A 1VBE2 1XNCA 4GWJA 3O1PA 2BNMA 1US3A 2XB6C 1O5LA 5F39A 2HWD2 3IM0A 4PI0A 4QD2A 1TMF1 3AXDA 4E27A 2SLIA 4OUSA 3WP5A 1BCXA 3VBOA 2Z5WA 1S0DA 4ZZ8A 5K0UB 1LJ7A 2LTNA 5J98B 4CUGA 2VZRA 3KLSA 3HNBM 4BCUA 2F6BA 3IAQA 1XNDA 4YW4A 3RMXA 4XACA 3HR9A 3HBKA 2BWCA 1F5JA 4IV3B 1MZ5A 3LWCA 4HFSA 4E4SA 4L92A 3MEPA 1VB4A 2DFCA 3VZLA 4AEKA 4URAA 1UL9A 4YYOA 2FZ1A 2WL1A 4BB3A 3WCSA 1JXNA 1CAWB 1PM4A 2RS33 3AJYA 3TN91 4QX0A 2ZS6B 3ME2A 2GMPA 2UY9A 2CDPA 3KCYA 4Q1RA 4FBFA 3ZXEA 5CFCB 3ETQA 3NV3A 4BYYA 2AGSA 2D43A 4PIZA 4YGEA 1CD3G 2JD9A 4GWIA 5GZEA 1RUJ3 1SG3A 1VIWB 4A4AA 3J8F1 4DXRA 4LHSA 4JGZA 3ETPA 4RR3B 4RS5C 5JXHA 1CZVA 1G9FA 2R1BA 3PVBB 4IE0A 4DOUA 5FO9B 1X36A 4Y20B 3ROUA 4UFIA 4N43A 4DXTA 1Q8SA 2AZ5A 2D7FA 1S0IA 1W8TA 1I5PA 2CV6A 3P1IA 5J3UA 2NMOA 1W2UA 1OLME 1PO11 3HIFA 2IFRA 1SBDA 1XSRA 2YUEA 1UPIA 5CA6A 2GMMA 2DVDA 4AQ2A 1UIKA 2VG9A 4PLMA 4PQQA 4Y5TA 3VN4A 3T2TA 3DKWA 4B29A 1S0GA 3GXUA 1PZ7A 4MO3M 4UBHA 4Z2AA 1GNHA 5ISLA 3UT0A 4NIHA 3NVCA 4NUBA 3KCXA 1SBEA 1MS5A 3ZIWA 2WRAA 3POGA 2WT1A 3HN3A 3NV2A 4FOVA 1UW8A 3O12A 4A7ZA 4PBPA 4NPLA 4CDWC 4CSWA 4IERA 5A7OA 1ZREA 2OS2A 1F31A 1E57A 1ULDA 4QAWA 4Q0VA 2WNEA 2A3YA 2JG9A 3IDCB 3MHZA 3WCRA 4K40A 1IZ3A 2WUHA 4Y1UA 5DZGA 5LEKA 1EP0A 3VHOA 1HQLA 4BQXA 2RDQA 1ND3A 1ASJ1 2VVDA 1UX7A 1Y7BA 5F2SA 5I0TA 1UZYA 5LEJA 1RHI1 1ZBE2 3AMPA 1M06G 4BQ2A 5K7PA 1RGSA 1JI6A 4Z82A 1CPMA 1BLZA 1DHKB 1XXNA 1K3IA 2EA7A 2XJSA 1Q5OA 3D0SA 4QDSA 4WVMA 1NG0A 4XVHA 1OFNA 4BZ4A 2OUJA 2B46X 4OZXA 1UWWA 2PHFA 3IDEA 4CXWA 4OUEA 5A7QA 2VULA 4GULA 2W08A 1WCDJ 3KV5A 5FIXA 3WF4A 2K46A 4CU9A 1IS5A 3I2DA 2HWB3 1JODA 3ZSMA 5LY1A 1RUOA 3A4UA 5FLIA 3WNKA 2QQOA 2CTVA 1QQP1 5CFDA 1BMV1 1XRUA 1JOJA 4IEVA 4X8PA 1R083 3C7FA 4CUBA 2XQRA 4Q4X3 5LRRA 5J09A 1ZZ6A 4YWAA 1EPZA 4NWWA 1NCRB 1IHMA 2D6MA 1CZSA 3NAPC 3JUUA 5L7OA 2GAUA 1QXPA 3OD0A 4I0AA 2WLQA 1ZRFA 1RVF2 2WO1A 5KHHA 5FP9A 1ODNA 5GZCA 1KITA 1MS9A 1V9U1 5BNQA 3FLPA 1C5HA 3WG3A 2NN8A 3K4DA 5E1RA 2DUOA 3K3NA 4UT5A 4IEYA 4PT6A 3VBOC 1U0AA 2XXZA 1C4RA 5I8YA 1RINA 2DTWA 5HI0A 4IW3A 1VBA1 5B4XA 2GALA 1AL22 1ZZ7A 1RUG2 4GKXA 4QGLA 3UKVA 4V2VA 2VOKA 3NNGA 2EIBA 3WQ0A 3QH6A 1A3KA 1H8VA 1NZIA 2QE3A 3VBHA 1OD5A 1S55A 2VW1A 1S2EA 2NPIA 3NRUA 4HBNA 5F5AA 3U4XA 1WW7A 5F3GA 2CL2A 2VW0A 1AYM2 1ND2B 4HVOA 4YVWA 4AFAA 1UYPA 3RRDA 1JUHA 3LA2A 1BEV1 1B35B 1QIQA 4Y1ZA 5JI7A 2OYZA 1UOJA 1UZ0A 2OA2A 1R092 2QQWA 4JGYA 1PNFA 1UOFA 5FYMA 4IV1B 4D6QA 2W1UA 1ULCA 4DS0A 3MV01 4KWLA 3EQEA 2WWJA 1ODMA 1QJY3 1D0GA 2YC0A 4XAAA 3S0MA 4XUTA 1W9TA 5CVRA 1FV3A 2A7AA 2CNAA 3CHXA 4XEZA 3APBA 4E4DX 1W8WA 3M3CA 4IGQA 2WSVA 5JSRA 3WNMA 4O7XA 1QJU2
chains in the Genus database with same CATH topology
2D44A 2XJVA 5CFDB 2XKOA 5FQ0A 4R8HA 2Q30A 2RJLA 4JDOA 4AFDA 2FMYA 4IL7A 2YDEA 4K1ZA 4R9BA 5L73A 5F1RA 1DGWX 3CNAA 4QQHA 3AP5A 4YZ4A 2OUHA 3JBG3 1V70A 1DBNA 1PVC1 2H0BA 1LHUA 2YHJA 3KT4A 4GH4A 4QGNA 3JBG2 5FFOC 4BPZA 3AFGA 5FMOS 1KS5A 2A3XA 2ZPXA 4QQLA 4NVPA 1URXA 5T3NA 3VBSB 1QOTA 3B7MA 1XYPA 2JG9C 5GZGA 1VBC2 4DNYA 3D82A 4UBGA 1QH7A 4KG8A 3SCFA 3OF1A 3WHTA 2Q8OA 1GSLA 2YMZA 4KBBA 4M3CF 5FO8B 2DV9A 1TQ5A 5CG9A 5BNOA 2EIGA 2AREA 4IEWA 2IXJA 2Y0IA 4JTNA 4Q0QA 2WS93 4PDWB 3FHIB 1XU2A 4AEJA 3MPPG 2PLV3 3M8LA 2O0OA 2WS92 4V1PA 3DGTA 3H1WA 3OCPA 1DYKA 5T50A 5JZGA 4AQSA 2CGOA 1YHFA 3U10A 1KD7A 2R072 5C9AA 1O3SA 1RUE2 1ZBA3 2WNVB 4HKOA 2NZ9A 4OI4A 4FPGA 1XNBA 5KXDA 2MPFA 2XWJB 4LO7A 1W0OA 4DB5A 5L7OC 3ZX7A 5FQ0B 3WVJA 2PN5A 4O9GA 2PHUA 3H1YA 4CP1A 3ZXGA 1KRIA 4YW3A 1N3QA 4ZU7A 1MQTC 3JD73 5GALA 4LHKA 1PGW2 3MIGA 3IKWA 3WXPA 4YW2A 3N7KA 2R063 4C1XA 1QNWA 4CDUA 1V6KA 1KQRA 1V6LA 2DF7A 1LEDA 2R062 3MICA 1W6QB 1UD1A 5C4WB 4RQPA 5B2GB 4JTOA 4GALA 3JCIA 1WCSA 1J3RA 1FATA 1U5XA 2ETEA 3SCGA 1NZCA 4F7ZA 1H8TB 4GB32 4YVWC 1PMIA 1BJQA 4WM8C 5LRSA 4YZ1A 3BU7A 4B4QA 1DZRA 5A32B 4RGAA 4YZ3A 3GBGA 2FMDA 4JGYC 2JG8B 1C8M3 4A3XA 2EVXA 1REDA 3WY6A 4XF4A 3MI8A 4XILA 4WVWA 2P37A 2DCYA 1POV1 3M3IA 3DL3A 2ZGTA 3MLLA 4FT8A 5T5PA 2XL7A 5JAXA 4XBNA 4PQ9A 4Q8LA 4C91A 4MLOA 1Y9QA 2K9ZA 4IEOA 2RR13 4A7KA 1PO23 3M4FA 2RR12 1RUH3 4YVSA 3WDYA 2QDNA 1H2LA 1NXMA 4JAAA 3RDIA 3WINE 4LEJA 4YNIA 2C1FA 1LCLA 1G86A 1NOVA 2ZZJA 4META 1UU6A 4JRAA 1O7FA 2B5HA 2O1QA 2VVEA 2D3RA 3ZFFA 1FMD2 3A0KA 4FPYA 3VUOA 4MGZE 1GZWA 1RUC3 2NLRA 2ZJCA 4QQ2A 5GM0A 3IIAA 4Q4W3 2BGCA 1CIWA 3AYEA 4CTEA 5BNPC 2I45A 5GLZA 4XJUA 2CGPA 5GZFA 1CAVB 1D4M2 3ENRA 2P2KA 2BYVE 2TEPA 4E4ZA 1A78A 3DUIA 4PIXA 4EWDA 4FTSA 1OOPC 4WVZA 4QQOA 4D7SA 4SBVA 1K5MB 4INDA 3B5LB 3E5UA 4HSJA 1LOFC 1EV11 3VDDA 1LHOA 1AX2A 1EY2A 2AR6A 4YZ2A 3MDPA 4LLFA 2PHWA 1FAYA 2DFBA 5JWPA 5EYYA 2H6BA 3WP4A 5C9AC 3OBTA 1AR63 1H1MA 1N1TA 4HN1A 1WLDA 2G9FA 4P9JA 3USUA 4YLZA 5DUXA 1Z7S2 1J58A 4R9DA 4AGRA 1AR62 3MF9A 4RA0A 2AUYA 2PYTA 3DV8A 2WZR3 3FFZA 3USSA 2HWF2 2E7QA 4MYEA 2UYBA 1RUD3 2ZTNA 2PFWA 1MEC2 5BNNC 2OVUA 2A6VA 4RHV1 1PK6A 1IKPA 3MW3A 3ZYGA 1A8MA 2VOXA 4LLOA 4K20A 4OFGA 2ZAHA 3RG0A 3V0BB 5J37A 2IXCA 3MIHA 1MS8A 1SEFA 5L36A 1RMU3 2XBO3 3ZN6B 2PHXA 4CDUC 3VBFA 3FUOA 1RMU2 3AP9A 4AEDB 4TYSA 4GWNA 3HAGA 3ZXLA 4BOWA 1LENA 5KHGA 2ERFA 2Q0AA 1YFWA 4N53A 1VRH1 2B9UA 1SCSA 2GH8A 5C8CC 4QPIA 1NQJA 3HMYA 4RSUA 3M7AA 1MZFA 1PIV3 4OUMA 3TNQA 4AK3A 1GR3A 2DUQA 3O0VA 4OHWA 5A3MA 4M00A 3DN7A 2RMU1 5I93A 2GNMA 3WG4A 3VL9A 5F9TA 3PMSA 2XVLA 1LKNA 4M0NA 1OSGA 1UKRA 3ZFEB 1H9PA 2GNTA 3QOPA 2UYAA 4MZUA 1RUF1 3RPQA 1FPN1 2ARXA 4KU8A 2RS13 4RGGA 1CVNA 4K9SA 2GC3A 4DRVA 4FAGA 2P3KA 3NL1A 1G9CA 1MS1A 1V00A 4P5HA 1IPJA 1LR5A 2A3WA 5DDJ1 5FCCA 1X7NA 4YG6A 4FQ4A 2ZGQA 1I1EA 5FMOL 3KT1A 1WLCA 4ES8A 1AR73 3QCWA 1IS3A 3WDTA 2WNUB 4L8QA 1SQ4A 3AKPA 4MXWA 5E88A 2CYFA 3ZXKA 4CZSA 1PK6B 2YZ4A 1G8WA 3ZMNA 4QQPA 4LBQA 2ZX4A 3W9AA 3TBDA 3WW1A 4G4FA 5HCAA 4O9EA 3D6EA 4BIOA 5ABJA 1D2SA 1VBB2 2GSYA 1FYUA 3MIDA 3VBFB 4NHLA 3VKLA 4NO4A 3POWA 1QNYA 2PQQA 3K48A 2VNGA 1HXS3 3KM5A 2IXHA 3HWJA 2HWC3 4GMP1 3RI9A 3ZYPA 1W0PA 5DUUA 1J3QA 2HWC2 2WQZC 3OYWA 1AR83 3MFAA 2DU0A 1ULGA 2XVKA 2YYOA 1DYPA 4YFWA 1ZYBA 4P9XA 5BXXA 4GXLA 2K0GA 3GBWA 1CESA 3ELNA 2WSUA 4CEWC 4Q29A 1ENSA 3WV6A 5AC93 2XWBB 1MVQA 1SFNA 1FOD1 2VMIA 3AKRA 4YW1A 5JCTA 2BQPA 4MGYE 5AC92 2QKDA 3U0ZA 1LOGA 3ST7A 5GZDA 2BNNA 4B7EA 5ACA1 3KCCA 4K1YA 4MGKE 2V5YA 2PHDA 3V56A 2MEV2 3KSCA 3P3PA 5EFUA 1HRV1 5E8AA 3KGZA 4ATFA 2XH6A 4LO5B 3MF6A 4LE3A 1JN2P 1ZRRA 4XJ9A 3DPRB 5K0UA 4B7KA 5KWRA 1QOSA 2ZGSA 1VBD3 3MIBA 4Q4V2 3LZZA 5GJ6A 2VVFA 4XFIA 3AP4A 1D0HA 1GNZA 3U11A 1IQAA 1A6CA 2UURA 3L9JT 1Z78A 4N53C 4IV3A 1Y3TA 1HV1A 4MUVA 4AHZA 4Q4Y3 3AKSA 4QPIC 2PAMA 3RMYA 1RJ7A 1CAWA 3RYKA 1QJX2 2ZGRA 4FPOB 4ASMB 2RS53 2RE9A 3LAGA 1S2KA 1ZNPA 3SH4A 1AJKA 3AYCA 2CGNA 1HRI3 4HPKB 3PNAA 3WOGA 1X8EA 1TMF2 1OQDA 1REFA 1UX6A 4P14A 4JRLA 3GHMA 5JPMB 4FOYA 1EAH1 4XMIA 4RR3A 3JB8A 3GHNA 3AMNA 1MS0A 3CJIC 4Y20A 2JD4A 3KD4A 4WM7C 1MZEA 1NCQB 5JOXA 1C3HA 1CAXB 1COV3 4CYDA 1FT9A 4QT6A 2GU9A 5IUQA 1DGLA 2BFUS 4CDXC 1VBE3 5EWSA 3VBUC 5LK5A 3TN92 4DY3A 1ZVFA 1T6GC 3ZFGB 1BBT1 4Y24A 4AEMA 1B09A 1IS4A 1V6IA 2R0FA 4ZXKA 4YGDA 5D8AC 4F3JA 3RJRA 4L97A 1LGBA 3FE5A 1AJOA 3J8F2 5JOZA 4RS5B 1J1TA 5C8WA 3OY8B 3H1MA 2Y26A 5AVPA 4AGVA 1QH6A 1GICA 3ZSJA 1GYKA 1PO12 4D3WA 4EN7B 2HWE1 1JYIA 5FOJB 1AHSA 2GH2A 4AVBA 3WDWA 3B69A 2XLFA 4PJYA 4LBKA 2EXHA 4TWTA 3V0AA 4Q0UA 1YJKA 1L3JA 1SACA 1LHVA 2QJVA 4EN0A 1IS6A 4CDWB 2R041 3AYDA 1G9DA 2PTMA 4QGMA 4HZFA 3ZXFA 5KBFA 2RM21 3UJQA 3IN9A 3O0XA 4DFSA 4XFGA 3MLKA 4CDQB 4QHBA 1NCRA 4KL1A 3PLQA 3D5OA 1ASJ2 4ITCA 2R6QA 2BTVC 2XLGA 3HD8B 4H7MA 1RHI2 3NV1A 2ZX0A 4OHZA 4NPRA 4NHKA 1LU2A 2GN3A 1C5IA 3NWKA 2ARBA 4GWMA 4J1XA 2F4PA 3SISA 1H2MA 2CY6A 3NKGA 3H0OA 1NQDA 2ZZQA 2D5HA 3LOIA 2ZAAA 1AXZA 4B4PA 3NV4A 2VQ0A 3MW4A 4AVTA 4K8FA 5DG1A 2Q1MA 2VUAA 2EAKA 4L2NA 1DQ6A 2KA3A 1TNRA 1BMV2 3LOBA 1ND2A 3OBRA 1KFXL 4IV3C 1DGRN 4JQRA 3WP6A 1B35A 2O8OA 2Z2SB 1U5YA 3JB4C 3NAPB 1ENRA 1ZBE3 4P9IA 3AZYA 3AMHA 5D1IA 2YXSA 4GQ7A 4AQ6A 2JKBA 2QQPA 2RS31 4IV1A 3E5XA 3QD6A 4AWDA 2VMHA 2WLPA 5CFCC 4PLNA 3KQRA 1V9U2 1JW6A 4I3PA 1ZZ9A 3V0AB 3ILFA 3N7LA 1U12A 3W59A 1RUJ1 3MIFA 4RR3C 1VBA2 3GALA 4I02A 4AYUA 4AI1A 3INAA 3M2MA 1GQGA 1YIFA 1WW4A 3RS6A 1LULA 4K6BA 1BEV3 3SMHA 1W6NB 4C1WA 5JR7B 1Y43B 1BVP1 1CAUB 1BEV2 4D69A 1XE8A 4QU2A 3CL1A 1VJ2A 1RVF3 2GMEA 2OZJA 1DU3D 5CNAA 2XJQA 2O8QA 1CJDA 4XQWA 1YRZA 3OGJA 3MFCA 1MACA 1RITA 5CBLA 3BCWA 4QPGB 1AL23 5DZEA 1RUG3 2EXIA 4OHXA 3VBSA 1DZQA 1QY4A 1WCKA 1DDLA 2HJIA 2QUOA 3B3QE 4EROA 4K7JA 2EALA 1AYM3 5F6KA 1ONAA 2P3IA 2WA4A 3BOPA 4XIOA 5JVVA 1YNAA 3VBRB 3FX3A 5H9QA 1R093 2WQ4A 4ZKTB 4IETA 4PDWA 2ZMNA 1YI9A 4R9CA 5K9YA 1GZ9A 2SBAA 2EF6A 4FXKB 3AZWA 1PVC2 3O14A 4AHYA 2BBVA 1OLRA 1I3HA 1JTZX 2XJUA 4FTBA 2WNVA 2HWB1 4EV0A 1PGL1 2BVVA 2E7AA 1XE7A 2ZGKA 3H8UA 3OGGA 3VV1A 2ZMKA 4F8AA 3B93A 5GLUA 1QJU3 4JGZC 4XFFA 1R081 1UCXA 2R16A 2X5IB 4G9SB 2PA7A 4Q4X1 2ES3A 1LESA 3T1MA 4N43C 4ISRA 4SLIA 1FV2A 3ES4A 2WT0A 4LHNA 1G6NA 3WX5A 5T5JA 4DRRA 2DVFA 2YV8A 3POYA 3R0RA 2R1DA 4NR1A 4QM8A 3QBQA 2GC2A 2VUJA 2A6YA 4BH9A 2CWSA 2WT2A 2XKPA 3N7MA 4IEPA 1KDKA 1REEA 4IEUA 1W6QA 5C4WA 5L19A 3B9IA 2B45X 1H1IA 4URTA 3ZIXA 2GNDA 1SLIA 5FTTC 1VBC3 4Y4YA 2QVSB 1QWRA 1H8TA 5FLHA 4KH9A 3WUCA 1W6OB 4XQDA 1B35C 2FQPA 1I6XA 2BUKA 5A32A 1ND3C 3CEWA 1NA1B 2D98A 1TEIA 2DWRA 2JG8A 2BVBA 1MQTB 3ZN4A 2V09A 4HKWA 1YFUA 4XF0A 2E9QA 4LBMA 1AZDA 1QJY1 5SV5A 3L2HA 3TRSB 2ZKNA 1NXD1 4DINB 1X8MA 2AH2A 1PVXA 2R073 1BK1A 1QHDA 1ZRCA 2BFUL 1POV0 1RUE3 5FPZA 1KDMA 4Y22B 2A73B 3JQWA 2JJ6A 1XYNA 5CFDC 2GDFA 5GLTA 4WM8B 4X6RB 2VOWA 3QLQA 3V65A 4YFZA 3P3NA 2C9AA 4COWA 3TB0A 1VR3A 3NJZA 1UPSA 4FXGB 3WW4A 2ZHKA 5E89A 1POV3 1AUYA 4B8EA 4BA6A 2VOVA 4K3UA 2VGDA 1TE1B 3D0JA 4W6XA 4FQZA 4E9KA 2XHKA 4B4RA 2DTYA 2YGMA 1CAVA 3VBHC 4GB33 4XJWA 3ASIA 4BM8A 1VB2A 3NKTA 3SH5A 4AHXA 3CO2A 1AYN1 2P34A 2FZ2A 4UW3A 1O5UA 1K5MA 3POSA 4H55A 1BYHA 1PGSA 4BE3A 1O4TA 4OHYA 1D2QA 1WMEA 5I8SA 2PLV1 2ET1A 3Q9OA 1GFF2 4MVTA 4AF9A 5TSWA 2DCZA 3VKOA 1EYBA 1UIJA 2E53A 1FNZA 2ZACA 3UJOA 1APNA 2WFF1 2Q5TA 4FP2A 1ZBA1 1Q56A 2G9GA 2JX9A 5KXEA 3E6DA 5DUWA 1QU0A 1YI7A 3GYDA 4NHMA 3LB9A 4E2QA 1O4YA 2PHTA 4H14A 1HV0A 2E6VA 4AXOA 1H4HA 1DFQA 4Z82A 3V0BA 1N47A 3ACLA 1G7YA 4LO8A 3BIWE 3FFQA 4XFBA 2WIIB 1NE4A 3N36A 4N9HA 3JD71 4JDNA 4FP3A 4MX3A 4Q2FA 1F9KA 1EV12 2MHFA 2UWCA 3ZN6A 1LGCA 4WZFA 1FMD3 2R061 4GH4C 4AEDA 4BLJA 5C4WC 1S2BA 2IXIA 3V64A 4COVA 4HETA 3PVNA 1OQ1A 4LO4B 4EN9B 3B01A 2DU1A 1H8TC 3WLUA 3FBYA 5EJ3A 3S7EA 1D4M3 3R4SA 3N35A 1RJ8A 2EXKA 5BNNB 4HKLA 3BTAA 2ZKLA 3WDVA 2A5ZA 1O3RA 2RJKA 2MNGA 5BNOC 1JH5A 3OTFA 1AL0G 2WFPA 3R4UA 4Q0SA 1C8M1 2QZ2A 5GKAC 3ZFEA 3R6SA 1X50A 3BODA 3S7IA 4TLFA 5JZGC 3VHPA 3E6BA 1CQ9A 4CP0A 4HVRA 4Y1XA 1VRH2 4DQAA 1Z7S3 3ZN5A 1QXJA 1UMZA 2W52A 4M0HA 2WWSA 5C8CB 4AFBA 1WMDA 2HWF3 4OLLA 1PO21 1Q8VA 5JIUA 2XPJA 1RUH1 2DUPA 5EYXA 5IK4A 1MEC3 3URFA 3B9CA 2WNUA 3UKNA 2RMU2 2VMGA 3SH3A 1C57A 2PELA 1QF3A 2GC1A 4FPLA 3IPVB 5IT6A 1BZWA 3KT7A 5I0SA 1WGPA 4LNVA 1WBFA 5F6LB 5DXDA 2NM1A 4CEYB 4IXLA 4YGBA 2AYHA 3WW2A 3E5QA 1RUF2 1NY71 1FPN2 1RUC1 3HT1A 1IGOA 4R52A 2ZABA 4Q4W1 4RQPC 4Q1PA 4F83A 2LM3A 3MIEA 1H9WA 1H4GA 4N90A 5DDJ2 5A33B 3HBZA 1GKBA 4MXVA 1AR93 4FOQA 4YG0A 1YWKA 1K5MC 5EZWA 1AR92 4HLTA 1RUI1 1ENQA 1TME1 4TSVA 2A6WA 2KM2A 3SITA 1ALYA 4FPEA 3THTA 1LOBA 2D5FA 4Y1YA 3PJQA 4YZ5A 4YGCA 2D3SA 1DG6A 3VKFC 1GBGA 3U07A 1AR61 3RI8A 1V6MA 3ILNA 4YRDA 2B7YA 3IT8A 4Z07A 2UU8A 1YIPA 2WZR1 4DZGA 1W6PB 2UY8A 3MLJA 3ZSEA 4AHWA 2NMNA 3VGIA 1RUD1 4YVSC 1S0JA 4UW5A 1OFSA 3PTYA 3E97A 3DPRA 1KXGA 4AQTA 4FTEA 1LEMA 4OVEA 2E7TA 4UW6A 4P9LA 1GZCA 3N7JA 4JV4A 4S2FA 1PHMA 1FOD3 5JSPA 4CEWB 2XBO1 5I8TA 3IBMA 4AEDC 1FOD2 3ZFFC 1OPOA 1VBB3 1SCRA 3RYRA 5FBZA 4EN6B 3RWNA 4EWAA 5FO7B 4XIKA 3ILRA 2Z79A 1PIV1 5ACA2 1OHFA 4AI0A 1NYWA 4HPKA 4S2GA 4ASLA 1HRV2 2CWMA 2VW2A 2W68A 5J96B 1NLSA 3GZTB 3AZVA 2WJSA 4EJRA 3VKMA 1G9AA 5E16A 3OJBA 3FLTA 3VDDC 2W0XA 2TUNA 3CJXA 1YXWA 1DGWA 4PIYA 1NCQA 2DURA 1CAXA 1CJPA 2RS11 4LUMA 2DCKA 4FOWA 4BWOA 3I59B 1F5FA 2D6PA 4IEXA 2JEMA 1BKZA 1DQ1A 4WZCA 4X8NA 5FRAA 2E51A 3I7DA 4ORFA 2MEV3 4CRQA 1MR5A 1W6MB 2JE9A 1AR71 3ZFGA 4Z8BA 1QDOA 3CU7A 4J1WA 3PVOA 1PK6C 1ZZ8A 2ATFA 3S6PA 4GA9A 4XBLA 1SLAA 4Q4V3 3SHRA 1EAH2 4RS5A 3ZMOA 3OY8A 4YG3A 2QNKA 1SLTA 3CJIB 1Z0HA 4Q0PA 4WM7B 2XJRA 3VBFC 4TZDA 4PF5A 3AJZA 4M01A 4XYXA 2HYKA 4Q27A 5FAXA 5CG8A 3RSJA 1DGRA 1HXS1 4XHXA 1SMVA 1QJX3 2A70A 4FPJA 1D4VB 1R1A1 2HWC1 4CDXB 3WZ1A 3VBUB 3KB5A 3ZYJB 3H50A 1BXHA 2B42B 1AF9A 1BBT3 3FBMA 4YM0A 1AR81 1TMF3 1BBT2 1DLLA 3J9SA 3AZZA 5D8AB 4ATEA 4CDWA 4WBBA 4H3WA 2XJTA 4FVVA 4I30A 1A8DA 1XU1A 4DMIA 1F8VA 4CDQA 5HCFA 3B02A 1CR7A 1LGNA 2G4IA 2LUWA 2K2SA 1LOCA 3LA3A 4XETA 2D6LX 5JPNB 3LSEA 2NYYA 2HWE3 1SLCA 2ZX2A 3ZXDA 2HWE2 3LSDA 3LCPA 1H0BA 3AKTA 5LK7B 4N7UA 3TN93 1OMIA 4FSJA 1JBCA 2JENA 5BPXA 1LU1A 1M4WA 2H0VA 3D4KA 3AXEA 1Q8OA 2ZX3A 4OHVA 3TAYA 4W6WA 2PAKA 1VBD1 3J8F3 2R042 3WG1A 5JLVA 1LECA 1DF0A 2VY0A 2WINB 3BOWA 3IDBB 2BEOA 3FC0A 4J6GA 4C0HA 1CGPA 2RM22 4I3GA 4D7TA 1VAKA 5ABJC 1AXYA 4JVAA 3NAPA 4Q4Y1 5KHJA 1O3QA 1PO13 5I0UA 2N7GA 2WZPP 1MVEA 2IXLA 2RS51 3TWIA 3WP3A 5FDBA 4XF1A 1EPWA 2ZX1A 1HRI1 1UAIA 1AX1A 3MGUA 5EXOA 4HN0A 1CONA 4LE4A 3QH7A 4M3CB 4EN8B 4BMBA 3S30A 4COUA 2TBVA 2GZWA 4PBOA 5JOWA 1S0EA 3VL8A 3R4DB 1LHWA 4RL7A 1NCQC 3THPA 3H3ZA 3MZHA 5J36A 4P9GA 1X82A 1COV1 3BALA 1SLBA 4LA2A 1W6NA 1H1AA 4GIQA 1ASJ3 4QMAA 1CAUA 5DUVA 4FCAA 2VU9A 4QXKA 4LBNA 1RHI3 4L99A 4OI2A 2KXLA 3ZDSA 1VBE1 2RS32 3JZVA 5GLVA 2XG3A 2HWD1 3ZFGC 3AM2A 3JQXA 3H7YA 4QPGA 4R4XA 5K0UC 5AFBA 1RUJ2 1S0CA 5AFEA 3AMMA 3QACA 4QM9A 1QQP3 3EJKA 2V73A 1N3PA 1QQP2 3RNSA 1C8NA 3LKJA 1S0BA 3LGRA 4M3CE 5IK8A 3VBRA 2RHPA 4N7IA 2X8KA 4XBQA 1OA2A 4YARA 3T1LA 4UXAA 5T5OA 3VKNA 3IWZA 1UU4A 1V9U3 3OD4A 5CB7A 5IK7A 1J1LA 4BLIA 2ENRA 3AB0A 4C0BA 3WT3A 4KU7A 1S1AA 2JDZA 1LRHA 3VBOB 3NSTA 1VBA3 3VZNA 2X5IA 4YM3A 5JMCA 4CDQC 3PVEA 5SV8A 1WUVA 2QFEA 4AW7A 1YYNA 2OW4A 3FWEA 4A2UA 5T5LA 5KC6A 1JYCA 3FUQA 4XXPA 2YPJA 1XYOA 3J26N 1N1SA 2XLAA 1J3PA 1HW5A 2OIIA 3NW4A 1SBFA 5BUVA 5FOBB 3WHUA 1HIXA 3M70A 3AP6A 4MGIE 4Z1VA 2HWB2 1PGL2 2QZ3A 4U36A 4COZA 4H7LA 4JGZB 4ONUA 3HT2A 3VLBB 3VZMA 3ZVXA 3L2YA 1R082 1W6OA 5I0RA 4P9WA 4Q4X2 1I5ZA 4I01A 4N43B 1NA1A 2Q1ZB 1OKQA 4AI8A 1ZBE1 1VLNA 1OA4A 4JDMA 4R4ZA 1MQTA 3LA7A 4XTMA 3I54A 3UV9A 5IK5A 1PVC3 2ET7A 2QDRA 4LT5A 4E2SA 2D97A 3B00A 4UW4A 1HQNA 4BMEA 1UN1A 4Y22A 3K51A 3H7JA 4W65A 4K21A 4LULA 3FMGA 4FPHA 4KGQA 4WM8A 2JG9B 4ISQA 2ILMA 1NCRC 1ND3B 2ZA9A 1OA3A 1YLLA 4YM1A 2QCSB 1O4ZA 1RVF1 4FO9A 4S2HA 2XUMA 2EXJA 3ZYRA 3ZXJA 1ZZCA 2D40A 2UWBA 2X29A 2ZHNA 4WVMB 2R32A 2DCJA 2YROA 4HL0A 1LTEA 2WKKA 1QJY2 3M3QA 3O5SA 4QPGC 5C33A 1IOAA 3CLPA 3SCHA 1AL21 4WVVA 1RUG1 4HK8A 4OI0A 1Q8QA 1HKDA 3EXUA 3VZJA 1GLHA 1ZA4A 5J48A 4BQ1A 4L9BA 1OQEA 1U5ZA 1V6OA 2JICA 3ALQA 1ENXA 1AYM1 4XFCA 1ND2C 3VBRC 3ZSKA 1BQPA 5BV6A 1R091 5L7OB 4RFT0 4XOGA 4LUKA 2UWAA 4IV1C 1PZ8A 4IESA 3AK0A 1YJLA 4KWJA 1H2KA 1V6NA 3WDXA 4A7YA 4DPNA 4D94A 3SXWA 4E2GA 4Q8KA 5C6CA 5BNPA 3ZYIB 2DCTA 2ZBJA 2X5IC 1QJU1 1ZRDA 1DIWA 5CAZA 1R1ZA 3GZAA 2R30A 1Q43A 3GZUC 3VBHB 1AYN3 2DVGA 1QGLA 2A71A 2BWAA 4YVWB 4PCRA 1OOPA 1AYN2 2GN7A 4XW3A 5FLJA 3PMEA 1LOFA 4GKYA 4Z2WA 1WD4A 2I74A 4JGYB 5JI9A 2PAEA 2PLV2 3JBG1 2VH9A 4LO6B 1ZM1A 4XZPA 1WA4A 4KG0A 3WQ7A 5H9SA 2WFF3 3DF0A 3WG2A 2ZHLA 1VALA 1YFYA 4FAHA 3AKQA 2WFF2 1ZBA2 1J59A 3WQ1A 3VBSC 3C2UA 1LB2A 1VBC1 3E6CC 1LOEA 1YUDA 3VHNA 1HLCA 1IKQA 3OPZA 2ZGUA 1NE6A 3FZ3A 1NA1C 5BNNA 3KZ4C 2B8MA 3CF6E 3C3VA 1HQWA 4HT1T 2HEVF 3TOJA 1N3OA 5JSOA 1SDWA 2BPA2 4PDWC 3JD72 4KWKA 1QDCA 4QPYA 2A6ZA 2WS91 4Q26A 2YY1A 3AYAA 3JU9A 4QX5A 1WMFA 4GH4B 4XQ4A 4HANA 4JCKA 2EAAA 3GF6A 4MSVA 2R071 2XL9A 1RUE1 2IXKA 2VXRA 2WC2A 2TNFA 2WNVC