1H0DB

Crystal structure of human angiogenin in complex with fab fragment of its monoclonal antibody mab 26-2f
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
223
Chain Sequence
b'EVMLVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGGNTYYPDSVKGRFTISRDIAKNTLYLQMSSLRSEDTALYYCTRLGDYGYAYTMDYWGQGTSVTVSSAKTTPPSVYPLAPGGGGGGGAMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT, LIGHT CHAIN
publication title The Crystal Structure of Human Angiogenin in Complex with an Antitumor Neutralizing Antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 41
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2002-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h0dB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h0dB01
4ALAL 4TVPD 3KLHC 1PG7L 1YPZE 5D7SL 5TF1L 2IPTL 4L4VA 4LQ1A 5GSVA 3BVNA 3WD5L 2LU3A 3ZE0F 4Z77A 5I8OL 1ZK9A 3REWB 5K9JL 4RA0C 3C8KA 3H9ZA 1VADA 4R2GC 2WWKT 1A4KB 2X4NB 3QEQD 1QR4A 3ULSB 1Q9KB 1H3WM 2ILLA 1S9VB 2C26A 4NPYB 5BW7A 4RQQB 5TDOA 2ICEB 3IKCA 2H3NB 1JTPA 3ZE2E 3QDJA 3TPKA 1ZT7A 3IFOA 4HGWB 3RPKA 2PO6A 1MCDA 3BSZL 4YGAB 5JXEA 2DF3A 3LS4H 4JFHE 4LIQE 5D96B 1YZZA 1F2XK 1NC2B 2HMIC 2D3VA 1SMOA 5HHPA 2ZCHL 1T03L 4PIRF 5C08D 2F8XC 5IHBA 4OQTH 4TVPE 2Q8BH 2J6EH 3M07A 4GW1B 5ENWB 2AEIT 1TENA 2AEWA 4ZTOL 3VFUB 1H3XA 1LO5A 5INCA 4XMPH 3O41A 3WCYA 5FM4A 1CF8H 3I50H 4PJGE 4RAUA 4F7CB 2D4DA 4NQCA 4JO1H 3KPPA 4HFUH 1T5WB 3QEQE 1RUQL 2EZ0D 5E9DB 2EIDA 1N7ML 1C08B 2HKHL 4DN3L 3B8YA 3CFEB 3TFKC 4FFWC 4F9LC 2IBGA 2H32B 1J0ZA 4JGMA 4OLVL 5MENA 3FB6B 3VFRA 5C0NC 4J3UA 3MV7A 3JUZA 4FQXB 1U41A 4XT1C 3G6JF 4OSUH 5C7XH 4NWUL 1KCLA 4P2CG 3TBTB 3W0WD 1XF3B 4P3WA 3STBA 3RTQC 3FO1A 5C08E 4OZGB 1CE6A 5BMFL 1MREH 2D03L 4N5EC 4Y5VA 4D0DB 5DFWH 4JFFD 4K9EH 2AW2A 5DD0L 3VXRB 2BHZA 1VACB 4NO0D 3T0EA 1JV5A 4MD4A 4L8SB 1L4IA 2DMKA 5E8PA 4DTGL 2HP4A 4XCCH 5A2IH 1AD0B 1J1PH 4NSKB 1QFWL 4LLQA 5KS9F 4TTDD 3LEYH 5E5RB 3RJDA 3U4EB 2VLKA 2IANB 2XFXB 3OJMB 2QQNL 4ZS6C 3VXSA 1MLCA 2FJFB 4MA3A 5BS0A 2NXYD 3L3DA 4ZSOE 3O4LB 2HRLA 3OKDA 3ILPA 1JI2A 2VN7A 3SE3C 1JRHH 2EDHA 1BWMA 1J05B 1F11B 1UM6H 3UYPA 3OBAA 1QRND 4XVSH 3FQNA 3GMLB 5EOCJ 3W0WE 1AP2A 3NGBB 5D6DA 3V6FB 2UZYB 3FQUB 4JFFE 1JGUL 3VI3E 1W72A 4OBRA 5HHNB 3TN0C 3FCTB 1NCNA 1WITA 3C09B 4E5XB 3O6KL 4PJIF 5IOPB 4HIHB 5F6IC 5J13B 2GHWB 5E4IA 4ZQKA 5KN5A 1NMAL 3VGAC 4ZPTB 2ED7A 1DBAH 4KQ4H 1A3RL 3DV6A 5EZOL 5KJRH 1FZJA 5E6IA 7CGTA 3JV6B 2IH1A 5DRNA 5KVGL 3CMOH 1C5DB 5E4EC 4Y19A 2A9NL 3MUHL 4OGXL 1QRNE 3EJYD 4FOMA 4X5WB 3T3PF 2X1OA 1JGDB 1DCLA 1G7MB 4HK0B 1FRGH 1NAML 4CNIB 5IROA 1T83A 4ENED 2B4CH 1FZMA 3ESVF 1R3IL 1ZA6B 1IC7L 5H35B 4GBXC 4BSVA 1BGXH 2ZOLB 5CJQH 5L8KB 3KPTA 5CZXD 2OZ4A 4NZUL 2UY6A 5D6CA 2VDNL 4AMKH 4X5XB 5F7DA 5FGSA 5J6GA 4KJWD 1RFDH 3CVIH 5MEPB 2X7LB 4I4WA 4JJ5A 4NKIL 1UB5B 1JI1A 1Z6JT 4ISVB 1HSAB 5D72L 1FIGH 5KSBB 4GMSL 2KQNA 4EN3A 1DANT 3G5YB 4FFZH 3SPVA 5C07D 3S4SA 1FNEA 3WN5B 1CGSL 5TJWK 5DUBA 5EO9B 3MNVA 3V52H 4R97C 2ITCB 4ELMB 1LDSA 2ESVA 4HWEH 3IXTB 2LABA 4FRWA 4NN6B 2NY0C 1S7UB 5GGSA 4ZMAT 3QEGH 1A6AA 4R7NA 1WSST 4P4KC 1XCTB 1EXUB 4Y89A 2EH7H 3HE6D 3BQUB 2R1YB 4RGMC 4EI6A 4Y2OA 3LD8C 2EKSA 1JFQH 3F8UB 5T1MA 1WWBX 3PWLB 1YQVL 2W60B 3GBNL 4LMQI 3FB7B 4PRIA 1F4YL 1I7RA 3QIUA 3EYUL 1A14L 4S10A 4F58H 3WLBA 5D7LB 2JK5B 2EEBA 3OXSB 1MFCH 2MKLC 2IPUG 5CZKA 2PYEA 1EK3A 2FX8L 5ICXA 4MXWH 5C07E 3BD5A 3BE1L 4OIIH 5FO9B 3EDFA 4OF3A 2O5XL 1YC8A 1KIQA 3PDDA 4RDQG 5TDNA 1QP1A 1U95B 1CR9L 5CZVH 3O3DA 1YA5A 5TE7L 1MJUH 3K8KA 3CAFA 4U6HA 3AFLA 3ZL4H 3I2CH 3WXWL 2BK8A 4IMLB 4I48A 5T3XH 2QHRH 3BMWA 5DJ2A 4Z5RA 3GUTA 3EOBA 3DBXB 3FN0L 2BVEA 1B6DA 4NN7C 1NCBH 2WIMA 2CJUH 4R90H 1T21A 4P5TD 3C08H 2AJUH 1NCUA 2IG2L 4L8DB 1FVDB 4P5MB 2VE6B 1YJDC 4WI5A 1RK0B 3RVTC 5DJXB 2VAJA 2IQ9H 1QSFD 3IF1B 4ZS7H 1ES0B 1YYLH 5EN2A 5IV2B 1YY9C 4F37F 4M6MH 2K9UA 5SX4H 5E08H 4QOKB 5ANMA 5FYKL 3TCLA 2VRAA 4EOWH 3BFOA 3IJSA 3BEWB 2CDFA 5J4MA 3VCLA 3LDBC 4Y4HC 2OXHA 3CSYA 4XP5H 2X1WL 3P30H 1HILA 2CDEB 3B9VA 3PDGA 4UQ2A 1G7LB 4BH8A 1JPST 4K8RC 1MRFH 5L2KA 2IQAA 5EWIL 1FYTA 4U7KA 4JFEB 4KHXH 1IGFH 4MXVE 3UTSA 4DK3A 5L8LB 5EO1A 1KEML 3AM8C 3QO0A 2BOBB 3P9MA 1OLZA 2X4QB 2JKXA 5F96L 5DMGD 4JY5H 3H0TA 3DI2B 2BVYA 3DYMA 3GHEH 3MBEC 2Y6SC 4YE4L 4YXHH 3KYOB 4UIKH 4PGDA 4QRUB 4PJBE 4P2QA 3LV3B 3KLSA 1QSFE 5HGHB 4E42A 2CGRH 1MHPL 1KEGH 1AGBA 3MV9A 2XKSA 2KH2B 3RZCC 1RZ7L 4QF1A 5IM7B 3S37H 1T4KB 1NMCB 5D2NC 4KKAD 3IDIA 4OCYH 5FYJU 3VXTA 3RGVD 4FABH 5FHAL 4H8WH 2QADB 1UM4H 5MP6L 3EYSL 4A6YA 1O0VA 1J8KA 1I7ZB 4PJ9A 3U82B 1IC4L 1T0MA 4WHDA 2D7TH 1B4JL 5IJVB 1CDBA 1KCRL 4E0RA 4NQDE 5FV1L 4NNXA 3WIHH 2X1PA 4UTBH 5IGXH 4WY7L 1OM3L 3HS0A 4XVJH 1F3DJ 4M1GL 4I0PB 1JP5A 2XZQH 1TLKA 4HIIA 5DXWA 2X70A 3PGFH 1MCFA 4IIQC 3ZKND 2BVQB 5IB4A 3UX9B 1VEPA 5HHXL 1BFTA 4Y4KD 1KPRB 5DQDH 1S7WB 1SYSB 4YHMH 4QRSB 2P7TA 4JDTH 1FGVH 3L5WB 3RNKB 4CL7A 4R4FH 3CFKA 3AVEA 1I3GL 2ZSWA 2RHEA 4PJ8D 1BQUA 3Q5OA 1J86A 2VUYA 3JWOL 3JV4B 3HZYB 1MRCH 5I30H 4ORZC 2ADIB 2N4IA 1X4YA 1X5ZA 4H25B 4GAYB 4OI8A 5CUSH 2X9WA 1UQSA 4HCRH 3CC5A 4LAJH 4QXTB 1HKFA 2OL3A 4BH7A 5KSUB 1WLHA 3LHPL 2JJVA 3ZDYF 5CHNB 4XVTL 5KZCB 4OV6F 2WUCH 4OFIA 1DN0B 4JN1H 2V2WB 2A38A 4Z7VE 4HKXB 4JZJC 2HJLB 1UEYA 5TH2B 4Q2ZB 4KQ3L 2PCPB 4LPWA 2NR6D 3QNYB 2W91A 4PG2A 1DBBH 5I75C 4R0LB 1E4WL 4IMKA 1Q9LB 1ZLWK 2GY7B 1H5BA 3D69B 3GSRB 4JZNB 5GJTL 2AJXL 3S3PA 1U42A 3SHSA 5BW7C 2XV6B 3OKMB 1NH6A 3SKJH 3DMMC 2FJHA 4O00A 5TQ0H 2PO6C 3LRSA 1J1XH 3OKEA 5JXEC 1X5FA 2QQKL 5KSAB 1AGCB 3TV3L 3VFOA 3BT2L 3T4YA 2QBWA 1CZ8L 4JVWA 4LSVL 1H3UA 5IVZB 3U30C 1R3HA 2AGJL 3O2VL 4ZFFB 4TUKL 4JREC 1X7QB 1IKFL 1A21A 1GOHA 2VXSH 3CFDB 1YNLH 4LCWA 3TNNA 1N2RA 2EE9A 5BV7L 1KELL 3NPZB 3MBXH 4RRPA 5SX5K 5BO1L 1OARH 1X5HA 5C6TL 1SY6A 3PGCA 1DLHA 1UADC 4U6XA 5HYJD 2AXFA 1HHHB 1A6VL 1NUDA 3PWUA 2Q7YB 2OI9C 1R0AL 3HE7A 2OTWB 5K9QI 4PJFE 3UJTL 2XRAH 4EI5D 4DGIH 5IT2L 4UT9L 3RWFB 1FL5B 3TO4A 1HKLL 2R29L 4DKFH 5ADPH 2DMBA 5DD6A 2I60L 4WDIB 5HI3C 5CD3B 4JRYA 4WFFD 1E4XH 5DVOA 4ELKB 2G5RA 3FFCB 4XWGH 4BQ6A 3D2UB 1TDQA 4Y5VC 5DGRA 4PV9A 1NCCH 3SDCD 4ZAKA 3QH3B 2P8PB 3K80A 5HGAB 3P40A 3PV6A 5I1EL 1GRWA 4FQQB 4LDLB 4M02A 5HHOA 4OUUA 4ODSH 5GPRA 1QLRB 1NDGB 3VJ6A 4N0YL 3HB3C 3PHQA 4HUVA 4M61A 2FL5A 1E6OH 4ZFOL 4NWTL 3S34L 2NNAA 5KVDL 5HYJE 5LWYH 1MCPL 5EBLB 3M17B 3QULB 4NM8H 3I9GL 3BRDA 2PXYB 1JZ7A 3MLVL 1PKQA 2J8OA 1CDHA 1U3HA 2WBJB 4HS3B 4KUZL 1ZHKB 1G1YA 3JTTB 4Z7WB 5D8JL 4X4MA 2G2RA 1S9YB 3SDDD 3C6LA 5GRVK 4DCQA 4K3GA 2X4RA 3MUZ1 4WNQB 4M93C 4WFFE 4PJAE 5D6DC 2HWZL 5FGRA 2YKLH 2DQFA 2EDYA 1CXFA 5I1GL 4J3XA 2ZCLL 2DYPD 4EEEA 5F9DC 5DURD 2FH8A 4LMQE 1PEZA 3ROOA 1F8TL 1EUUA 1A7QL 4L3CA 3DV4B 5D1QA 32C2B 4EBQL 5ID0A 2NY3C 3MROA 4HIXL 4FFYL 5KVFH 3F5WB 1D5ZB 4W4OA 3QZWB 3MXVH 1NGXA 1V5JA 3ULUD 2BNRB 4I77L 1UFUA 2RQ8A 3TM6A 3KYKL 4G8GD 3RKPA 3ARFC 2A0LD 3A6BH 3TT1L 3ARXA 2EDLA 1R5IA 1AHWB 2FEEI 4PJCE 2R0KL 5FA4B 2EDJA 4X98A 2Y07L 2VR4A 3TBSA 4OJFL 3QNXA 3HFMH 2Y23A 2HFEB 2AQ1A 5I15L 2MCPL 2HVJA 2XWTB 4OLUL 4M7ZC 3ZT7A 1AO7A 1T5XA 2VC2H 5EUKA 4JM2A 3QIWA 4YDLC 2GUOB 3BIKA 1ORSA 5IROC 5JW5B 4XNUH 3UC0L 3QUZD 4UI2A 5IG7B 2J7LA 5FUCC 3RUGA 4L8CA 2NY7H 1DQTA 1MCEA 4FTVA 3MPCA 5E5MB 4G8IB 1HCFX 1YPZA 2HA1A 3H9YA 3GSNL 1QBMH 5I1JH 5ETUB 3O6MH 1NKOA 2GSIA 2C5DC 3ULUE 1HOCB 4P9HH 4G8GE 4MDJB 2WV3A 1G9NC 3C5ZA 4JY6B 3MRBB 1C1EL 4HGKC 2AJZB 2Y5TA 4QEGA 1ETZB 4BQBA 1OTUC 1ZGLB 1T1ZA 4EN3C 4QY8A 5HY9B 4LSTH 2HG5B 2Z93A 4HBCL 5EFIB 2R1XA 1IAIM 5I2IB 3HR5B 2D2OA 3QA3A 3AY4C 5DVKA 1K8IB 3VXNA 1JHLL 3WYRA 3GSVA 4ONHB 1AQDA 4PB9H 1IEHA 4HS6B 5ID1A 4LCYA 3O2WL 1WF5A 4EVNB 5B39A 2Z31B 5EC2A 1RZKL 4G8FA 1JGVH 2EDBA 4S1SL 1E28B 5CEZH 1HCVA 5K9KB 2EO9A 1XR8B 3O0RL 4R2GB 2OTUA 2AXHA 4PY8J 1HIML 5DVLA 1YECH 1S5HB 3MCLH 3QIUC 2Q1EA 1EEUA 4PP2B 3W11D 2JJTC 3H3KA 1NQBA 5ALCL 5IIEA 4OD3H 1B9ZA 3QEQA 4DK6A 4HDIB 2P5EA 2DQUH 2M26A 4CVZB 5DC4B 4G9DB 3QFDA 4NDMB 4YBHA 5EZIH 5HYQA 4G7VL 1CGXA 3HG1A 1K85A 4NNYA 4L8BA 2ZSVA 4JZOA 2HH0H 2JIXD 3S35X 1XR9B 1GOGA 5D2LB 1MJ8L 5LCVL 3V8CA 1SJVA 4DKDC 2F5BL 5E99H 1CFVL 3NCJL 1XMWA 4PJHB 3WJJC 5I1AA 3ET9F 4V1DB 3I6GB 1QA9A 4LVOB 4KZEH 4U6VL 5EU7C 2AJVH 2YPLD 2V9RA 1MCBA 4BZ2L 3KS0H 3MLZL 2VZOA 4YGVB 2ZUQC 3WE6B 3VG0L 1VB9A 5FYLL 1WGOA 5FHBH 2H8PA 2UVEA 4BUHA 3EO0B 2L7UA 4M6AA 1LE5B 5FYJD 4HUWB 3GBLA 2YD7A 4KXZI 3B9KC 5GZOD 1BQLH 3BGFC 5ITFB 3L3OB 1KXTB 3RWIB 3L5IA 4LPUA 4MQXC 4OLXH 3RTQB 4NZTL 4PBWD 4JGJA 4FG6D 2V7NA 5GIRB 3UTPE 1CGVA 4HZLB 1WBYA 2G75B 4M48L 1U9KA 3QDAA 1FNAA 3W0WA 3OPZH 4S1DC 4LSRL 2YSSB 1M05A 5E70A 4WUKL 5JQHC 4KTDL 1CIDA 2YPLE 1N3NA 1BIHA 4YBLB 4DGVH 4WU7A 1B0RB 1G7PB 1UZ8A 2JCCB 4AEFA 4GRWF 2NY4C 1YEIH 4FQ1L 5GGSY 3G5XA 3W9DA 1RAMA 4IEFB 2F54A 1LO2L 4HKZB 2F5AL 3HZKA 5FYJE 1LD9B 4X9IA 1PKOA 3GMPA 1U58B 3I75A 5F7EH 4K94H 2BVPB 1GXEA 4P57B 4GSDH 3RZWA 4X6DA 2AEPL 4N8VA 5DK3A 4U1JB 3RDTD 3WEXA 4X80H 3U2SB 1QG3A 4DQOH 3PWPD 2O5ZH 5EC1A 3DJ9A 3G9VA 1S5IH 2Y36L 3C5JA 3CSPA 3MRRA 3W5NA 1RZIB 4PJXB 3OKOA 1CICA 2C3VB 3TJEL 5F6IB 4PJ9C 4UU9A 4X8JA 3DSFL 1OSZB 2E7HA 1QKZH 4DAGH 3VGAB 1NC4A 2NX5A 1NFIA 3MRKA 2BNUA 1P5VA 5SWSB 4XCFL 3DO7A 4HC1H 1IM9A 4Y2DA 2VR9A 5E4EB 3D48R 1OAKH 2DQHL 3K2MC 4UMGA 4JN2B 1HDMB 1AXIB 3NABL 4OM0L 3QUML 2WK2A 4L1HA 4D9RD 4HHAB 2XWBA 5HPMA 3KG5A 5KW9H 1I9RL 3RU8L 5E03A 1FNFA 5GRXG 1HYRC 3K2UH 1T7YA 5FIEA 4LOUC 1UWEL 1Z9SA 4NQEB 3NIDE 2ATKB 3SKMB 4GAJL 5GGQH 5DHYA 3QQNA 3MRPB 3TEUA 2H1PH 3PWPE 1FGNH 1S7VB 3LKRA 4GBXB 3QNZB 5I74C 4JM2F 2MCG1 3MO1A 3F65A 2WW8A 3HPLB 1Q94A 1NBVH 4HIJA 2VKXA 3RUGF 3IDNB 5TPWH 3FT2A 2YPKB 5HHQB 5JIIA 3H9SB 4PV8B 4ZPVB 1XCQA 2Y06L 3CUPB 1YPZF 4O2FB 4OFPA 3KLDA 1FH5H 1IFHH 3BZFB 3EYOB 3PQYB 1HYSC 1EJOH 3VFTA 4Y16A 5JOFB 1AKJD 2YD1A 3D9AH 4X6BA 3GEWB 3SDYL 4D9RE 3U7AA 3MOAL 5LGHL 4WU5B 1S78D 5FGCB 5T33L 1P6AB 2FR4B 4PY7B 2IH3B 4NQUA 4R97B 1FFPA 3HMXL 2YUXA 2FB4H 3LMJL 4JO4L 1KENL 5TE4H 2NW2B 5ALBL 2E7CA 1H5BC 4WTXA 2NY0B 4R8WL 4GRMB 3X3FH 1IT9L 3GJEB 5E24E 1XF5B 4LGSB 4G5ZH 3N9GH 1I8KB 4RGMB 3MX0A 4MAYB 3LD8B 1YNTA 1AGDA 4YDVA 2VDRH 3NACH 3B8SA 1G7JB 4HLZH 1JPFA 1KCUL 4HG4J 2B5IC 4YXKH 4KC3B 1CE1L 1ZANH 1T1XB 3ELAT 4F33B 1K2DA 1NAKL 3K1DA 1BX2A 4RCAA 1KCVL 4OZFB 2CKBB 5FUOL 5LBSL 3H2WA 2WM0A 2CLVA 4JM4L 3TNMA 4XNQB 1OWWA 2EIZB 5DD5H 3VFWA 4M8QA 4JHWL 3CFIC 4G8EA 3WS3B 3LB6C 1HHIB 3T2PA 1YMHB 3G6JB 1QLEL 4OV5A 1FORL 3HC4H 3BP7A 5ICYA 4JO2L 3RWGB 1FVEA 3HE7C 3KXFA 3V95A 5DUPH 3FOMB 1XFPA 3I85A 5C0GA 4HKJB 3CXHJ 1VGEL 3VRLE 1BM3H 3JXAA 2FO4B 4U1GC 4NN7B 1I7UB 2X4UA 4OBSA 5FDWA 1PYWB 4IRJA 4Y5XB 4IRZL 1MPAH 4ZAKC 3S5LA 5KS9B 1BJMA 3LZFL 5E8NB 1GZPB 1XGRB 3BJ91 3B2UD 5GS0L 3S9DB 2DQEH 1ZSDA 2H26B 4PGEA 2WUBH 4N8PA 3BPOC 3GJFA 2ZP0T 4GS7C 1C5CH 3O6FC 2P8LB 4HBQA 3V0VA 5IMKA 1DBML 2HFGL 2XZAH 3LDBB 3F58L 4JQIL 4LLDA 4H0GA 3EJZD 4BJLA 3MLUL 3GIVB 1I9IL 1Z3GL 2CXGA 3AS1A 1FZKA 3JSSA 3NCFB 1U8JB 5GS2H 1OPGL 3SJVB 3G08B 3V7AE 3CX2A 1U3HC 4UAOC 4ZG1A 2J3SA 2VXTL 1A7PH 2H2SC 4P99A 4QHUB 3C6LC 1JRHI 2ZUTA 1MEXL 3IETA 1JGLH 4XGZA 4K3DH 5JW3L 4QGYA 4PJIB 1EUTA 3VRIA 1ZLVH 4G3YL 2A83A 1N8ZA 1CFSA 4OIAA 5BJTA 1KYOJ 3MFFB 5T1KB 3MRIA 1TXKA 3K8LA 4HXBH 1VESA 3Q3GA 4H1LB 1AIFA 5IFHL 1MI5A 4ZFOA 4MLIA 3DIFB 1F2QA 5MEOA 5D2NB 1RUAH 2R9HC 4L3AA 4OAWB 4W4OC 4XPTL 5TE6H 3L3IB 4KKLC 2BSTA 3RI5K 3W5MA 3ISWA 5FGBA 5ESVA 5F89B 3P3YA 4U1KA 5AYUH 1HQ4A 1B2WL 2F9BT 2IMNA 3AS0A 3IDJB 2NW3B 1UM5L 3GSUA 1HEZA 1KLGA 2R0ZH 5ACZA 5GRJL 1EO5A 1FDLL 4UIMB 3RGVA 4P3DB 3T1WA 2KBGA 5CEYB 5EU6D 4X6FA 4JM2C 1HXYA 3FMGL 1NDMA 2I9LA 3DSNA 4MD0B 2QV2A 3G6DH 1OAXL 3PGDA 3V6OC 4IIQB 4JKMA 4M43H 2NZIA 4P2OD 3S35L 5I1HL 4UNTA 5ESQB 3VE0A 2CD0A 3BW9A 1BQHA 1ZT4B 4HUXA 1CI5A 3FRPA 2FHCA 3M1BA 1Q0XL 4FQJH 1QPPA 4X7SL 1TZIB 4P0DA 1ADQL 5IVNA 1N64L 3C5ZC 5L6YL 4HK3J 2YD9A 4J6RL 2DQCH 2EXWD 2G5BB 4XXDB 3TH4T 3WXVH 5JORA 3IRPX 4JO3H 5F7UA 3DECA 4TNWF 5E1AB 5F1NA 4OGAC 4PGZA 5IB3B 2ADJA 2EYTB 5DQ9A 4RMVA 3GIZL 3TBWA 3KYNA 5EU6E 1T3FA 3BN9D 1ZMYA 2DTSA 4JE4B 3VD3A 6FABH 2QLVB 2DOCA 5EOQL 3RVWC 5D7IE 5I8CA 5GSVB 3BVNB 1FIEA 4R7DA 4YEEA 1WAAE 1MHCA 1N0XH 5DRZA 4Z77B 4J3WA 3GSNA 5I75B 5T3ZH 1I9EA 3GNMH 3C8KB 1VADB 3HTLX 4J12A 1U91A 4GAGH 2R2BA 2OYPA 4MA8L 1RJZA 5CJBA 2V5SA 4LQFL 4Q74A 5TDOB 3C8HA 3E8UL 5EU4A 1J0HA 4X7DC 4PS4H 3IKCB 4NZRL 1UVQA 1XGYH 3QDJB 1G7QA 3DYPA 3IFOB 2PO6B 4LFHD 1MFDH 3ILQD 2ARJQ 4EQ3A 2PR4H 4LVEA 1GGTA 2XKNB 5HHPB 1U93A 5BOZG 4K07A 3L3KA 3AU1A 3GRWL 4G9FD 1G6VK 4YIQA 4PJ5D 3U30B 1VFOA 3FT3A 4LSUH 4JREB 3BXNA 1WC7A 3NFSH 1WIPA 4NKOA 1DQDL 3DETD 1AR1D 3MRHA 4YHKL 3QJHA 1SM3L 3DVNA 4U1SA 1LO5B 5DFVD 5INCB 1AFVL 1D5MA 1N0LA 3IJYA 3LY6A 3T08A 3BZEB 2DDQL 3O41B 4LPYA 1MHHA 4FXGA 3PF2A 4PRNA 4RAUB 4I2XE 2XTLA 3QHZL 4NQCB 1AY1H 4HF5L 3BEVA 2MJWA 5GRYA 4ONFH 4OZFG 4GLRI 2OI9B 4N68A 3SGKC 4BFIA 1S7RA 5D1XA 2MMXA 5MENB 4U1NA 3MV7B 4AJ0A 3HAEH 1CFQB 2Y7QA 2EZ0C 4M3KB 5HYJA 4WENB 3V4PH 2XNAA 3QO1A 3JV0A 4KVNH 5D7KE 4W6WB 4MNGA 3FO1B 1VCAA 1INEH 2ICES 4G9FE 5SX4I 4Y5VB 4PJ5E 4QTIH 2Z91A 4M9OA 3Q1SL 1FCGA 4RGNB 2YPVL 3T0EB 5JUEL 3N06B 4OB5H 4MD4B 5D9SA 1J12A 1FG2A 5E8PB 2CUMA 4MXVF 3HUJE 3HCVA 4CBPA 3SDCA 3G5VA 5E6ZA 3G5ZA 4F15C 5JHDA 3NCYS 1A7RL 1D6VL 4OLEA 1MFBL 2VLKB 4OCMC 2IPKA 3ZDZF 1MLCB 4EDXA 5BS0B 5GRWA 2VSCA 1X5AA 4TTDC 3OKDB 1FFNB 1NSNL 1BIIA 3ZTJG 3VU2A 3OKLB 4JFDB 2P5WD 2AK4B 3FQNB 4WTZG 1AP2B 4OI7A 2DLFH 4XH2A 5D5MA 2NXYC 3OAUL 1H3PH 3UMTA 4QXGH 2FX9L 4AENA 4KTEH 4K7FA 2E7LA 4KUCF 1QFPA 4U6YA 1V7ML 4R26H 2CUHA 1VFBA 1GAFH 1JBJA 1W72B 5E00A 5BRZD 1T1WA 2AXGA 1T2QH 4PREA 1G6RH 3INUH 2ZNWA 5C3TA 2DQGL 4NNPL 1MCJA 3NZHL 4O58H 5D93C 2OP4H 2DYPA 5K33A 2ICWB 1I1AA 5HVGB 1FFQA 3D3VA 2NY3B 3VMNA 4ZQKB 1J87A 4OD1H 4RFOH 3DV6B 1FZJB 5E6IB 4LEXH 3ARFB 2IH1B 3DTXA 4MJID 3RIFF 1IQWH 4YZFF 1NCDH 4H1LG 4Y19B 3I6KA 5A2LH 3O6LL 2H45A 2P5WE 1KB5L 2VDPH 1PZUB 2YZ8A 1BAFH 4U1HA 3HNVL 4RMTA 2OXGA 4YR6A 5F7NC 1KF9B 3OR6A 4YDLB 4YDKL 1FN4A 3VXMD 2W9DL 5C0BD 1MHEA 1FZMB 5BRZE 3EJYC 3NN8A 4BSVB 5ICZA 3ZTNL 3RL1A 1I1YA 3HC3L 1ERNA 3DOSA 3MRCA 4LLAA 4ZOCA 5D6CB 2AEQL 2BXYA 3CXDH 4NGHH 4ENEC 3BZDA 4ZYKA 3OKKA 1YUHA 5ITBL 2CMRH 5F7DB 1M7DA 5J6GB 4XRCA 2GT9A 1U6AH 1JF6A 4I4WB 4JJ5B 5CZXC 4XI5C 4RBPH 4MJIE 4J2XA 4H26A 3QUMA 1CD9B 2XQBL 5KTEL 4F80A 1ND0A 3NIGF 1TJHL 2Y25A 3ZKMD 1RHHA 4EN3B 3T2NL 4KJWC 3S4SB 1FNEB 2CIIA 1JPSH 3AROA 5DUBB 4TVPH 3E2HC 1YMMD 4H20L 3TLRA 3FO2B 2ESVB 4U3XA 3VXME 5C0BE 3L1OH 3CDGA 1T7ZA 1FPTL 2DICA 4PPTA 4UILL 3BH9B 2FATH 4DEPB 2CRIA 1A6AB 4NFBA 4R7NB 3EZ8A 3MRFA 4L4TD 3LRGA 1IGIH 5GRZA 4EI6B 3B9AA 2EKSB 3WIIL 1CD1A 1FBIH 3ULVL 3MODH 4O2CA 1J1OL 1JN6A 1V8HA 4PRIB 1MRDH 2D0GA 3QIUB 3RWCA 4YEFA 1AC0A 3WLBB 3RX5A 1QTYT 2FSEA 2PYEB 2QSCH 5ICXB 4XBEL 3S37X 3HMXA 5DZLA 1QO3B 3PHOB 1MJ7H 3P73A 1YMME 5I76A 5IHLB 1HI6A 4MJ6A 3O3DB 3O4OC 1YQ2A 2HLAA 3K3QA 5C0EA 3FZUD 3D18A 2E7MA 4KI5D 4U6HB 4LF3A 3QUXA 2D9QB 4L4TE 1U8LB 3ETBF 4I48B 4BZYA 1HE7A 3PE9A 5DJ2B 1KPUA 3V0WL 4Z5RB 4JGUA 3EOBB 2ZUQB 3GUTB 3MV01 4XPAH 3T4AA 4MGXA 3LS4L 1WZKA 1T21B 1TTGA 4L5FL 5F7HA 5A1AA 3DUHA 1EGJA 2VZ3A 5SWQA 2Q8BL 4X4YA 4CVXB 1M7IA 1NCAH 5EN2B 4XCEA 1OT2A 5J3HD 3EUUA 4RQQA 1ORQA 3CX5J 3WS6C 5ANMB 4WJ5B 3TCLB 4WW1A 5MEQA 3IJSB 4XMPL 2CDFB 4HMEA 2DM3A 1CF8L 2R0WL 3I50L 2EE6A 4Q6IC 3ARDD 2GITA 2VXUL 3PABB 4JO1L 1HILB 2VXVH 4KI5E 4UQ2B 4HFUL 4URTB 2DJSA 3ARZA 4PR5A 2BVUA 5B21A 4F37K 5L2KB 2IQAB 4UBDD 5CGMA 2V2XA 3BJLA 4GW1A 3UTSB 3QIBD 5EO1B 2NY5C 3MNWA 1LEKB 3P9MB 1F4HA 4YDIL 4OSUL 3FQWA 2NY4B 5BVPL 3L7EA 1MIEH 3H0TB 1IARB 2BY0A 3G6AA 4IJ3C 5IBLD 1U0QA 4PGDB 4OCXH 3GZKA 5T3XD 4P2QB 2X44D 1OP3H 1WICA 1CL7I 4S2SA 4E42B 5I1LA 4K9EL 2R56H 3ARED 2F74A 3ZLQC 5DMGC 1T2XA 2JB5H 3MV9B 1KOAA 2R4SH 2WBKA 3VFGH 3EGSA 1RZ8B 2H32A 4OI9A 3MLTA 4QF1B 5IEHA 1HINH 3FB6A 1Z0NA 4O5LH 4OTXL 4QWWC 2BOCB 5IMOA 3IDIB 3BIBX 3LEYL 1NEUA 2WIIB 5C0DB 3TBTA 5D5MF 2NY1C 4M7LT 5HYSA 4IRSD 1P9MC 4A6YB 4NUGH 3CGTA 4PJ9B 4F7MA 4KKAC 1MSPA 1T0MB 4MQTB 2DWEA 3RGVC 3PL6D 4M6OL 3OGOE 1JRHL 3WO4C 2E8ZA 3QQ9D 4E0RB 1AD0A 4XVSL 2HT4D 4KKNA 4NNXB 3BGMB 3HS0B 4UDTA 2NQCA 1S7QA 1MIMH 3A6OA 3LN5A 4QRQA 5T3XE 4HIIB 3PUCA 3T0WA 3R0NA 3CPLA 4BQ8A 3CIQA 1F4WH 1OF2A 2XFXA 4NKMA 4UT7H 5IB4B 2FJFA 3UTZA 5C0RH 4I8DA 4WGVB 5IB5A 1QEWA 4CU6A 2ZSWB 4FFVD 4KU1A 3ZKNC 1TVBA 4HPYH 1OP9A 4LLYA 4Y4KC 3ALWA 1DBAL 4KQ4L 3IFPA 2MHAA 5DGQA 4U1MA 5KJRL 3A67H 3UJIH 1IEAA 2JF1A 1UQSB 1GPOH 3N1FC 3CC5B 3CMOL 5JHLL 4PJ8C 2OL3B 4BH7B 1MCQA 4P2YA 3QCUH 4LASH 3MLPA 1U8MA 3T0VA 4NIKB 1F4AA 1SJEA 2J8UE 4WEBL 1FRGL 1CLOL 2B4CL 5ACMA 1KB9K 4WWKD 4JQXA 2XTJC 4DVBA 3REVA 4MHHI 1JNLH 1BGXL 1AKJA 1Q9OB 5CJQL 5ERWA 5E7BA 1H5BB 1ADQA 5BQ7A 5IVXB 4ZODA 4AMKL 1VSCA 5INDA 1MCKA 1A02N 2NR6C 4ZNEA 1BLNA 3P0GB 4AEEA 5DZNA 3S4SG 1RFDL 3CVIL 3LPGA 3MJ9A 5IEKA 5D70H 1SEQH 4KRNA 4X9HA 3O81A 5H35A 3DNKA 3OKEB 4OFDA 3MV8A 1FIGL 4KMTL 1MNUH 1OW0C 2B5IB 1UJ3A 3T4YB 5JA8B 4UINH 4P46D 4CDHA 3C2SA 3V52L 4K3HA 4NP4H 3T3MF 2VDQH 4HWEL 1RZKC 3GKZA 4LCWB 3TNNB 3IS0X 1D9KD 1N2RB 3BN3B 3NFNA 3QEGL 1ONQA 4J3VA 1LEIA 2YUWA 2EH7L 3X3GH 3CFJA 2JJWA 5H37H 1JF1A 2V5YA 1DLHB 3BMVA 3PGCB 4PRPD 2Z0BA 3PWUB 4OGYH 5A16B 2KL6A 4M62H 1UH3A 1FSKC 3HE7B 2CDGB 3IXTA 3V8OA 2YEZA 4F58L 4Q9BA 4WW2A 1CDUA 3LS5H 1NLBL 4FA8A 5DO2D 2GTWA 3TO4B 4HG4K 1X44A 4U1GB 1YEGH 3CDFA 4UZGA 5DD6B 3ZDXF 2BZDA 3CD4A 4JRYB 1RZFH 4MXWL 2E6JA 4IBLT 4OIIL 1OAZH 4GXUM 2ZPKH 5SWZA 4LCIH 4XMKH 4PV9B 4EXPX 4ZAKB 2NYYD 3ARGA 3B9DA 5CZVL 2KPNA 3PV6B 4GUPA 4GRLD 5DSCA 1NANH 1IZJA 2LU7A 2R2HA 3BPOB 4OUUB 4Z95H 4GRWB 4GS7B 1MQ8A 3BISA 2JK5A 3O6FB 3SDCC 3T1FB 3ZL4L 3I2CL 3P0YH 3K74B 2NY5H 4APQA 4HUVB 4M61B 2FL5B 2QHRL 3W39A 2VB5A 2NNAB 4JKWA 4PRPE 2QEJA 4JKPL 1NCBL 4YFLI 3C6SA 2AJUL 4UAOB 1U3HB 1UGNA 5CD5D 3OB8A 5CIPH 2VLRA 1CLCA 2G2RB 5CCKH 5E8OA 2WWMC 3C6LB 4DCQB 2IQ9L 3SO3C 1PAMA 1U8OA 3RP1A 4ZS7L 4HT1H 1YYLL 2DQFB 3GI9H 3LCYA 1AGEA 5ECJE 4TUJA 2V5RA 4M6ML 2XACC 5E08L 1NBZA 1A5FH 3DBXA 1J8HA 4G7YH 2XQYG 3MV11 3ECBA 1UCBL 2DQIH 5AZEH 3P30L 4L3CB 1A6WL 3MOBH 3IDGB 4UDUB 1RK0A 1MRFL 3KJ6H 4QGTA 1TZHB 4KHXL 2BC4A 1IGFL 3H3PH 1NGXB 1I85A 5LXGH 5FCUH 4JY5L 3U0PA 4LHUA 3PHSA 1R5IB 3K8MA 5KSVA 4KTYA 4YXHL 4UIKL 2AI0H 3TIDA 1KJ2A 1O7SA 3TBSB 2CGRL 3QWOA 2A0LC 5DVNA 2W59A 1KEGL 3ZO0A 4XMLH 5DRWA 5LAXA 3KDMA 1AO7B 5EUKB 4JM2B 3QIWB 1UYWH 2IBZX 1ORSB 4JPWH 1ZLVK 5ACLA 3U7WH 3ZT6A 3S37L 3RUGB 1DVFD 3AC0A 5EU6A 4OCYL 3UJJH 1W8NA 4B7IA 1F6AA 4FABL 1YPZB 5F7YC 3IVKB 1V7NH 5IHZB 4OZHA 1UM4L 1FO0H 2M2DA 3QUZC 3UO1H 2VZTA 3C2AH 3OKYA 4PRDA 4U0RC 2GSIB 5IMLA 2VR5A 3HI5H 5MI0C 4Z7UA 4U2ZA 4P2OA 3C5ZB 5IM7A 3DRQB 2Y5TB 3WIHL 4UTBL 4CJ0A 5IGXL 1F90H 1KB5A 4XVJL 1T1ZB 4R3SA 1SBSH 2XZQL 4QY8B 5E9DD 1X5YA 5DT1H 4S0TD 3BAEL 2Z93B 1NUNB 2R1XB 4TVSa 3PGFL 3BKJH 3QA3B 3MUJA 4GG6A 1UWXH 2AKRA 3VXNB 4POZD 1GGIH 2ZJSH 2YBRA 3BESR 2E9JA 2K7QA 3K46A 3GSVB 4FQXD 5T1LD 4B53A 5DQDL 4WHTA 3BDYH 1EMTH 3X14A 4YHML 4JDTL 5ID1B 4LCYB 4NQSA 4R4FL 4HWBH 5B39B 1A7OL 1V3LA 5EC2B 4QKXB 2FBJH 3EIFA 4G8FB 3ZKXC 1ACYH 2W0FA 1MRCL 4CW1B 4I0KA 4LHQB 3V9FA 2OTUB 5DEFA 4OM1H 5CUSL 4HCRL 5F6HI 1ZXQA 2BVQA 4PLOB 4X6CA 1INQA 3EOTH 5FK9B 4I2XA 5EDXA 4FQIH 1MY7A 1IE5A 4KH2A 1I8LA 5IIEB 3VG9C 3QEQB 2P5EB 5E9DE 3WNNA 2WUCL 2IAND 2EYSA 3RNQB 4JN1L 5FF6A 3QFDB 5IQ7H 4PG9B 5HYQB 1CCZA 3X12A 3LPWA 5KANI 4Z8FH 2KKQA 4H25A 3HG1B 3O4LD 3W11C 1LP9A 1DZBA 4L8BB 4NNYB 3UZQA 1Q9WA 2ZSVB 3PXJA 1HSBA 2CIKA 2CK2A 5I1AB 3O2DH 2YA2A 4OZGE 4N5UA 4JPKH 4XCYA 3T09A 1DEDA 2YRLA 2WP3T 4PJ5A 2FLBT 1TVHA 3VXRE 3STZA 2V2WA 1QZ1A 2K7PA 3SKJL 1TTFA 4N9GA 5TDPA 3D0LA 1J1XL 4U7MA 3HUJA 2I24N 4XPBH 1T0NA 1Q9LA 4ONGH 2NY6D 3SGEH 5DLML 3K0WA 3DVIA 4FP8H 2YHGA 4NHUA 4RRPG 1IC1A 1PJ9A 4TTGA 4XNYH 2IANE 1Z9LA 4BM7A 1NKRA 2VXSL 4L3EA 5LKNA 1CQKA 3QWRD 1YNLL 3IFLH 2I07A 5CJOH 3O4LE 2UZIH 5GRUH 4WW2F 3QP3A 3KNBA 2V7NB 3EDDA 1WBYB 4X6EA 5GZOC 2P8MA 5KSAA 3ABZA 2DJUA 1VKXA 2DM7A 3W0WB 2F19L 4I18A 3U9PH 3F7PC 2I26N 1M05B 1YEJH 5K93A 2ZUWA 4FG6C 5IVZA 5A3IC 4ZFFA 2W9LA 1MVFA 4EQ2A 4WI6A 3QXVA 3WIFA 3QEHA 4F15B 2XRAL 4WU7B 4DGIL 4RWYH 1C12B 1OTTD 3BYYA 4Y7MA 5ADPL 4PB0H 3W9DB 4OQTA 2F54B 3NVQA 1NMBH 3VFNA 2J6EA 3OG4B 1KN2L 1E4XL 4XWGL 5JO5A 1NCCL 3GMPB 3M8OH 4NOBA 4GAFB 3I75B 1WZ1H 2NXYB 4K8RL 1QYGL 4C54A 4ODBD 4ODSL 1DL7H 4N8VB 1KJVB 2CLZA 1PBYA 1DEEA 4XP9H 3WEXB 1WBXB 2E9WA 1C8PA 4GKNA 1E6OL 5EC1B 2VTFA 5I8EA 2ED8A 4ZDHA 3C5JB 4LNRA 1NUGA 2OMBA 4FQHA 5D93B 4Q9QH 3MRRB 3OKOB 1CICB 4NM8L 2P8PA 2YZ1A 4UU9B 4X8JB 2RR3A 5BRZA 3RDTC 1L7IH 4X8XA 5DA0B 3UTQA 3ULUH 1AR2A 2NX5B 1NFIB 3MRKB 2BNUB 2X10A 1LHZA 5KG9A 3DO7B 3W2DH 4I0CC 1IM9B 2PETA 4HJ0D 4LVHC 5CP3H 3BQUD 4BKLA 3MLXL 2YKLL 4JFXA 3UTTA 2LTQB 3VA2C 5HPMB 2XWBB 4YWGL 4X7TA 2NXZC 3C60D 3M17A 1A6PA 4ZFGL 1GSMA 1I1FB 5D7LD 1UCTA 5T5NF 3W81A 3EYQC 5L2JA 1ZHKA 3JTTA 1JIBA 5DHYB 3U7YH 3TYGL 5KVFL 5EZJA 4AL8L 3LKRB 2BSSA 3TVMD 1D5BA 3MXVL 3MO1B 4ELME 5F97E 4EDWH 1Q94B 3VXMA 4HIJB 5C0BA 1R24A 3K4AA 5DJDA 4HX1A 3H7BA 3FT2B 5BZDA 1EV2E 5IBTH 12E8H 1WQVT 4OZHF 1BPVA 32C2A 3VFTB 4Y16B 4EJ1C 4XHQA 1BF2A 3U46A 2VC2L 1BVKA 3BPCA 3F5WA 1LK3H 4FHBD 4Z7UF 4XNUL 3H7LA 3LKPA 4XAKE 4KZDH 3U1SH 2D4FA 1RIUH 3NOIA 4PJ7A 2NY7L 3E2HB 5GGRA 3OAZH 5D7LE 1FFPB 1JCKA 4FQPA 1R5VB 1YEFH 3QEUA 3VW3L 1JYWA 1NGQH 3QXWA 5C07B 4ZFZA 3O8XD 1S78C 1QBML 5J1AA 2MQ3A 1T89A 5I1JL 1M4KA 5I19L 3B43A 3O6ML 4P59H 5GS1C 4GG6F 4QOKD 4P9HL 3VFMA 1YNTB 3RY6C 1AGDB 1FZOA 4YDVB 5IQ9A 5IG7A 2ZUXA 43CAA 4KKBD 2XYCA 1JPFB 2VWEE 4BSWA 3D0VA 1UJ3C 5I8KH 4OZIE 4RBPK 5E1HB 4JFED 4LSQL 2D0HA 5B39G 1K2DB 2AV1A 5B22A 3GSXA 1TVDA 1BX2B 1OGTA 2DQDL 4QNPF 2Z35A 4X6CF 1MAMH 2CLVB 4QHNA 3TNMB 3MRBA 3FTGA 5GISH 4B0MM 3VFWB 1QSEA 4M8QB 5CEZL 4G8EB 4HPOH 5JTWA 3KWWA 1DBJH 2QSTA 5I66A 3Q2CA 5EFIA 4OV5B 2BRRL 4M1CD 5ICYB 1LP9F 4QOKE 1FVEB 1XGUA 1YECL 3KXFB 1J11A 1NEZA 1XF4A 4MCYA 1CXEA 2J88L 2Z92A 3KYAA 3GK8H 5J1SC 5SV4A 4OD3L 4ODTH 5GZND 3TO2A 2X4UB 4U3CA 1ZKAA 5FDWB 4Y88A 4XTRD 5FYJH 1M6OA 4IRJB 5EZIL 4JFEE 1IM3A 4AEHH 1H3VA 5K9KA 2A6JA 1XR8A 4IS6B 5ABDE 3WNOA 3S5LB 2WMPA 4RNRA 3R8BB 2HH0L 4PRAB 3HUJF 1ZSDB 5I1KH 1DDHA 4YC2C 4BUGA 4PGEB 3HRPA 5E99L 2ARWA 3GJFB 1QFUH 2UYLA 4KRPB 1F4XH 3V0VB 4I0PD 2PTTA 3QPXH 4KZEL 2GK0A 3B2UC 1N5YH 2BHYA 4HIEA 4I5BA 1IC5H 1G0DA 4YPGA 5CGYD 4K7PY 3D85A 2GJ6D 4KMLB 4PTTA 5CJ5A 3UXFA 1C16A 3ARDA 3KAAA 4LRIA 4JFZH 1BEYH 3EJZC 4YH6A 4ALAH 1H8SA 5D7SH 4YHLH 3SDAD 2IPTH 3EAKA 5L7XL 1VHPA 3IETB 4MQ7A 4XGZB 3WD5H 4YX2H 4GQPH 3BP4A 4AEIH 2VLJA 3W9EA 5LVEA 4OLXL 3VRIB 2A83B 1N8ZB 2A9ML 5CIPB 1C5BL 4UQ3A 1CFSB 5BJTB 3VWJA 3MRIB 3N1QC 2BFVH 1TZGL 3Q3GB 3FQXA 3EO0A 3OPZL 1AIFB 5DC0A 2HTKC 1LE5A 1MI5B 1U92A 5KZCD 4ZFOB 4MVBD 5MEOB 3I3DA 2BNQD 2C4FU 1MF2L 1Y6KR 1DQLH 4DGVL 1U8IB 4WCYL 2NY1B 4BQ9A 2BSTB 4PP1D 2ZNXA 4XCNA 5ESVB 4W70A 5HBBA 4RIRA 4XP1L 1HQ4B 4KDTA 1YEIL 2IBBA 3L3JB 2GJ6E 4KPHL 3GSUB 2ZCHH 1BREA 1HEZB 1KLGB 2ZG3A 5ACZB 3RGVB 5H8DA 1WK0A 4X6FB 2MKWA 4JY4A 3CFCH 5F7EL 5CWSB 1PY9A 4OCSH 1HXYB 1NDMB 2AQ3A 2I9LB 1IAOA 4GSDL 4I3SL 3TT3L 1OP3K 1B0RA 3PL6A 5C9KA 2XXMB 3PGDB 1P2CB 3RWEA 3OWEA 2ICCA 4PJDA 1B0WA 4CN4A 2R8SH 4X80L 4DQOL 4DZBA 4YFDB 2WLYA 2O5ZL 1S5IL 1VFMA 1UACH 3LKSA 1DLFH 2BNQE 3AMLA 3VE0B 1BQHB 5FCSH 3M1BB 4TSBH 3WBDA 1QKZL 4DAGL 3VXUA 3HPJA 3VDAA 4FXKA 1SMAA 4P2OC 4HC1L 5JORB 3F6LA 3ARBD 1OAKL 1JWMA 3TN0A 1RSFA 2DN7A 5F1NB 5BMFH 4UV4H 2EDDA 2ADJB 3TBWB 5KW9L 3KYNB 4LRNH 1T3FB 2YN3A 4OKVA 2E8YA 2EXWC 4PJXA 4CU8A 4CGTA 3K2UL 1ITBB 5LGJA 1T20A 4DTGH 5I8CB 4R7DB 5SWSA 1MHCB 5DRZB 5GGQL 4X99A 2B1AL 1EHLH 2XTJB 3GSNB 3NIFE 2H1PL 1FLRH 1FGNL 3D2UD 1JVKA 4JN2A 1DUZA 5K59E 1LQSR 1I8IB 3NH7H 1NBVL 1U91B 2R2BB 4PJ7F 5TPWL 1RJZB 4WWKA 1ZT1A 1Q72H 5TQ2L 3WIHA 3F12A 4X9BA 1IFHL 1UVQB 4QCIA 2VXQH 4AH2B 1MFAH 1S3KH 1I8LC 2P48B 1G7QB 3V4VH 1MAKA 3D9AL 2D31A 3T8XA 4HS8H 4ZUSA 1U93B 4OFYD 3L3KB 3AU1B 2PXYD 2VERN 1IAKA 1QRKA 2E5EA 5FECA 1CLYL 4YIQB 2WBJD 3SKUD 3FB8A 3FT3B 3TESA 3BXNB 3O6KH 1WC7B 4RX4D 2YPKA 3ILQC 4NKOB 3MRHB 3LKNA 3QJHB 4U1SB 3DVNB 4ZPVA 1GC1C 3AAZA 3T04D 3IJYB 1D5MB 3X3FL 2OMNA 5IFAL 2AK1H 3JTSA 1MHHB 1HK6A 4FXGB 4P46A 1VFAA 4PRNB 2EXYC 4G5ZL 5DDHA 2QQQA 5CLWA 4HCRA 3DETC 1AR1C 3WDHA 3I84A 4OT1H 3BEVB 2VDRL 3GSOA 3UDWC 1KG0B 5DFVC 1D9KA 1F45A 4PY7A 3KHOA 5BZWA 2YC1A 2W0PA 4BFIB 1S7RB 1FSKB 4I9WD 3D39A 4OGXH 5LJYH 5CBEA 3I02A 2HJKA 1ZANL 1NFKA 3ZYIA 2Y7QB 5DR5H 1F5WA 5HYJB 5HHMB 2BNRD 1NAMH 1KTLA 2XNAB 3QO1B 4P4KA 3WHXB 4MNGB 5HGBA 3UZVB 5IWLA 4H5SB 1R3IH 1IC7H 1P4IL 3RKDD 3BGAA 2Z91B 4Z7WE 2LU4A 5EBWA 5DD5L 1KCSH 4HLJA 4NZUH 4IOFD 3AB0B 5D9SB 1FG2B 5D4QA 5DD3H 4J8RB 4S0SD 3PWVA 3SDCB 3HC4L 3G5VB 4MCZA 3T0XA 2DIAA 3RHWK 5JHDB 5HTSA 5IB1A 2IFGA 1TJIL 4NKIH 3S5LG 3HZVA 4IDJL 4ZTPH 1BM3L 2IPKB 4MNQA 4EDXB 4XNQA 4GMSH 3EHBD 8FABA 4I9WE 5DJ6B 1UJTA 1IEBA 5F88B 1G0XA 4MA7H 1BIIB 2PN5A 4O2EA 1EO8H 1MPAL 3QG7L 2BNRE 5L88H 3SO3B 4OF6A 3VH8A 4XH2B 5D5MB 2DQEL 1TITA 1HHKA 2WUBL 1YEDA 3O45A 4K7FB 1J0YA 5C70A 4N0RA 4U6YB 1N4XH 3R1GH 1VFBB 5F1IA 1T1WB 2AXGB 3HNSH 2XZAL 1TNMA 2YD3A 4PREB 4D9QD 2APWA 3G04A 1ZHNA 1IRAY 5A2KH 3KLHD 2DYPB 5EO0B 5C09A 1W0WA 3KPRA 4N0UA 4QTHA 1I1AB 5DURB 1JHKH 3D3VB 3W82A 5FDYA 1F4YH 1QNZH 4KDVA 2GCYA 1GZPA 1A14H 1XGRA 3EYUH 1A7PL 3I6LD 1J10A 1ZWIB 2Z31D 4FQLL 4P2RA 4PD4K 1MCOH 1CXHA 4KV5F 2FX8H 3DTXB 4GW5B 5HDLA 3BE1H 1FAKT 4Y4HA 3I6KB 2P1YA 4TNVK 1NFDA 5CKGA 1D5IH 1WWCA 1TCRA 1CR9H 5ADOL 4GXVH 4U1HB 4YR6B 2F58H 4JG1H 4HXBL 1ZLUH 3OR6B 2ARJA 1FN4B 3AM8A 1MHEB 4JJHA 35C8H 2QKIA 4YXLL 5IK3A 5B3JE 1RUAL 1X5LA 5ICZB 2ERJB 2XI9A 3NCMA 3RL1B 3MBEA 1I1YB 3MRCB 4M4PA 1CDGA 3QUZB 3ZE1E 5AYUL 4ZYKB 1OVZA 3OKKB 4XX1G 3RI5F 1HQRA 1FL6A 4PJDF 2IG2H 3P11H 1M7DB 3I6LE 2R0ZL 4XRCB 4V1DD 2GT9B 5MI0B 3RZCA 5C0AA 4Y1AA 4H26B 1KTDA 3QUMB 3QSKB 2VQUA 1ND0B 1S7TA 1KC5H 3BUYA 4G80A 1RHHB 1PDKA 3BPLC 2VDMH 2VDKH 1BQHG 3FRPG 3G6DL 3TFKD 4NKQB 2VQTA 2XPGA 1OAYH 2BJMH 2ZCKH 2Z8SA 2NW3A 4M43L 3B5HA 4V2CB 2E7BA 1ZS8A 3ZKMC 3CDGB 5D71H 2ID5A 2AP2A 1OB1B 1DSFH 1KTKE 1RMFL 2Z9TA 3RTQD 3IDXH 1XF1A 2RBLA 4Q0XH 4LSPH 1CD1B 5T1LA 3UPAA 5D2LE 2DQCL 3WXVL 1P7QD 1V3JA 1X9QA 4O2CB 3MMEA 1JN6B 3O3EA 4PJHE 2YRZA 1J5OH 4V1DE 2GJJA 4G6KH 4DZ8A 3RWCB 1OT1A 1MHPH 5EBMA 3IDMA 5ESQA 1ZLSH 1QSZA 25C8H 2FSEB 3SE9H 6FABL 4PGJA 1DJSA 1D6EA 1GC1H 4LP4A 3SCMD 3BIAX 4M7LH 4ZS6D 5GQBA 4Q97A 1N0XL 2FNBA 2G5BA 1JTTA 5I76B 3CZFA 3LQAC 1HI6B 4M6NH 4MJ6B 1UWXK 1MCHA 4KROB 2XIDA 5E1AA 5CP7A 5T3ZL 2BX5A 3GNML 2HLAB 5C0EB 3D18B 4YHYC 5A43C 1F02I 1AJ7H 3K4ZA 4R4BA 1IC4H 4B50A 2C1OA 2VNCA 1NGWB 2V9TA 3ES6A 1KPUB 4JZJA 3EYVA 3FZUC 1XGYL 3T4AB 1WIOA 3S96A 2OJZH 4G6AC 2PR4L 3U4BH 1JUFA 4YFEA 5HYFA 1HH9B 1IGCH 2EC9T 4G6ML 1A2YA 2ATPB 3CVHH 5DRXA 3SDXA 3JVGC 4X4YB 2PW2A 5SWQB 2JCCE 1KJMA 4LSUL 4XB8A 1ED3A 1SY6L 1M7IB 3NFSL 4XCEB 4LDOB 1NANI 1ORQB 4QRRD 5F71A 3E3QC 3VXPA 3DMMA 1Q1JH 4WW1B 5MEQB 1BJ1H 5F7MC 3MUGA 2GITB 1BZ7A 3I3EA 1AY1L 2XKNA 5J3HC 4PR5B 3TYFA 4ONFL 4NQED 2V2XB 2X4OA 4PLKC 3E1F1 3LEVH 3OTTA 3ARDC 4LRIC 4LSDA 3TBVA 3MNWB 3X11A 5C0IA 3BZEA 3FQWB 1VDGA 3PP4H 3L7EB 1EX0A 3DO3A 3EDJA 1OQOA 3G6AB 3V4PL 3MUY1 4JCMA 4KVNL 4GKZA 3O9WD 3QIBC 4KQ3H 1INEL 4S2SB 5I1LB 3IRZA 3H9SD 3EFFA 2F74B 4QTIL 2JJUA 3VWJC 4U1LA 3WNKA 2XN9D 3PQYD 4QRRE 2J5LC 3EGSB 5GJTH 1T1YA 4OB5L 3MLTB 5IEHB 4ETQA 1CFQA 4YLQT 5IMOB 4QRPA 3WSQH 4CMHC 4F7TB 3P9LA 2VYRE 4JVPA 5HYSB 2O93L 1QBBA 1PD6A 1H3TA 2DI7A 4NQEE 1IKNA 4KDTC 2UVFA 2APXA 2DLGA 4F7MB 2EE2A 2NY0D 3TJHD 4FZEL 5GGVH 4D2NA 2DWEB 4LSVH 4IRSC 4TUKH 4LVHB 1IKFH 3TA3D 4MAYD 4UDTB 4WVRA 4XWOD 1S7QB 4EUPH 1H3PL 3LN5B 4QRQB 2D7NA 4FNLH 4QXGL 2JLLA 1MAJA 4KTEL 3CPLB 3PL6C 1BQSA 3VRJA 4OGZA 3H9SE 2YWYA 5BV7H 1NBYA 1KELH 1L0QA 1IBGH 1OF2B 1GAFL 2NXZB 3IU4L 4NKMB 4PTUB 4R26L 3ZE0E 2XN9E 3PQYE 3EJJX 3UTZB 3INUL 2AJ3A 4O58L 4OLZL 1FFNA 2OP4L 5IB5B 1NFDF 5IR1A 3OKLA 1QEWB 4JFDA 2AK4A 1R0AH 5FGCE 4NRXA 3UJTH 1EHNA 1TVBB 4LLYB 4OD1L 4RFOL 3V79C 3P4OA 3IFPB 2MHAB 3MLWL 4U1MB 1J0JA 1HKLH 1IEAB 3L9RA 4LEXL 1CTNA 2R29H 3L6FA 4I3RH 4JVUA 1IQWL 4FFVC 1Z5LA 1NCDL 4MNHA 4U6TA 1C7SA 2DBLH 1R3KA 1WCBA 5HI5C 4I1NB 1TJGH 3QHFL 2OX5A 2FECI 1P7KA 2W0KA 1U8MB 5I1EH 2ICWA 2VDPL 1BAFL 1SJEB 3ALPA 3IDYC 1A0QH 1I4FA 4JLRA 4N0YH 3ARFA 3GMNA 4DVBB 4H8WC 5DJYA 4OZIA 3REVB 3IAGC 1AD9B 1L6XA 2APTA 4LGRB 1AKJB 1PQZA 4XPHL 5ERWB 5BQ7B 3CXDL 4J4PA 4NBYB 5ESAA 4WWKC 5INDB 1OSPH 4HC1A 5GS1B 1BLNB 3IS1X 4CADA 1U6AL 1CLZL 3GB7A 5IEKB 1MWAA 5AD0A 3O8XA 5DTFA 1I3VA 1PSKL 3G6JE 3MV8B 4LIQL 4LKXA 1U36A 4K8RD 2VDLL 3HHRB 1UJ3B 3LQAH 1VPOH 1JPSL 3MC0A 4MMZC 2F53D 4TVPL 3QAZC 2GTZA 4MLSA 3SJVD 2GAZA 2HT3D 4K23H 1X6NA 1JGEA 3DXAA 1B6UA 5JPMA 4TULH 4U49A 3DURA 5DHVH 1I9JH 5E2TH 4AIZB 1NL0H 1J0KA 4YHOL 4W4NA 4YNYA 2FATL 4FFYH 3NFNB 3OAZK 1EAPB 1ONQB 2B0SH 4P46C 1Y18A 1K4DA 4N8CH 1LEIB 3AS3A 1IGIL 3CFJB 2OQJA 1QFOA 4YBQC 1JF1B 1FBIL 5IBUB 1X6LA 5T1KD 3MODL 4NQTA 1EFXD 1G84A 1LGVA 1D9KC 3NTCH 1MLBB 3AY4A 1V3MA 3FO2A 1MRDL 5JR1H 2YEZB 1IAIL 2LAGB 4WW2B 4YK4C 2GJZA 3SGEI 5I15H 4F3FA 3BH9A 1RI8A 2GTWB 3HLAB 1NGPL 2RB8A 1EIBA 1A3LH 3FFDA 5ISZA 5IWLC 4X7EC 4NYLB 1TPXC 1ZVYA 5SWZB 2F53E 3SJVE 1MJ7L 4JKKA 5B8CC 3ARGB 4PGBA 5DO2C 4GUPB 4QXUH 2GSGA 5DSCB 2CO7B 5IUSA 2N7AA 4MJ5B 1F3JA 4WEUD 1RJYB 2R2HB 4Z0BH 3IT8D 3SDXF 2HVKA 2JJTA 4PJIE 3VGHA 2NYYC 4U31A 3QJFA 4APQB 1SQ2N 4GRLC 4IDLA 3AXLA 4NC2B 3W39B 3WMSA 5KAQF 4OCLC 2A1WH 1FNGA 5EIIB 1QO3A 3PHOA 2WQ8A 4F9PC 1GCFA 4XPAL 4DN4L 3F7RA 2VIRA 4ZNCD 4U7SA 2H6PA 2J4WL 4E41A 5C0CA 3C6SB 5F9JA 3WUWA 4P49A 5D2NE 3E0GA 2VLRB 5D7JA 5E8OB 4C57C 3CH1A 3EW3B 1ZHLA 3WJJA 2IFFL 3VXOA 4HUNB 3NCEB 1BFSA 1JHLH 1U8OB 1U8LA 3NCYP 1NCAL 1REIA 1TMCB 1W0YT 1AGEB 3T3PE 4YHZL 2GJ6A 4TUJB 2IADA 4K55A 5CD5C 1NBZB 5DMYA 1YC7A 4S1SH 4GLRH 1J8HB 5AG9A 2I9TA 3SDAA 3ECBB 4RISH 1UZ6E 4Y5YC 2YUVA 1IGTB 3BRGC 1T7VA 4L4VD 3B9KA 1WFNA 1VFUA 2QR0A 1LVEA 4CVXA 2BC4B 4TSCH 4XBPB 5DJ8A 1XH3B 3LRHA 4ETYA 2RAMA 1MOEA 4WJ5A 4YO0A 3U0PB 3GFUA 4LHUB 1MIEL 2BNQA 5E2VH 4XBGA 5KSVB 3KLAA 4XPGH 3VXQA 4M7KH 3TIDB 2YUZA 3PABA 1KJ2B 2R56L 3O3BA 3QWOB 4KI1A 1KULA 2XZCL 5DRWB 5LAXB 2JB5L 3KDMB 2R4SL 3SKOA 4J3TA 3VFGL 3VWKA 3QDJD 5C0JA 2PO6D 1A1OA 1HINL 1LEKA 3SE8H 4O5LL 4X9GA 5EU6B 2Z8RA 4NQDD 2C4FT 1F6AB 4OZHB 3MYZA 3IXAA 4L4VE 3DX8A 4MDIA 5C2UB 1DVFC 3P0VL 4PRDB 5KVEH 5IMLB 3BKYH 2B2XH 3GI8H 1G9EA 4Z7UB 1RZ8A 1FL3A 3C5SA 5C92A 4P2OB 4JG0H 4W6YB 3MRLA 2Q3ZA 5HDOA 4NQCD 1J9CT 2N1KA 3KPQA 2BOCA 1KB5B 3V5HA 1MIML 4R3SB 4NZTH 2WIIA 5C0DA 4YFLF 3KHQA 1FFOA 1F4WL 1JE6A 4GG6B 2GY5A 4TRPH 4UT7L 5J12B 2AKRB 2A77H 2I5YH 1N59A 3QDJE 3ARBA 2YBRB 4LSRH 3JUYA 2BDNH 4WHTB 4WUKH 3X14B 1HXMA 4NQSB 1LEGA 1FNLA 3BGMA 3N85H 3QDGA 2J8HA 4P9MH 1SJXA 3RX8A 2W0FB 3UJIL 4RGND 5DEFB 4FQ1H 3T0ED 2X09A 3FQTA 4G43A 1GPOL 2BSRA 4WHYG 4OZIF 2F5AH 2RGSA 5E8EA 4X6CB 3HNTH 5F7WC 1BZ9A 1XF2A 1CBVL 1INQB 4I2XB 3BKMH 4NQCE 3OHXA 4LASL 1F13A 5JIHA 4JB9H 3JWDC 4L8SC 2VLKD 5CLTA 4BQCA 2EYSB 5FF6B 4GKSB 3VXSD 5DWUL 3X12B 3T77A 5BS0D 1LP9B 3VFVB 5MENE 1Q9WB 3MLYH 1JNLL 3H6JA 4D0CB 1HSBB 2CIKB 4P9HC 1A1NA 3TJEH 4N90D 3DSFH 4G9FB 4XCYB 4PJ5B 1TVHB 5JMRA 3QRGL 3STZB 4L29B 4RGNE 5D70L 3T0EE 4N9GB 1L9NA 2C4XA 5TDPB 1KV3A 3UYOD 3D0LB 3HUJB 2BCKA 5I73C 1T0NB 1Q9OA 3THMH 2ZG2A 4UINL 5IVXA 4NHUB 2IF7A 4M1DL 2CQVA 3C09C 2VLKE 4DJMA 4L3EB 5E6ID 3VXSE 1IQDA 5I18L 2VDQL 4H0IA 5IBUG 5BS0E 2I07B 3VD5A 2NY6C 3LN4A 5J13C 3KNBB 4Y19D 4X6EB 2P8MB 3X3GL 2QL1A 5C86A 3VD7A 3SQOH 1VKXB 3WFHA 5D1ZD 4I18B 1B4RA 1RJCA 4P3CH 4N90E 3DVFA 3HKFA 4WUUA 5HYEA 4HXAH 4OGYL 2V2TA 3WIFB 3QEHB 5HDQH 5JMOC 3T65B 4O9HH 3VDBA 2V5MA 4FQ2L 3BHBA 4NFCA 4EIGB 4P4RA 1XGQA 1RIHL 1GGCH 1YEGL 3DGGA 1X4ZA 4X0KB 3VFNB 2JELH 1EVTC 1RZFL 3RWHA 1KLUA 2UWEA 4WI8A 1ZEAL 3QUKA 5JO5B 2I25N 2ZPKL 4LCIL 1MQKH 1G0YR 3BYTA 4ODHH 4CUCA 1N6UA 1OTTC 1XGTA 3PV7A 1K6QH 3WFDH 4CRPA 5A16A 4U3HA 2CDGA 1IT9H 4Y19E 3KPLA 5E6YA 2CLZB 4LARH 1DEEB 1GL4B 1WTLA 1DN2A 3P0YL 3HR6A 2NY5L 5AEAA 3J7HA 4GKNB 4AIXA 5I8EB 4ZDHB 4LNRB 4FQHB 1T22A 3B5TA 1IKNC 4WGWB 2KZ1B 4UTAL 5M94B 4M5YH 4UUJA 5BRZB 1JPTH 3HAEA 3UTQB 4NT6A 1RUPH 5I0ZA 1HZHH 5KG9B 4R6UA 5CCKL 2WINB 3O6FA 4BKLB 3T1FA 3ZDYE 4GQ9H 4X83A 2XICA 5DUMH 5EUOA 3GI9L 4JFXB 3UTTB 1CS6A 4LVNC 2PW1A 1UXWA 4I3GA 1A5FL 5I17A 4X7TB 4PRID 1X5KA 3OSKA 4HJ0C 1XEDA 3UROR 4G7YL 4MJIB 4XC3H 3FHAA 3VFSA 3DYOA 2DQIL 5L2JB 1CIUA 4EUPB 3VDCA 3MOBL 1FORH 3BP5A 3P4MA 2PYED 4LHUG 3UPRB 5F1KC 3C60C 5EZJB 5T5NG 3MGOA 2BSSB 3H3PL 3V7MA 1D5BB 1DUYB 2QSVA 3WNMA 1VGEH 1CL7H 2YXMA 5LXGL 5FCUL 4DOHE 2CH8A 1UH4A 3VXMB 5C0BB 4BFEA 4UNVA 1R24B 4Z7OE 5DJDB 4HX1B 3H7BB 1MFEL 5BZDB 2AI0L 2YD8A 3TVMC 4K94C 5F70A 4IM8A 3IDGA 3CSBA 4UDUA 1OD7A 1AE6L 4XMLL 3STLB 1TZHA 3U46B 4Z78A 1BVKB 3BPCB 3QFJA 4UV7H 5EH1A 4JPWL 5JW4R 2VWEC 3HN3A 3LKPB 2ENYA 4PRIE 1G6RA 3U7WL 4POYA 2HFGH 1MCLA 1QFWI 4PJ7B 5K59F 2G60H 3N1PC 5GGRB 4JQIH 3UJJL 4ZXBD 2DI9A 4WO4A 3QEUB 1ZLUK 4XAWH 3MLUH 2HLFD 1V7NL 2PYEE 4ZFZB 3IFNH 4J4PC 5J1AB 3FKUS 1YYMH 3UO1L 3C2AL 4WFHD 7FABH 3D5OF 1UXSA 1YMMB 3X13A 2BERA 3VFMB 4MX7A 3EOYG 2IBZY 3E6FA 4XP4H 1FZOB 3KPMA 5IQ9B 2FBOJ 2VISA 4M4RA 4RAHA 5DJAA 1MEXH 43CAB 3O8XC 3V6OA 3JWDH 5EU3A 5CEXA 4PJEA 4KK6D 1F90L 2L4OA 1E4KA 4BSWB 1SBSL 3D0VB 3SY0B 5DT1L 3IVKA 1WWWX 5IHZA 1FYTD 3UTSD 3V5DA 3LSOA 2AV1B 3BKJL 1B88A 3GSXB 1P7QA 4KKBC 4XB7A 1OGTB 2GFBB 2HFTA 1GGIL 2Z35B 2ZJSL 3U36B 2NY4D 3BDYL 1EMTL 5FOBA 3BRFA 2Z4QA 3E6HA 4QHNB 3DRQA 2XG5A 4HWBL 3FTGB 2Q6WA 4LCCC 2EKJA 4P2QD 1QSEB 1ACYL 1ZE3C 3KWWB 5DHVB 3KVQA 3WDIA 5I66B 3MV9D 4WFHE 4OM1L 2VLLB 5ANME 1XGUB 4MCYB 1NEZB 1XF4B 4YHPA 4WI3A 2EDOA 5FM5O 2Z92B 4AM0A 4FQIL 4QHKI 3TO2B 4M1CC 2J2ZA 4NRYA 1M6OB 1FYTE 3UTSE 1IM3B 2A6JB 4PJ9D 4Z8FL 3MZGB 4RNRB 1PGRB 4K7PH 5GZNC 3IYLW 1DDHB 4PJGA 5FK9A 4XTRC 2UYLB 1UENA 3O2DL 1Q0XH 5F7FA 1HNFA 5IVXF 4P2QE 4JPKL 2PTTB 3HI6H 3WUZA 2GK0B 2IC2A 1JMXA 1RZGA 3RNQA 4HIEB 4JQVA 3VGDA 3MV9E 4I5BB 1CVSC 4PG9A 5IW6A 4M8VA 1AXTH 5E5UB 4JRXD 4YPGB 4OLWH 3D85B 3UTPD 4PTTB 1H15A 4XPBL 1OAQH 1RUMH 4YQXH 1C16B 3ARDB 4ONGL 4YAQA 3IGAA 1Y6NR 4HJJL 5D7JC 4FP8L 4YHNA 5C08A 1L9MA 3EKCA 4MQ7B 1P1ZA 4XNYL 1JHTA 5FYKU 1I75A 1DQMH 1FP5A 1ZLWH 3BP4B 2VLJB 1F6LL 3W9EB 3IFLL 1CXIA 3OX8A 1BBJA 5CJOL 2UZIL 5GRUL 1P4BH 2E9IA 4UQ3B 1R3JA 3KS0J 1DQQB 3VWJB 3SDAC 3SGKA 1KNOA 2J5LB 3FQXB 2UWEF 2UZXB 4ODXA 3U9PL 5F7KC 1YEJL 1U92B 2GW5A 4OZ4A 3V6BR 2P44B 3KPNA 1NBQA 4CMHB 3E8UH 3VGBA 3QXDA 1WVZA 4PYHA 4IHOA 4NZRH 2XN9A 4XCNB 4ZSOA 4RIRB 1KN4H 4RWYL 4NCC2 4JRXE 5FXCH 5JW4N 5FO7A 1FV1A 4MVBC 1KFAH 2IGFL 2VDOL 4PB0L 1NMBL 3RVVD 2CRYA 3MLRH 3GRWH 2EECA 4PP1C 3FN9A 4R0LC 4JY4B 1BD2D 4HD9A 1CWVA 4JFFA 1DQDH 1WZ1L 4YHKH 5EZLA 3VWKC 1IAOB 1JMZA 4NO0A 5CBAA 2JB6A 2DDQH 3PL6B 3QHTC 4HSQA 4ERSH 5C9JA 3MXWL 5E2WH 1C12A 2HRPL 3RWEB 4PJDB 3TA3A 2ORBH 4J3SA 4DZBB 5EUOF 4F7EA 4XNMA 3UBXA 5F8QC 1NGZA 4LL9A 3LKSB 3CK0L 1LILA 4LCWD 5T1DH 1LK2A 3VI4F 3ULUL 1PLGL 4MB5A 1WUNT 3VXUB 3HPJB 2DLHA 4FXKB 5H94B 1YEKH 3W2DL 2ICWJ 1KJVA 3B2VH 1QRNA 1JWMB 3TN0B 1WBXA 4N0FA 4C55A 4YDJA 3TBYA 1AQKH 3R0MA 4OKVB 3HE7D 1E27A 1BD2E 1Q8MA 2O5YH 5HHVH 5JUEH 5LGJB 4NRZA 1T20B 3ARBC 1U3ZA 3EDEA 3IDYB 3Q6GH 4K3EH 4S1RH 3TO4D 5F9OH 2V17L 3QRFM 3QISA 3BKCL 4X99B 1ZA3A 1EDQA 3U7YL 5AWNH 2B1HH 1SEBA 2DJ4A 1D6VH 4D9LH 1MWAH 1DUZB 1MFBH 1K5NA 2FIKA 4EDWL 4MZ2A 5HI4D 1KBGH 2YWZA 4LCWE 4WWKB 3MA9H 1ZT1B 5HHOD 1KB9J 3QZWG 3MA7A 1I1FA 5IBTL 5IFJA 12E8L 3F12B 2WAHA 4QCIB 2FGWH 3Q48A 3V0AC 4DFIA 4NUJA 2P46B 2D31B 2BHUA 2H9GB 3T8XB 1EAJA 1LK3L 3FRUA 4ZUSB 4KZDL 5FECB 1IAKB 1RQ5A 1RIUL 3QAZB 2MWCA 3BWAA 3FB8B 2DQGH 1YEFL 1JL8A 3Q6FA 4PJEF 3LKNB 2EDWA 1NGQL 1YEEH 2OTPA 3AAZB 5E8DH 4JRYE 2PXYC 4CN6A 5BCAA 3JTSB 2F53A 3O3AA 4P46B 3NAAH 1VFAB 4P59L 3RQ3A 3U83A 5DDHB 1I8MA 3GHBL 2Q86A 2DQTL 1LO0H 1GHFH 5C0FA 3GSOB 4PBVC 1D9KB 5HHOE 2W07A 1FCCA 3QXTA 4GRWE 5BZWB 2YC1B 1ZGLP 5JQ6H 4JR9H 5D1QD 1R5VA 15C8H 3D39B 4J7RA 5I8KL 2EIBA 3I02B 2HJKB 3P77A 5C3LD 4YK4B 5CBEB 5C07A 5DF0A 3EZJB 1EZVX 1QSVA 4KKLD 4PRPB 5HVWA 1KTLB 4P4KB 3ZE2F 5JLZA 4HKBA 2AJSH 2CK0H 1MAML 5HGBB 1HH6A 1PX3A 1PKQE 1YY8A 4YHIA 4LPVA 4R96A 1JZ2A 1F00I 4X4ME 1NEZG 5EBWB 5GISL 5F6HJ 3HC3H 2D7MA 3RVUD 3TZVD 4HPOL 3HE6A 1DBJL 5ITBH 1AO7D 3PWVB 4JM2D 3QIWD 4LKCA 3RKDC 4MCZB 3V5KA 2DKUA 3F7VA 1EFQA 4GRLB 1EGJL 5IB1B 4IOFC 2AV7A 2CR3A 1CU4L 4PJGF 4FTVD 3HZVB 1JYVA 3GK8L 1CD0A 1MCSA 4MNQB 5L8JB 1TJHH 4M03A 5HVFB 8FABB 2A6KA 4TQEH 4KHTH 4YUEL 1IEBB 5FOJA 3F7YA 2EDNA 2WP3O 2M1KA 5FYJL 1MFNA 5IB2A 3MFGB 2COQA 4O2EB 4AEHL 3GSQB 4JKLA 5E94A 3VH8B 3EHBC 1HHKB 1YEDB 3O45B 4Z76A 1QFUL 1J88A 3RX7A 3QI9D 1RV6X 1F4XL 5F1IB 2EH8H 3QPXL 1DE4B 3TP4A 1T7WA 3ULVH 1N5YL 3G04B 5I6XC 1ZHNB 1U8NA 1AO7E 4M7JH 5C09B 1W0WB 2QQLH 3KPRB 4N0UB 4QTHB 4IS6A 5J06A 1K4CA 4LCUA 2R4RL 2GCYB 3RUGE 4PRAA 1WWAX 2DKMA 4FTVE 4P5TA 5KBNC 3WS6A 4P2RB 1BEYL 5CINH 3SBWA 4NJ9H 4YHLL 1JZ4A 4PJBA 4XBEH 1QSFA 4GG8A 1MH5A 4Y4HB 4YX2L 4Q6IA 4AEIL 1LMKA 4LLWA 4D8PA 1NFDB 1FNSH 1TCRB 2Z31C 1OGAD 1VGKA 3DROA 3L7FA 2BFVL 2LV4A 2Y72A 5DVMA 4FMFA 2ARJB 3EOAA 3PXHA 2QKIB 2LVCA 2P5ED 5IK3B 2Z8VC 1A64A 3NA9H 3AGVA 2P4AB 3V0WH 1DQLL 3MBEB 3VI3F 1K3IA 3HG1D 3A6CH 1A9EA 4UNUA 3QPQD 5FEBA 4FMKA 3CCHA 5CIPA 1DVFB 1HQRB 4L5FH 1FL6B 1BFVH 4NQDA 4PLJD 1BFOB 5AZ2H 4DVRH 3RZCB 5C0AB 3RJQB 2VZ1A 4Y1AB 4KFZC 1KTDB 3CFCL 1S7TB 2X05A 3F6IA 3BUYB 4G80B 4OCSL 4TPRH 5F3HA 4P23D 1U8IA 1XZ0A 1CT8A 3MREB 1L6ZA 4LVOC 1OGAE 2R0WH 1P9MA 3MRGA 4BYHA 5FO8A 2XPGB 2NY2D 4WO4C 2VXUH 1K8DB 3L3JA 2R8SL 4JDVB 1ZS8B 3QUYD 4U1IA 2P5EE 1UACL 1BOGB 1DLFL 4PBXA 3ZT5A 4TSBL 5EA0H 3HG1E 5CWSA 1JZ3A 4YDIH 5T1LB 3R8QA 5BVPH 3MMEB 1T04A 1P2CA 3OB0H 3O3EB 3WKNA 1E4KC 4L4JA 5T5FH 4DZ8B 4UV4L 4LRNL 3MTRA 5EBMB 5J8OA 1U8QA 4HQQH 3IDMB 4Z7VA 4BZ1H 1D6EB 4Y4KA 4DW2H 3OG6B 4OTXH 1X5GA 3MJGX 2F54D 4G6JH 3RGHA 5TGBA 3CZFB 1W0VA 2ITDB 1EHLL 4YBLC 2FEEL 1FLRL 1FO0A 3MJ9L 1RJLA 4PJ8A 5CP7B 5DYOA 3CDYA 2YXFA 2RCSL 3BH8A 4KK8D 2WANA 2F15A 1WBZA 3B3IB 3SCMC 3H42H 3ESUF 4KJQC 5FYKD 2MPAH 4BELD 3NH7L 1WFUA 5FB8A 4R4BB 4X5LA 5HPOA 1Q72L 2C1OB 3GM8A 4M6OH 2GKIA 3ES6B 1XIWD 4XNXH 2IMMA 4JZJB 3Q5YA 5EOCH 3EYVB 2EDFA 2VXQL 1U8KA 1MFAL 1S3KL 3ZHKA 1FE8H 2EEAA 3S96B 3V4VL 3ZSSA 5I73B 1JUFB 5JXAH 4HS8L 1A2YB 4NC0B 1CICD 2R69H 3DUUA 5DRXB 3SDXB 1EBAA 1I8IA 2PW2B 1NC4D 2NX5D 3GBMH 1KJMB 3UEZA 5AAWA 2MSPA 1ED3B 3OQ3B 3MCG1 4HWBA 1IM9D 1NCWL 3QCTL 4HWZA 4UB0H 4Y2DD 2F54E 2NY6B 3GM0A 3VXPB 3DMMB 2X4SA 4AH2A 2HN7A 2AK1L 2CO6B 1X4XA 2AJYH 2RJMA 3MUGB 1BZ7B 1OW0A 4JQVC 5FYKE 1KIPB 3U0TA 5D7KD 4OT1L 4PJFA 3TYFB 5JHLH 4AQOA 4GO6B 1RULH 2X4OB 2VL4A 4MZ3A 2R1WA 4X6DE 4GMTH 3MJ8A 3QCVH 3TBVB 4C56D 3TIEA 1MCWM 5D1ZA 3X11B 5C0IB 5DR5L 3BZ4A 2YD4A 4WEBH 3KJ4C 4M5ZL 4B7LA 1CLOH 4GKZB 5EB9A 1HHGA 2FJGA 2NX5E 4E9LA 4FZ8H 1UZ6F 1KG0A 2H2PD 3EFFB 3O2DA 4U1LB 2ZKHH 1KCSL 4NO2A 4XI5D 1T1YB 3O9WC 4Y16D 3QDMD 4GXUN 5DD3L 2W92A 4ETQB 1XGPA 4QRPB 1WT5A 3UAJD 2NMSA 3WHXA 3P9LB 5LG1A 3OZ9H 5GJSL 4C4KO 4EI5A 1MJJA 4H5SA 4JHZA 3NCCB 3RHWF 1A22B 4ZTPL 3VH8G 4KMTH 1GGBH 1NCTA 8CGTA 2FZ3A 4C56E 4MA7L 4PJAA 3KYMA 1EO8L 4J8RA 2MQ0A 5JW4M 1OWRM 5L88L 1RU9H 1OCWH 3TJHC 4LVNB 2B39A 4D3CH 1ZVHA 2EYRA 5DJCA 4NN5C 5DD1H 3VRJB 1N4XL 1NBYB 3PIQA 3R1GL 2Q3AA 5GRVL 3UYRL 4PJBF 3TA3C 4MAYC 3HNSL 5DJ6A 4XWOC 5F88A 4CVWA 3QDME 2AJ3B 5CSGA 1G9MC 5IR1B 1KIRA 1JHKL 4NRXB 3C60B 3TPUA 1QNZL 4M93B 3MRMA 3WL9A 1KJ2L 3MGTA 1WEJH 3ZHDA 4LAQH 3P4OB 4Z9KB 5CJXA 1NLBH 5HDBE 4G42A 4PJCA 1JYXA 2R39A 2OJEA 3L9RB 1MCOL 3L6FB 5IHUH 3SDDA 5GHWL 1Z5LB 4MNHB 3L3GB 3RY4A 3MACH 2XY2A 1R3KB 1WCBB 3TVMB 2IPUK 4HEPG 2ADFH 3D87B 1D5IL 5EO0A 1RPQA 1P7KB 3KXFD 1Z9MA 4GXVL 5IMMB 4TNVF 3DUSA 1R3LA 2F58L 4JG1L 5BOPA 3RFZC 1I4FB 1IGMH 1ZWIA 35C8L 4CVUA 4JLRB 3GMNB 2BXZA 5DJYB 4OZIB 4GW5A 4IRJD 4NM4H 2O61A 4LU5L 1URLA 1PQZB 3FB5A 3MRQA 4D0BA 1A6UH 4R4ND 5IESH 1K9TA 4JKPH 1QR1A 4AG4H 5ESAB 5BXFA 3MRDA 4G8GA 3BWUC 4JDZA 1SYVA 1G1CA 4HH9A 4M7ZB 3SGDH 5CP3A 3P11L 4ZXBA 3FAWA 4KRPD 4Y5XC 4HWUA 4CADB 1OP5H 4MXQD 4O4YH 3GB7B 1MWAB 5AD0B 3O8XB 5DTFB 5M95B 1JPGA 2A6DB 1KC5L 2X9XA 4LKXB 4PUBH 3RPIA 2VDML 3KXFE 2VDKL 3V2AR 2GTZB 2GAZB 3QUZA 3BD3A 3B5GA 1JGEB 1OAYL 1UCBH 2BJML 2ZCKL 3DXAB 4KUCD 1AH1A 5JPMB 1A6WH 3DURB 1LO3L 2E6PA 3RAJH 1IGJB 2FCBA 4LP5A 5D71L 4YNYB 5M7QA 1EO7A 1DSFL 4Z7VF 1Y18B 1K4DB 4ODUB 2HT3C 4DGYH 1V3KA 4LCCB 1AGFA 3IDXL 5DZOA 2OQJB 4Q0XL 3HC0A 4LSPL 4NBXB 4LBEA 2HYMA 3Q0HA 1U2HA 3DX9A 4O51A 4KK9D 1J5OL 4JPVH 4ZUWA 1MI5D 3O11A 4G6KL 3ZDZE 1TNNA 5CMAA 1RIVH 4Y8DC 4QWWD 2GJZB 4F3FB 2XXCB 1ZLSL 1OB1A 2NY1D 25C8L 3SE9L 3FFDB 4K2UH 4NQVA 1GC1L 2CRZA 5ISZB 4M7LL 1U8HA 2ZUUA 4NO5A 3DVGA 4PGBB 1BP3B 4M6NL 2GSGB 4X4XA 2Z8WC 1F3JB 3HE6C 2HVKB 2C7UA 1AJ7L 3P4LA 5DEZA 2ZOKA 2CLRA 3QJFB 3P2TA 3AXLB 5EU5A 1FNGB 5BVJA 4XXCA 1F3DH 2VIRB 2H6PB 3U6RA 1MI5E 4MHHG 5KAQG 2OJZL 4Z0XA 4E41B 5C0CB 5F9JB 1M71A 3DPBA 3U4BL 4M3JA 1P6FA 3BAEH 1IGCL 1H8OA 4M9PA 4YZFE 3WUWB 4KKCD 3GDBA 3CVHL 2X5PA 5D7JB 3FL7A 3CH1B 5DK2A 1ZHLB 4LDEB 4PJFF 3D25A 3VXOB 1U8PA 1W2KT 1GGUA 1FG9C 4JRXA 5B4MD 3TH3T 1NGWA 2JIXA 2GJ6B 4OF0A 2IADB 3P4NB 1Q1JL 1A7OH 4XHJD 2I9TB 3SDAB 4KMQA 1GIGH 3B4NA 2B20A 1AXSA 1HH9A 1KGCD 4WV1A 2YPLA 2ATPA 4XX1E 4LEOB 2R15A 3IJHB 4OQTL 2J6EL 4PRHD 3LKQA 1TQCC 1WISA 3B9KB 2QR0B 5K9OA 3VFPA 3LEVL 3BGFB 1OAUH 5DJ8B 4P5TC 2UV3A 1JNHA 2XTJD 4S1QH 3SBWC 1RD6A 4YO0B 3PP4L 2BNQB 3OKNA 1BVLB 4XBGB 2Q7N