1H0DB

Crystal structure of human angiogenin in complex with fab fragment of its monoclonal antibody mab 26-2f
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
223
Chain Sequence
EVMLVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGGNTYYPDSVKGRFTISRDIAKNTLYLQMSSLRSEDTALYYCTRLGDYGYAYTMDYWGQGTSVTVSSAKTTPPSVYPLAPGGGGGGGAMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT, LIGHT CHAIN
publication title The Crystal Structure of Human Angiogenin in Complex with an Antitumor Neutralizing Antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 41
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2002-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h0dB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h0dB01
1QQDA 1RIHH 2D7NA 4JHZA 3MRFA 4I48B 4K2UL 1BBDH 4XHJC 4OZFA 5C86A 2UYLB 3EOAA 4XHJD 5D2LF 3IFLL 1YEJH 1J8HD 4K94C 1KENH 1W72A 5GGRA 1JPSL 2Q3AA 3T4YB 4WNQB 3BKMH 1F3JA 2XZQH 2DBLH 4X8JB 5IB5B 5DJ8A 2NZIA 1YPZA 5I9QB 1QPPA 1WF5A 4S2SA 2EDBA 4UILL 1WCBA 4TSCL 2VAAA 5DTFB 2AK4E 4LF3A 1L0YA 2VZOA 3MTRA 4JR9L 3WD5L 4NGHH 4L9LB 4TULL 1X7QB 3PXJA 5A43C 3MNZA 2FJGB 3VWJD 3FQTB 1B0WA 2VC2L 3DJ9A 3GRWA 4FQJH 4Q0XH 1TXKA 2FJHA 1KBGH 1K6QH 1UJ3A 5BOPA 5EBLA 2HFFB 2MHAB 2OP4H 5DZNA 2ICWA 3VA2C 2JELL 1PKQB 1DLFL 1JGLL 2XPGB 4JZOA 1OGTB 1UXWA 4HC1A 3TNNA 5DR5H 4F15C 3F8UB 1BOGB 1ZTXH 2NTSP 3IDIB 1HSAB 2NTFB 3QFJD 5D7KD 5GGTH 5A2LH 4DVRH 3BMWA 4LIQL 4GAYB 4UDUB 1WBXA 1G7HB 2J8UB 4MHHG 4D8PB 5F3BA 2JK5B 1YZZA 1Z0NA 3VFTA 1JE6A 4JO1L 4WWKB 5FGSA 5IV2B 1NCNA 4MNGB 5JDSA 4NP4L 3RGHA 3RIFF 1I7RB 5KS9E 2EDFA 4XMPL 3VMPA 3VA6A 2H45A 2VLRA 1F2XK 1X5LA 2P47B 3WL9A 5AYQA 3KXFE 4KKBC 1FZJB 4KKBD 4WY7L 3KLSA 4DKEH 3BUYA 2BVPB 4R96B 2OMBA 1TMCB 1RJCA 3AXLA 3VGFA 3N1GC 3C6LA 4MMXC 1AGFB 2BRRL 4FQLH 5D8JL 1O7VA 2J3SA 4PTTB 1AIFB 3MO1B 4Z5RB 1K4CA 2XNAB 3GJFB 3HUJA 1T66C 2YN3A 3V6ZB 1T66D 3C08H 4K7PH 5DQJB 3OKEB 4OD3H 1Q0YH 5SWQB 1U3ZA 3IDNB 1GPOL 4XNZB 3QCTH 3KPSE 4RAUB 2CGRH 4Y5VB 3T1FB 5JHDD 4PJ7E 4ZOBA 2OL3L 5F9WB 3GIVB 3AU1A 2X7LB 3BRFA 1R3HB 1N26A 1NAML 3RVVC 3RVVD 4R4BB 1NAKH 3VG9B 3SKNA 2IMNA 4PGDB 4RAVA 2ARJA 4LLUA 3RY5A 4JRWA 3O2VL 3RWJB 1AD0A 5J89A 5D70H 1EEUA 4PJ9B 4PBVC 2DQFB 5EO0B 2VQ1B 3MGOA 2H32A 3X11B 2EIBA 3MV7A 1J8HE 1HH6A 1AP2A 4E9LA 2R2HB 1D5BA 3VE0B 4QHLA 4YHNB 5DJ0A 1T7ZA 2OJZH 1U8HB 5I66A 4AEIL 3O3AB 4TPRH 3QEQB 4K3DL 4DKFL 1TITA 4ZOEA 4G80B 3VFPA 3RBSA 3HZYB 1N8ZA 3Q3GB 4BA8A 3G6DH 4P2OC 5FOBA 4MD4B 4TVPD 4ZD3L 3VXOA 4P2OD 1C1EL 1BZ9B 4AQOA 1K85A 1ZA6B 4Y2DA 1RULH 3P9WB 2WINB 1RUQH 4HIXH 2VLJE 3QQ3B 1PY4A 3CSYB 3K46A 4JFPA 2CJUL 5HPOA 2FLBT 1P4LA 3BGMB 3WHXB 5HHOE 3BXNB 3DRTB 4P5TB 3STZA 4HPYL 3HLAA 1DBAH 2I5YH 2Q8BL 3KLAB 4ZUTA 4Z18A 2JCCB 4GO6B 5D6DC 4XBEL 5HYQB 3P9MA 3OV6A 1IAKA 4ZAKB 4K71B 1YEHH 4M03A 2C7UB 3FQXA 2F58L 2BNQA 1B2WL 4PJBA 1ZHLB 3QFJE 3QPXL 5D7KE 3U9PH 4Y5YC 1KEMH 3QIBB 5A16A 5MEOA 5KAQF 5GGQH 4BKLA 3VXRE 5D1ZB 1GGBH 5D5MA 4D2NA 4G8GA 2FYYB 4LQFL 3FOLA 4HSQA 1VFMA 5CHNA 1WCQA 4HV8B 5HVHC 4H88L 2B4CC 2F74B 1PZ5B 1S8DA 3V95A 1TZGH 1NCDL 4KRMB 4KHXL 1N6VA 4JHAL 4KI5C 2VITA 4KI5D 1S5IL 4LSRL 1CFQA 1A5FL 4XZUA 2H2PC 4GKZB 4GG6B 2H2PD 4KTEL 1SEBA 3U4BL 3JZ7A 4M8QA 3T4AA 2APWA 1N3NA 3PL6A 4ZS6C 2MQ0A 2NY5L 4ZS6D 5F3HB 1QBMH 1EEZB 4DEPC 3F58L 5AD0B 2DM4A 5C0CA 4OLXL 4YHIB 1IAOA 3B5TA 2HFEA 3IDYB 2XI9A 2XIDA 4XP9L 4J6RL 1OAZH 2BP3A 3B8YA 4P9HL 2Z91A 1I7UA 1E6JL 3SJVD 4PD4K 2DQTH 4LHQB 5J9PA 2O93L 1MFBH 3IU4H 4YFLF 4P2CG 2MCG1 2XV6B 4HUKB 2R0ZH 5D96C 1A02N 3KS0J 2A6JB 2IFFH 3QT2A 1UYWL 4P48A 4PG2C 4M5ZH 2EIZB 5JHDE 4XMKH 3BE1H 3E1F1 4P5MA 1JPFA 3H9SE 1J18A 1E4XI 5EBGA 2CDFB 3MYJA 4Y16A 2L7UA 4O58H 4OGZA 5TDPB 1FL3B 3Q1SL 4NBXB 2DQHL 2PTVA 2P7TA 4ELKB 1KB5A 4WJ5A 4KHTH 5FK9A 1JV5A 4M43L 4POUB 4R97B 1KELH 4MVBC 4MVBD 1FCCA 5DA4A 4WTXA 2V9QA 1HKLL 2BVQB 1CDUA 1UM5H 2N7AA 5J1AA 3UDWC 4J3TA 1R0AH 3FKUS 4MLIA 3UPAA 4GRWB 3X17A 1TNNA 5IMMA 2G5RA 2W9EL 1HWHB 3QEUA 3ARGA 2P5WA 3RTQA 1MQ8A 2I24N 4JFDB 3CMGA 1AXTH 3O8XB 1INQB 3SE3A 1IKFL 3QXAB 2D2OA 4HLJA 4GXVL 3UMTA 5IB4A 3UO1H 3QDHA 1F4AA 3BP7A 1VCAA 2VISB 3NACH 2VE6A 3QDMB 1RZJL 4G7YL 1AHWC 2VZSA 3LD8B 2EH8L 3SDXB 3ZT6A 4G7VL 2V2TA 1G9NC 1YMHB 5F7UA 4WFFD 5TFSL 4XVTH 4NQVA 1RJYA 5AWNH 1G1YA 1DBBH 3PGCA 5IB1A 4Z7VF 4CVXB 4GXUN 1E0OB 3B9EA 4MNQD 1IFHL 4OCWH 4P2RB 3UTOA 1HOCA 2X42A 1PX3A 4GQ9H 1VERA 1AH1A 5BMFL 4F9LC 3WFDH 4MA1C 3KPQB 1H5BA 3RVTC 3JTTB 3VFSB 3WXWL 4RWYL 1LK3L 4OLZH 3IS1X 4WHYG 3MBED 4XVSL 4ODWB 1ZLWH 1J87A 4KI5E 1AC0A 2FECI 4XWOC 2V17L 4ZQKA 4XWOD 5DVMA 1ULVA 3TVMC 3UJIH 1HN1A 3L3OB 2R9HC 2R9HD 4NIKB 3UTQB 1ZLSH 2Z8VC 1QNZL 5EU4A 5ISZB 3F12B 2OYPA 4X4ME 5E2VL 4LKCA 3D18A 4RQQA 2YD8A 1CFSB 2VLKB 1AGDA 1KG0B 3BWAA 2C3GA 5I75C 1WAAA 3QDGA 1I7TA 1SHMA 5IMLA 3RDTD 5EC1A 5D1QB 3SKUD 4JO4H 1NDGB 5CP7B 5FA4B 4WFHD 1XF1A 1NBVL 5FV2A 5C0BD 1JIBA 1CL7I 2FJFB 1VACA 3T77A 2GQHA 5FF6A 1JWMA 2BNRD 2JIXD 1X6NA 3PP3K 2FO4B 3VXMA 1S9XB 3EO0A 2H9GA 2GTZA 3F7RA 5IFAL 2Z31B 5I2IB 1NFDE 1Q72H 4N68A 2QQLH 4CNIB 5BV7H 4JCMA 5HGHB 5B8CA 5DMGC 4ZS7H 5DMGD 4D0CA 2AJSH 4ETQA 3L5WB 4V1DD 4KRLB 1G7PA 1MJ8L 1FDLH 4M93C 3U4EB 2B0SH 1KJVA 1MI5B 3OBAA 3KJ6L 5HYJA 4PGJA 3DUHA 4NBZB 5I1DA 4AIOA 3ZMRA 4NQEA 5T1DL 1XGPA 4MDIB 4QYOA 4XPFL 4MGXA 1FORL 5BZWA 5A2KH 5KN5B 1GGUA 5FYJU 1B4JL 5I1JH 3UTZB 2NY0B 4PV8A 2XRAL 3CSGA 2EDWA 3OKMA 3TN0C 5GQBA 3TN0D 4ODVH 2O26U 3TBWA 1QSFB 3VD7A 3MRJA 1N6UA 4N0CD 1CTNA 5IB3A 2BRQA 4CU6A 2FATH 3W0WA 5FKPB 4KROC 4KROD 4G9FA 3I2CH 1MCWW 3AB0C 3FONA 3DSFL 3DECA 1GGYA 1T89A 1JRHL 4BZ2H 2ADGB 1A9BA 2OL3B 4WFFE 3ZSSA 3L3HB 4G8IA 3CFKB 1RZFH 2AJVL 1NAMB 1OF2A 3FTGB 4ISVA 5MHSD 3OJDA 2JJSA 3RWCB 4O2CA 5JMRA 1A1OB 3MOAH 5DJ6A 5BQ7A 3QXDA 4NNXB 5HHMB 4KI1A 3WJJC 3RL1A 4ZO7A 2ZCKH 4O51A 5EU5A 4N9GB 3KPNA 1CVSC 5F21B 3UBXB 4R4FH 2ZUSA 1A8JH 5JPMB 4KJQC 2B2XL 4UV4L 2DLHA 4KJQD 1Y18B 2PNDA 3HPLA 4L3EE 1U92A 3E8UL 3ARDB 4X7TB 3WUWG 4HIJB 4K3JL 3SBWA 1MH5B 3G5YA 3OQ3B 4JGMA 3DOSA 2GJ6A 2PXYA 5EUKB 2R4SL 3GNMH 2GAZB 1U42A 4YWGH 4YDVA 2EDTA 5KVEL 1BAFH 2H3NB 5FM5O 3T0EE 3MRKA 4H8WH 3VG0L 2RJMA 5ACMA 5T1MB 1MFAH 2VDLH 4RFEA 3QIWB 1KYOK 3MNWA 1HYSC 3WO3B 2APBA 2CKBA 4UDTB 1GGCH 1H8OA 1P2CA 5F9JB 5DHVA 4TSBH 1TZHA 1YEDA 2NXYC 2HFTA 2NXYD 4WFHE 2EICA 3TBVB 1JF1B 2ZUYA 1YJDC 4WU5B 4IJ3B 1OPGL 5KSAA 1KJ2A 4QGYA 5IMOB 2VLRD 1OM3L 2QADB 4U2YA 3NZHH 2BNRE 1DL7L 4UT6L 4FQPA 1AFVL 4HWUA 3C09B 3HZMB 2P49B 3BP4A 3SE9L 3WIFA 3TYFB 3INUH 1F3DH 3FFDB 1CG9A 2B5IC 3O3DB 1GAFH 4ZDHB 3S3SA 3C6LC 3GFUA 4PGCA 3H2WA 1KTDB 3C6LD 3U7YL 3V4PH 4ZFGH 5IHZA 1SMOA 1XIWB 3QCUH 1F90L 4U05A 4YH6A 1RMFH 4HK3J 4OF8A 1B4RA 1I1AC 1KOAA 4NNYA 5C6TH 1I1AD 3N1FC 1U6AL 4JKMA 4NCDA 3I3DA 3KPOB 1TCRA 4WO4A 1G9MH 4CGTA 3NCYS 4R90H 3UPRA 3HE7A 1YNTB 1EDQA 4L4TD 5I74B 2BCKB 1B0GA 3BSZH 4FQXB 1RJLB 3VD9A 1EZVY 4LRIA 1BFVL 1L9MA 3VFWB 1I8MA 4UT7L 1TIUA 1IGFL 2JKXA 2V7HA 4JQVC 3V9FA 2J5LC 5CKGA 4M7ZB 1DQLL 2R2BB 3T2OA 1H3VA 1KLGA 1D7FA 2AJ3B 1DQDL 4LEXH 2A6IA 2L0DA 4C56B 3WDHA 4QXUL 1T2XA 3WFCL 3IDUA 1KIRB 5DO2C 5HGDA 5DO2D 3T0WA 2OXGA 4BH7B 4C83A 5BW7A 1MWAA 2P8LA 3VXUE 3NFPA 5C0AE 1URLA 2E27H 3MV7D 5GGUA 5CEZD 5ACLA 3IGAA 3MQIA 1IT9L 1EA9C 5F88A 4JKPH 5DQ9B 3WLWC 3WLWD 2XWBA 5L8LB 5F72S 3IKCB 1P4BL 2CLVA 3FQWB 4BFIA 2ERJB 3VXQA 1T5WB 5HXMA 4NSKA 3LKQA 3VFMB 4Y2DC 3GBMH 2KQNA 4XPAH 4Y2DD 4M9OA 5LBSH 1MJ7H 2ED7A 5IVZA 1CDJA 4ERSL 1IGCL 2LAGB 3V5HA 1GZQB 3FQUB 1HQRB 4GFTB 2IMMA 4Z7NE 4JFEB 3MJ9H 1FVDB 2OCFD 3NAAH 4LSSL 1LK2A 5M95B 3M45A 4TQEL 2JB5L 4W68A 2ATKA 4KRPB 2UWEB 4EI6B 5GJSH 1JGEA 2J8HA 3TO2A 2QHRL 1CT8A 3U4AA 4XC1L 3WFEH 3C5JA 2BNQD 1HHHB 4RSVA 4NRXB 3U0TA 3MJ8B 2ZCHL 5M94B 3QJFA 4O00A 1FLRL 2EZ0C 5JA8B 3MFFA 2EZ0D 3GSRB 1UXSB 4IS6B 4Q6IB 3GSWA 1M7DB 3OKKA 4G8GD 4MWFA 3RL2B 1U8NA 2BMKB 2XWTB 4R8WL 4GG8B 1M05B 1BZ7B 2X4OA 3GI9H 3VXNA 3DARA 4UAOC 1I9JH 5LAXB 5I0ZA 1UCTA 4LDLB 1BEYH 2DQIL 4LOUC 2WAHA 4G42A 1U3JA 4LOUD 5EU3B 1X5KA 2VLRE 3EYUH 4HK0B 3WSQL 5ITFA 4I0PA 1AY1H 3CCHB 4U1NA 1D5MA 2AV1B 3JTSB 1GGIH 4R2GC 1WSST 4LSQH 3MRBB 4MXVF 4PJEA 2AJUH 2IGFH 5IROA 4O2FA 2ATPA 1FG2B 3HNVH 3RWDA 4QRSA 4MJ5A 1HZHL 5C0CD 4EDXA 3TWCL 3GJFH 3MREB 4NM4H 3I9GH 5J6GA 2NY4C 5C1MB 2NY4D 2IPKB 3PUCA 3K1KC 1YQ2A 5ALBH 3CAFA 1VENA 3U0WL 1F00I 5FO9B 3WE6A 4HMCA 1EERB 4L4TE 2FX7L 4WW2F 2EC8A 5DK3A 5D9SB 5TH2A 1WGOA 5K59E 5E2UH 2VZTA 3LKPB 1CFBA 4LDEB 4QRTA 3CH1B 2GITA 4S1DC 2OR9L 4S1DD 3T0VA 3DXAA 4Y16C 4Y16D 4HZLA 1HE7A 4QO1A 4XWGL 2FX9L 4JFXB 4A6YA 5IKCB 3FB6A 2Z93B 1V8HA 2CR6A 3OPZL 1FZOA 3GMQA 3DGGB 2CIIA 1EHAA 4K8RC 4EXPX 1BF8A 3QH3A 4QHMB 4DTGL 3I02B 3LQAC 4PJXF 4LPYA 3U36B 2FDBP 3R1GH 4WFGD 4XAWH 2VLME 4FQHA 4JFZH 3ARGC 3RTQC 3EOBB 2OXHA 3ARGD 2P5WD 3RTQD 2ADJA 3EZ8A 4J3OC 4LSUH 1P1ZB 4L8CB 1MRCL 3TT3L 3FO9A 3SE3C 5JOFA 1LE9A 3UYPA 3D2UB 3BDBA 3L3KB 4L29A 5D7JA 4K94L 2X40A 1P69B 1FSKC 5IIEA 1EMTL 2PR4L 3QRFM 3CLEH 4Z95H 5TE4H 4O02H 3V2AR 5HPMB 1X44A 5JHLH 4K55A 3MV11 3BO8B 5E5RB 5ID0A 5A2IH 3C60B 5FO8A 5BS0E 4R0LA 3GO1H 4QOKA 1C5BL 2YKLH 2E5EA 3LEVL 4RBPK 5LWYL 1CN4A 2BNQE 5IM7A 4JDTH 1ZANL 3BZFA 2J88L 1JHTB 5DQDL 1PJ9A 1A6AB 4RX4D 4UNVA 1MRFH 1T7WA 2Q20A 4OZGB 5ILTL 3IETB 3TIDA 3DWTA 5E2WH 3VMNA 5E1AA 3PV6A 5E5MB 1UB5A 4LVHC 3O6LH 3VDCA 1BREA 1H5BC 4PJGF 2CXGA 3WUZA 1MJUH 5I1EL 1YN7A 2R1XB 2VB5A 4XPTL 1UWEL 3QULA 4O5LH 4M7KH 4XCEA 3EJYD 2F53A 1ZHNA 3U6RA 3D39B 5GJTL 1ES0A 3SEPA 4UTAL 5EC2A 2JJUA 1HINH 2OZ4A 5EU6B 5DLMH 2VXQH 4FFZL 3MUHL 5GRJH 3ZDZE 3ZYIA 1KJ3L 3AMLA 1ZWIB 4OT1L 1U58B 4JFFE 4YQXH 1N6QH 1UACL 3WUWA 5DD5H 5JW5A 3UXFA 1A7RH 3HC4L 4X6EA 3RRQA 1U9KA 3QDGD 4ZUSB 2JB6A 4HH8A 4YXLL 1I9EA 1ACYH 4HLZH 1PBYA 4KGJA 2AQ1A 4CKVX 3ZHKA 1OB1A 4FTVA 3SGEH 4CAGA 2APTA 2CPCA 3KVQA 4OZHE 2A9ML 1DANU 4Y4KC 1K8IB 5TF1L 4Y4KD 2YD6A 3ISWA 3BIAX 1D5XA 3F7QA 1J0JA 3I6GA 3L3GB 4QRRB 2R23A 5GSRB 5IQ9A 3D9AL 5T5FH 1CLCA 1D3CA 4MJ4A 3IB4A 5SX5K 4ZUWB 2AJYL 3EFDL 2NX5A 3GMPA 1UKTA 1MCFA 2MKWA 4Z76B 4ONGL 1LNUA 1BHGA 2VMFA 2FHBA 5B8CC 5DRNA 5L0QB 3M8OH 3MGTA 4FP8H 5I30L 5DD3L 4QRQA 4WENB 1F4XL 3T65A 5C8JA 4GRLA 3VRLE 5FUOH 4JHWL 1KTRL 3B2VH 5I18L 4P2QE 1IZKA 4U3HA 3OZ9L 5DYOA 3IDMB 1CGVA 4NHUB 2Z8RA 4GRWH 4NQED 4X9HA 4PJAA 4S1RL 3ARBA 2O5XH 2KH2B 4O4YH 1TFHA 1CU4L 4B7LA 2P5WE 2X09A 4M1CC 1HIML 2BSSA 3C2AH 5ITBL 3N9GL 4M1CD 1VADA 3QRGH 1AKJB 3THMH 3T2QA 3W9DA 3AREA 1CFNB 1BWMA 5CLWA 4H0GA 4L4JA 2LU4A 2O5ZL 2BDNL 4MJ2A 1F58L 3HC3L 4FFVD 5T3ZD 2I25N 4AEHH 1AI1H 3OF6A 1ZT1A 4QTIH 4YGVB 4YFLI 4PTUB 4YBLC 1QRNA 4CJ1A 3N1QC 1X6LA 2HFGH 1YEIH 2FL5B 5FYLD 2XKSA 3H42L 4G9FD 5EN2B 3V7AE 4O9HH 5J6HB 3QUMA 5HDBF 1NEZB 3DV6A 1T89C 1AGEA 5C2BL 1B9ZA 4TVPL 2O61A 4WI6A 4FFYL 1MNUH 5ESQB 2NW3B 2JJSC 3DX9A 4HWBA 3NA9H 5DUMH 2F54B 3CDFA 5GPRA 3MCKB 1BLNB 3N1PC 1OW0A 4PYHA 4L5FH 4OM1H 3IS0X 5DHYB 5ELIA 5HHQB 3S35L 1ERNA 1NBYB 4NQDA 1V7NH 4K2UH 4WUUA 4R7DA 4JM2F 4NQTA 3WXVL 3IFLH 3AROA 5DJCB 1JPSH 5L2KE 2AJZB 1ZT4A 1J88A 1WICA 3SBWC 4CMMA 3OKNA 2B20A 4Y1AE 3IAGC 4JO3L 2ESVA 3H8NA 2PXYD 4UILH 3U46B 3CSBA 1A21A 3LRSB 1F4WL 4TSCH 2FH8A 3LIZH 4E41A 5HGGS 4JR9H 4MJIE 3TC9A 3WD5H 4TULH 1PAMA 1DQML 2OSLA 4MS8C 1FYHB 3P2TA 4MS8D 3ELAT 3K4DA 5IMKB 5IEKA 4ZPVA 2VC2H 2P5EE 2ZSVA 3D0LA 5DS8B 2IALA 2W60A 1YY8A 1DEEB 3MLTB 5I16A 1I9RL 5K93A 1EIBA 5C08A 2R0LL 6CGTA 2PCPB 3BKCH 3OL2A 1EZVX 1M71A 1CIDA 5DA0B 2JELH 3EJJX 1R24B 4Z78B 4WEMB 1DLFH 1XCTB 5KSAC 5HYEA 1DE4A 2HJKA 4NN7C 5KSAD 3RWEB 4CVWA 5ANMB 3RZCA 4B0MM 5IW1A 4HZAA 4YO0A 1RHHA 5CSZB 4NQXA 3O11B 1KN2L 4JO1H 4PP2B 4PGZA 3MRNB 5IF0B 3DSNA 5IK3A 1A7NL 4NP4H 2E6QA 2YC1A 1T1XA 2DMKA 3S37L 5INDB 4XMPH 4HEME 3B3IA 3CU1A 5IBUG 4WO4C 1UQSA 3DRQB 4WO4D 5D7LA 3HE7D 4PRIA 4KDVA 1F8TL 4LCCA 1U95A 3CK0L 2OTWA 3KJ4C 4NQEE 2UVEA 3HS0B 4XXDB 5I71C 3JWOH 3L6FA 4LRIC 4J23A 4PJ8B 1WFUA 1D6EB 5ALCL 1CD9B 2BRRH 5D8JH 2OTPA 2HVJA 5E8DL 4F7EB 4HJ0C 3TZVA 3J8F7 4LDOB 4PJXE 4PG9B 1S9YB 4J1UB 5BW7C 4EUPG 3VXTB 4HH9A 1GPOH 2EDXA 2E3VA 3LKOB 2K7QA 2VABA 1KF9B 3QHTC 3ZDYE 4P3DA 4PREA 1I3RA 2OL3H 1XGUB 4KKNA 4NQCA 1H3XA 4MB3A 3KYKH 2DYPA 2QL1A 1FL5B 3LZFL 1NAMH 4RWHA 5CWSB 4BH8B 1IARB 5J13B 4AL8L 5SX4I 1OAXL 4LLYB 3IFPB 2YBRA 3O2VH 3PF2A 4LL9A 3HR5A 1CTOA 1GC1L 3MLZL 4LEOA 3UJJL 3VJ6B 4PJHE 1WBYB 4DUVA 3EYQC 4Q6YA 3EYQD 3MROB 4U1HA 4PJ7B 1KPUB 1DBML 3OGCA 4ORGB 1QSVA 4M1GH 1FCGA 4AEIH 1RAMA 4N8PA 3TH2T 4K3DH 4DKFH 1X5IA 4NO3A 2N56A 3C8KA 4RGMC 1WWBX 5DT1L 4PPTA 1EUTA 4ZD3H 3U30B 1C1EH 3BZDA 4MQXC 4PJGE 1CGSL 4MQXD 3CFEB 5L7XL 4J4PA 4UOW0 1P9MC 4DUXA 1ZS8A 4ODUB 3DUUB 5DGQA 3DROA 1J8HB 1ORQB 3LV3A 2CJUH 4IEFB 4NWUL 3R8BB 4GUPA 5F89B 1MHHA 2Q8BH 2PKDA 3BOVA 3VFRB 1I1YA 4TUJA 4OQTA 1NCBL 1JP5A 2WANA 3C8HA 4UQ2A 3ALWA 2F58H 3J7HA 2D31A 1B2WH 4CADA 3DTXA 1K5NA 5EPMB 3QPXH 5I8KL 4I0PD 5D7IF 3TNMB 3WYRA 3V4VL 4UTBL 3VWJB 3LN5A 5GS1A 2AXFB 1N59A 2G5BA 3RUGA 4O2EB 4BSVB 1MLBB 2K1MA 5IROC 3JUZA 3S7GA 1NCWL 4PGBA 5I1AB 4DGYL 2FR4B 3VRJB 3V6BR 1FGNL 2WBWB 4H88H 1MY7A 4HCRA 2ZZUT 3W9EA 1LO2L 3EUUA 2X4NB 4Y7MA 1EFQA 3PWVB 1NCDH 3BEWA 4KHXH 4JHAH 4N5EC 1F6AB 4F15B 1S5IH 4LASL 1DQJA 4HT1L 3QFJB 2XY2A 4LSRH 4N5ED 4YFDB 1A5FH 4GRMB 3LKSB 1PDKA 4KTEH 3U4BH 1D5ZA 4HGWA 1A6PA 4FXGA 2NY5H 3S6CA 1UA6L 1OAQL 3F58H 4OLXH 4QY8A 3TPKA 2WLZA 4PRBA 4ONHB 5KBNC 4N8VG 4MA3B 4XP9H 4J6RH 5C0IA 4P9HH 3H3KA 3QP3A 2XFXB 4MNHB 2I9TA 3ZTJG 5F7LB 1RZ8A 1E6JH 3CDYA 3ARQA 3WNNA 2FCBA 5DUPL 1MUJA 1RZ7L 2QQNH 4Z7UE 1UYWH 2DWDA 4E0RB 5L88L 4QCIB 4OKVB 1I7ZA 2Q8AL 3ARFA 1UM6L 3WEXA 2Y9RT 3C6SA 2ARWA 3Q1SH 2DQHH 3MLVH 4Y4HB 2NCMA 2MKLC 2E9IA 3TJHC 3ULVL 3TJHD 5I8CB 4M43H 1C5DA 2PW1B 3HZVB 2AKRB 4RMSA 5D7JC 1W72L 5D7JD 5JHDB 4JY4A 1HKLH 1Y6NR 3ZO0A 5IFJA 3MCG1 1JNLL 5EOTB 4X7SL 4LCWA 3BD4A 3VFNA 1JGVL 1IAII 2C1PB 2IANA 4R0LC 4QRPE 2HYMA 4ZYKB 2W9EH 3NH7H 4QOKD 1U3YA 2KDGA 2G75B 4NNPL 3NCMA 1IKFH 4LKXB 5DJ2A 3ULVF 3RA7L 3GRWL 3OG6B 4K9EH 3L3DB 1QLFB 1GIGL 4XP6L 5KOVC 5ESAA 4JDZA 1RZJH 2XTJE 4G7YH 3IDXL 3CNKA 4E42A 5TE7H 2EH8H 2FNBA 2ED8A 4MX7A 3PHOA 4G7VH 1T03H 3ARYA 3MA7A 1SEQH 4ODTL 3O2DA 5FDWB 4Y8AA 5TFSH 5I17B 4X99B 4HC1L 3IVKA 3FCTB 2DN7A 5IWLA 4I0KA 3BP6B 4MD0B 2F53D 3FOMA 3OMZA 4XRCA 2NW2B 1EGJA 2Y4SA 1IFHH 3MRGA 4HG4K 4WGWB 1KTLB 5INCB 1CZ8L 4ZUUB 3QG6B 4HPOL 4PRPE 1F45A 3MV8A 4RMTA 2EDEA 3QZWG 3TIEA 3ALXA 4X4XB 5JW3L 1M7XA 2CDGA 2GTWB 3F62A 5BMFH 1OGAA 4RWYH 1JWUB 3WXWH 5MEQA 3EIFA 3O3BA 1LK3H 3G04B 3TYGL 2YD2A 1YJDL 3P9LA 1JZ8A 1FZKA 3TJEL 4XVSH 4TTDC 5GRUL 1S7XA 5IEHB 4OQ1A 3QWOA 5I1GL 5K9OA 4Q2ZA 4X5XA 2V17H 4Y5YB 1BM3L 4R3SA 1KGCD 1GH7A 4FTVD 4QHNA 4KU1A 2IH3B 5D93B 3BZEA 3MV9A 4YDJA 5TGBB 1QNZH 1OD7A 2Y7QA 4NOFA 5E2VH 1HCVA 4U1GC 2NY2C 4PRAB 2NY2D 4NKMA 5HVHB 5FECB 2QLVB 1IILE 2P8PA 4Z7OF 3U1SL 3MUZ1 1AR1C 1AR1D 3OXRA 4IOIB 4K3GA 2X10A 4ONFL 1M7IA 3DUSB 3HCVB 4XNQA 3TBSB 1A6TA 3TBTB 1NBVH 3ESUF 5EOCJ 3F65A 1K9TA 3G9AB 4YFEA 3PDGA 4GRLC 4XCFL 3BHBB 1AC6A 4GRLD 4ELME 1UWGH 4BQ9A 2ZCLL 2BK8A 3WIHA 1II4E 4CW1A 2VR9A 3ARBC 3HC0B 3ARBD 5EDXA 5IFAH 5D71L 4NRYA 3OXSB 2M26A 4NZUH 1NGWA 3HUJF 3SJVB 3SGKA 3ARED 3I84A 5MERB 2Q7NA 2BJML 2AI0L 5JLZB 1JUFB 1MJ8H 5B38G 1NMBH 2ADIA 2B1HL 3ZHDA 2DLIA 1G7MB 3UTTA 3OF6D 3KJ6H 4YZFE 5CEZL 5C9KA 4C54A 3HI6L 5T1DH 4AH2A 4LLAA 1JGUL 2ID5A 4XPFH 4HHAB 3QNYB 1FV1A 4Z7WA 2YZ1A 4KV5E 1U8JA 4XPGL 4F7MA 5CEYA 4QOKE 3MGAA 1B4JH 3C5ZC 4D9LL 1A6VL 2E9BA 4XGZA 3PWPA 5D2NC 1IEAB 1IGML 2J8OA 2XRAH 1MVUB 3EOYG 2QTEA 4EUPA 4MDJB 5DD0L 1HXMA 1OW0C 4JFHD 1WBZA 4F58L 1NBQA 3DYPA 2WNGA 3IAPA 4YIQB 4NQDD 4LLWA 4WUUD 2Q7YA 1EHNA 4JAMB 2DJ4A 2NMSA 4NFDA 1BF2A 3DSFH 2V5MA 4JFYA 2DF3A 4RIRA 2A6DA 4PY8J 4HUVA 2AJVH 4KQ4L 4ZG1A 5L2JA 4UINL 5EO9B 4CMHC 1ORSB 4GMTH 3MRQB 4JREC 4E41D 5E6YA 2L4OA 4KK8C 1AD9B 4KK8D 5JNYB 1S3KL 3GMNA 1ROWA 4YHKL 1J0ZA 4KVCL 3VFVB 1AHWB 4ZXBA 4EKXA 2B2XH 4UV4H 2XTLA 4F3FB 5JORB 3E8UH 5C08D 3E6HB 3CJJA 5D7IE 4K3JH 1JPTL 3PNWA 4TUKL 2FGWL 2IADA 4OZ4A 3GMMB 3D85A 5DJAA 4OCYL 2H6PB 1KGCE 4FTVE 5KVEH 4MNQB 4Y4FB 5GS0C 5GS0D 5GGSB 1OT1A 3VG0H 3ZT5A 3RZCC 1BIIA 3RZCD 3MLSL 2X9YA 5D5MF 3VH8G 4N0YL 4YHOL 3OG4B 3SY0B 1MFCL 3DYMA 3K80A 3C9NA 4JM4L 2VN7A 4YHPB 1QG3A 3Q5TA 3MBEB 4HXBL 2Y1VA 4Y19E 3A67L 5IVXB 5IW6B 4KXZI 4GKOA 4OBSA 1VSCA 1OPGH 4G8FB 5DC0A 5D7LD 1OM3H 1ZT7B 4PRID 2HMID 4LCCC 1DTUA 4NZJA 1DL7H 4UT6H 2A83A 1AFVH 4I2XB 5T3XD 3FB8A 3FFCB 4E5XB 3L5IA 4YUEL 4F7TB 4XX1G 1TVBA 3QB7C 1RY7B 5KSBA 1EAPB 5F1OB 1KCVH 4XAKD 1KB5L 3U7YH 5KVDL 1F90H 3RDTB 4NUJB 2Q76A 4YBQC 3PWJB 4AEFA 4YBQD 1J9CT 2ENYA 1TPXC 3NCJL 1U6AH 4ZNEE 3TZVC 5C0BB 1OAYL 4D9RE 3TZVD 5F6IB 5CUSL 1WV7T 5DK2A 3NIGE 3LQAL 3P30L 4LNRA 2JIXB 3OR6A 4U7MA 1MRDL 4P4KC 1FL6B 2GSGA 2VAJA 3RU8L 1BFVH 1SJXA 1LEKB 1R5VA 4UT7H 4NQCD 1DUZA 2VL5A 3HI5L 2Z4QB 4N8VA 4YPGB 2DYPD 5MEPA 1JVKA 1SVZA 1KBGL 1DN2A 1FJ1A 5I1LA 2P8MB 1K6QL 1DQLH 5D2NE 2EC9U 1F3DJ 1LDPL 3BYTA 3IDJA 3ARZA 3UTPD 4V1DB 3TO4A 1DQDH 1KCSL 1P6AB 3FQRB 1WEJL 2V2XB 4ZTOL 1ND0A 4JFHE 4M93B 4P2YA 4QXUH 1MHEA 3WFCH 4OF5A 1PVHA 2I9LB 1N5AB 1K2DB 1MHPL 4YEFA 2OBGA 5BVJA 2EDLA 4CVZA 5CZXC 3W5NA 5CZXD 5ACZB 3L3JA 4LCIL 3OAYH 1ZTXL 5F8RC 5GGTL 5CJQH 1BMGA 1FNEA 4XI5C 5HYSB 5CBEB 2EYTA 1MFEH 4XI5D 3KDMB 1IEHA 2I26N 4WRLA 1IT9H 3BN9C 4F9PC 1DDHA 2YUWA 2YUVA 3BN9D 3M1BB 4I3SL 4KZEL 5CGYC 1P4BH 3TN0B 2R15A 5CGYD 4KJPD 1OTTC 1OTTD 4RZCB 5IOPA 3NPSC 1KPRA 4MCYA 5DEFA 4WIQA 1ZV5A 1Z2KA 1QQDB 2DB8A 4OLWL 2J6EA 3MRFB 4J4PC 3W39A 5I8OL 4J4PD 4OZFB 4KROB 4ERSH 2YD3A 1IGCH 3EOAB 3REWA 4X6CA 4GW4A 3AB0B 1W72B 4POYA 5GGRB 5I6XB 2EH7H 4GXUM 1F3JB 4LSSH 1FO0A 4FQIL 2V5YA 4NO0A 3GIZL 5DJ8B 5J06A 3O4OC 3JWDC 1YPZB 4U1JA 5JW4R 3N0PB 3FRUA 4TQEH 2JB5H 5LGKA 2Y25A 4S2SB 1S5HA 2RR3A 1OCWH 4TYUA 4U1SA 3V0WL 1ZLVK 1WCBB 2VAAB 4LF3B 4OZIF 4LAQL 4OI7A 2UV3A 2QHRH 5HY9A 4BELD 4XC1H 1QYGL 4I9WE 4FHBD 4D9QD 1TJHL 3MNZB 5GS1C 4OD3L 1ONQA 2ARJQ 5H2BA 2FJHB 4FQQA 1T0MA 2IH1A 4M7JH 5EBLB 1LVEA 2ICWB 4WVRA 1YN6A 1VFOA 2DQIH 3C5SA 2DQUH 5A1AA 4QRUA 4JZOB 5BXFA 2AEQL 3WSQH 1UXWB 3QHZL 3TNNB 4PRIE 2E7BA 3KLHC 3SDYL 4PJCE 3KLHD 3WCYA 3CFIC 4PJDF 4BSJA 4Z7OE 1WBXB 3QZWA 4EZMA 5HI4C 1EHLL 4FFWC 5HI4D 5F3BB 4XNUH 2C1OA 4FFWD 3GSXA 3VFTB 2GJZA 1IGIH 4XAKE 4D0DA 1KJMA 1HZHH 1WAAF 2EEDA 5JDSB 3QO0A 4OFDA 4LLQA 3TWCH 4M61A 1EXUA 4J3SA 2NXYB 4PRDA 4QTHA 3S96A 15C8L 2BC4A 3WFHA 2E7CA 4GAJL 2VLRB 4JG0L 3MRCA 1BFOA 3L5XL 3WL9B 2ZG3A 2FX7H 4I0CC 2F5AH 2XWJA 1DBKH 3BW9A 1CXLA 3AS1A 3QWRA 3BUYB 3RX5A 5LGJA 2B5IB 3AXLB 1TVHA 2FH6A 3KYAA 3C6LB 3LAFA 3LH2L 2OR9H 3ARFC 3ARFD 2YPLA 4LPCA 1K3ZA 4NKOA 5E5UB 2DJUA 4OB5H 4XWGH 1K4CB 5T3ZL 4W6WB 3HUJB 3LY6A 3QBTB 2DKSA 5CJ8A 1B0RA 1QFPA 5FYLL 3OPZH 1YNLH 3D6GA 1YEHL 5H37H 4YGAB 4RMQA 4H0HB 4IRJA 2IPTL 5EORL 4DTGH 4U6XA 4EQ3A 2DWEA 5FEBA 3AU1B 4LCWD 1AXSA 4PJFA 4XT1C 4NDMA 2IAND 2J5LB 5KTEL 5CAYB 1OWWA 2X9WA 3SKNB 1XR9A 4I8DA 4HUUA 4RAVB 2ARJB 1V7ML 4LLUB 4QT5A 2E7HA 1MRCH 5B38A 3TT3H 3ARSA 2A6KA 1AD0B 2DL2A 3T09A 1WZLA 1INDL 3CIQA 3CMOL 4HX1A 3MNVA 4N0UE 3MGOB 2H32B 4K94H 3MV7B 1EMTH 2PR4H 1HH6B 1AP2B 1D5BB 2VXSL 4QHLB 5DJ0B 2HT4C 5I66B 2HT4D 3VGAC 4KZDH 1JN6A 1S9KC 2R69L 5IB2A 4JANA 3VFPB 2DTSA 2WSKA 1N8ZB 5IWLC 1C7SA 3LEVH 5LWYH 2YA0A 5FOBB 3VXOB 1T4KA 3UCRA 1ZANH 4Y2DB 2J88H 4LCYA 5DQDH 3UYOD 3F7VA 3HAEH 5ILTH 1RUAL 5CEXA 1XAUA 1I85C 4JFPB 1CE6A 1P4LB 1FIEA 3MV8D 3STZB 1QKZL 3BE1L 4XMKL 3SDCA 2YMXL 5C0FA 3HLAB 4ZUTB 1OGAD 1TQBC 5I1EH 2EYSA 2P4AB 3O9WA 4XPTH 1UWEH 4ODBD 3QXWA 4LARL 3P9MB 1IAKB 3OHXA 1KJ2L 5HGAA 2AABL 2X1PA 3ULUC 3FQXB 3ULUD 2BNQB 1PKOA 4PJBB 5KSUA 3R8QA 5A16B 4UTAH 5MEOB 1OP3H 3NBNA 4XPBL 3G5ZA 1ZLUK 4BKLB 4FFZH 3KPRA 3MV9D 4RA3A 5L8KB 1D6VL 5D5MB 4G8GB 1Y0LA 5E7BA 4OT1H 3QISA 3FOLB 3HN3A 5CHNB 1QR1A 1MELA 4UAOB 5IVNA 3P4LA 4OF3A 1IGJA 4PJIA 1R0AL 3HC4H 2DQGL 4M6NL 1S8DB 1NANI 4YXLH 4WEUD 2VOTA 4UV7L 2BSTA 3I75A 1U8QA 1X9QA 5FYKU 2VITB 5ERWA 5BRZA 5F7MC 1CFQB 1ZHKA 2WZPD 1MFNA 4XZUB 2X1OA 4HFWA 4Y5XC 4R4NC 1SEBB 5FYJE 3NZ8A 4M8QB 4KDWA 2A9MH 4R4ND 3VH8A 3T4AB 4HS6A 5TF1H 1N3NB 3MODL 5CFHA 3PL6B 3NIFF 3O2WL 4JG1L 5C0CB 3D9AH 3CDGA 3MLUL 1IAOB 5AZEL 5MENA 2Z92A 1MCOL 2HFEB 1OVZA 2HN7A 5E7FA 1CXFA 2NY4B 4LFHG 3FN0L 3EFDH 1OLLA 4V2CB 2Z91B 1I7UB 3SGKC 4ONGH 5J9PB 1MWAL 5DDHA 4PLJC 4PLJD 2FWOA 5IW3A 3S36X 4BK4A 5DD3H 5C3LD 2HJFA 4JRYA 3D87B 2R1YA 4PRNA 3GSOA 2PO6A 4JHWH 3E0GA 4P5MB 5I18H 5EA0L 3G9VA 3OZ9H 3AM8C 3P77A 1JPFB 3BJ91 3MOQA 3AS0A 4NN5C 1FLTX 1CVRA 4S1RH 2PN5A 4U4BA 4H5SA 2IANE 3MYJB 4Y16B 1BWWA 3FT3A 1CU4H 1OL0A 1HIMH 5F7DA 3W5MA 5ITBH 3N9GH 3WFDL 3BVNA 2P7TB 1KB5B 4PRHE 3PWPD 4WJ5B 5FK9B 1FFOA 1JV5B 3KYMA 2O5ZH 1I75A 3CC5A 2BDNH 1F58H 3HC3H 3RIAK 1TETL 1V3MA 5EUOA 4JY6A 3ZKSD 4AM0A 4ALAH 2AK4A 1EO7A 3IT8D 4DZ8A 5J1AB 5MP6L 2AGJL 1T5XA 2NR6C 3H42H 2NR6D 3T3PE 1FYTE 5IMMB 2R0KH 3QEUB 3ARGB 2P5WB 1YA5A 3RTQB 4TVPH 4FFYH 5B3JF 3L9RA 3PE9A 3WNLA 2VDNL 4FQCH 5IB4B 1KPVA 3BP7B 1KACB 1FSKB 1NGYA 1QSEE 3GBNL 2VE6B 3BDXA 3IF1A 3S35H 3VXPA 4ZXBC 4ZXBD 5DMJB 3WXVH 4OZIE 2DMBA 4BSWA 4L4VE 3W11C 2V2TB 4WFEE 3W11D 2GK2A 1LP9F 2YRLA 4NQVB 1WFNA 1PSKL 1RJYB 1KIQA 1Z5LA 3PGCB 5IB1B 3WHE1 3D85D 1F4WH 1VGKA 5KS9A 3PWNA 2AJSL 1DQMH 1CBVL 2H26A 1HOCB 2ZNXA 4KAQL 3WO4B 1JPST 1WISA 4LVHB 3PG2A 1YC7A 1H5BB 4X6DF 5FOJA 2B4CH 3KXFA 5DRZA 2LFGA 1IQWH 1NDMA 1I9RH 3TT1L 2GSIA 2R0LH 3BP5A 5HTSA 3O3UN 5E4IA 2VO5A 5DF0A 1YMMA 4ZQKB 2AEPL 2PTTA 5LGHL 2EDRA 3UX9B 5EU4B 3MRMA 2E8ZA 4KJYA 4LKCB 3D18B 4RQQB 2HAZA 4NJAL 1AGDB 1C7TA 1KN2H 3BWAB 3KPSA 3CVHA 2Z35A 3QDGB 5GRVK 1I7TB 1A7NH 5IMLB 4JKLA 2FZ3A 5HI3C 5EC1B 3P0GB 4BZ2L 4XXCC 1CLYH 3REVA 4ODHL 2PYEE 4YHYC 3G6JA 1PLGH 5F1KC 1RZFL 5GS3A 3VGEA 1VACB 5GHWL 3NABL 3T77B 2XQYG 5FF6B 1F8TH 1JWMB 2EXYC 2EXYD 3NVQA 2VLLA 4NN6C 1QFWI 5T5NG 3MOAL 1VDGA 1IKNC 3DVFA 2FD6L 5GRYA 3VXMB 2X1QA 3EO0B 2H9GB 2GTZB 4MA7H 1OY3B 4J8RA 4LSDA 5ALCH 5K9JH 1P84K 4R4FL 1A7BA 3PWPE 2P48B 2DD8L 5B8CB 2AK1L 1TJIL 3ZKQD 5E8DH 5HVWA 3P4MA 4D0CB 4ETQB 4D0BA 3GSNA 3TO4C 3H6JA 4ZFZA 1G7PB 3TO4D 1A1MA 1E6OL 1KJVB 5HYJB 5I1DB 1BAFL 4NQEB 1XGPB 4QYOB 3VFUA 5AAMA 3G08A 2X4QA 4U2ZA 5BZWB 1F97A 1FN4A 2VLJA 1K3IA 3QXTA 4KY1H 1FVEA 4PV8B 2R1WA 5HHOA 1P84J 1Q9WA 3OKMB 4AL8H 2BX5A 4S0SD 1OAXH 1R6VA 4QKXB 3TBWB 1GJIA 3MRJB 3EYFA 5IB3B 5HD8C 2IEPA 4NZRL 3W0WB 5HD8D 4YBLB 4EQ2A 1J1XL 1GC1H 3MLZH 4OLVL 3UJJH 4NQUA 2ZKHL 1Q38A 4G9FB 1QFUL 3HHRB 3NZHL 3FONB 3DIFA 1DBMH 2P24A 2X4TA 3VXRA 1A9BB 3SKOA 4NO0D 4G8IB 2F9BT 4DN4H 3EZJB 3HNSL 3KYOA 1CXIA 1OF2B 4ISVB 2OZ4L 5DT1H 3F6IA 3OJDB 4LHUG 4U7SA 4O2CB 1SJHA 1RMFL 5FAAA 3D25A 4M62L 5FYKD 5DJ6B 5BQ7B 3B5GA 3QXDB 3RL1B 1CGSH 5L7XH 4O51B 5EU5B 4R90L 1SMAA 3KPNB 3C2SA 3MCLL 4NWUH 3I50L 1VFUA 3HPLB 1U92B 4JGUA 1X5ZA 3G5YB 1HXYA 2GJ6B 1H3UA 2PXYB 2EXWD 3NMEA 4YDVB 4M7LL 3VGBA 2IG2L 3MRKB 2CK0L 1DZBA 1UH2A 5I8KH 5K9QI 4KDTA 3V4VH 4UTBH 4RFEB 2D7OA 1RJZA 3BPOC 3MNWB 2RBLA 1AJ7L 1XR8A 1NCWH 4CUCA 2CKBB 1P2CB 5FA3A 3P4NA 4DGYH 2DQEL 1B3JA 5DHVB 1TZHB 1B6DA 3B5HA 4NCC2 3RQ3A 1YEDB 2QSTA 2F8XC 1GZPA 3H9SA 1MIEL 1FNAA 1LO2H 1QP1A 2LU7A 1QEWA 5SWZE 5KSAB 3V0AC 1KJ2B 4NN7B 4U1IA 3TA3A 4LASH 4HT1H 3GUTA 4G6ML 1GXEA 1NUGA 5F7YC 3AVEA 2EDKA 3D69A 4DOHB 5H35A 1NH6A 3BP4B 3WIFB 3QWRD 1MJ7L 1F42A 1CG9B 3EHBD 3ZHLA 1MCDA 1XF5A 4OCRL 1HI6A 1UA6H 2ZPKL 3CDCA 4PGCB 1OAQH 2EIDA 3B9AA 5IHZB 4DFIA 5I15L 3GKWL 4RCAA 2K9UA 2YPLD 1WZMA 3V6FA 3NAAL 1PYWA 4NNYB 43C9A 2C3VA 5IHUL 2BVOA 1MY5A 1TCRB 2HKFL 4WO4B 5FKAA 4PV9A 3UPRB 1U2HA 3HE7B 1A1NA 3BQUC 1DQTA 1WT5A 3SGDH 3SCMA 4P2OA 1RZ7H 1B0GB 1FP5A 3KJ4B 3QUML 2XACC 5D2LA 5I1HH 4IRJC 2R2EA 5L88H 4IRJD 4OF0A 4PJAF 4JPKL 2VZ3A 4HKJA 1I8MB 1G7LA 5KSVA 1U3HA 3GBLA 2V7HB 3H9HA 2Q8AH 4JDVA 1QSZA 4HWBL 2BZDA 1KLGB 1FIGL 1BPVA 2A6IB 1I9JL 3NCFB 4FMFA 3V0VA 4TN9A 3DV4A 5HGDB 4GW1A 1TDQA 4OZFH 4C83B 1MWAB 2P8LB 3TFKC 3TFKD 3EYUL 4FXKA 1W72H 3NFPB 4FQ2L 4OGYL 5B3JE 5GGUB 1V3LA 2LE9A 4X7SH 4M8VA 2LAAA 1NGPL 3IGAB 5F88B 3BPLC 4LSQL 2XWBB 3EYOA 5KZCD 2J8UF 2FLRT 2WW8A 1FFQA 4XNYL 2CLVB 4BFIB 3VXQB 1WWCA 1E4KA 4NNPH 4NSKB 4RGND 2GJJA 3LKQB 3P4OA 3BESR 2HRLA 4QHKJ 4G6JH 3RA7H 5IVZB 2W59A 3GRWH 3V5HB 1LP9E 5ICXA 1GIGH 4XP6H 3HMXA 1KIPA 3DYOA 1LK2B 3IDXH 3SDCC 3SDCD 2X6MA 5J1TC 5GGVL 3O9WC 1PQZA 3O9WD 4YHLH 2ATKB 2W0KA 3LEYL 4EEEA 4RGMB 1MCPL 5E56A 5GS0L 1XGTA 3U0PA 1JGEB 4HC1H 3TO2B 1CT8B 3C5JB 3IU3A 1UKQA 4X6DE 3O41A 3U0TB 3QJFB 1EV2E 3MFFB 3BFOA 3KPRD 2APXA 3GSWB 1CZ8H 4HPOH 2ZJSL 1TQCB 1GYAA 3OKKB 3CLFL 4MWFB 1U8NB 3GSQA 3ARWA 1Q8MA 2X4OB 2D7PA 4HEPG 3JV0A 3ZKXC 4X4ZA 1IGYA 4EN3A 4MJ6A 3OAUL 3TYGH 1YJDH 4G42B 1QVOA 5C6WH 5TQ0L 3FT2A 3TJEH 1OHQA 4DZBA 3QQ4A 4KUCF 5GRUH 4JFZL 5I1GH 4L1HA 1HNGA 2AV7A 1NFDA 4LSPL 5BRZD 5ITFB 4I0PB 4AJ0A 4D94A 2GYSA 4U1NB 5T3XL 1BM3H 1D5MB 3U79A 1C12A 4M3KB 3HZKA 4NQSA 1BD2E 6FABL 2W65A 2BXYA 4BZYA 5F1NA 4PJEB 1O5DT 5CILL 5EZJA 4O2FB 2ATPB 3RWDB 3PWUA 4QRSB 4MJ5B 3MX0A 3GSVA 1YY9C 5MEND 2YPLE 4EDXB 1YY9D 2XA8H 5J6GB 3UDWA 3L3IA 2DJSA 3MA9L 3U1SH 5C0NC 5C0ND 2EDDA 5SWSA 5DMYA 5DWUL 2EKJA 3TBYA 4ONFH 5KW9L 4RBPH 3RVWC 1N7ML 1IEBA 3MXWL 2F5BL 3WE6B 4U0RB 1T1YA 2HA1A 2AQ2A 3RHWK 4JRYD 5TH2B 1BJ1H 2YPVL 4XCFH 1U8LA 1Q9KA 1K4DA 2VUYA 4FS0A 1JI1A 2ZCLH 4P9ML 4C55A 1MRFL 2UY7A 4PJFE 4QRTB 2GITB 3F7YA 3DXAB 2IPUK 3STLA 4CN4A 5I9QC 4HZLB 1DVFA 1T7VA 3WFZA 4A6YB 3FB6B 1CGUA 1U41A 1MJUL 1CDIA 4HMEA 2JCCF 4L9LC 4PJ5E 1FZOB 3GMQB 3NFNA 4PS4L 4PLKC 2BJMH 1CCZA 2AI0H 2CIIB 2H32H 1A3LL 4PLKD 5IHLB 4U3XA 1JCKA 1Q1JL 2B1HH 3R06A 5CEZH 3IXAA 3QH3B 4GAFB 2AK4D 4F80A 2VUOA 1FVCA 1MCJA 3QIUA 1C8PA 1QUNA 2FIKA 2DAVA 2QR0A 4FQHB 1VA9A 2JJWA 4XPGH 5T33L 1NC4A 4D9LH 2ADJB 5HI5C 4GOSA 5CBAA 1A6VH 5HI5D 3HFML 1A7RL 2ZUVA 1IGMH 3FO9B 4L3EA 5JOFB 1LE9B 1S9WA 1Q9LA 4QWWC 4QWWD 4L29B 5DD0H 5HVFB 2FX8L 5D7JB 4F58H 5IIEB 2R29L 3TVMA 3FMGH 3D3VE 4X83A 1OTSC 4GG6F 2VDML 5LQBL 3T0EA 5ID0B 3SO3C 5I19H 1X5FA 5FO8B 3CU7A 4R0LB 3ILQC 4QOKB 4OQTL 3ILQD 4G43A 5IM7B 2Y5TA 4KQ4H 3BZFB 4UINH 3DVNA 4FP8L 1SJEA 1CGTA 2CIKA 3TIDB 4LPUA 1CDHA 3RWHA 5TDNA 2COQA 4K07A 1SYVA 4YHKH 5E1AB 3PV6B 4KVCH 4R7NA 3O0RL 5F1IA 1UB5B 3ZLQC 3B2VL 4HCRL 2BNRA 2W91A 1YN7B 1U93A 2DDQL 3KXFD 4EJ1C 3QULB 1N4XL 5C09E 4XCEB 3S9DB 1JPTH 4TUKH 4LHUA 4O4YL 2FGWH 4UI2A 1X3DA 2F53B 2YOCA 1ZHNB 5BRZE 1YMMD 3U6RB 4U1KA 1ES0B 4OCYH 2IC2A 5CIPA 4LPTA 5EC2B 3VI3E 5EO1A 4JZNA 3MSPA 4C59B 3NFSL 1QBLL 1RZIA 2I27N 3CUPA 3MLSH 12E8L 3PQYE 4FQ1H 4QTIL 5F9WC 3ZE1F 4EDWH 4N0YH 4YHOH 4DN3L 5FFLA 5EBWA 3WUWB 1MFCH 5JW5B 4KMLB 3KPSD 2NY1C 4JM4H 4KQ3L 4X6EB 2NY1D 4YX2L 3VG9C 2JB6B 2A77H 4HXBH 3ZYOA 1H8SA 3EDEA 3I3BA 4GRWF 2XICA 1P7KA 3A67H 3V7AG 3A6CL 1V3JA 43CAA 5DRXA 3ZE2F 3V5KA 1OB1B 4FTVB 4Y8DC 1QBBA 3OX8A 3QNXA 4H26A 1TZIA 1CLZL 1HWGB 2OS7A 4XX1E 1KC5L 1D5XB 3RIAF 4AT6A 3I6GB 2R23B 2NY2B 5IQ9B 4YUEH 5FHBL 1V7NL 4JY5H 4LK4A 3NIDF 3VXUA 4P57A 2NX5B 3GMPB 1KB5H 1JNHA 5C0AA 3SDXF 5KVDH 1LNUB 5DRNB 2YD4A 3MGTB 2MTPA 1FHGA 2RHEA 2A1WL 4LLMA 1IL1A 4QRQB 3NCJH 3FO2A 5A40E 1OAYH 4ZFOA 3CFBA 5CUSH 5EUOE 3T65B 5C8JB 2DM2A 4GRLB 2EE6A 3MRIA 4NYLA 2WUCL 3LQAH 3P30H 3LIZL 5DYOB 1L6XA 3RX7A 1MRDH 4WHDA 5DJXA 4PJAB 4JCLA 1A4JA 1KCRH 3ARBB 3B8SA 3WJJA 3HE6A 1VEPA 3RU8H 2VLJD 2BSSB 3HI5H 1VADB 3W9DB 3AREB 3H7BA 1GOFA 1ZKAA 5HHOD 1LDPH 4Z7VA 3PWLA 1KCSH 2VXVL 1WEJH 4ZTOH 3BKCL 1ZT1B 1QRNB 1MHPH 2J8UE 4LCIH 1BX2A 1U2CA 4WDIA 3O2DL 3QUMB 3OAYK 2QQQA 3DV6B 3LB6C 1AGEB 1G6VK 3LB6D 2WQRA 3GK8L 1UG9A 3DVIA 4M4RA 3VXRD 4DKDC 1I8IB 2O61B 4I3SH 1VEOA 4KZEH 2FBJH 5GRVL 1G7QA 1A0QL 4HIEA 4NO5A 4MCZA 3UAJC 1EGJL 3UAJD 3DX9B 4WV1A 5I1IL 3L95A 1I4FA 2GFBA 3K0WA 4HKXA 3T0BA 3VDBA 3CFDA 3JVGA 3UEZA 4OLWH 4Z7QF 5ESVA 4NQDB 3MRPA 4WUUB 5I8OH 4LBEA 4R7DB 3DHMA 2X89A 3QUZA 4Z6AT 4U6HA 3LOWA 3IDYC 5F7EH 1ZT4B 1H9VA 4FQIH 2X41A 3GIZH 3ULUL 4CMMB 3OKNB 1ITCA 3JWOL 2ESVB 1JGDA 1YMME 2AERT 4NC0B 2YS4A 4HIHA 3V0WH 3MV01 1S7RA 4CMHB 4F33A 4G3YH 4LAQH 4E41B 4JREB 1QYGH 1I1AA 2OSLB 4KDTC 3BPCA 1TJHH 1IC1A 5JXEA 4H25A 4KPHL 5IEKB 4ZPVB 1NPUA 2ZSVB 3D0LB 4MD5A 4L4TA 2IALB 2W60B 1YY8B 4UOW1 5I16B 1FNGA 4OV5A 5C08B 5DJZA 3MLYL 4M6OL 1YEEL 1M71B 3GHEH 3H9SD 4JVPA 3KYKL 3QCVL 4ODSL 4M1DL 3G6JE 3D0VA 2FEEL 4JQVA 1DE4B 2AEQH 2HJKB 3AAZA 3QHZH 3TA3C 3FZUC 32C2A 3TA3D 3WIHL 3SDYH 3RZCB 3RWFA 5IW1B 4NM8L 1T22A 2G9HA 1RHHB 4YO0B 1H3GA 1T20A 2UUDH 1X5JA 4NQXB 3SDDA 1EHLH 1NKRA 3AS3A 1NGZA 2OTUA 5CP3A 4GW5A 5IK3B 3S37X 2YC1B 4I18A 1T1XB 3O8XC 5DURD 4M1GL 2W1NA 15C8H 3B3IB 2QJDA 1UQSB 4GAJH 1LO0L 4JG0H 4TVSa 5D7LB 3L5XH 3ZKNC 1WT5C 4PRIB 5SV4A 5IFHL 4HGKC 3ZKND 3MLXL 1BQHG 4LCCB 2UY6A 3SCMC 1U95B 3HA0A 3SCMD 2OTWB 2A9NL 3DGCR 5E00A 3HRZA 2NLJA 4ZTPL 3L6FB 4XVUC 4XVUD 1U3HC 3LH2H 1U3HD 4LFHD 4KUZH 2HVJB 5HYIA 2IBBA 1CDYA 4JRXA 1CICA 5T3ZH 1TPXB 5IUSA 3TZVB 1U8OA 5BS0A 4PY8I 4ZSOA 5FYLH 3SDAA 4HH9B 5IR1A 2VABB 1RI8A 5BCAA 2IPTH 4P3DB 5EORH 4PREB 1GCFA 1I3RB 2X4UA 4Y2OA 1VB9A 3O6ML 2XZZA 4NQCB 4OTXL 5EU7E 3K4ZA 1T0PB 2DYPB 2D7TL 2VJXA 1ZMYA 5FUCC 3MOBL 1CQKA 1PFCA 5KTEH 2ZSWA 1E4KC 1V7MH 3UC0L 2YBRB 5E70A 3F5WA 4EIZC 5DEZA 3HR5B 5IJKA 2J7LA 1INDH 2R0WL 4GS7C 4LEOB 3CMOH 4Z77A 1G6RA 4IHOA 2FSEA 4U1HB 1J05A 4MB4A 1F3RB 2VXSH 3NCEB 3OGCB 3G5VA 2ZUQC 3K4AA 2WIMA 1G9EA 2EDNA 4JFFA 2R69H 3PIQA 4NO3B 3C8KB 2CK2A 1N2RA 5E08L 4YK4B 4K7FA 3GM0A 4KXZH 1EHXA 1J11A 2AEIT 1ZS8B 1CK0L 3FHQA 1UCBL 1RUAH 3DROB 3MPCA 2MMXA 3LV3B 2CKBH 5T1KA 2G60L 5C0JA 2QQNL 5DHVH 4GUPB 1QKZH 4OZHA 5E8PA 3U2SA 2YMXH 1MHHB 1IC5L 3O4OB 3BEVA 4KK9C 2ITDA 2YD5A 4KK9D 4CDGC 4EN3C 2L7JA 4EN3D 1I1YB 4LARH 4TUJB 1S7QA 1KJ2H 3OAZH 1RSFA 2AABH 1I9IL 4JLRA 1LILA 3B6SA 4UQ2B 1UENA 4UIKL 2D31B 4CADB 3DTXB 1K5NB 3MLVL 5DUBA 3UZEA 1I1CA 3QDJA 4QF1A 5JQHC 4HJJL 4XPBH 3LN5B 5AAWA 5GS1B 3VWKA 1N59B 1OP3K 2G5BB 3RUGB 5C92A 1UVQA 1D6VH 1OSPL 25C8H 4PD4J 3V8CA 1MCQA 4GRWE 4EXKA 4PGBB 3V5DA 1G7JA 1U0QA 4HQQL 3ZE2E 3BMVA 1IJ9A 4P2QA 2HG5A 4X8XA 3W9EB 4HIIA 2DQGH 4M6NH 3QEHA 3GMRA 1CR9L 4PBXA 3BEWB 3HB3C 4UV7H 1BGXL 5SWSD 3NH7L 3FB7A 3HB3D 1XH3A 4F8QA 4I3RL 1DQJB 1HYRC 3EOTH 3QDME 1RIUL 2VIRA 1S78C 1SBBA 4UT9L 5D2LE 1D5ZB 1S78D 3FQNA 3SDXE 3MMEA 4HGWB 1JWSA 3MODH 3LSOA 1QA9A 3EKCA 3O2WH 4FXGB 4JG1H 4K9EL 2F15A 3MLUH 5AZEH 2Q6WA 1CD1A 4QY8B 1MCOH 3IAQA 1DVFC 1XF2A 4PRBB 1DVFD 4K7PY 4FA8A 3B9KA 5TE7L 3FN0H 5C0IB 2I9TB 4P0DA 3MBXL 4WWID 1RZ8B 1T03L 1UZ6F 1SEQL 5CZVL 2V9TA 1MWAH 3PDDA 4P2RE 2QHLA 4OJFL 2UWEF 9CGTA 1MUJB 4HJGA 3OKOA 5BJTA 2DWDB 5EFIA 1FZMB 5E1HB 3CZFA 4PFEA 3BYYA 4U0QB 5EA0H 2CLRA 1EEYA 3GMLA 3QIUC 2CRZA 4RX4A 2FBOJ 3QIUD 1YNKL 2BVTA 1I7ZB 1NJ9A 2I07A 2YR3A 3UP1A 3CPLA 3ARDC 3ARFB 1RHFA 3ARDD 4TUOA 3WEXB 4M9PA 5FUCE 3IXTA 3S8WA 1NC4D 3C6SB 4R9HA 1GOHA 2BXZA 3S98A 4AIZA 3RVTD 1I1RA 5L2KA 2XKUA 2J6EL 4L3ED 1C5DB 2V7NA 5ISZE 1W8OA 1SY6A 3PP4L 4IIQA 4Y1AA 1TETH 1J8KA 4JY4B 1KCUL 1KCKA 4U1MA 5IFJB 1FO0L 5L9DH 3TVMD 5MP6H 4MJIA 4LCWB 3T1WA 2AGJH 3VFNB 1YEFL 3T0EC 4OUUA 3G5XA 1F6LL 3S4SG 3T0ED 2FRGP 2IANB 2A73A 2ZUXA 2E7MA 5KVMC 4N90E 5GSVA 2VSDA 4CU8A 2Y72A 1FFRA 2P5EA 5FYKL 1FC1A 5IBTH 2VH5L 5I1CL 5IJVA 5HYFA 2EYRA 2HLFC 4AQ1B 3MRLA 5DJ2B 2HLFD 2VDNH 4DGVH 1AGCA 2APFA 1U8IA 3VDAA 1KLUA 2D9CA 1AO7A 4LIQE 5FXCH 3GBNH 5ESAB 4JDZB 2BHYA 4E42B 5DRWA 1YEKL 4Y4KA 1UWGL 3VD5A 4AG4L 3VGAB 4HW6A 4MX7B 3PHOB 4G8EA 3MA7B 4RMVA 1Q94A 3RI5K 3BIKA 4GT7A 3IVKB 1EJ6A 1PSKH 2VL4A 2GK0A 4LHUD 2BY0A 2DS4A 2XYCA 1FGVL 1MI5E 4NZUL 3Q6FA 3FOMB 4B7IA 4XRCB 5C07A 5DVKA 4WW2A 5I74C 3MRGB 2NZ9C 3VW3L 3HMWL 2NZ9D 3R0NA 3CX2A 1CBVH 2BOBA 1NMBL 4WHYH 4KAQH 3MV8B 3UROR 2XZAL 3RHWF 1OARL 2EDQA 1JTPA 3TIEB 5HGBA 1K8DA 1VHPA 4KGLA 3AFLA 4H1LG 2CDGB 3PHSA 1OGAB 2WP3T 1MF2H 5MEQB 5J1SC 3O3BB 1TQBB 2HRPL 3T0DA 5B3NA 3P9LB 3TT1H 1FZKB 5SWSE 3ZYJA 1S7XB 2DOCA 3QWOB 5K9OB 3VMOA 1QSFE 4Q2ZB 5EULV 4X5XB 2AEPH 3NGBC 5LGHH 1J12A 4JVWA 4R3SB 4QHNB 1LEGA 2NQCA 3RVUC 3RVUD 3BZEB 3MV9B 4YDJB 1PEWA 2DTMH 2Y7QB 3FN9A 2VZVA 1BQSA 5I8EA 3P73A 2Q87A 4PJXA 4YDLC 4DVBA 2PW2A 4NKMB 4CU7A 3NCBB 4NJAH 4A6YH 3VXUD 2P8PB 4RFOL 3ORJA 4JFQA 5C0AD 4X9IA 3OXRB 1ZSDA 1M7IB 3CGTA 3WHE0 4XNQB 3ZZ1A 1A6TB 4ODHH 4JFOA 5HHME 4OCSL 1E27A 3KPPA 1CQYA 1JNJA 5GHWH 3NABH 2GUOA 4JZJA 1JK8A 4DAGL 4MXWH 1HKFA 5IT2L 5DGRA 4GMTL 5E94A 3X12A 4CW1B 4N9OB 2EE2A 2FD6H 5F97E 4OZGF 2W0FA 3HE6C 3HE6D 2YA1A 4NRYB 5DMKA 4PJHA 3KYNA 3O6KL 1KULA 1JYNA 1NGWB 4IDJH 2J4WL 1MLCA 5IBUB 1KB9K 2DD8H 1R5IA 2AK1H 2CSPA 1TJIH 4NPYA 4KFZC 5D6CA 2ZP0T 1ZXQA 4K3EL 3MR9A 2ADIB 1BQHA 1E6OH 3UTTB 4AENA 2X9XA 3SKJH 4HULB 3ABZA 4AH2B 1VFBA 4NHCL 2PF6A 4FZEL 1WTLA 2DIBA 4NN5B 1IGTA 4GKNA 1FV1B 2YRPA 4PJGA 1UGNA 4Z7WB 5JOEA 2HVKA 4DK6A 1U8JB 4F7MB 5CEYB 4J3UA 2NY3C 4WHTA 2NY3D 4OLUL 2KZ1B 4XGZB 1PD6A 3X3FL 4X5LA 1A64A 4XP1L 5ECJE 3PWPB 1HYSD 2YSSA 2RFXA 4WV1C 4X7EC 4EUPB 1E4XL 1FPTL 2V9RA 5GIRA 1HXMB 3D48R 4NZRH 1WBZB 3JVGC 4M6ML 1FFPA 1J1XH 4OLVH 3HAEA 2ZKHH 4LLWB 5CJXA 1RZGA 2Q7YB 2YWZA 3QUZC 1QFUH 2X89D 3QUZD 3O3EA 4XCNA 3JV4A 4JFYB 3SE8L 4OCMC 5FGBA 5H94A 2RIKA 4FG6C 4RIRB 2A6DB 3PGDA 4HUVB 2CLZA 3E2HC 2XQYK 3L1OL 1ADQA 2GY5A 2D0FA 1KCVL 3HNSH 5L2JB 1L7TL 1KYOJ 5TF0A 2OZ4H 4HWZA 4M62H 2XG4A 1NANH 1R3JA 3CX5K 3L5JA 1JPGA 1MCRA 2OI9B 4JEGB 4MAYA 3GMNB 3MZGB 1X5YA 5JXEC 1J10A 4XCCL 4XMLL 5JXED 3AC0A 4ZXBB 1EK3A 3MCLH 1NBZA 1QACA 3I50H 5HDOA 1FNSH 5E6IA 5AYUL 5C0DA 1UC6A 2BHUA 1JTOA 3PNWB 4HWNA 2IADB 3VCLA 4C56E 2WMPA 4N1HB 4N0RA 4OZ4B 5DJDA 1ZHBA 3D85B 5DJAB 3WMSA 3OKDA 1JL8A 4FZ8L 2F8VA 5F8QC 3QHFH 1A6WH 4M7LH 2D9QB 5SV3A 3N1MC 2IG2H 3X13A 2CK0H 2RGSA 1BIIB 5KANG 1C08A 2Y5EA 3L5HA 2VDOL 1DP0A 3SDDC 5HDQL 3DO3A 3SDDD 4PUBL 5D1XA 1AJ7H 4JGJA 3C9NB 4Z7UA 2W9DL 1EPFA 2DQEH 2H2SC 5CJQL 4I18C 2H2SD 1MFEL 1OSZA 3ZSTA 1MIEH 2ICEA 2N1KA 2HH0L 2CMRL 4LP5A 2ILLA 2VLMD 4KJWC 1OT2A 3LN9A 4KJWD 4G6MH 3KHQA 2GHWB 2A83B 2AQ3A 1ZVSA 3FB8B 5IESH 2DQJH 2HJLA 3KNBA 2FECL 3BKJL 3QQNA 1MAMH 1TVBB 1S9VA 5KSBB 2VR4A 3ROLA 1QR4A 4OCRH 2ZPKH 3TEUA 4NZTL 5I15H 3GKWH 2Q76B 1TTFA 2EH7L 3ZDXF 5ICZA 5HDLA 3VI4F 1CICC 4Z7VE 1Z9OA 4JRXD 5D72L 1CICD 3EYVA 2WBJA 5IHUH 1ZLVH 4QRPA 5BS0D 2HKFH 3BT2L 3CXHK 1OCWL 1OTUC 1OTUD 1CE1L 1NFIA 5DK2B 3SDAC 4UU9A 4YPJA 3SDAD 1YYML 4LNRB 3OR6B 4NN6B 3QUMH 4JM2A 4F8TA 4OBRA 4WTZG 2GSGB 5FGCB 1ZGLA 4XBPA 2UZIL 4OIIL 4JPKH 1R5VB 1P9MA 1DUZB 5FV1L 1CL7L 2VL5B 4N8VB 3WN5A 4XH2A 5MEPB 1FJ1B 5I1LB 1ITBB 2Y6SC 4M7JL 4HWBH 2Y6SD 3IDJB 4JHBA 1PG7W 1FIGH 4G9DA 2VR5A 1NCCL 3TO4B 3A6BL 2R2CA 3FO0L 1ND0B 2CUIA 2GKIA 1MHEB 3SPVA 4LVOB 3VRIA 2DQUL 5I1KL 5IJKC 5BVJB 2DI9A 4OCNC 2QQKL 4CVZB 4I4WA 5TE6H 5C7XL 1CIUA 3L3JB 1M6OA 2A38A 4MZ2A 1H8NA 4FQ2H 1VKXA 4OGYH 5ADOL 1FNEB 2FB4L 2EYTB 3U7WL 1KNOA 3JBG7 2MOVA 1NGPH 2X5PA 4NKDA 4R2GD 4UB0L 2OK0L 3TCLA 1U91A 1DDHB 4XNUL 5ENWA 4PRPA 4XNYH 1IGIL 1WZ1L 4JFFD 3RBGA 1RK1A 5F7FA 1E28A 5IOPB 5JUEL 3X3GL 4X4YA 1KPRB 4MCYB 5DEFB 1HDMB 1MCEA 3FB5A 5DC9B 4YDIL 1CLOH 5FDYA 5ADPH 3ETBF 4N8CL 3W39B 1HHJA 4F7CA 3REWB 4X6CB 4GW4B 4RDQF 1QLEL 3QWQB 3O6FA 3S4SA 5C0GA 5T1KD 4L1DA 5AEAA 3W81A 2F5AL 1DBKL 1FO0B 4NO0B 4UQ3A 2JLLA 1T0NA 4U1JB 4JKKA 5GGVH 3FRUB 5HVGB 1WLHA 5L0QC 1S5HB 5E4EC 3LEYH 4U1SB 1T1WA 1MCPH 3T8XA 5GS0H 1E4JA 5HY9B 4OB5L 4RISL 2KPNA 2C3HA 4K7PX 4LLDA 3QDJD 2AEWA 4NBYB 3QUXA 3VWKC 1ONQB 3VWKD 3AUVA 5H2BB 1YNLL 3CVHL 5C3TA 2ZJSH 4FQQB 3RNQA 3CLFH 1T0MB 2IH1B 2DM3A 2ORBL 4K8RD 1A47A 1W0YT 4ELMA 4YC2C 1I1FA 4P2QD 1YN6B 3SOBL 3C5SB 1P4IL 3OAUH 5TQ0H 4QRUB 4TTGA 2OJEA 3D5OF 5DVOA 3EO1A 5BXFB 2Y07L 3U9UA 1T21A 2VWEE 5TPWH 4LSPH 1NUNB 2XZCL 1BQUA 4EBQL 5T3XH 3V4UL 3T2NL 3RZWA 3H9ZA 1YQVL 1JNNH 6FABH 3QZWB 4HUXA 2DQDL 3BPOB 4H1LA 2C1OB 2VKWA 3GSXB 2GJZB 5CILH 1WFOA 4HGMA 4YLQT 4D0DB 1KJMB 1FAIL 3QDAA 3QO0B 4LLQB 1PW3A 4PJ7F 4M61B 3GSNL 1EXUB 2QSVA 3B9KC 4JRXE 4OKDA 3MA9H 3B9KD 4ZUVA 3SQBA 4KZDL 4PRDB 4QTHB 3S96B 2BC4B 3WFHB 2UZYB 3MRDA 4FXLA 5DWUH 4ZSOE 5KW9H 3MRCB 1BFOB 1N7MH 1QBAA 3MXWH 5IQ7L 4OZGE 1G7IA 5K9QG 2F5BH 4L3CA 1HCFX 2GW5A 3MRHA 4UNTA 1RK0A 4JVUA 2XWJB 3MJ7A 2YPVH 4RRPG 3BW9B 5ID1A 4DQOL 4P9MH 5LGJB 1TVHB 4XNXL 1C16A 3F6LA 1CFVL 2YPLB 4NKOB 3K81A 1A7PL 3Q48A 3D39E 1IM9A 3UYRL 1CYGA 5K9KA 5B39G 5L2KD 1B0RB 4JJ5A 4PS4H 2AXGA 2H8PA 1A3LH 4IIQC 4TNWK 3ZTNL 1Q1JH 4Y1AD 1IBGL 5DK0A 3X14A 1HHGA 1ZLUH 4IRJB 2W0PA 3QEGL 4WI5A 1DSFL 4U6XB 3LN4A 5CD3A 2DWEB 4MJID 5DSCA 1AXSB 4PJFB 4NDMB 1BJ1J 5JIPA 4Q7DA 2VTFA 5T33H 5EZLA 5JIIA 3WKMH 4WI2A 4KWUA 1OQXA 1XR9B 4UZGA 3UBXI 4HUUB 2P5ED 4XPHH 3HFMH 4QT5B 5B38B 2A6KB 4OI9A 4S11A 2OR7A 2AJXL 5D7IA 4F2MA 4HX1B 1TLKA 3MNVB 2FX8H 4F7PA 1AO7D 5B22A 5JDJA 1NMAL 2R29H 1XZ0A 2X70A 2VDMH 3LDBC 3F7PC 5LQBH 2J2ZA 5KZCB 1L9NA 4I5BA 1JN6B 1DUYA 2NYYC 4OQTH 1HILA 5IB2B 5EWIL 4F37K 4JANB 3LS5H 3LPWA 5CJBA 4RGNB 4ZOCA 1T4KB 3CZJA 3QDJE 4WW2C 2GEEA 4LCYB 5C07D 4Y19A 3F7VB 1T2QH 1G1CA 3QNZA 1ZA3A 5CEXB 4ACPA 4YBHA 1CE6B 5ABDE 3BKYL 2YEZA 4NWTL 4PJ8C 4M5YL 3O0RH 4MSWA 4K3HA 3SDCB 2I60L 5C0FB 1H0DA 1MCWM 4HCRH 1DLHA 4NT6A 4JN2A 1T6WA 2EYSB 3O9WB 2DDQH 4EIGB 3OHXB 3LKRA 1N4XH 5JZ7C 5HGAB 5E95B 5JZ7D 1U8PA 5DI8A 1DFBL 2X4SA 1QTYT 4X6BA 4PY7A 5KSUB 1NQBA 4OLYH 3K8KA 3G5ZB 3GM8A 1SVCP 3KPRB 3NFSH 4ZNEA 1QBLH 3BAEL 4FRWA 1Y0LB 1XF4A 12E8H 1MCCA 4DN3H 4LRNL 4ALAL 4P4RA 4YNYA 1QR1B 2NXZC 1R5WA 2BVUA 2NXZD 1A6UL 5GRWA 1IGJB 4PJIB 3BH9A 4KQ3H 2FHCA 4UMGA 8CGTA 4YX2H 3S3PA 3GGWA 1UZ8A 2DLEA 1NGQL 2F54E 2BSTB 2R0KL 3I75B 1U8QB 5FB8A 4HF5L 5ERWB 5BRZB 3A6CH 3C5ZA 1ZHKB 1I8IA 1UT9A 4URTB 3WS6A 4HFWB 2IJ0C 5GGVY 5D2NA 8FABA 3NZ8B 4JZJC 3VH8B 4HS6B 4AY0A 4W4OC 1CLZH 3RGVA 4FQCL 1KC5H 2QSQA 4Q9QL 3TF7C 2WUBL 5MENB 3CDGB 3EO9L 2Z92B 5FHBH 2VDRL 4A2LA 4KKCC 2HN7B 5I76A 4KKCD 4X7FC 2WIIA 2FHFA 1QPXA 5DDHB 2EECA 3RPIA 5LXGL 5C0RL 2FWOB 2VXTL 1OWRM 2A1WH 3PGFL 3WDIA 2RQ8A 2HJFB 4P46A 2DLFL 4MQSB 4GSDL 4JRYB 2R1YB 4PRNB 1NLDH 3GSOB 1I3VA 2PO6B 2WUCH 2DICA 4S10A 4LLVA 2VZUA 2YK1H 4QHKI 3P77B 1MIML 2G2RA 1A14L 3IFNL 4H5SB 3TM6A 3FT3B 5JPNA 1HH9A 5F7DB 3DX6A 5HHNA 1F11A 2C4FU 3BVNB 4XCYA 5FHAL 2B4CL 1FRGL 1Z6JT 5JO5A 4MA8H 1FFOB 1IQWL 2PYFA 3KYMB 3RI5F 1N64L 3ILPA 3CC5B 4JJHA 2KKQA 5ANME 2VXVH 3VWJC 1JBJA 5EUOB 4JY6B 3HMXL 1AO7E 4LCUA 4AM0B 4MXVE 5GZNC 4S1SL 2AK4B 4WTZA 5GZND 4DZ8B 5CJXC 1AQKL 1T5XB 1XMWA 3BPNC 2IBZY 2EEBA 3MC0A 3O2DH 5CJOL 5EG6C 4KVNL 5FGBC 5CCKL 1ED3A 3GK8H 1R3LA 2PETA 1T04A 1YUHA 1A0QH 3L9RB 4U6YA 1D9KA 1EGJH 3IFOA 1NCAL 3V6OA 5C07E 5I1IH 4WUKL 4BQCA 3ARRA 1KPVB 1CLYL 4KI5F 1NGYB 1XGRA 4MAYC 2OX5A 1PLGL 3IF1B 4MAYD 3VXPB 4X0KA 3EFFA 2BHZA 2LVCA 5I0DA 1MJJA 2MPAL 3SO3B 4BSWB 4PJCA 5E6IC 1IRAY 5E6ID 4YEEA 4C4KT 4EOWL 3ULUH 1R3KA 4MA7L 1KXQE 1ZAGA 1KIQB 3RNKA 1Z5LB 3DX8A 2V5RA 5K9JL 3ZL4L 2BNUA 1VGKB 1AGBA 5DFTA 5F9AC 5TQ2L 1KSRA 4HD9A 4GMSH 5KS9B 3PWNB 4JPVL 2H26B 1AE6L 4G6KH 1HK6A 4HJ0D 4KPHH 4W6YB 1P5UA 1HNFA 5D1XC 4LSVL 3KPLA 3KXFB 5D1XD 5DRZB 3BDYL 1MPAL 1NDMB 2Y06L 2P44B 4P4KA 3MLYH 1IZJA 2GSIB 4NKIH 3BP5B 4WCYH 4Y4HC 4M6OH 3KWWA 4Y4HD 3U7AA 1YEEH 5F7NC 3VFGH 1YMMB 1YYLL 3QA3A 4JO2L 4U49A 1NFDF 2BERA 3QCVH 2PTTB 4ODSH 4M1DH 4KY1L 2ED9A 4XP5L 4TRPL 4AZ8A 4DKAA 1NUDA 4W70A 4GLRH 3MRMB 2JF1A 3WIHH 1L0QA 5I73B 4KJYB 4NM8H 1VFAA 4XP4L 5FCSH 3O4LA 2UUDK 3ES6A 3KPSB 5DZLA 2NY1B 3CVHB 2Z35B 1JHKL 1G9NL 2FZ3B 5DD6A 3GZKA 1LD9A 3PABA 1ACZA 3REVB 2AP2A 4RMRA 1S7WA 2WBJC 4F9PA 3WLBA 3G6JB 2WBJD 4EI5A 4QRPD 1LO0H 4DN4L 1PGRB 2ZOLA 1P53A 1NC2A 5IFHH 5M7QA 2RAMA 3MLXH 3HG1A 3DBXA 2HT2C 2VLLB 1W8NA 1GOGA 4JM2C 2HT2D 4JM2D 2A9NH 2NY7H 3GB7A 3S97C 4ZTPH 1EO5A 4N0UA 4LPXA 4J8RB 3WN5C 1L6ZA 2CRMA 4NOBA 2XTJC 2XTJD 2XG5A 4EUPH 3P4MB 4QHUA 4JPIA 4POZC 2HWZL 1A22B 4D0BB 3GSNB 4POZD 4ZFZB 4YXHL 1A1MB 4YHZL 3KLDA 3NN8A 4RRPA 5T5NF 1BVKA 3DMMA 3SKMA 2YXMA 3VFUB 3G08B 2X4QB 4CL7A 3LS4L 1FN4B 5GS2D 3O6MH 4OTXH 2VLJB 3I6KA 2YXFA 2CRIA 4I1NB 5EBMA 2XN9A 2D7TH 3P11L 1FVEB 4NJ9L 5BZDA 3BGFC 4PRPD 2R1WB 3MOBH 5HHOB 1Q9WB 5B39A 2BOCA 3UC0H 3ME0A 2CUHA 3EYFB 3OKLA 4OM0H 4HXAL 5D93C 2EDHA 5JA9A 5IVXF 2R0WH 1JRHI 1H15A 1A3QA 3LHPL 3T0AA 3O6FC 5AUMA 3O6FD 2IFGA 3DIFB 3NA4A 2P24B 2X4TB 3VXRB 3SKOB 1DQQA 3SO5A 3QUKA 3KYOB 1KEGL 1ZOXA 2CH8A 1HHIA 1SJHB 1L7IL 3D25B 5E08H 2O5YL 3N06B 5FO7A 1HHKA 3NCYP 2A74A 2MQCA 1IQDA 5DJYA 1BOYA 1SJVA 1HSBA 1NLBL 3QUXC 3QUXD 3B9DA 4HK3N 1CK0H 4FN0A 1UCBH 1PEZA 2G60H 5IG7A 5I1HL 3A0OA 3IJYA 1FZMA 4KTYA 4APQA 3L7EA 1IC5H 1CGXA 1NMCC 3CVIL 1HXYB 3QYCA 4ORZC 2QSCL 3O45A 1IM3A 1I9IH 4UIKH 3CFCL 3OAZK 4XNMA 5DXWA 3S36L 2X4PA 3HR6A 1JZ7A 1SYSA 4PYGA 5EH1A 3U48A 4HJJH 2WP3O 1RJZB 1RZKC 2DIAA 1ODAA 1OSPH 3LCYA 5HDBE 1JZ5A 4X6FA 1XR8B 1JYWA 3HTLX 5FA3B 3P4NB 4HQQH 3S5LG 3STBA 1CDBA 1GSMA 3RVXC 1GZPB 3H9SB 3KPTA 3RVXD 5JOPD 4ZFOL 1XCQA 2EKSA 1QEWB 2GY7B 1CR9H 4UUJA 1BGXH 4OCLC 4U1IB 4HKZA 3TA3B 4I3RH 3GUTB 2K3TA 4NCC1 1RIUH 3D69B 4PRHA 5H35B 4UT9H 4YHML 2Y23A 5J12C 3ECBA 4G6JL 3C87A 4X5WA 4BYHA 5KG9A 1S7TA 1XF5B 1IAMA 1HI6B 1LO3L 3WFBL 3ZTJH 2AAVA 5C9JA 5EZOL 4HDIA 4TVPE 3V6FB 5DURB 1PYWB 1QLRA 43C9B 3ET9F 1FYTA 2C3VB 3QUYA 1IM9D 3MBXH 2BVOB 1YPZF 2IQAA 5IBLC 4YHLL 5CZVH 5FKAB 7FABL 2D4FA 4PV9B 5IBLD 1KXVC 1A1NB 4OFKA 4OJFH 2ZWLT 3M17A 3SCMB 4P2OB 4HAFA 4IRZL 4JPWL 5D2LB 1GC1C 4ZPTA 5DVLA 2R2EB 1L0XA 3T08A 1S7VA 4HKJB 5GGTA 1G7LB 5KSVB 1YNKH 3MFGB 1U3HB 3H9HB 1QSEA 2V2WA 1H3WM 4X98A 1I85A 1FFNA 4JDVB 1LE5A 1PG7X 5ETUA 1HEZA 4Z7NF 3PDOA 2OQJA 4OZIA 4PB0L 2YWYA 4L4VA 3V0VB 3GJEA 4Y4FC 3DV4B 5E2TL 4Y4FD 2J6EH 4GW1B 5E8NA 3RWIA 4M02A 5KVGL 1CD8A 3PP4H 4FXKB 2XKNA 4TTDD 4ZOAA 1ZK9A 3LKNA 5E9DA 1KCUH 1FO0H 1UWXK 4AMKL 1A9EA