1H0DB

Crystal structure of human angiogenin in complex with fab fragment of its monoclonal antibody mab 26-2f
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
223
Chain Sequence
EVMLVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGGNTYYPDSVKGRFTISRDIAKNTLYLQMSSLRSEDTALYYCTRLGDYGYAYTMDYWGQGTSVTVSSAKTTPPSVYPLAPGGGGGGGAMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT, LIGHT CHAIN
publication title The Crystal Structure of Human Angiogenin in Complex with an Antitumor Neutralizing Antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 41
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2002-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h0dB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h0dB01
4DCQA 2N7BA 3GZKA 2EDDA 2HAZA 1C5DB 1F4HA 5DDHB 3CSYB 3SKJH 5EIQA 2GTZA 4PJGA 2BSTA 1NQBA 1J1PH 3D85B 2VISA 3WHXB 1D5ZA 2VWEC 4XBGB 5IJKA 4P9MH 1MCQA 1L7TH 5D7IB 1WZLA 3RHWF 5JNYA 5I74B 4LPYA 5JPNB 2E3VA 3T0BA 2BNQB 4CDGC 4JDZB 4NQCA 1QRKA 5KN5A 3SE8L 4Y4FD 4ZSOA 2FYYA 2EIBA 4WWKD 3AROA 1J1XH 5J4MA 1RZ8A 1I8MB 2D7TH 4Q58C 4WV1B 2B5IB 3U36B 2H26B 2ZP0T 12E8H 2IMMA 4LKXA 4HEME 1P9MA 1VFOA 1DBML 2DLHA 2BRQA 4G9DB 5EA0H 2WP3T 3MLZL 1TDQA 1WTLA 2D31B 5B3JE 4OCYH 2YKLL 1EEZB 4X8XA 3BMWA 1WFTA 5E5MB 5FAAA 4Q6IB 4OLUH 2LVCA 3F8UB 4QRUB 2CLVB 2HG5A 4LSQH 1W72L 2G75A 2Z31A 4LHUG 3BKYH 2OI9C 3T08A 3PV6B 1CD9B 3ECBA 5IW1A 5CLWA 4QHNA 4XZUB 1LK3L 1Z5LA 2V17H 2GJZA 5HI3D 2AERT 5FA3A 1N64H 3OB0K 3QEGH 5F1IB 3CXHJ 2EDYA 3K7UA 4EN3C 4G9FD 1NSNL 3IGAA 3BN3B 4U1KA 4FA8A 3EYQD 3MA7B 1RZGB 1CD1B 1S7WA 1J87A 5LQBH 4LK4A 3KYNA 4HG4K 5HJ3B 1ZHBA 2VLRA 3PABA 4HUWB 3TYGL 3OKKA 3QZWG 5D8JL 3QQNA 1R3JA 4ERSL 1JF5A 1CFTB 3GMRA 2A9MH 1A7NH 5DJ8B 4L1HA 2XIDA 4AMKL 3G5VB 4G43A 4P2QE 3CLFH 3QT2A 5HHOB 3QDGA 4U05A 4FTVB 4Y16B 4A6YH 5KVGL 3NFPB 4NZUH 4NKOB 1DBAL 1BGXL 4RGND 4R97B 3T1WA 3OTTA 4Z77A 2P8PA 5CCKL 1KELL 1T1XB 5DTFA 5C86A 5DQDL 3DX8B 4OV5A 3E8UH 1OQXA 2HVKA 3MLSH 1IC7H 4MHHI 1U8HA 1VEMA 3O6LL 3DVIA 2E27H 5ESVB 5GSVA 3RDTD 2W60B 1B3JA 1C5BH 3O3DB 3IXTA 4O58H 4M1DH 1D5BB 3BPNC 2FB4L 2NY4C 3IETB 3IDGB 4RMTA 3UPCA 4MQTB 2HMID 1RUPH 3NCYP 3S35H 5C0RH 1RUKH 1T66D 2ICWA 3QISA 5J9PA 3V4PL 3MOAH 1OP5K 1I9IL 4Z7NE 7CGTA 1M71B 1A5FL 2CLRB 3MO1B 3NACL 3T0EA 2HKFH 1MCWW 2YBRA 4K8RC 1MVUB 2VLKD 4XAWL 1CI5A 3WNMA 2FH6A 3FRPG 1XR9B 4JJ5B 5I73C 4EBQL 1OT1A 5FV1L 1LP9B 2GY5A 3GSOB 3D3VA 1KYOK 2VUOA 1ZOXA 4XHJC 4XNXH 2IGFH 1KB9J 1ZHLA 5C92A 1DEDA 2JJVA 3IDMB 2YN5A 3MRPB 4L8SA 5TQ0H 2AQ2A 4HH8A 3FKUS 3CCHA 4ZO9A 1KJVA 2OJEB 1D7FA 3IFOA 5CD5D 1MY7A 2BNRA 4LDOB 2V2TB 3L95A 1NCCL 3SGKC 3W11D 4J3XA 3QO0B 4PJAB 4WFGD 3MFFB 2QHRL 3K46A 4JO4L 1W0WB 3AS0A 2CKNA 1KIPB 3DV4B 1AGCB 5TE6L 4TSCH 2VB5A 5FA4B 3PNWB 2IFGA 4Z7WB 1RZKL 4NO3A 4FP8H 1F58H 1I3RA 4IRSB 4YDVB 1WZMA 3BGMB 3VDBA 4G3YL 1QFWL 3GSNA 2BJML 2IANA 4G6KL 3OJDB 1AFVH 3UYRH 1NFIB 5IVZB 3H9SA 3BPOB 2EKSB 1WISA 1CD8A 5ISZB 4R7DA 3ZKXC 1LQSR 5IMKA 3O6FA 1FFQA 2QL1A 4RA0C 3C9NB 2X9YA 3P9MA 1HSAB 2FZ3A 1AIFB 3BEVB 3QNZA 3SDAB 5GRXG 1EK3A 4MWFA 4XPBH 3RUGE 4G8FB 3MOBH 4M7LT 2B1HH 1MCEA 4HGKC 2VDPL 1N6VA 4NIKB 3S37H 3GI8H 1MCPH 3LRSB 3GGWA 1G9NH 1Y18B 4GBXC 4JFEA 4LCWD 5BS0E 5F3BB 3GBML 4ETQB 4XP6L 1U2CA 1IGTB 2H1PL 3GIVB 2X05A 2NY2D 1ITBB 4LQFH 3WLBB 4YDLB 4PD4K 3KPPA 3L3DB 4MQ7A 4LSPH 5D70L 5GISH 4HGWA 3P0YL 2LU7A 4IM8A 2VH5L 4OTXH 1QFWI 4IRJB 4KDWA 1SYSA 4PFEA 3OAZK 32C2B 5D7JB 1ORQA 1B6DA 4PBVC 3FFDB 2DLGA 4K3GA 1G84A 5GJSL 5C2UB 35C8L 3C2AL 1KOAA 1KCUH 2RHEA 3QEQA 3I6GB 3ULUF 4MNQB 4MAYA 1MI5B 4YBLB 5GJTH 1XGUB 5IFAH 1I3VA 5D2LB 1R3IH 2R9HC 5IVXE 2YPVL 5E9DD 2YZ8A 2RB8A 3O3EA 1U42A 3U9UB 3VFUB 1ZLVH 4M8QB 1MFDH 1EO7A 1ZS8B 3GRWL 3HG1D 4WRLA 2DQHL 1N6QL 1IGMH 3X14A 2FIRT 4JFZL 4HAFA 1XH3A 3FONA 2YUXA 4C55A 2UZXB 3LEYL 4EEEA 4FZEH 4HDIB 2BOBA 3QHZH 5AYQA 1G6RB 3SGEH 3GHBH 3MRCB 4X80H 2CK2A 1EZVY 1X3DA 5FM8A 5TDNA 3TIEB 5IB3A 1IGYA 2DDQH 1CICD 4FMKA 4P59L 1XF2B 3C6SB 2FATH 3ALWA 3E6FA 4FQJL 5TE7L 3HI6L 2JTDA 4OFYA 5I74C 2DRUA 4QTIH 4ONGH 1F2QA 1T1ZA 4NM4L 4EIGB 1AHWA 3AVEA 2ZOKB 1TTFA 4M00A 4I0PA 3B5TA 2AI0L 5JHDB 3BKJH 3TPUA 2F53E 5J11B 4XVTH 5I1HH 1F13A 3BVNA 3BUTA 4HKJB 3MLUL 4JY6B 1EFXD 1FFOB 1R3LA 4WV1C 2X44D 2B5IC 2VJXA 1KLUA 5FCSH 1HN1A 1HH9B 1K8DA 1H5BB 1E28A 4UV4L 1ODAA 1QLEL 4KQ4H 1ES0A 1IAIL 3B8SA 1ZANL 1JWMA 5CD3B 4ZXBC 1S9WB 4EXPX 2VZVA 2Y7QA 2PYEE 3WXWL 3F5WB 4GG6A 3DROB 1BZ9B 4WI3A 2E8ZA 4Y4HA 2YEZA 4K7PX 4Q6IC 2XWBB 2YMXH 4FNLL 5F9AC 5KVEH 5C0JA 2O5YH 3W39B 5D71H 1YPZF 3MFGB 3T3PE 2EECA 3ILQC 4W4NA 1AGFA 4K71B 4E41B 1P4BL 4KJYB 5IKCB 3I02B 5FHBL 5FYKH 5IB2B 3KNBA 2FD6H 4GJTB 1FIGH 2VDOL 5AAMA 1OF2A 1KPRB 4HIHA 5D5MF 5C2BL 4OQTA 4HS6B 1DVFD 3IKKA 4HWBA 4X98B 3X13A 3VG9C 3D0VA 3ZT6A 1NLDH 5C6WH 1YMMB 3FT4B 1T20B 2FX8L 3P0GB 1NKOA 2WBJD 4ELKB 5F7EL 5E08L 2EKJA 2LVEA 3UDWA 4Y5XB 2MCG1 3W0WE 4WFFE 1IAII 2JIXA 5HHVL 1NMCB 3DXAE 4IHOB 4XMPL 4IJ3C 5INDA 3CFJB 2F5AH 4U6YA 3FB6B 3WL9B 5EORL 1AGBA 2P5WD 3JTSA 5DWUL 2KZWA 3E3QE 4KKCD 5E2UH 4KK6C 1FFPA 4MD5B 4ZUUB 4QOKE 3NCBB 1KG0A 5DD0L 3P40A 4K9EL 1RURH 3TBTA 4KZDH 3CDYA 4NT6B 1BBJB 3ZTJG 3TBYB 3GMPA 2IPUG 2D03H 2PTVA 3G08B 1X4XA 2ATKB 1TZIB 1P2CB 4PJ7B 4Y16C 2VIRA 1CVSC 4MDIA 1KXTB 3L3GB 4HUXA 4R97C 2Z93B 3UPAA 3MQIA 1H3GA 3IU4H 1OM3L 2GJ6A 2C3VA 1Q94A 4LLQA 5C09E 1I7ZA 4HGMA 1OP3H 5F7WC 1U3HB 1BQHA 3IXAB 2EIZA 2BC4A 3MRHB 4LU5L 5MEOA 1EPFA 3HE6D 3D39E 4XP4H 4JM2D 5EZOH 1K5NA 1OAQH 3EYVA 1J11A 3P73A 1SJHA 3FTGB 2V2XB 3GNMH 5MHSD 2DQTH 4TVSa 5J06A 2YPLD 4YFEA 2QJDA 1W8OA 3FQWA 1PKQB 1S7XB 3CX5K 5GGQL 1T7WA 1DJSA 3DRTA 5KVMC 2YUWA 2DWEB 2XN9A 3DWTA 4UQ3B 5J3HC 1IEHA 4MX7B 2A9NL 1ZXQA 3SGJA 3QDMA 4JFHD 3OF6A 2CKBA 3C8DA 5MEPA 4G42B 5I16B 1YEEL 3ZYIA 2J5LC 5HGHA 4J7RA 3BOVA 1LE5B 3IDXL 2IALA 3MBXL 4OZFB 4QHKI 1A6UH 3AM8C 2J12B 1DQQB 4GW5B 4FQCH 1DUZA 3KHOA 3P30L 2A6JB 2DQCL 1FDLL 4PJBF 2ZKHH 1WTGT 4P4RB 1EZVX 3UZEA 4R0LB 4Z0XB 4S1DD 4XNQA 2BXZA 5INCA 1UJ3B 4GAJL 4K3EH 5HYQB 4R90H 3HUJE 1MCWM 2FCBA 1DBBL 2ITCB 1VADA 3GKWH 4O2FA 5LCVL 4P3DB 5IFHH 5EWIH 4NQCD 1URLA 4NFCA 4PJCF 2VQUA 4DKDC 5JOPD 4HFWB 5SWQB 2EDHA 1WSST 5JOFB 4OZIA 3CU7A 3UO1H 5HPOA 2QEJA 4JM2F 5DURB 5GRZA 4JPVH 4HV8A 3NGBB 5DYOB 4H25A 2VZSA 4X7TA 2C4FT 2Q8AL 1AJ7H 3MACL 4IRSC 5E2VL 4PGJA 3HFMH 2IPKB 1T0NA 4YQXH 5DMJB 4KJPD 2OXHA 5A3ID 3VI3E 3VXOB 1H3TA 5AZEH 5CEZD 2BY0A 2X4PB 2AJ3A 1UB6A 4OZGA 3T09A 3BPOC 3O2DL 1FL6B 2EDEA 2PCPA 5ENWB 43C9B 1FVCB 1CFNB 4D8PB 2LV4A 2NXZD 3QWRA 5DEFB 3LQMA 3D2UA 3G6JF 3WJJA 3SDAC 3NTCL 5D93B 4HKBB 3ZO0A 1TVBA 4OCRL 3WHE1 2J8UB 2JJUA 5TF1H 1C8PA 3JV5A 2VXTH 5FDWA 1RK0B 3B9VA 3ESUF 5F7DA 3L1OL 2D4DA 1JGUL 2Q1EA 1D9KC 2VLMD 4U6TA 4YDLC 1KXVC 2VLRD 5GGVY 3WUWB 1Z9LA 2QTEA 5DUBA 3S36L 4LCYB 5ECJE 1GC1L 4GKZA 3MV8E 1JZ5A 5J89A 2IQAB 4IRJC 1ZE3C 3QXAA 5D7JC 1IT9H 4R4BB 4RZCB 4FXKA 1RAMA 1QFPA 2D4FA 1OTUD 2YC1B 1EH9A 4X4YB 4LSSL 5CJXC 4HFUH 5DRXA 5ACZA 4U7MA 3B83A 3TCXA 4M6ML 4O51B 5HD8C 1MWAB 2EZ0C 1MIEL 2VDLH 3QDGD 4OGYL 4HIEB 4QRPA 1PFCA 1Q9KA 5LWYL 3ZTNL 3BD3A 1N0XH 4YHOH 5E5UB 3O3AB 1JYWA 5IGXL 1I8LC 1IEBB 4OT1L 3EOBB 5I75B 4ZNEA 3U0PA 4V1DA 4CGTA 1JMZA 2W9DL 3FO1A 4YR6B 1INQA 1KTLB 4X5WA 4OGXH 3RVUC 3FT2A 4P2QB 4K2UH 4HT1H 1RZJC 2QQNL 4UIMA 1SVCP 2IC2A 3X3FL 5C07A 1CD0A 5HHME 1EV2E 1MELA 4KXZH 2VABB 4NP4H 4PJIA 1JJUA 4GKNA 3VXPB 4OGAC 3MRKB 5JXEC 2DD8H 5L2JA 2FGZA 5FHAL 1ZVHA 5A2FA 4YO0A 1Q9WA 3L9RB 5EUOF 2LTQB 4NC0B 3Q6FB 1IE5A 1HQ4B 1OGTB 2FEDD 4PJ9B 3LSOB 3BSZL 1ERNA 1WBZB 2EH7H 5I1AA 1T22A 3RNQA 3IJSB 3SKOB 1LVEA 2WK2A 2BDNL 4M03A 4LLMB 5GGSA 2VXUL 3HRZB 4MHHG 2EDBA 2J2ZA 5CJOH 3HNTL 2YD8A 3D3VD 3OHXB 5JLZB 3HI1A 3MJ8A 5JPMB 1RZKC 2BFVH 1JPST 1PEZA 4V2CB 3SHSA 5J11C 5I1KL 1J5OH 4OBRA 3AXLA 4NZRH 3I3DA 4PTUB 4XHQA 3LEVL 2EDXA 3QNYB 5EU6A 4IMKC 2EXWC 4KTDH 4XRCB 4U2ZA 2BNRD 3M07A 2YD9A 4R8WH 2EC9U 4P2OA 5B38B 1JZ3A 4LGSB 3GSUB 4UDUB 1MLCB 2FWOA 2XICA 2Z4QA 1FQ9C 5I2IB 4EJ1C 1NAMB 3CFKB 5KSBA 1Q0XL 1ED3B 1VERA 3RBGA 2IH3A 1IM3B 3VGHA 4P3CH 1ZHNA 4WVRA 3I2CH 1JRHL 4NJAH 2GTWA 1P7QA 1AC0A 4MJ5B 5EN2B 1T2QH 2CK0L 4FQQA 4XTRC 5CBEB 3HC4L 3BP7A 4Y8AA 2IAND 4K71C 1J0JA 4UT9L 3WSQL 4LCCB 3H9SD 1FZMB 3K4DA 3PWJA 3TH2T 3UTSA 3BH9B 4YLQT 5DA0B 5ANMA 1GIGH 5HHPB 3V6ZB 3OZ9H 3QEHB 1AGEB 1XT5A 4IIQC 5EOTA 5H37H 2J6EA 3V8CA 3FO0H 3O6FD 4OFIA 4MD0B 2DQUL 2EDLA 2Y72A 4G6JL 1YMHB 4HJGA 5I8KH 4TTDC 3NIFE 4X6FA 3M17B 2V9TA 4GRWH 4NQDE 4XI5C 3FN0H 2L4OA 3NVQA 5JQHC 2VDMH 1BFTA 4ELMF 5DT1L 2BX5A 1BBDH 3MRGB 1G7HA 1BM3H 1JRHI 3WKNA 5T5NG 1KJ2A 1RJZB 1YEJH 4HS8H 2HKHH 3BPCB 2HJKA 3PWVA 3UPRB 2YRPA 1LD9B 3CK0L 3RUGB 1ADQA 1F3JB 3GMNB 3WBDA 1MCKA 3OKLB 4BH8A 2X2YA 3BD5A 3GJFH 3QEQD 3DVFA 1XZ0A 4MAYD 1MFNA 3FRPA 3TO2B 1U3HC 4U1JA 3U9PH 3AS2A 3DUUB 1SEQL 1NFDA 2MSPA 1KIRA 3C5SA 5JW3H 2ESVE 3G5ZB 4Y19E 2OQJA 1KC5H 3BWAA 4KUCF 3RBSA 5DR5L 1FHGA 1S7QA 1UZ6F 2ERJB 3DRQA 5ILTL 5KVDH 1G7PA 1IARB 3OPZL 1NCAL 2LABA 3U7YL 1IGIH 4NNXB 2H32B 4LKCA 4HBCH 5F89A 1YEGH 4Q0XL 4MJIE 2DJ4A 3J7HA 4UZGA 2FH8A 4ZOEA 1GGCL 3KPRA 3ET9F 5F72S 3CFBA 3ZHKA 3RWJA 1JWUA 4TVPH 5EU4A 2P5EA 2GKIA 4G8GE 4GSDH 4HIJB 1CXIA 2AV7A 3K1DA 1FYTE 4R0LC 5C6TL 1A14L 1UJ3C 4UIKH 5FF6A 4OFYD 5IF0A 3HMWL 5DD6A 2OZ4A 3AREB 4QEGA 3CSPA 4UB0H 4C4KO 2ORBL 4GKOA 3T0DA 1A9BA 2CGRL 1E4WL 1A1MB 5MENE 4IOIA 3V0AC 3WLWD 3BP5A 5DK2B 2R2BA 5HDOA 4I0PD 1MRCH 1CQYA 3VFMA 3VFGL 4J2XA 4EOWH 2F5BL 3CJJA 2FBJL 2AEPH 3W2DL 5F7YC 1H15B 4LFHD 5FKAA 4XCYA 4ZO7A 3VD5A 1JHTA 4QHMB 3FB8B 3NGBC 4NN5B 4XP5H 5HDQH 2UWEB 4QXTB 2NY1B 1Q38A 1U8JB 4P4KB 3VXQB 2DIBA 5DJAA 4Y7MA 1HH6B 3WKMH 1G7MA 3ULUE 3WN5B 1QHOA 4PB0H 3R1GH 3EOAA 3IS1X 4NNPL 1CU4H 4YHZH 5JMOC 5D7KE 2F53B 4Y4HD 3GMQB 1OGAD 1ORSB 1NMBH 1GGBH 2JCCA 4U1GB 3VFSB 5A1AA 4HC1A 3D18A 3LS5L 2PR4H 3WS3A 2P47B 2WIIA 1Q72H 2ZZUT 3GMLB 2IADB 3LPGA 5E8DH 4ZDHA 2EDNA 4ZUSA 5D93C 5I66B 3VRLF 2DMCA 4TNVK 1HXYB 3L5HA 4HAGA 1MAMH 3PWLB 2PYEB 2WLYA 1MOEA 4U2YA 1EEUA 3ZHDA 4LQ1A 5BVJB 2VDNL 4U1HA 1GGIL 2JIXD 2KUTA 1WQVT 4K55A 1NLBH 4OD1L 1SYVB 4OJFH 5DVKA 5A2LH 4KMTH 2CRYA 4ZYKB 2BXYA 1TPXB 1VCAA 2XQBL 3SGKA 4XBPB 2P45B 1F6FB 5DO2D 1DQJB 4M7LH 2DF3A 4OZFG 3G6DH 3TF7C 3SE4C 3W0WB 1WIUA 4XAKD 3BZ4B 3O6KH 4U3XA 4NQVB 3DXAB 3U48A 2E7HA 5E9DE 2GJ6D 3NZ8A 1C7SA 3MREB 4MMZC 5I75C 4XH2B 4OUUA 4KI5D 5J56B 3V4VH 2AXHA 3RWEB 4JG0H 2R1YA 2KKQA 2IQ9H 3TIDB 5BW7C 4PJEF 1IQWL 5GIRB 1GVIA 5T3XL 5C0CD 4LMQE 4QYOA 4U1SB 2Z8WC 3UCRA 1TJGH 5CZXD 2NY6B 3DVGB 5F3HB 3QUZB 1PDKA 1I8IB 4FQPA 5DLML 3V52H 3FMGH 3LKQB 4FQLH 4DOHE 2CIIA 2XN9D 5D72H 3T8XB 1HDMB 4KJQC 4BKLB 3VXTA 1A1NB 1YPZE 1HILB 3QDMD 3OF6D 4G8EA 3BZFA 5IBLC 4PJ9C 3INUL 2EO9A 4GBXA 1KGCE 4LF3A 3NAAH 3CVHA 4I3RL 2WQ8A 4QRRA 5D5ME 5A43C 3ZDYF 2HVJA 5F7KC 4WUKH 1YJDC 5TF0A 3LY6A 2OMNA 4R3SA 1JTPA 5DD3L 3O45A 4X9FA 3W9EB 3RL2A 5DI8A 1CE6B 1FV1B 4LSUL 3OX8A 2NY0D 2D0GA 3ZT5A 5ID0B 4QHLB 5C08A 4PRBB 3CC5B 2DLIA 1KCSH 5DGQA 3WYRA 4APQB 4PRPA 5EUKB 4JKKA 4KI5F 3EYSH 1GZQB 4UBDC 3MRNB 3LKPA 1A6ZB 1MH5A 1UVQA 4HJJL 5CILH 4CADA 1KPVB 5ALBL 1FNEB 4OLEA 4XVSH 1QSEE 3HUJB 3VDAA 4QRSA 3WUWG 5I8CB 1A7BA 3HNVL 3WD5H 3QULA 5A2KH 4OAWB 3EO1B 3RPKA 3KXFE 5AD0B 3MGAA 2DI8A 4UV7H 3RVXD 3UYPA 1JV5B 4LCCC 5DDHA 5HPMB 5HI5D 3BPLB 3GB7A 2UY6A 25C8L 3RL1B 1CCZA 3QWRD 4KHTL 1EAPB 3E0GA 5EO1B 4XNMA 3D2UD 1JFQL 4BSWB 4GLRH 4NWUH 4HMDA 3MLYH 5D7IA 5JPNA 3NMEA 4JPWL 1JPGB 2BNQA 4H8WL 4JDZA 2WM0A 2P5WE 2YUZA 5C0AE 1WIPA 1BHGA 4XMKH 2VMFA 1XGYL 1JNJA 1I8MA 3EDKA 2X4SB 1KCVL 1XGQA 4ONOA 4PJBE 4YK4B 2ZUYA 3L5XH 4RFEA 3U36A 4PV9B 4CRPA 4AENB 3OAUL 1J8HE 4YHKL 1P7KA 5ESAB 1PVHA 1R6VA 4UI2A 3OJMB 3K8KA 4NQUA 4CJ1A 4G9DA 2AJSH 1ZEAH 4Z6AT 3BXNA 4I8DA 5CZVL 1KT2B 4ZXBA 3O4LB 4PJCE 1MHCB 2HFGL 1EEZA 4QRPD 4FG6C 2FLRT 3KLHD 2C1PB 4I13B 5E5MA 1NDMB 3Q5OA 1BX2B 4OLWL 4L8CB 4JQIL 4L3EE 5FCUL 3M45A 3RZWA 3FZUC 3VWKA 1ZGLB 3RX5A 2CLVA 1F4YL 4GH7B 4XB7A 1OTSD 4OUOA 1MFCL 2PYFB 2ERJC 1K3ZA 1BJMA 4PS4H 3PV6A 4JFDE 2ZOLB 1N5YH 4V1DD 3PQYE 4XZUA 1BQLH 4E0RB 5DQ9B 1OOAA 1YYMH 3BUYB 3MGTB 5F1IA 5IB4B 4CNIB 3ARGB 4FFWD 4RISL 1MQ8A 5C07D 3OKYA 3P9WB 1X7QB 1OP9A 4JFHE 5E2TL 1ZT7B 3G04B 1RZGA 2Z8VC 3ZT7A 5B38G 1A3RL 1VACB 5C0GA 5GGRB 5GRWA 4DN3H 5HJ3A 2BVOA 3G9VA 3BQUA 4HUWA 3EJZC 3HHRB 5ALCL 5IHUH 5KS9F 3QJFA 1OP5H 3QPXH 3G6JE 4LCUB 4NC1E 3RZCA 1YEKL 3MCLL 5GRVK 2HFFA 3AREC 2XTLA 3ETBF 5DJ8A 1JZ8A 5HHMB 4F37F 3QFJE 4YDKL 1NUFA 3G5YA 5E7FA 3C5JB 3AS1A 1C12B 1U91B 2A0LC 4FTVA 1WT5A 2DBLH 2HT3D 4GMSL 4GRWF 3ARWA 1MAKA 2AABH 1AO7E 3VXNB 3L3IB 1QYGL 5E1HB 3WMSA 4D9LL 5EU6D 1T1XA 4NO2B 5TDPB 5ICYB 1CLCA 1FGVL 3MUHL 3OGCA 3QIUD 2OTWB 3D25B 4RMUA 3DX8A 3H3PL 1FC1A 1SEBB 4P4KC 1QD0A 4P2OD 5E70A 3CUPB 3MNVB 4JPIA 1V7MH 1R0AL 5C8JB 4Y5VB 3RGVB 1SY6L 3WN5C 1S8DB 3VFRB 1T2JA 1DQLL 5EZIL 1TTUA 4WWKB 2GY7B 3ULVD 1T2XA 3H7LA 3IETA 5E8PB 4I0KA 2ZCLL 1K6QH 2Q20A 1P7QD 1IJ9A 3VRJA 4ZFOL 2ADIA 4UMGA 4U1GC 3ARVA 2MPAH 4PR5B 4MJ6A 3BDYH 1NGZB 1M71A 3HI5H 4TNWF 4OLYH 1KENL 4OFKA 2CLRA 5CJQL 5T1LB 3UTSD 2ZWLT 4Z7UF 5F6IB 1XEDA 3AM8A 4S2SB 4X6DB 5FUCE 1BQUA 5CSBA 4H1LG 2C3WA 3FHAA 2F58H 4Q9CA 1V7NH 4TUJB 4LEOA 3JWOH 3MNWA 1A6TB 1A47A 4MB5A 4YBQC 1CGTA 5EUOE 2ITDB 1AXSA 1G9ML 3MRPA 2JB6B 1ZT1A 3GK8L 3SEPA 3TJEL 1PLGL 3K2UL 3O9WC 3TM6A 3E6HB 1FZOA 4LP5A 1OAZH 2W07A 5JA8B 3T2NH 5I1IH 1HHJB 2IPUK 1MCOH 3ULUL 3MRJA 4TQEL 1TPXC 1YNTA 2Z92B 4YDIH 3QO0A 4POZC 3DYMA 1GL4B 3D5OF 1SBSH 4KU1A 3DV4A 1MJJA 3OAZH 1M1SA 4NQDB 5FA4A 1UZ8B 4WW2F 1F3RB 4IRSA 1L6ZA 3EO9H 3O6MH 4WY7H 3QAZB 3BGMA 3RJDA 1XF4A 3IF1A 1A21A 2XA3A 3E3QC 2RBLA 4AM0B 1MCCA 2EKSA 4LNRB 5IB5B 5D2NB 4XVJL 3WFBH 5ISZA 2W0FB 3QUZC 4ZTPH 3T3ME 4CN1A 1F6AA 1MFAH 3P0VL 5D9SA 1AIFA 1UWEL 4MAUL 3R0MA 4RGNB 3SDAA 1NKRA 1HQRA 3SDCA 1INDL 1ACYH 1G0DA 4NM8H 4PYGA 4DW2L 4GRLA 3LRSA 1UH3A 2QADD 1B6UA 5F3BA 1LNUB 1OWRM 1D9KA 1EA9C 1F97A 2ESVB 3KPRD 1IGTA 3QXDB 4Y19B 4L4TA 1QR1A 3FCTB 3RDTB 2NNAB 3AFLA 4DVRH 4ZFGL 2P5ED 2DQIH 2F9BT 4YFDB 2KBGA 1YDPA 3OSKA 3BDXA 4IRJA 4NRXB 2NY3C 4Y89A 1ZKAA 32C2A 1LO5A 3WNNA 5KAQG 1R5VB 4PLJC 5DD1L 1T5WA 1CR9H 1WEJH 1QBLH 3MOQA 5CSZA 3QHTC 4XCFH 4LVNB 5GGUA 2DQJH 3BP4A 3I6GA 5LJYH 3ROOB 5IMLB 4MNQA 2ZPKL 4ELME 3BMVA 4F7MB 3DNKA 4APQC 3FT3A 1QLFB 1NBYA 3SE8H 4PJHF 3MXVL 2R1WB 4G7VH 5K9OB 1CQKA 4LASL 3KR3H 3VFUA 1AH1A 3I6KB 2VDQH 4M5YL 4M8QA 1X9QA 3S34H 1ZS8A 5I30L 5HYSB 2XT1B 5LBSH 4HF5H 4PGBB 1BLNB 1WVZA 1XGPA 5JUEH 2J8HA 3T4AA 1JPSH 3R8QA 2EXYC 2HN7B 4WCYH 4DUWA 1J1OL 1CXKA 1YNKH 3BEWB 4JQXC 3BPLC 3MRCA 5JXEA 1SJVA 3WV0A 1MUJB 5F8QC 3DGGA 1JI2A 1S7VB 5FGSA 3CVIH 3SKUD 1UZ6E 2B4CL 1INEL 2CDEB 1II4E 2WQRA 5HYJE 4PJXF 5GS0H 1YY9C 2R2EB 1ZLSL 2CUIA 5D1ZB 4K8RD 4CUCA 4IMLA 5FFLA 4RMSA 4YHPB 4LMQI 4NFBA 1VKXB 4QWWC 2ZOKA 5T33H 4M1GH 1J1PL 4PTTA 5KANG 5JHDA 4QT5B 5TFSH 3IU3B 3IFPA 4HKJA 4P9ML 4YK4C 1DANU 5FYKE 1WBXA 4IMKA 3G9AB 1HH9A 2YXFA 2X4UA 4XPTH 4XT1C 4J8RB 3WFEH 1VENA 2SEBB 1RZIB 1S9XB 4AIOA 5I1GH 4FXLA 2RAMA 1J1XL 1S9WA 2HYMA 2APXA 4LCWB 1ZHKB 5DMGC 5GGRY 1NCTA 3CD4A 4UT7H 1I8KB 3OKNB 3AB0B 3LN9A 2UUDK 3F5WA 2NY2B 3P4MB 5EDXA 1BF2A 1ZVSB 2XWBA 2PETA 3ZE0F 4OLVH 12E8L 4HMEA 4D9QD 5TH2B 5T1KA 3V5HB 4Z7VA 1KELH 1LMKA 4E41A 5EA0L 1KCKA 1XIWD 1KPRA 4I5BB 4OCYL 3LMJH 1DSFH 2X4OB 4IIQA 1FVEA 3MRRB 5FYLD 4OF8A 2P46B 2Q8BH 2QLVB 3FT4A 4OLUL 1T20A 4PBWD 3JWDL 1D6EB 3VGAC 5DC9B 4LSQL 3GBNH 5E9DB 3BKYL 3V4UH 4H20H 4IHOA 3C60B 4M1CC 4QHUB 3FB6A 2IH1B 4PLOB 4GBXD 4JFXB 1N64L 5JW4M 3S97C 4EDXA 3QEGL 4QRRD 4ZUUA 3VRLE 1EXUB 4RAVB 5FYJH 4NJ9L 1BIIB 5LQBL 3RAJH 5F1SA 4EBQH 1NEZA 2AXGB 3G08A 2ATKA 1TZIA 5JW4R 4DZBA 3N9GH 1EEQA 2FSEB 1YPZB 1IMHC 3EUUA 4ETYA 1TQCC 1U3HA 2A9ML 4OFDA 5GS1C 3MRHA 1A7NL 1NBVH 5D5MB 5FM5M 1UXSB 3MRMB 4PJFF 3CLFL 1Q8MA 2R9HD 4CN6A 3K81A 3P4NB 3RGVC 4A6YL 1NCCH 2V2XA 4WWKC 5J8OA 2E5EA 3FQTB 1PKQA 2K7PA 3AS3A 2P7TB 4YIQB 1OGAE 2CQVA 1J88A 5T3ZD 2WW8A 2NX5E 4UQ3A 1EFXB 4EUPB 2R23A 4MX7A 3OAYK 3E8UL 4F7CA 2D0FA 2Q7YA 3MLSL 1SMAA 4OF7A 3B8YA 1J8KA 4G42A 1QR4A 3OJVC 2E27L 2EE6A 5IR1B 3ARDC 3FQUA 1LE5A 3K80A 4PJEE 5F6IC 4JKMA 4OZFA 4O58L 4GW5A 1WCQA 4M1DL 1D3CA 3NCMA 2A6JA 5ICZB 4QO1A 1KIUA 2P42B 5DJ2A 5T5FH 1RUPL 4Z0XA 4D9RD 6CGTA 3S35L 4L29B 1UJ3A 5F1NB 1RUKL 2VL5A 4YAQB 2ITCA 3MOAL 4N90D 4P3DA 5E4EB 3UBXB 2HKFL 4XWGH 4X6BB 3CDGA 3U83A 5I1LB 1BOGA 4HFWA 5HBBA 3ZDYE 2H1PH 2V9RA 3S8WA 2PW2B 5I1DB 4AT6B 1VFUA 3H42H 2ICES 5CGTA 3P0YH 4XNXL 2IGFL 4U0QB 3V6FB 1ZA3A 2WBJB 4L4JA 5DYOA 3VFVA 5TQ0L 3G6AB 1CIUA 3QAZC 2IPKA 2R56H 1FCGA 1U8IA 3GEWB 4ZXBD 1D5MA 2P5WB 3VXOA 2BNUB 1B9ZA 4KI5E 3D0LA 4KRPB 5FGRA 1JHKL 1REIA 5DQJA 2A6IB 1PX3A 3VWKD 43C9A 1FVCA 2PTTA 2VR9A 5D2NC 3O41B 5C0CE 4D8PA 5IUSA 3K4ZA 3UJJH 1J8HB 2BHZA 4TSCL 3ILQD 4FP8L 1F58L 1MNUH 4UQ2B 4WEBH 3GRWH 4HKBA 4EQ2A 3KPMA 1DQDH 2IAMD 4NHUB 1AFVL 4PJCB 3UYRL 4MD4A 2VKXA 3WIIL 2HLAA 4AJ0A 4Y2DB 2DJSA 5F70A 3VD3A 3WFHA 4YNYA 1EDQA 1UYWH 4N9OB 2A1WH 4JM2B 3ZMRA 3RDTC 1EAJA 2VQ1B 4U49A 3WUWA 3BQUD 2G2RA 4ORGB 2YPLB 1PZ5A 3RY5A 1KCRH 3PQYB 4F57L 2IQAA 1ZMYA 3MOBL 4JFFD 4R4BA 2B1HL 3C8KB 4FQXC 4CVXB 1CDIA 3RZCD 2HMIC 1IGFH 3S37L 3GI8L 1B2WL 1U9KA 2KDGA 5I71B 4LVNC 3N1FC 2D2OA 1G9NL 1T66C 4DCQB 4O51A 3U30B 2ADGB 2P8MA 4LQFL 1EX0A 3GO1H 4FTVD 2GTZB 4PJGB 4YGVB 2BSTB 4LSPL 4YFLF 5ABDE 5GISL 1OAXH 4OTXL 3O3AA 1QKZH 2OTUB 3D9AL 2MQ3A 4Z78A 4XPHL 5EU5B 5JNYB 1KCUL 1KTLA 5BW7A 5F21B 3QFJB 5HXMA 4P2QA 5GJTL 1UKSA 1EERB 4NQCB 4QXWA 2N1KA 4NCC2 5IFAL 4ZSOB 5KN5B 2FYYB 4D2NA 5CD5C 1U6AH 4DUXA 1R3IL 2VABA 1HZHH 1RUML 3VD7A 2YPKB 4JDTH 5J3HD 4MA1C 1G9MC 1MFDL 1KNOA 2WAHA 3TESA 3Q6FA 1F11A 1HQ4A 1MRDH 1IGML 1PJ9A 4XC3L 5JXAL 5FO7A 1P4BH 5D1ZC 3WIHH 3I85A 3SKOA 3ULUC 2M1KA 4FZEL 1EFQA 2VDOH 3QHZL 3BAEL 4I0CC 3HRZA 4J1UA 4X80L 2ED8A 1O7SA 5F9OH 4CW1A 1I9JH 1FJ1A 1RI8A 5JLZA 1RHHA 1UXWA 2V5RA 2DLFH 1H8OA 2HG5B 2G75B 2R0ZH 2DDQL 2NXZB 2O93L 1NH6A 2FATL 3QNYA 4HK3J 5KS9E 5IW1B 1DQMH 4QHNB 4H0HB 1Z5LB 1I7RB 4QTIL 4ONGL 4XRCA 5IEKA 4OF6A 2W9EH 4J3UA 1GOHA 1V3KA 4UDUA 5DMKB 4U1KB 1N6UA 3MV9E 3BKJL 4UUJA 3CFKA 4XVTL 5I1HL 3AB0C 1B0WA 2Y25A 3KYNB 4GRWE 2OBGA 1P5UA 2VLRB 3MRDA 1VA9A 2DLTA 3PABB 1C08A 4J23A 3OKKB 4JRXE 3HNSH 3RU8H 4L4VE 4MJ5A 4H88H 3SKNA 3SGEI 1NL0H 3QIWB 1SBBA 2FX7H 3GMRB 4JHBA 4LCCA 2V7NB 3BH9A 4HCRA 4G43B 3V6ZA 3QEHA 1GZPA 3QDGB 1IEAB 1CWVA 3LKNA 4MD0A 5HVGB 2OR9H 4AYFA 4OM1H 2YMXL 3SDAD 5J1SC 5KVEL 4MQXC 2DYPA 2O5YL 2P8PB 5D71L 1JPTH 5CP3H 5CIPA 3SDCD 2WWMD 3GI9H 3C60C 3SDYH 4OV5B 2FD6L 5DEZA 4GRLD 1FIGL 4BQ9A 1P7HL 3SDXF 5IQ9A 1U0QA 2HVKB 1D9KD 4XP9H 5HYSG 1NBQA 4L4TD 4Z7UE 2IBZY 5GSVB 5I8OH 5EZJB 1A6WH 4OF3A 3KYMA 4IRJD 3UZQA 3BPCA 5C0EA 3H2WA 2X41A 3N85H 3BKCH 4CU8A 3UPRA 1LD9A 3RUGA 2Q86A 3GMNA 3TNNB 4OBSA 3OKLA 2F5AL 5E2UL 5HD8D 4MNQD 2EZ0D 3P3YA 4H1LA 5BS0A 2IG2H 1UWXK 4BH7B 1L0XA 2J4WL 3DVNA 2YBRB 4X0KB 3DUUA 3TV3L 1W0YT 3TYFA 4TVPE 2D03L 3G5ZA 3GMMA 1JF1B 2B4CC 2IMNA 1YEFH 3H9ZA 4N1HB 4QTHB 3ULVE 1ZHLB 1MFBH 3IU4L 1G0YR 4NNXA 1M7DA 2NCMA 4P5KA 5CGYD 4UTAL 3F58H 3GSVA 1OAYH 5JZ7D 1D5IH 1KJVB 3IFOB 3LN5A 4F80A 2F54E 4XP4L 2BNRB 3L95B 5EZOL 1OAQL 4OGAD 5JXED 1MJ8H 5IVXA 2MFNA 3GNML 1QFUH 2DQTL 5HI4C 2AV1B 3VFPA 2K9UA 5DEGA 5BV7B 4WUUE 4NO3B 1I3RB 2VC2H 3AREA 4X4XA 5MEQA 3GSNB 4YJZL 1A1MA 5E4EC 2GHWB 1A6UL 5HGAB 3H9SB 4D3CH 5I76A 4FQCL 5JHDD 3MA9H 3QXUA 4EXKA 1YQVH 2ZKHL 4L3AA 2C5DC 4R7DB 4JGJA 3CAFA 3O6FB 5F8RC 4K3EL 4R90L 1H15A 2EXWD 2VZUA 4HJ0C 4MWFB 2WBJC 3GKWL 3MLVH 4QHMA 4PP1D 4QXTA 4P4KA 4ZUTB 5EWIL 2HTLD 4PRHE 3TBWB 4JRWA 3WFDH 5GSRA 1ZA6A 3GGWB 3B43A 4HIXH 4KKCC 2MTPA 3A6OA 4KRPC 4HWEH 1JZ6A 4PJHE 2F53A 3X17A 4JZNB 3GMQA 4MQ7B 4M7JH 5H35A 4HGWB 4M6OH 5T1KD 1RV6X 4JPVL 4XTRD 5K9KA 1SYSB 5MP6H 1BPVA 4AEFA 1ORQB 4E41D 3IDIB 1AJ7L 4FXGB 1JGDA 3HFML 2EEBA 2WUCH 4B7IA 4YXHH 3GMLA 2IADA 4YQXL 3QO1B 3X11A 5B8CB 3QEQB 1ZT4A 4MAYB 1NAKH 5FKPB 3PWLA 4OZHF 2PYEA 4X7CC 5JIKA 4Y2DC 4U7KA 5J6GB 5LKNA 1DBJL 4JM2C 4S1SL 3RWGA 5BVJA 4XI5D 3O3EB 2E6JA 4PREA 4MA8H 4ZNCD 2BSED 2A2QT 1OAUH 1Z6JT 3HPLA 4PJXE 3O9WA 5IBUG 1QFWM 4G6FD 5TF1L 4K3HA 2XWTB 1SYVA 3X14B 3BSZH 1JZ4A 2VXTL 4ZYKA 4EUPG 3BISA 5F9DC 1XH3B 3FONB 2VE6B 4DQOH 4XBPA 4KY1L 3U30C 4FOMA 3MJ6A 4YXKH 4JZOA 1DQJA 2DM4A 1T7ZA 1WZKA 3HR6A 2BZDA 3W0WA 5KW9H 1X5ZA 2I27N 1A8JH 3WE6B 3DXAA 5I1KH 1FRGH 1IGYB 3C2SA 5IB3B 1WCBA 1IT9L 3MREA 5IJKC 3FAWA 1U3HD 3E6FB 2YZ1A 4NC1C 4HFUL 4QOKA 1GPOH 3A6CL 3TIDA 4GG6F 3K2MC 2VDLL 5DHVH 4JO2H 1L9NA 3UBXG 1BJ8A 4U1SA 5F3HA 1FO0H 2JF1A 4I0PB 1N0XL 3TPUB 4YHOL 1ZK9A 3LKQA 3NH7H 3ZE0E 4WFHE 2Y5EA 4BKLA 5E7BA 3T2OA 5EPMB 4BK4A 1KLUB 5C09A 2CIKA 2YWZA 3BE1L 4ODUA 2CD0A 1E28B 1T7VA 2GAZB 4OGXL 1ES0B 2Q7NA 4ZOAA 4DK3A 4K2UL 4HT1L 3D39A 1KB5H 3CZFB 3ELAT 4NQXA 4NQEE 4X9GA 2YD6A 1CE6A 4XX1E 1FV1A 2DD8L 3IFNH 1RK1A 2MQCA 1OGAB 5ID0A 4QHLA 4ODBD 4U1NB 3RWCB 1YEDB 2NXZC 5J6HA 1JGEB 4WO4B 2EH7L 4ODSL 1KF9B 3QP3A 2GI7A 4WHTA 3KNBB 4APQA 5EUKA 1OF2B 4PJEB 4HIHB 5DT1H 2WANA 5FUCC 3QI9A 1A6ZA 3OXRA 2W59A 2Q87A 3BP6A 1UH4A 2VOTA 3D0VB 5DFWH 1B0GB 3FL7A 4XCEA 4DEPB 5F7FA 4OCXH 1FNEA 2Y07H 1J5OL 3FFCE 3PIQB 4NZRL 3SQBA 2LAGB 3IKCA 3HUJA 5IESL 1B0RA 2JIXB 4OQ1A 4B50A 2R29H 1TJIH 4KTDL 5INDB 4U6YB 4D9QE 1AGBB 2WNGA 4NNYB 4KXZI 3JTSB 3EO1A 4JCLA 4Y4KD 4R8WL 4Q9QH 3OB8A 3QIWC 1CK0H 1KG0B 4PJFE 4S1RH 3HN3A 3TBTB 4WNQB 4JQXA 3BGFB 5HPMA 2H45A 3GMPB 1WWAX 4L9LB 4K3JL 5BQ7A 1U95B 3CZJA 5FYLE 1EAPA 2VIRB 4P3CL 2F8XC 3I2CL 5EO1A 3FAXA 4HUXB 4ODTH 4BSWA 4JFPB 2GJ6B 5C71A 1Q94B 1G9NC 1O7VA 1T0PB 2ED9A 1I7ZB 1BQHB 3QQ9D 2EIZB 4XNZB 5E1AB 5MEOB 1GIGL 2W1NA 1K5NB 2W65B 3FO0L 3PHQA 1GGCH 3KPTA 3P73B 1SJHB 5C0CB 3PE9A 4NO5B 3KS0H 2HT4D 1UACL 3DRTB 5I8KL 4AENA 2CDFA 1BOYA 2JK5B 5ESAA 1FLRH 2PXYB 4KRLB 3FN0L 3KPNA 2OL3H 3AY4C 5L8KB 5DUMH 3HAEA 3W5NA 3QDMB 2FEDC 4OZIF 3IB4A 1BBDL 5MEPB 2CKBB 3KPLA 1EHNA 2CGRH 4BZ2L 1MHCA 1XF5A 1BM3L 5JHLH 4UOW1 1K85A 4FN0A 1NDMA 4UNVA 1YEJL 3ARXA 2PTUA 2HKHL 3MJ9L 3MV8A 4YUEH 2WZPD 3CFEB 1VSCA 2PYFA 2NY0B 4XNQB 2VO5A 1VADB 4E0RA 1DCLA 3LVEA 4L1DA 3BUYA 3RJQB 3NCEB 2DM2A 3QG7H 4PRDB 5JW3L 4OSUH 1X4ZA 3U79A 1VACA 1LEKB 4KJQD 1BJ1J 5KVDL 3QDJA 4HV8B 5HSFA 1IGIL 1E6JH 2X42A 4H25B 4LCUA 4X7TB 2EDRA 3LS5H 1K4CA 4HBCL 3BO8A 3LQAC 2X89A 4N90E 5IMMB 3T0WA 4DN4H 2BHUA 2VLJD 4LDEB 2AJ3B 3C5JA 4HWZA 1UB6B 4OZGB 1C12A 1EHAA 3VGGA 3GFUA 4TVPL 4W4OC 2R1XB 3LKSA 5F44A 1J12A 1HK6A 2VZ3A 3L3IA 5E8OA 3O6FC 4UIKL 1EGJH 4NO2A 5TDPA 5ICYA 3D2UB 2OTWA 2LE9A 4UB0L 1S78D 4M4PA 1KJ3H 1TVBB 5GS1A 1SEBA 3ZTJH 3CUPA 1A1OA 3MNVA 3QR2A 1R3KA 5EBMB 2UVFA 3GIZH 5EZLA 1AY1H 1UA6L 5FDWB 3RGVA 1TLKA 5F7DB 1S8DA 3VFRA 1MRCL 2AS5M 1AC6A 1IM9B 4I9WE 2WIMA 1HKFA 5DUBB 2CDGA 3S37X 4IDLA 4KQ3H 5D1XA 3BJ91 3DPBA 4XP5L 5HDQL 3T4YA 3QXAB 1NGZA 5TE4L 3WKML 3DUHA 1A3LH 5DRXB 3ARDA 4YEFA 5T1LA 5ACZB 4PB0L 3R1GL 5B8CC 3CLEH 5ITFB 1CU4L 4S2SA 5B21A 1AQKH 2DOCA 5IM7A 3KJ4B 4L8BB 2OX5A 4F8QA 4M3JA 1NMBL 4GRWB 1FZKA 1GGBL 3IYLW 1PAMA 3WIFB 4JRXB 1DE4A 2DYPD 3QDAA 4OI7A 2PR4L 1Q72L 4HX1B 5E8DL 2YK1H 3U0PB 3DUSB 4V1DB 2DL9A 3FO1B 4JFFE 1INQB 1MAML 2C4FU 4UIMB 4UT6H 3EOTH 1T03H 5IIEA 2Z92A 5C07B 4EI5B 2IPTL 4PJIB 4GKNB 1I4FA 1CDYA 5L2JB 3LKOA 4NQDA 4YO0B 1UZ8A 4TNVF 1NLBL 2X1XR 4CAGA 4J3TA 3L5WA 3X3GH 4KMTL 4M7KL 2FDBP 4PY8I 5BS0D 1T22B 5I1AB 5FECB 4FG6D 3QUMB 3RNQB 1V3LA 1S7SB 4LLVB 5KSBF 2MKWA 3DETC 3HRPA 4LNRA 3MV11 1MF2L 4M7LL 4X7DC 4HJJH 5CEXA 3G6DL 3N06B 4KKLD 2ZCHL 2W0FA 2X1OA 4I0PC 3O6KL 1QTYT 1J0ZA 5DA4A 2AXJA 3AXLB 5EU6B 3GM0A 1FBIH 2FR4B 15C8L 2VSCA 3V4VL 2AP2A 1BEYH 4G80B 4DKFH 2BMKA 3MROB 1JWSB 4JG0L 3QIUB 4CVUA 3VDCA 1NCNA 1RVFH 2IQ9L 1I1FB 4GG8B 3RWHB 3NPSB 2ESVA 4K94C 4Y19A 3FCTA 5I8EA 2Z4QB 4PJDF 3EJZD 1S9KC 4KKAD 4FQLL 1T7YA 4JR9H 1H3UA 2IH3B 1T7XA 4M8VA 5D72L 1EMTH 4WW2B 2G5BA 1PSKH 2GTWB 4FQXA 2QQLH 4RGOH 3ARED 2UZIH 1UM5H 1SY6A 4WO4C 3FQRB 3NAAL 4MJIA 3SDXE 4R6UA 4F7MA 3PWJB 4HUUA 4FQHA 1QLFA 3UTSB 2PN5A 4WUKL 2P48B 2XOTA 1JE6A 5K9OA 4ZFOA 4KPHL 2H2PD 3MRIB 4G8GA 5HYEA 4DEPC 1FYTA 5JMRA 3UDWC 1A4JB 4P4KD 2HT2C 5JTWA 2EDOA 2XFXB 1BLNA 5MENA 3EYSL 1HWHB 5CZVH 4TULL 1AGDB 2F53D 1G7HB 2J8OA 5CILL 3BEWA 3BGFC 4M7ZB 1KJ2B 5FCUH 1LO3H 2BSSB 2Q76A 4L9LC 4XVSL 2BY2A 4R7NA 4DVBB 2KQNA 2EO1A 2HJKB 1OY3B 3QHFL 2R2EA 3WD5L 2UY7A 4O2EA 3LRGA 5D4QA 5D1ZA 3ZKQD 2WINB 3SCMD 4KI5C 4U1JB 2PYED 1VKXA 4N8VA 2UYLA 3MLWH 4XC1H 4U31A 1WFNA 3C5SB 4KTEH 1FNSH 1QP1A 2HRLA 2NQCA 4AEIH 4Z76A 2JB5H 4QT5A 1A3RH 2GFBB 3BWAB 3IU3A 5L7XH 1SJXA 5CZXC 4NWUL 3QWOA 2ARJA 4KK9D 3O9WD 1G7LA 3W82A 3WEXB 4A2MA 5E24E 2PXYC 3F6LA 2SEBA 5IEHB 1NCBH 4JDVA 1YEKH 1JUFB 3SGJC 3MCLH 5F89B 3DX7B 4KMLB 3VI4F 4XMKL 1IQDA 5DK0B 3BDBA 2QADB 1ZHKA 5FGCE 4LEXH 3ARBD 4WU5B 3KPRB 3SBWC 5D6CA 3P4MA 3W0WD 4WFFD 3CFBB 4S1QH 5GS2H 1JWUB 3L5XL 2B0SH 2YD2A 3DXAD 1Z9SA 3EHBD 5F1KC 2BP3A 2H41A 5TH2A 2AV7B 1QYGH 4PJXB 3V5HA 2NY0C 4N8CH 3VFWA 5FO9B 1Q9OB 4QOKD 5M7QA 2AJSL 1ZEAL 3MMEB 5IF0B 2HJFB 4JFQA 2CH8A 2N56A 5F7MC 5FYJE 5J7CC 4I2XE 4F15B 2X4OA 4IOIB 3BP5B 1X44A 4GLRI 2R2BB 1GAFH 5FB8A 4FQIH 3VFMB 1DLFH 4ZFZA 1F2XK 1T1YA 1IZJA 4XPFH 3V0WH 3F7VB 2F74A 5E9DA 5EBLA 4GW4A 4PS4L 5BCAA 1OSPH 5C09D 3OG6B 4XCYB 1P4IH 3C60A 3OAYH 1BQLL 1JZ2A 5L6YL 2DS4A 4F2MB 2IH1A 4JFXA 1YYML 2AGJH 3QXTA 3D39D 1EXUA 4RAVA 3EOAB 3ROLA 3MV7E 4OZHE 3E2HB 3VH8A 3RVXC 2W0PA 4DN3L 2NR6C 2NY3D 2CJUH 3DARA 1HYSC 2NW2A 5C0BD 4C4KT 4G8IB 5GGVH 2FSEA 2X10A 5IHUL 4O2CA 3D18B 1YPZA 2M8XA 3ARTA 3AMLA 1RD6A 2WIIB 4APQD 3TJEH 4ZDHB 1PLGH 5D5MA 3O2VH 3QI9D 1UXSA 2YRLA 1G6RH 4WIQA 1BQHG 3P4NA 3BIKA 1OW0C 4N0FA 3PL6A 2DBLL 2VR5A 1Z0NA 2AABL 2I60H 3FQTA 1PX4A 3PP3K 4U1HB 1TENA 1P6AB 1A64A 1FNAA 1RJYA 4MNGE 4Q2ZB 5JIIA 3PG2A 2APVA 4MYWB 1JMXA 1V7ML 3V5DB 4AY0A 2EEAA 2O61B 5IR1A 3ZDXF 2BVYA 4BZYA 1S7TA 1I9EA 4K3DH 2KQMA 4XPGL 3WO3B 3MNZB 3FFCB 3KJ4C 4DWHA 1B4RA 1K6QL 1QSEA 2CUMA 5K33A 4MQSB 1AR1D 4HQQH 1V3JA 4L29A 4M48H 5CJBA 2I9TA 1KULA 4BYHA 1OTSC 1XAUA 3ARPA 2NLJA 4YAQA 4GT7A 2GIYA 3KYAA 3HC3H 3BDYL 3HI5L 4OUUB 4OLYL 4PRIE 3KXFA 1TFHA 3UBXA 1L0QA 2R1YB 2AJUH 1NMAH 1FZJB 4JRYD 1XIWB 4P2YA 5I1LA 1BFVH 1BD2D 2F58L 1V7NL 1NGQH 2Y9RT 4EI5C 2PW2A 5I1DA 4FFVC 2XACC 5DJ6A 1VDGA 2ADJB 3FB5B 5C0IB 2CIIB 2GITB 4KGJA 1U8MA 4JKWA 1OPGH 3AC0A 5DD1H 5T3XD 2XV6B 3ZKSD 3WFCH 3BZFB 2EDQA 1OAZL 2P5WA 5C0AA 5CLTA 5E2WL 4U6XB 3T2NL 3CVHB 3O8XD 5I1IL 1MCOL 1TVHA 4QRRB 1GGYA 4YDIL 2HVJB 2XQYK 1RZFH 4GXUM 2A6IA 4ZS6C 2AJZA 4PJBA 3O45B 3MV8D 3RL2B 4FQ2H 1J8HA 2VL4A 5FO8A 1N59A 2HT3C 3EO9L 2YS4A 4YX2L 4CJ0A 4MVBC 5TQ2H 5AWNH 4LHQB 4X7EC 4YPJA 5D7LE 4PJCA 2OCFD 3B3IA 3QIUC 5ESQB 2HFEA 1N26A 3A0OA 1MH5B 3HMXH 4Y2DA 4L3EA 4YFLI 3LOWA 3KPSE 1PG7W 3WFBL 1MPAH 1I7UA 4BSVA 1HE7A 4JM2A 2VQ1A 5DJ0A 4CADB 3QDJD 5DMYA 4ZTPL 1OQOA 5DRNB 4JFDA 4YHNA 3ULVC 3PQYA 1BZ7B 4WW2C 4QRSB 3QRGH 4HG4J 4HUVA 4CVXA 1WC7B 3E1F1 1ACYL 4NM8L 2X89D 1RZ7H 4ZTOL 4HIIB 3S5LB 3JV4A 5LVEA 1FPTH 3I6LE 1T80A 4NN6C 1J0YA 2ADGA 5H37G 1FAKT 4YGVA 3GB7B 4DVRL 5KBNC 4S10A 2DQIL 3TBSA 1ACZA 3NN8A 1EEYB 4PJ5A 5FGBC 1ZGLM 2OTUA 4XNMB 1JK8A 3G6JA 5CWSA 1CR9L 1WEJL 1QBLL 1Z3GH 4CL7A 5EU5A 3DECA 1JYNA 4XCFL 1GHFH 4FABL 2DQJL 4ZPTB 3ZZ1A 3RNKA 2B1AH 3RGVD 3QFJA 1JTOA 4G7VL 1VFBA 4IEFB 3KR3L 3ABZA 1AO7A 1XGQB 4M7ZC 2YPKA 4DTGH 3VD4A 1AQDA 2VDQL 4RFEB 5D1XD 3DYPA 3LZFL 3S34L 1P7KB 1K3IA 3DX6B 1FC2D 1CGXA 4AG4H 5LBSL 4HF5L 5JUEL 1S7UA 3ARDD 5T1LD 2X4NB 1G1YA 3BXNB 1W8NA 1JPSL 5DGRA 4ZXBB 1P84K 2L7JA 4WCYL 4PV8B 1R24B 2QR0A 1YNKL 4WI2A 1IL1B 2E6PA 3VWKB 1AE6H 3JWDH 3CVIL 4GXUN 4X6CF 3KDMB 5GS0L 1A22B 1KYOJ 4Z8FH 1I7RA 5IHBA 5I17B 2IAMB 4EVNA 3VG9B 5BRZE 5DMKA 1K2DA 1XCTB 3EBAA 4X5XB 5T33L 4M1GL 1WFUA 3HTLX 3DBXA 2QADC 4JG1L 4NJ9H 2K3TA 5TFSL 3NPZB 3V6OE 5C0GB 4N0YH 1J0KA 4NQDD 2BVOB 3R4DA 1MJ7H 4RIRB 4U4BA 5EC1A 5EUOA 3BQUB 3MUGB 4IJ3B 5EULV 2DQGH 2VZOA 3QJFB 4WU7A 4XPTL 3WFEL 2DICA 2D7PA 4JFFB 4ODXA 3RZCB 2ARJQ 3QIWA 2HFFB 5I1GL 4TYUA 1BREA 5I1CH 5E00A 1RULH 2V7NA 3G5YB 4UT7L 3RIAK 4F15C 4OLZH 2RIKA 1IEAA 4FFYH 2CLZB 2GK0A 3NFSH 5GXBB 4OLVL 4PGZA 3SN6N 3J8F7 2ZG2A 3OGCB 1MSPA 4N0UE 3LMJL 1DSFL 4JPIB 4PLKD 2ESVD 4XVUC 4Y19D 4PGDA 1LP9F 1MWAH 5SWZE 3PWPE 2Q8BL 5EZJA 4I18B 2E6QA 4QF1A 3E2HC 2VLJE 1I85C 1RIVH 5JIPA 1AD9A 4NPYB 3GBNL 1NEUA 4FQXD 4PD4J 3V4UL 3VRJB 4H20L 4KDTC 2ADIB 2ZSWB 3TNNA 3AY4A 4MJ6B 2VDRL 4MJID 5CHNB 4MXQD 4NBYB 3JZ7A 4TUOA 2J5LB 4PJAF 1DN0B 4BH7A 4BQBA 3EKCA 4X0KA 5FYJL 1KFAH 4P57A 3RAJL 3QSKB 1I3UA 1MHHB 4PG9A 1U8KB 3EGSB 4G8GD 4PLNC 4LEOB 1JF1A 2Q3ZA 4Z7WF 3LN4A 3LV3B 3MNWB 5HDLA 3N9GL 1FYTD 3CMOH 1UKQA 4QTHA 3B4NA 5L88H 4LPCA 4YHLH 2DM7A 1H3XA 1AXSB 1ZT1B 2N4IA 3QCTH 5MEND 4ELMA 1IAMA 1NBVL 1JYXA 1FZOB 5IROA 5M94B 4Y1AE 5EFIB 4ZPVA 2XZCL 4W6WB 1YJDH 3MRJB 1JHKH 2VITA 1YNTB 3RKPA 1W72B 3LHPH 3DOSA 5E56A 3ZSSA 2AV1A 4K7PY 3EOYG 1V3MA 3H3KA 1MJJB 4WI8A 4GS7B 5F7LB 5D1ZD 5F1OB 3ULUD 4R26H 1XF4B 3IF1B 3EDEA 3C09B 1PZUB 5D7KD 1N2RA 4HPYH 1U92A 5HGAA 3WIIH 1RUQH 1XIWC 4W4OA 4X9HA 1NAMH 1NGYB 4PJDE 1RJLA 5T5FL 4LSRH 5DC0A 4P48A 2JKXA 5HYJA 1U93A 1F6AB 1N5AA 5D9SB 3UP1A 1HQRB 3MUJA 4F57H 3MSPA 3SOBH 5DRWA 3B2UC 4ZUTA 2BK8A 1H3PL 2FJGA 3SDCB 3TBWA 4XWGL 1B2WH 1FSKB 3OWEA 4GRLB 4OCWH 5D2LF 3DYOA 1NCUA 5CMAA 2ICWJ 3DHJA 1D9KB 4HCRH 1FFRA 4L4TB 1QR1B 5ICXA 3ZKND 4DFHA 4WGVB 5T1MA 4JZNA 1UJTA 3H42L 3QPQD 2YHGA 3GJEA 1YDPB 1CDJA 2YSSB 4Z5RA 5B4MD 1LO5B 3D9AH 4HS3A 3IDIA 4Q74A 1IVLA 4FXGA 1T5WB 1QSVA 5C9JB 5CSZB 4XPHH 2R56L 5GGUB 4WGWB 3QO1A 5B8CA 4C83B 3BP4B 4OQTL 4XGZA 2QQQA 5FKPA 3FT3B 1HSBB 3RIFF 1NBYB 5E94A 5EBWB 3H9HB 5J6GA 4MQXD 1RUMH 3UJJL 1XGTA 5C9KA 5DUPH 3C60D 3FQXB 1MNUL 4IBLT 5CSGA 2A6DB 3NABH 4WEBL 1QPXA 4X4ZA 1TETH 5L0QB 2XWTA 1JI1A 2H2SC 1CFSA 4PGCB 4XC3H 4F7TB 1CDUA 4CVZB 1DQDL 3BRDA 1ZTXL 1XGPB 1CLZH 2YA1A 4PYHA 5JXAH 2YOCA 4LSDA 2VNCA 3K74B 3T4AB 4X6EA 2VE6A 3BAEH 4KGLA 3GMOB 3RVTC 5C1MB 1UYWL 2A1WL 4DKEH 1FVDA 3T0XA 3F12B 3DGGB 2E7LA 1KCRL 3WE6A 1RIHH 5HVFB 4J3VA 5F96H 1YY8B 1KGCD 1IGFL 1WZ1L 2H32H 1A7OL 3MLTB 5I0ZA 4IMLB 5HGDB 1P53A 3VWJA 4BZ1L 4O9HL 2BRRH 2VR4A 5TDOB 3VI4E 1QRND 3GO1L 5JDSB 1CGSH 3PL6D 2AJVH 5GS3A 4PTTB 1OAXL 4J6RH 3IFPB 5EO9B 1QKZL 4NDMA 3KLSA 2AEIT 5GRYA 8FABA 5EPMA 1WBXB 2AW2A 3U7AA 3CX5J 4NYLB 2X4UB 2F8VA 2GAZA 1MCDA 5GRUH 2Z8SA 1F02I 3CZFA 5HI4D 3JWOC 3ZL4H 1U6AL 3PV7A 4BFGA 1HZHL 1ZLVK 1QSED 1CS6A 5K9QI 1IC5H 5TJWK 4JDTL 2GSIB 1XCQA 2VZ1A 1OGAA 3VWKC 4X7SH 3SGDH 2NX5A 1MRDL 1DP0A 4U1NA 5T1KB 3RWCA 1YEDA 3L3OB 1JGEA 1TTGA 4WO4A 1MVFA 4Z7VB 2VXVL 1E4JA 3KXFD 4HULB 3WIHL 3PP4H 5AZ2H 4R4FH 5CUSH 4PJEA 3EYFB 2BVUA 3HE7A 4PJ7F 4IIQB 1FVEB 2IAMC 1F4WH 3F7PC 5F9OL 1DUYB 1I9JL 1B0GA 1IRAY 2DLFL 4AEHH 3JXAA 4HJ0D 2R0ZL 3PIQA 4KROB 1C1EL 1MCLA 3QUKA 1FNLA 3BQUC 1Z0MA 3O0RL 1DQML 4ACPA 5E5RB 4PGEA 4NNYA 5C0AD 4G6FB 4EDXB 5I1EH 4FRWA 4JHAH 3H0TA 2W9EL 4KRPD 3RZCC 3SE3C 1JGVH 2J4WH 2Y5TB 4WNQA 3TV3H 3S5LG 3VG0L 2YA0A 2MHAA 4L9LA 1NEZB 2DQFB 1U95A 4YDJA 1J8HD 3V6BR 1QSFE 4DZBB 5A16B 2X70B 1NUDA 1WT5C 3AUVA 1XMWA 3RU8L 3HNSL 1HI6A 3KGRA 4HH9B 4H88L 4AIXA 2NXYC 2PKDA 4YHIA 4JFPA 2QHLA 1HOCA 1NL0L 1ITCA 2FX7L 4UTAH 4MA7H 3TH4T 4WHYG 5E1AA 1RUAH 4P2RE 4Y2DD 4L3ED 3ZDXE 1WAAF 4OIIH 2YR3A 2KL6A 2W65A 1CXFA 4I18C 1F90H 5C0CA 3WNOA 4L8DB 2OR9L 4NO5A 4XNYL 3IVKA 4J4PC 4OM1L 2QSQA 3PJSB 4CBPA 4JFDD 4J3WA 1CLOH 3UMTA 3PQYD 5LGHH 2DBJA 5EU3A 2JK5A 1JPTL 1VEPA 2PXYA 3GI9L 5C0BE 2R23B 3SDYL 2IFFH 1S9VA 4CVWA 4W81A 4F7CB 4MZ2A 3U0WH 3F7YB 4HKZB 2Q7YB 4XP9L 4LRNL 5I8OL 2HJLA 3DLQR 3FQUB 3RVVD 2Y23A 1A6WL 3SBWA 1KUMA 1RMFH 4C59B 5KJRH 3PF2A 1LO2H 2AK4D 4PJ5D 5I15H 3LAFA 1UFUA 5DJ2B 3N85L 5I1JH 3BKCL 3CFEA 3FO9B 2D7OA 2VL5B 1YQ2A 3IJYB 3UTOA 3BI9X 1IGCH 1LEIB 4K07A 2LAAA 3QFJD 2IG2L 4NQSA 2A6KB 3MJGX 5AAWA 3CDGB 2GYSA 3EJYD 1PEWA 3TNMA 4PRDA 1BOGB 3ARRA 3UC0H 1AO7D 1JIBA 4NZJA 1LEKA 1YEFL 2H8PA 2YRZA 1JZ7A 1KLGB 5GS0C 3HZMA 1MFBL 2J8UF 1ZA3B 3V5KA 1OP3K 1CDBA 4GS7C 3VFVB 4V2BA 4N5UA 2CMRH 5JIHA 3F58L 1OAYL 5K59F 2HH0H 1D5IL 5EIVA 3LIZH 1CBVH 1ROWA 1DDHB 1U8IB 1D5MB 5IMMA 4Y4KB 3C09C 3NA9H 4LLUB 3D0LB 3SY0B 2AJXH 1MJ8L 4R9HA 1QFUL 2H3NA 5DQJB 4JRYE 1H0DA 5GZNC 5BOPA 2PTTB 1E27A 2R1XA 1BD2E 2C26A 2EDFA 3CIQA 1DBJH 4S1SH 4AZ8A 5JO5A 3EYUH 2FO1A 5E6IB 3U2SB 2YUVA 2BSRB 2VC2L 1IAKA 2FO4B 3KPMB 3SDCC 2WWMC 5EBMA 5T3XE 4MD4B 1BJ1H 1FSKC 2FHFA 1OW0A 4GRLC 4D3CL 2HLAB 3MA9L 3WFHB 4KY1H 1CL7L 4HHAA 1YQVL 4YNYB 1T0MA 1IM9A 3QXWA 4OF5A 3MXWH 2G2RB 1PZ5B 3RX7A 3KLAB 5KS9A 2WSKA 3MLVL 4OLXH 3QIWD 4ZFFA 4I4WB 3WFDL 3QUYA 3ARFA 4LVHB 2CO7B 3BYYA 4HIXL 5ITFA 3A6CH 1HWGB 1BECA 5FUZL 4HWEL 2ICEB 2P8MB 3MV9A 3OKDA 4L8BA 2EC8A 3HLAA 5CINH 4NOBA 4M7JL 4M6OL 1Y6NR 3WIFA 4JRXA 2VERN 3QQ4A 1JYVA 4L4VA 5L2KD 5MP6L 4KH2A 3QDJE 2X40A 1G7IA 4Z78B 2BVQB 2WUCL 1Q0YH 4HX1A 4YXHL 1E0OB 2ADFL 3BE1H 3DUSA 5L0QC 3NCCB 5EOCJ 5CGYC 1NAKL 1C5CH 1UWGH 3OV6A 4NWTH 2VKWA 4AH2A 5D6DC 5JZ7C 4EI5A 3MBEA 1QNZH 1A4KA 1ZLWH 4MA8L 3GJFA 4PG2C 4M43H 2AVGA 4MLIA 5J1TC 1ADQL 1OAUL 3FOMA 1KNOB 4X6CE 5DZLA 5JR1H 1F11B 2B2XH 1D6VL 4N0UB 1TMCB 2WBWB 5KSAC 2P43B 5FO7B 5CGMA 4ODSH 5FECA 4NKIH 4L3CB 3QUMA 5HHOE 4Z7UA 1FG2A 2X1WL 5SWZB 4DQOL 1S7SA 1YN7A 3PWPB 4LLVA 5F7HA 2R2HB 3AAZA 4J1UB 2F15A 2VLJB 4YXKL 5DSCA 4X8JA 4KI1A 4CW1B 1FJ1B 1N7MH 5LGKA 4HK3N 5KW9L 1RHHB 1UXWB 2DJUA 5D96B 1NGWB 1PQZA 3DMMB 4Z7QF 5E95B 1FRGL 3MRQB 4P23B 3GSXB 5IESH 4RX4A 2ZCKH 2FR4A 4G80A 3MROA 1JWSA 5A2JH 3QIUA 1GPOL 1I1FA 4GG8A 4PP1C 2H9GB 5IEKB 5DRZA 3RWHA 3GHEH 1AD0A 1LGVA 4JO2L 2HTLC 1NGXA 3PUCA 3BKMH 1FO0L 4G7YH 1A7RL 5JQ6H 4UUJB 9CGTA 2JELH 4TOYH 4K3JH 4HPOH 3NH7L 3MCG1 3OXSB 2YD1A 3KYKH 4WW2A 1KACB 1UC6A 3MRDB 1QOKA 5I0DA 1C08B 1CYGA 4GW1B 1OTTC 1YEHH 5LGJB 1M7IA 2JLLA 4ODWA 3SKNB 3FQRA 2F54A 4JFOB 1KB5L 4XB8A 1A0QH 4DGVH 1F3DH 1F42A 1LP9E 1OCWH 3H7BB 2RCSH 1GZPB 1QG3A 4KUCD 3TO4C 3LKNB 3IFNL 3MRIA 4LHJB 5FGBA 5MERA 3FOLB 4WUUA 4W6YB 5HYJD 2VDKL 2FBOJ 4OD2B 4RMWA 1UACH 2GT9B 4KROC 2DYPB 1A4JA 1PY9A 5CIPB 1EUUA 4JN2A 2XFXA 2LFGA 1RQ5A 1VPOH 5IQ9B 3IDNA 4PJAE 4BZ2H 3VFNA 1AGDA 1HEZA 2XRAH 2MWCA 4QGYA 3KYMB 2FGWH 2FECL 4OCXL 1TJHH 2Y07L 4Z7WE 2BSSA 4HLZH 5FYKD 3NBNA 4DVBA 3MJ9H 5C0EB 5HVWA 1LO4H 4XCNA 1NCWH 3A6BH 2R29L 2Q86B 1ZGLP 2VXSH 1TJIL 2XY2A 3DSFH 4PRHA 4TPRH 4FZ8L 1GGUA 5C7XH 4K8RL 3TT1H 4X9BA 2WINA 1UM4H 4Q9QL 4YHMH 4H1LB 1CK0L 4U7SA 5BS0B 5ELIA 4S1RL 1HHHA 4YXLH 5IOPA 4X4ME 1AI1H 4OD3L 3DVNB 4PJHA 3TYFB 1VESA 3D69A 2ENYA 4O02H 3GMMB 1FORL 2GFBA 4N68A 2E9BA 4M6NH 4ODTL 3P4LA 2E7MA 5EOQH 4WJ5B 2A38A 3GUTA 3WEXA 4Q7DA 1M7DB 1CFVH 1NJ9A 4P5KB 3KJ6H 3GSVB 5IEHA 1JUFA 4RAHA 3LN5B 2FECI 5B39A 3DX7A 4GO6B 2Y6SD 4FQ1H 4NBZB 4AEEA 3RFZC 5DK0A 3BIBX 3WO4B 5F7NC 1JNLH 4WU5A 1NDGB 3SE9L 5IVXB 5DC4B 5HHXH 2WUBH 3VFPB 5DEGB 3EAKA 2UWEF 5IG7B 4PJXA 5SX5H 1FLRL 1A6AB 4LDLB 4LVEA 2O5XH 2OL3L 5FO9A 1Q9OA 3MMEA 1MI5E 3OKMA 4OIAA 5DUML 2HJFA 1OLZA 5LAXA 3VWJD 4X4XB 5MEQB 3ARQA 3RRQA 2ARWA 3DETD 1QSZA 2NPLX 5D2LE 5KAQF 5KTEH 4WI4A 4LAJH 4BUHA 5JHLL 1UA6H 2DQDH 5I76B 1BMGA 1CF8H 3QQ3A 2F8OA 3PP3H 1UKTA 3FHQA 4YUEL 3C5ZD 3F7VA 3ALPA 5AEAA 4NBXB 1X4YA 3B9EA 3HR5A 3OBAA 4F2MA 5DHXB 1MEXH 3CDFA 3H6JA 4TNWK 5TE4H 2CXKA 2FLBT 3QG7L 5GSRB 1ZA6B 1ZLUH 4Y4KC 4OSUL 1MCHA 3O3BA 1I85A 4BK5A 3FO2A 5DJXA 5H35B 4JY5L 4Z9KB 2NX5D 4KDTA 3VCLB 4G8IA 5K9KB 1NEZG 4WO4D 1E6JL 5IP4A 1P6FA 2AKRB 5E6IC 1JGDB 5IK3A 3HB3D 4Z95L 4XP1H 3RQ3A 1NCDH 4K9EC 4RBPK 1JTTA 3X11B 1ZT4B 4DN4L 3HE7D 1LWRA 3SCMB 4NQEA 2XYCA 3EYOA 3QQ9C 3RY6C 3PHOB 1CN4A 4P46D 1U58A 1UCBH 4I77L 1Q1JH 2IPTH 3RWGB 4YBHA 1CFQB 2HT2D 4PREB 1EGJL 2FJHA 4L5FH 1QPPA 5T3ZL 1C16A 4Q2ZA 4MA3A 2HT4C 1QLRB 3HPLB 4NHCL 3O9WB 1KJ3L 4X99A 1XF3B 2DKMA 2NW3B 4M7KH 3V5DA 3GIZL 4F7EA 2X4QB 1AY1L 2O61A 4Z18A 5CFHA 1ZWIA 4LVHC 1TQBB 1J05B 3RVWC 1S3KH 1HINH 4R96B 1MF2H 3MNZA 4JZOB 3ARBB 3FFCA 4G5ZH 1I1YA 3IAGC 3LPWA 3STZA 2ZCHH 4KQ3L 1HHIA 3DIFA 3OKEB 4U33A 4RDQF 3V79C 4JJHA 1WCBB 3M8OH 1TNNA 5IB1B 1PG7H 1G6VK 1YECH 2IWGA 15C8H 1A3LL 4QOKB 4PJFA 3CLEL 4TUKH 1FZJA 2YD7A 1YMME 1XIWA 4AQOA 1AQKL 4GAGH 4TSBL 2XNAB 3S9DB 1YN6A 4UINL 3KYOB 1NPUA 2ADJA 3S98A 1QFOA 4D0DA 1WITA 5F6HI 3FB5A 1BVKA 5C0IA 3SPVA 2GITA 4HXBH 5FM4A 2PXYD 3MRLB 5DS8B 2YK1L 5C09B 2CIKB 4ODUB 3IAPA 4JM4L 4ZG1A 4J3SA 4P2RB 3DO7A 2YA2A 4U6XA 3D39B 3EOTL 4UT6L 5AUMB 1T03L 3UTZA 4PJ7E 2VN7A 4GMTL 3GKZA 4NQXB 3HUJF 3WNPA 5BMFH 1QRNE 4QXUH 4F7PA 4KPHH 4Z0BH 2NY3B 1RK1B 1DFBL 5D96C 4GQ9H 3DMMC 4Q9BA 4QXGH 5IVOA 5C0BB 1EO5A 5D1QD 5J6HB 2BY1A 5BVPH 4P23C 2BVPB 5FUOH 3X3GL 2N7AA 5HGBA 4WHTB 4G6AD 3BZDA 5ESQA 3TBVA 3C87A 1XFPA 1S78C 4JFYA 3QI9B 1J18A 3OXRB 1GCFA 4TULH 3BP6B 5ETUB 4MSWB 4XCEB 2OS7A 4P5TC 2VRAA 5DRNA 3IKCB 1UADC 3U82B 3KHQA 1BZ7A 1B0RB 1FBIL 2XTJE 1FH5H 3QHFH 2HA1A 1BEYL 4DKFL 3SDDC 1WC7A 3KS0J 1RVFL 3GM8A 43CAB 3TFKD 5FK9B 4HIIA 3S5LA 1AKJD 4XMLH 1YUHA 1KN4H 5IBTH 4LPUA 3VW3H 2NR6D 3BGAA 1WAAE 1HYSD 5HHNA 1YYLH 3ZE1F 5BQ7B 1U3YA 4JR9L 1KTKE 1EEYA 1GC1C 1EMTL 3VXSD 2ZNXA 4OCNC 5FOBB 1PSKL 4CN4A 5HHQB 2QQLL 4KUZH 4RGOL 4EUPH 2Z35A 1HXMA 2UZIL 1UM5L 4EI6B 4ZPTA 3FQNA 4S0SD 3OB0H 1KJMA 4MCZA 1PW3A 1QEWA 5GZOD 1A2YA 4JZJC 4JRYB 1X5GA 5IWLC 1ZV5A 3HPJA 3HZYB 1IM9D 1BD2B 3PHQB 3TZVA 3RI5F 1LK2A 5GGTH 1NC2D 2CDFB 1KBGH 3DX6A 5CBAB 3KPNB 5IW6B 2Z9TA 3QUYD 3ARFD 2EIDA 2X4NA 3FRUB 3HAEB 2Q6WB 1UM6L 3Q5TA 1CT8A 3KPLB 3UROR 2GCYB 3MV9D 1XF5B 4PV8A 1R24A 3O8XB 4Y0GA 1IL1A 1LO3L 4D0BA 1DL7L 4JRXD 4Y5YC 4E42B 1KEMH 4PP2B 4L4VD 1WWCA 3MV8B 3MUY1 3KDMA 2ZUXA 2KZ1B 3ZHLA 2J8UE 4KKLC 5B3NA 3S6CA 3UTQA 3RWIA 5C70A 1UH2A 5L6YH 5K59E 2A73B 5I17A 3CNKA 1IILE 5CEYA 3QXVA 2IAMA 3MLWL 4M61B 4EI5D 4XC1L 1XCTA 4KTEL 1FNSL 3IFLH 4FFVD 4X5XA 4AEIL 1H9VA 5F6HJ 3MBED 2JB5L 3VGAB 1SM3H 3WO4C 5L7XL 1WFOA 1EVTC 1GGTA 2VZTA 4RIRA 3QDJB 3R06A 2AK4E 4PJ5E 2RQ8A 3VMPA 3MUGA 4KKAC 3DTXB 1GSMA 3RPIA 5IT2L 4JFFA 1K4CB 1NCBL 3OR6B 3BO8B 3SE3A 4W70A 3JUZA 2D7QA 4GRMA 4ZS6D 3V7AE 4TRPH 4HK0B 4K7FA 2V5YA 4LEXL 4HWZB 4HBQA 4JO1H 4NQTA 3QRFM 4S1QL 3L3HA 2CLZA 4AIZB 2B0SL 3MJ7B 4ONFL 3VGDA 3LKSB 2W92A 4X6CB 2LU4A 4MVBD 5E8OB 4RX4D 2H2PC 3THML 5HY9B 4N8CL 3O11B 1TQCB 3KPQA 2VTFA 5IV2B 4X6DF 4H5SB 5GS1B 3Q3GA 1EHLH 4TVPD 1A1OB 1S7RA 1R3KB 4OKVB 5EZLB 1RHFA 3RWFB 1EUTA 4M62H 3S36X 4I18A 1GAFL 4FQIL 1DLFL 3MTRA 4J4PA 4XPFL 3V0WL 3WCYA 4XPGH 4NPYA 1MY5A 4LSVH 1S9YA 1A3QA 2CDGB 1OSPL 4NZTH 2ZSWA 1P4IL 1W2KT 5D1XB 2P44B 3T4YB 2AGJL 1H3WM 5CHNA 2F54D 2Z0BA 3ARDB 4IOFD 1DN0A 5FDYA 4IRZH 4GOSA 3DX9A 6FABH 5ERWA 1DBKH 3SCMC 1QVOB 3T2PA 4W6XB 3NIFF 1T5XB 3S4SA 1MHHA 4X9IA 5IM7B 1U8KA 3EGSA 4WUUD 2CJUL 3LV3A 1FZKB 3NA4A 4PJ8D 2APFA 1JNNH 4C56D 5GGVL 1DE4B 1MLBA 3D87B 3QWQB 4YZFF 1J9CT 2V5TA 1P5VA 1IBGH 3SDXA 1U8LB 4KK9C 5FEBA 1RZJL 3O2VL 3RTQA 4CDHA 1UGNA 5EFIA 2JJSA 1G6RL 5E2WH 1Y6MR 5CEZH 2GJJA 5IIEB 4RFOH 5F9JB 1TQBC 1W72A 2I60L 1I4FB 3CXHK 1D5XA 3ARBC 4HXAH 4MS8D 5H2BB 3LKOB 2FIKB 4Z7QE 1HNFA 1RU9H 1WLHA 4PRHD 5BJTB 4YX2H 3EHBC 5D7SH 5L2KE 3L5WB 1JN6B 4HD9A 4JPKH 4OGZA 2F19H 1FE8H 2AJYH 2DI7A 4OM0H 4K3DL 2OJZH 1WK0A 3EIFA 3T2QA 1NGYA 1EO8L 5CEXB 4JN1H 2XXMB 3FB7A 3UTTD 4HQQL 3HA0A 4M48L 4R2GB 4LP4A 3X12A 1W0VA 1FNFA 2QKIA 4QRQA 1C7TA 3HC3L 1RY7B 2BMKB 8CGTA 1QA9A 2AJUL 1NMAL 4JEGB 1PYWB 4ZTOH 1BFVL 2R0LH 2MKLC 5DD5L 3ZYJA 3BHBA 4DGIH 3EO0A 1NGQL 1ONQA 1EJOH 3B2VH 5F88B 5I8EB 3T65B 5JORB 2YSSA 3VXRD 1MJUL 2G5BB 4FQXB 3L7EB 1OPGL 4B7LA 5C9JA 3WFCL 2I5YH 1XGRB 4U6VH 4FABH 4C83A 4MJIB 4ESKA 3K1KC 4N0RA 4WHCA 3ZKMD 3A67H 4HUUB 4FQHB 1AR2A 1HSBA 2UVEA 3LB6C 1RZFL 1TVDA 3QI9C 4LLDA 3U46B 4QLRA 4ZFOB 4NUGH 5CP7A 5EBWA 3U4EB 3H9HA 4FQ2L 3UAJD 4G8GB 4KJWD 1FYTB 5E8EB 3V8OA 1E4XH 3FQXA 2A6DA 3ALXA 3LZFH 4Z7OF 3W5MA 1MHPL 5TQ2L 1A9EA 5AWNL 2J1KA 2R15A 4PGCA 4XVUD 4AL8H 4F7TA 5C6PB 4CVZA 3MZGB 3QIBB 2QSCH 4I2XA 5MENB 1KB9K 4MDJA 1FFNB 4IS6A 2X4TA 5D6DA 3HMXL 3GMOA 3CMGA 3K0WA 3V9FA 4D0CA 3O3UN 1MPAL 4ZO6A 3B9KB 2APBA 1N0LA 4JQVC 4WFHD 4PG2A 4LLWA 4PRNB 3UJIH 4MA1B 2Q76B 3F12A 4R7NB 5EBGA 3QRGL 2EH8H 1YY8A 5KSAA 1AR1C 4O2EB 1OARH 1RZ7L 3MLTA 2M2DA 5HGDA 1FPTL 5JDJA 4NQED 4ENED 3MV7A 5TDOA 4OZHA 3SJVD 4N8VB 5JDSA 2UYLB 2XZAH 4Z76B 4H0GA 4JG1H 3CFDA 1DN2A 3VXME 3IS0X 5EO9A 5CJ8A 5BV7H 1UQSB 1VGEH 2LU3A 2UWEE 1NBZA 1T89C 3QWOB 2ARJB 1Z3GL 4LARH 1QBML 1G7LB 1GHFL 1NUNB 3LQAH 4NYLA 3GSNH 2B1AL 4LIQL 4WEUD 2VAAB 4JDVB 1TNMA 1MREH 3S3JA 4DAGH 1U8OA 1IQDB 2MQ0A 3FFCD 3O8XC 4KVNH 5D6CB 4DTGL 2GSIA 4MNGA 2C7UA 4DKAA 1JNHB 3L3OA 4AG4L 4BELD 3VFWB 5BO1H 5C0ND 3MR9B 4JFQB 4GQPH 3TN0D 5EC2A 5ID1A 3EYFA 2DB8A 3VFTB 4K23H 3TO4A 5DJCB 4XXDA 4GUPB 2M26A 1DUYA 5FB8B 4ZFZB 1AE6L 1T1YB 4WTZA 5H8DA 1WWBX 2F74B 4WEMB 5EBLB 4GW4B 2G9HA 3B2UD 4AQ1B 5DJZA 3VMNA 1H3VA 5ADOH 4X83A 1JL8A 4Z8FL 1YNLH 4NFDA 4PRIA 2VDRH 4ZAKB 5ITBH 4JANA 5J57B 1VFMA 3I3EA 2HLFD 2PW1B 5BZWA 3WDJA 2Y5TA 3ROLB 1F00I 3TVMD 4R4NC 3VH8B 3VA6A 2E9IA 3UTPE 2DQFA 4N0YL 2OK0H 3JV0A 3GRWA 1MJ7L 2BVTA 4DOHB 5A16A 2X70A 5HYFA 1L7IH 4NRZB 3WXVH 2NW2B 4HH9A 4O4YH 4OCLC 2DQGL 4O2CB 3DJ9A 4RQQB 5L9DH 1TXKA 1WV7T 3TA3B 2D9QB 3I9GH 1F8TH 1QQDA 5I1CL 1RULL 1BAFH 2D7NA 4HKXA 4IOSD 4OLZL 2XZCH 3BIKB 2DTSA 1QRNB 3PGDB 4FFYL 4N0FB 3PL6B 3NFSL 2B39A 4L8DA 1X5FA 4JKPH 2H6PA 3PJSA 3MODH 5H94B 5IBUB 1T4KB 2H2SD 1RJYB 4DGYL 1MRFH 2EYRB 1DTUA 5D1XC 5EB9A 5D7LA 3RIAF 1X5JA 2EYSA 4H8WC 3F7YA 3P77A 4HKZA 2KPNA 5CAYB 3RVTD 1JCKA 1MWAL 1I7TB 5I19H 3OL2A 3HAEG 3KPSA 1S7TB 5C0DB 3AMKA 3TCLA 5M95B 4ZUWB 4UU9B 1RIVL 1I1AB 2EE9A 1QSEB 3FO9A 2I9TB 2XTJB 4E9LA 1MCSA