1H0ZA

Lekti domain six
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
ESGKATSYAELCNEYRKLVRNGKLACTRENDPIQGPDGKVHGNTCSMCEVFFQAEEEEKKKKEGESRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEASE INHIBITOR KAZAL-TYPE 5, CONTAINS HEMOFILTRAT
publication title Homologous Proteins with Different Folds: The Three-Dimensional Structures of Domains 1 and 6 of the Multiple Kazal-Type Inhibitor Lekti
pubmed doi rcsb
molecule tags Serine proteinase inhibitor
total genus 9
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2002-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1h0zA00
1UVGA 1AN1I 1BUSA 1SGEI 1TBQR 2GKVA 1PJUA 2ARPF 1LR9A 2NU1I 3HH2C 3OVOA 1SGRI 3SGBI 1SGNI 1TGSI 1SGPI 2P6AC 1UUCA 1HDLA 1R0RI 2OVOA 1TUSA 1Y1BA 2SGEI 1DS3I 1CSOI 4OVOA 2XRCA 1M8BA 2N71A 2NU0I 3SEKC 1CHOI 1OVOA 3TJQA 4SGBI 1SGDI 1OMTA 1UVFA 2NU2I 1TURA 2N52A 2QQCA 1CT4I 1PCEA 2JZMA 1IY5A 2JYYA 2N17A 1OYVI 1TBRR 2KCXA 1LR8A 1MT1A 2F3CI 1DS2I 1LR7A 2GKTI 2KMOA 2SGDI 1IY6A 3SGQI 4GI3C 1PPFI 2V53A 1SGQI 4HGUA 1YU6C 1CGII 1H0ZA 2KMPA 1IW4A 3QTLD 2QQDA 2M5XA 1FYBA 1Y1CA 2KMQA 1BMOA 3B4VC 1CE3A 1NUBA 2SGPI 1OMUA 1YTPA 2BUSA 1HPTA 1N13A 5DAEA 1M8CA 2JXDA 1HJAI 5JHWC 2NU4I 1CT0I 2SGFI 2LEOA 2KMRA 1TIHA 1Z7KB 1KMAA 2SGQI 1CGJI 2WCYA 2B0UC 2GKRI 1SGYI 2ERWA 1CT2I 2NU3I
chains in the Genus database with same CATH superfamily
1UVGA 1AN1I 1S20A 3UEJA 1K7VA 3OL0A 1BUSA 1VDDA 5FUVA 3VE5A 1SGEI 2RC4A 3OXFA 1TBQR 2GKVA 3R5DA 1ULNA 3UGDA 1P9ZA 1PJUA 2RIJA 5HQ8A 3D00A 2ARPF 1LR9A 1WKXA 5FUYA 2NU1I 1MJ9A 2QPOA 2QQ0A 3HH2C 3OVOA 1ULKA 1XX6A 1SGRI 2WGCA 3SGBI 1SGNI 1TGSI 1SGPI 1Q9BA 1K7UA 2OD1A 2P6AC 1UUCA 2J9RA 1R0RI 3OXLA 3R5AA 5EX3A 3UEYA 1HDLA 5CCLA 2JW6A 1TUSA 1Y1BA 2OVOA 2SGEI 4MPIA 1DS3I 3KY9A 3QAHA 5HI7A 3UFFA 1CSOI 3E59A 4OVOA 4FKDA 1WTJA 3TO6A 2X52A 2XRCA 4UXJA 1M8BA 4UXHA 2N71A 3GOXA 1KBFA 2NU0I 3SEKC 1FY7A 1CHOI 1OVOA 1WGTA 2ENZA 4SGBI 3TJQA 4AMLA 2GIVA 4B6DA 3R5CA 1W4RA 4E1RA 1SGDI 2DIPA 1OMTA 1TBOA 2ENNA 1UVFA 3FC3A 2V1CC 1RFHA 5E3QA 1HEVA 2PQ8A 2NU2I 1TURA 5FUWA 2CJSC 2K9HA 2UVOA 2N52A 1Y8FA 2QQCA 7WGAA 2V1CA 1CT4I 1PCEA 3MEKA 3TO9A 2VRWB 2JZMA 2ORWA 3UOEA 1ULMA 1IY5A 2JYYA 5J8FA 2N17A 5CCMA 2ELIA 1TOTA 3UGLA 5E3RA 1WGCA 1Z2IA 1X4SA 2DKVA 1OYVI 1TBRR 2KCXA 3BJIA 1U5KA 1LR8A 1MT1A 2N1AB 2UZ3A 2F3CI 1DS2I 1LR7A 2LUYA 2OZUA 2GKTI 2LB7A 3FSXA 5FUXA 2KMOA 3R5BA 2SGDI 1IY6A 1K7TA 2WVJA 3SGQI 4UXIA 2ORVA 2FNFX 4GI3C 3QWPA 2E73A 2B8TA 3OXGA 1PPFI 1MJBA 1SGQI 1PTRA 2V53A 5EX0A 4HGUA 1YU6C 1CGII 1H0ZA 3E2IA 1FARA 3RU0A 2GVIA 2KMPA 1P9GA 2L7XA 1W3SA 1MJAA 2QQDA 2M5XA 1NXUA 3QTLD 1IW4A 1FYBA 3TO7A 1UHAA 2Y0MA 1Y1CA 1XA6A 2KMQA 1BMOA 3B4VC 1CE3A 1KBEA 2CWGA 2DB6A 3FSYA 4E1PA 2CWHA 4DNCA 4JCVE 1TBNA 5E3PA 1NUBA 2SGPI 4A24A 3VDPA 1OMUA 1YTPA 2BUSA 3PDNA 1HPTA 1N13A 2OU2A 2J87A 2W0TA 2YUUA 1M8CA 5DAEA 3TOAA 2ODDA 1V1HA 1FAQA 2A20A 2JXDA 1XBTA 1HJAI 2YQPA 2NU4I 3CXLA 5JHWC 2L8EA 1R79A 1CT0I 2SGFI 2E5RA 2CWFA 2LEOA 2JA1A 4WP4A 3TOBA 3UGIA 2KMRA 3VDUA 1TIHA 1V1IA 5J8CA 1Z7KB 1KMAA 1X74A 2X3TA 4L9MA 2SGQI 1CGJI 2WCYA 9WGAA 2B0UC 2GKRI 1SGYI 2ERWA 1CT2I 1PTQA 2NU3I 2ROWA 2QQEA
chains in the Genus database with same CATH topology
1UVGA 1AN1I 3UEJA 3OL0A 1BUSA 1VDDA 5FUVA 3VE5A 1SGEI 3OXFA 1TBQR 2GKVA 3UGDA 1PJUA 5HQ8A 3D00A 2ARPF 1LR9A 5FUYA 2NU1I 2QPOA 2QQ0A 3HH2C 3OVOA 1XX6A 1SGRI 3SGBI 1SGNI 1TGSI 1SGPI 2P6AC 2OD1A 3UEYA 1UUCA 2J9RA 1R0RI 3OXLA 1HDLA 5EX3A 5CCLA 2JW6A 1TUSA 1Y1BA 2OVOA 2SGEI 1DS3I 3KY9A 5HI7A 3UFFA 1CSOI 3E59A 4OVOA 4FKDA 4UXJA 2XRCA 1M8BA 4UXHA 2N71A 3GOXA 1KBFA 2NU0I 3SEKC 1CHOI 1OVOA 3TJQA 2ENZA 4SGBI 4B6DA 1W4RA 4E1RA 1SGDI 2DIPA 1OMTA 1TBOA 2ENNA 1UVFA 3FC3A 2V1CC 1RFHA 2NU2I 1TURA 5FUWA 2CJSC 2K9HA 2N52A 1Y8FA 2QQCA 2V1CA 1CT4I 1PCEA 3MEKA 2VRWB 2JZMA 2ORWA 1IY5A 2JYYA 2N17A 5CCMA 2ELIA 1TOTA 3UGLA 1X4SA 1OYVI 1TBRR 2KCXA 3BJIA 1U5KA 1LR8A 1MT1A 2N1AB 2UZ3A 2F3CI 1DS2I 1LR7A 2LUYA 2GKTI 5FUXA 2KMOA 2SGDI 1IY6A 2WVJA 3SGQI 4UXIA 2ORVA 2FNFX 4GI3C 3QWPA 2E73A 2B8TA 3OXGA 1PPFI 2V53A 1SGQI 1PTRA 5EX0A 4HGUA 1YU6C 1CGII 1H0ZA 3E2IA 1FARA 3RU0A 2GVIA 2KMPA 2L7XA 1IW4A 1W3SA 2QQDA 3QTLD 2M5XA 1FYBA 1Y1CA 1XA6A 2KMQA 1BMOA 3B4VC 1CE3A 1KBEA 2DB6A 4E1PA 4JCVE 1TBNA 4A24A 1NUBA 2SGPI 3VDPA 1OMUA 1YTPA 2BUSA 3PDNA 1HPTA 1N13A 2J87A 2W0TA 2YUUA 1M8CA 5DAEA 2ODDA 1V1HA 1FAQA 2A20A 2JXDA 1XBTA 1HJAI 2YQPA 2NU4I 3CXLA 5JHWC 2L8EA 1R79A 1CT0I 2SGFI 2E5RA 2LEOA 2JA1A 3UGIA 2KMRA 3VDUA 1TIHA 1V1IA 1Z7KB 1KMAA 1X74A 4L9MA 2SGQI 1CGJI 2WCYA 2B0UC 2GKRI 1SGYI 2ERWA 1CT2I 1PTQA 2NU3I 2ROWA 2QQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UVG A;  1AN1 I;  1BUS A;  1SGE I;  1TBQ R;  2GKV A;  1PJU A;  2ARP F;  1LR9 A;  2NU1 I;  3HH2 C;  3OVO A;  1SGR I;  3SGB I;  1SGN I;  1TGS I;  1SGP I;  2P6A C;  1UUC A;  1HDL A;  1R0R I;  2OVO A;  1TUS A;  1Y1B A;  2SGE I;  1DS3 I;  1CSO I;  4OVO A;  2XRC A;  1M8B A;  2N71 A;  2NU0 I;  3SEK C;  1CHO I;  1OVO A;  3TJQ A;  4SGB I;  1SGD I;  1OMT A;  1UVF A;  2NU2 I;  1TUR A;  2N52 A;  2QQC A;  1CT4 I;  1PCE A;  2JZM A;  1IY5 A;  2JYY A;  2N17 A;  1OYV I;  1TBR R;  2KCX A;  1LR8 A;  1MT1 A;  2F3C I;  1DS2 I;  1LR7 A;  2GKT I;  2KMO A;  2SGD I;  1IY6 A;  3SGQ I;  4GI3 C;  1PPF I;  2V53 A;  1SGQ I;  4HGU A;  1YU6 C;  1CGI I;  1H0Z A;  2KMP A;  1IW4 A;  3QTL D;  2QQD A;  2M5X A;  1FYB A;  1Y1C A;  2KMQ A;  1BMO A;  3B4V C;  1CE3 A;  1NUB A;  2SGP I;  1OMU A;  1YTP A;  2BUS A;  1HPT A;  1N13 A;  5DAE A;  1M8C A;  2JXD A;  1HJA I;  5JHW C;  2NU4 I;  1CT0 I;  2SGF I;  2LEO A;  2KMR A;  1TIH A;  1Z7K B;  1KMA A;  2SGQ I;  1CGJ I;  2WCY A;  2B0U C;  2GKR I;  1SGY I;  2ERW A;  1CT2 I;  2NU3 I; 
#chains in the Genus database with same CATH topology
 1UVG A;  1AN1 I;  1S20 A;  3UEJ A;  1K7V A;  3OL0 A;  1BUS A;  1VDD A;  5FUV A;  3VE5 A;  1SGE I;  2RC4 A;  3OXF A;  1TBQ R;  2GKV A;  3R5D A;  1ULN A;  3UGD A;  1P9Z A;  1PJU A;  2RIJ A;  5HQ8 A;  3D00 A;  2ARP F;  1LR9 A;  1WKX A;  5FUY A;  2NU1 I;  1MJ9 A;  2QPO A;  2QQ0 A;  3HH2 C;  3OVO A;  1ULK A;  1XX6 A;  1SGR I;  2WGC A;  3SGB I;  1SGN I;  1TGS I;  1SGP I;  1Q9B A;  1K7U A;  2OD1 A;  2P6A C;  1UUC A;  2J9R A;  1R0R I;  3OXL A;  3R5A A;  5EX3 A;  3UEY A;  1HDL A;  5CCL A;  2JW6 A;  1TUS A;  1Y1B A;  2OVO A;  2SGE I;  4MPI A;  1DS3 I;  3KY9 A;  3QAH A;  5HI7 A;  3UFF A;  1CSO I;  3E59 A;  4OVO A;  4FKD A;  1WTJ A;  3TO6 A;  2X52 A;  2XRC A;  4UXJ A;  1M8B A;  4UXH A;  2N71 A;  3GOX A;  1KBF A;  2NU0 I;  3SEK C;  1FY7 A;  1CHO I;  1OVO A;  1WGT A;  2ENZ A;  4SGB I;  3TJQ A;  4AML A;  2GIV A;  4B6D A;  3R5C A;  1W4R A;  4E1R A;  1SGD I;  2DIP A;  1OMT A;  1TBO A;  2ENN A;  1UVF A;  3FC3 A;  2V1C C;  1RFH A;  5E3Q A;  1HEV A;  2PQ8 A;  2NU2 I;  1TUR A;  5FUW A;  2CJS C;  2K9H A;  2UVO A;  2N52 A;  1Y8F A;  2QQC A;  7WGA A;  2V1C A;  1CT4 I;  1PCE A;  3MEK A;  3TO9 A;  2VRW B;  2JZM A;  2ORW A;  3UOE A;  1ULM A;  1IY5 A;  2JYY A;  5J8F A;  2N17 A;  5CCM A;  2ELI A;  1TOT A;  3UGL A;  5E3R A;  1WGC A;  1Z2I A;  1X4S A;  2DKV A;  1OYV I;  1TBR R;  2KCX A;  3BJI A;  1U5K A;  1LR8 A;  1MT1 A;  2N1A B;  2UZ3 A;  2F3C I;  1DS2 I;  1LR7 A;  2LUY A;  2OZU A;  2GKT I;  2LB7 A;  3FSX A;  5FUX A;  2KMO A;  3R5B A;  2SGD I;  1IY6 A;  1K7T A;  2WVJ A;  3SGQ I;  4UXI A;  2ORV A;  2FNF X;  4GI3 C;  3QWP A;  2E73 A;  2B8T A;  3OXG A;  1PPF I;  1MJB A;  1SGQ I;  1PTR A;  2V53 A;  5EX0 A;  4HGU A;  1YU6 C;  1CGI I;  1H0Z A;  3E2I A;  1FAR A;  3RU0 A;  2GVI A;  2KMP A;  1P9G A;  2L7X A;  1W3S A;  1MJA A;  2QQD A;  2M5X A;  1NXU A;  3QTL D;  1IW4 A;  1FYB A;  3TO7 A;  1UHA A;  2Y0M A;  1Y1C A;  1XA6 A;  2KMQ A;  1BMO A;  3B4V C;  1CE3 A;  1KBE A;  2CWG A;  2DB6 A;  3FSY A;  4E1P A;  2CWH A;  4DNC A;  4JCV E;  1TBN A;  5E3P A;  1NUB A;  2SGP I;  4A24 A;  3VDP A;  1OMU A;  1YTP A;  2BUS A;  3PDN A;  1HPT A;  1N13 A;  2OU2 A;  2J87 A;  2W0T A;  2YUU A;  1M8C A;  5DAE A;  3TOA A;  2ODD A;  1V1H A;  1FAQ A;  2A20 A;  2JXD A;  1XBT A;  1HJA I;  2YQP A;  2NU4 I;  3CXL A;  5JHW C;  2L8E A;  1R79 A;  1CT0 I;  2SGF I;  2E5R A;  2CWF A;  2LEO A;  2JA1 A;  4WP4 A;  3TOB A;  3UGI A;  2KMR A;  3VDU A;  1TIH A;  1V1I A;  5J8C A;  1Z7K B;  1KMA A;  1X74 A;  2X3T A;  4L9M A;  2SGQ I;  1CGJ I;  2WCY A;  9WGA A;  2B0U C;  2GKR I;  1SGY I;  2ERW A;  1CT2 I;  1PTQ A;  2NU3 I;  2ROW A;  2QQE A; 
#chains in the Genus database with same CATH homology
 1UVG A;  1AN1 I;  3UEJ A;  3OL0 A;  1BUS A;  1VDD A;  5FUV A;  3VE5 A;  1SGE I;  3OXF A;  1TBQ R;  2GKV A;  3UGD A;  1PJU A;  5HQ8 A;  3D00 A;  2ARP F;  1LR9 A;  5FUY A;  2NU1 I;  2QPO A;  2QQ0 A;  3HH2 C;  3OVO A;  1XX6 A;  1SGR I;  3SGB I;  1SGN I;  1TGS I;  1SGP I;  2P6A C;  2OD1 A;  3UEY A;  1UUC A;  2J9R A;  1R0R I;  3OXL A;  1HDL A;  5EX3 A;  5CCL A;  2JW6 A;  1TUS A;  1Y1B A;  2OVO A;  2SGE I;  1DS3 I;  3KY9 A;  5HI7 A;  3UFF A;  1CSO I;  3E59 A;  4OVO A;  4FKD A;  4UXJ A;  2XRC A;  1M8B A;  4UXH A;  2N71 A;  3GOX A;  1KBF A;  2NU0 I;  3SEK C;  1CHO I;  1OVO A;  3TJQ A;  2ENZ A;  4SGB I;  4B6D A;  1W4R A;  4E1R A;  1SGD I;  2DIP A;  1OMT A;  1TBO A;  2ENN A;  1UVF A;  3FC3 A;  2V1C C;  1RFH A;  2NU2 I;  1TUR A;  5FUW A;  2CJS C;  2K9H A;  2N52 A;  1Y8F A;  2QQC A;  2V1C A;  1CT4 I;  1PCE A;  3MEK A;  2VRW B;  2JZM A;  2ORW A;  1IY5 A;  2JYY A;  2N17 A;  5CCM A;  2ELI A;  1TOT A;  3UGL A;  1X4S A;  1OYV I;  1TBR R;  2KCX A;  3BJI A;  1U5K A;  1LR8 A;  1MT1 A;  2N1A B;  2UZ3 A;  2F3C I;  1DS2 I;  1LR7 A;  2LUY A;  2GKT I;  5FUX A;  2KMO A;  2SGD I;  1IY6 A;  2WVJ A;  3SGQ I;  4UXI A;  2ORV A;  2FNF X;  4GI3 C;  3QWP A;  2E73 A;  2B8T A;  3OXG A;  1PPF I;  2V53 A;  1SGQ I;  1PTR A;  5EX0 A;  4HGU A;  1YU6 C;  1CGI I;  1H0Z A;  3E2I A;  1FAR A;  3RU0 A;  2GVI A;  2KMP A;  2L7X A;  1IW4 A;  1W3S A;  2QQD A;  3QTL D;  2M5X A;  1FYB A;  1Y1C A;  1XA6 A;  2KMQ A;  1BMO A;  3B4V C;  1CE3 A;  1KBE A;  2DB6 A;  4E1P A;  4JCV E;  1TBN A;  4A24 A;  1NUB A;  2SGP I;  3VDP A;  1OMU A;  1YTP A;  2BUS A;  3PDN A;  1HPT A;  1N13 A;  2J87 A;  2W0T A;  2YUU A;  1M8C A;  5DAE A;  2ODD A;  1V1H A;  1FAQ A;  2A20 A;  2JXD A;  1XBT A;  1HJA I;  2YQP A;  2NU4 I;  3CXL A;  5JHW C;  2L8E A;  1R79 A;  1CT0 I;  2SGF I;  2E5R A;  2LEO A;  2JA1 A;  3UGI A;  2KMR A;  3VDU A;  1TIH A;  1V1I A;  1Z7K B;  1KMA A;  1X74 A;  4L9M A;  2SGQ I;  1CGJ I;  2WCY A;  2B0U C;  2GKR I;  1SGY I;  2ERW A;  1CT2 I;  1PTQ A;  2NU3 I;  2ROW A;  2QQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...