1H1QB

Structure of human thr160-phospho cdk2/cyclin a complexed with the inhibitor nu6094
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Structure-Based Design of a Potent Purine-Based Cyclin-Dependent Kinase Inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h1qB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h1qB02
2WMBB 2CJMB 3MY5B 2UZDB 1BU2A 2UZEB 3M03A 5CEIB 2C5OB 1H1RB 4BCMB 5ACBA 1O9KB 4EOMB 1H24B 4ELLA 3TNWB 4EOQB 2W2HA 1OKWB 4CFXB 4F6SB 2PK2A 4F7JB 1ZP2A 4BCQD 4CFVB 2WIHB 2C5NB 4KRCB 2WMAB 4F7NB 4ROEA 3MY1B 4II5B 4BCFB 4BCND 1OI9B 2W9FA 2PMIB 1H1PB 2C4GB 2UZBB 4EOLB 5ICPB 3DDPB 4CFMB 3TN8B 1H28B 2UZLB 2V22B 4EORB 4F7SB 4EOKB 1F5QB 1N4MA 1E9HB 1URCB 1VYWB 1AD6A 4FX3B 5HNBB 2CCIB 3BLHB 4F6WB 2G9XB 5HBHB 4BCHB 1OKVB 5LMKB 1O9KA 2WXVB 1JSTB 1OGUB 4BCGB 4EONB 4CFWB 3BHTB 1D3UB 2IW6B 4EOPB 4ROCA 1GH6B 3QHWB 2PHGA 1TFBA 1VINA 2JGZB 2WFYB 3F5XB 4OR5B 4YOZA 1VOLA 3TNIB 3BHUB 2W96A 1OIUB 5HQ0B 3DOGB 2WPAB 3BLRB 2BPMB 5BNJB 3TNHB 4CFUD 1UNGD 4EC9B 4EOOB 4TTHA 2I53A 1H4LD 1OL2B 3H4CA 4BCOB 1H25B 3BLQB 4BCQB 5EFQB 2QDJA 2WHBB 1H1SB 2X1NB 3QHRB 4EOIB 2F2CA 4BCNB 1H26B 4OGRB 3EIDB 5HBJB 4EOSB 1XO2A 2W99A 2BKZB 4F6UB 4BCMD 5L2WB 1KXUA 3MI9B 5HVYB 2WEVB 4ELJA 2UUEB 3EOCB 1JKWA 4YOSA 2I40B 4BCPB 1H27B 1GUXB 2CCHB 3MIAB 1H1QB 1OIYB 3G33B 4EOJB 5I5ZB 2B9RA 1UNHD 1FVVB 2IW9B 5LQFB 3DDQB 1GY3B 1C9BA 1OL1B 4YOOA 4CXAB 4I3ZB 4YC3B 1PKDB 1JSUB 4BCJB 4NSTB 2W9ZA 1QMZB 4UN0A 3O0GD 1P5EB 2WIPB 1UNLD 3EJ1B 3RGFB 5CYIB 2PK9B 1G3NC 2R7GA 4EC8B 3LQ5B 4RODA 2C5XB 1JOWA 4CFNB 2C5VB 4F70B 2IW8B 4CFUB 4BCKB 5IF1B 1W98B 2C6TB 3BHVB 2EUFA 1FINB 3POMA 5FGKB 4CRLB 2IVXA 5HBEB 5IDPB 1AISB 4G6LB 4F7LB 3K7AM 1GUXA 4Y72B 4BCIB 4IMYB 5IDNB 4KRDB
chains in the Genus database with same CATH superfamily
2WMBB 3MY5B 5CEIB 1H1RB 3BG9A 3X24B 3QYEA 2WIHB 2C5NB 4ROEA 4BCFB 4BCND 1OI9B 3HO8A 4AKIA 4EOLB 3KHIA 2ZCFB 2KMGA 4CFMB 4EORB 1F5QB 4FM4B 2G9XB 5HBHB 1OKVB 3X28B 4EONB 2CZ1B 2IW6B 4EOPB 4ROCA 2PHGA 3F5XB 5IHYA 1VOLA 3BHUB 2W96A 1OIUB 2BPMB 3TNHB 4QSHA 1UNGD 4TTHA 3QXEB 3QZ5B 3H4CA 5EFQB 2WHBB 4BBRM 3QHRB 1H26B 1UGRB 2QDYB 5L2WB 1KXUA 3MI9B 4HLQA 3G33B 2IW9B 2ZPEB 3X25B 4YOOA 4CXAB 1PKDB 1UNLD 2R7GA 2CYZB 2C5VB 2DPPB 5IF1B 3DTOA 1ENWA 2EUFA 1AISB 4BCIB 4MFDA 2UZDB 3DL1A 4BCMB 4ZGEB 4OB2B 4BCQD 4KRCB 2WJ9A 1V29B 2PMIB 2CZ0B 2KR6A 1H1PB 2C4GB 2UZBB 3X26B 4EOKB 1N4MA 1URCB 4BY1X 1UGPB 2G77A 5LMKB 2WXVB 1JSTB 1UGQB 1OGUB 1D3UB 3DJBA 1TFBA 4OR5B 2AHJB 3TNIB 1AHJB 5BNJB 4EOOB 3VYHB 4BCOB 5DQWA 4EOIB 4BCNB 3HBLA 4EOSB 2W99A 4JX6A 2QQ8A 1JKWA 1GUXB 4ZGDB 4AKGA 3MIAB 1H1QB 1UNHD 4AKHA 3A8HB 4YC3B 3A8GB 1E7PA 3O0GD 3HZJA 3EJ1B 4Z6YA 1G3NC 3A8OB 4OB0B 3LQ5B 2C5XB 1JOWA 4BCKB 3VKHA 2CZ6B 4CRLB 1GUXA 4Y72B 4IMYB 1FKMA 2DD4B 2CJMB 1BU2A 2C5OB 5ACBA 1O9KB 1H24B 2D0QB 3TNWB 4ELLA 4EOQB 1OKWB 4CFXB 4F7JB 4JX4A 3VYGB 1ZP2A 4F7NB 2WMAB 4II5B 3PO3S 3TW6A 1TD6A 3GTMS 3DDPB 4M6VA 4OB1B 4BBSM 1VYWB 4FX3B 5HNBB 3BLHB 4LOCA 4BCHB 1O9KA 2LW4A 2PJQA 4HNUA 1QLBA 3BHTB 1GH6B 3QHWB 2ZZDB 2DXCB 3DOGB 4CFUD 2ZPFB 4HNVA 3HHTB 2I53A 2IN3A 1H25B 3BLQB 5EJCA 2DD5B 4BCQB 3NDQA 2QDJA 3HB9A 1H1SB 5HBJB 2ZPBB 4BY7X 5HVYB 4ELJA 2UUEB 3EOCB 4BXXX 3BG5A 2I40B 1H27B 2CCHB 2B9RA 4OB3B 1FVVB 5LQFB 3DDQB 1C9BA 5DQVA 2W9ZA 1QMZB 4ZGJB 4UN0A 4RODA 3BG3A 5HBEB 2C6TB 2IVXA 4F7LB 4KRDB 2BS4A 2UZEB 3M03A 2QF7A 3A8LB 4EOMB 2W2HA 4F6SB 2PK2A 4CFVB 2CZ7B 2ZPGB 3MY1B 4AI6A 3QYHB 2W9FA 3A8MB 3TW7A 5ICPB 3TN8B 1H28B 2UZLB 2V22B 4F7SB 3VKGA 3X20B 1E9HB 1AD6A 3QZ9B 2CCIB 4F6WB 3WVEB 3B57A 1IREB 4BCGB 3QWLA 4CFWB 4MFEA 4MIMA 1VINA 2JGZB 2BS3A 2WFYB 4YOZA 3QYBA 4JX5A 5HQ0B 2WPAB 3BLRB 4HL4A 2QFZA 4EC9B 2BS2A 1H4LD 1OL2B 3QYGB 2DMEA 2X1NB 2ZPIB 2F2CA 4OGRB 3EIDB 1UGSB 1XO2A 2BKZB 4F6UB 4HNTA 4BCMD 2DXBB 2WEVB 4YOSA 4BCPB 1OIYB 4EOJB 5I5ZB 3WVDB 1GY3B 1OL1B 4I3ZB 1JSUB 4BCJB 4NSTB 2QGSA 1P5EB 2WIPB 3RGFB 5CYIB 2PK9B 4EC8B 4NC6A 4CFNB 4F70B 2IW8B 4CFUB 1W98B 3BHVB 3POMA 5FGKB 1FINB 5IDPB 2ZPHB 4G6LB 3K7AM 5IDNB
chains in the Genus database with same CATH topology
2WMBB 2CJMB 3MY5B 2UZDB 1BU2A 2UZEB 3M03A 5CEIB 2C5OB 1H1RB 4BCMB 5ACBA 1O9KB 4EOMB 1H24B 4ELLA 3TNWB 4EOQB 2W2HA 1OKWB 4CFXB 4F6SB 2PK2A 4F7JB 1ZP2A 4BCQD 4CFVB 2WIHB 2C5NB 4KRCB 2WMAB 4F7NB 4ROEA 3MY1B 4II5B 4BCFB 4BCND 1OI9B 2W9FA 2PMIB 1H1PB 2C4GB 2UZBB 4EOLB 5ICPB 3DDPB 4CFMB 3TN8B 1H28B 2UZLB 2V22B 4EORB 4F7SB 4EOKB 1F5QB 1N4MA 1E9HB 1URCB 1VYWB 1AD6A 4FX3B 5HNBB 2CCIB 3BLHB 4F6WB 2G9XB 5HBHB 4BCHB 1OKVB 5LMKB 1O9KA 2WXVB 1JSTB 1OGUB 4BCGB 4EONB 4CFWB 3BHTB 1D3UB 2IW6B 4EOPB 4ROCA 1GH6B 3QHWB 2PHGA 1TFBA 1VINA 2JGZB 2WFYB 3F5XB 4OR5B 4YOZA 1VOLA 3TNIB 3BHUB 2W96A 1OIUB 5HQ0B 3DOGB 2WPAB 3BLRB 2BPMB 5BNJB 3TNHB 4CFUD 1UNGD 4EC9B 4EOOB 4TTHA 2I53A 1H4LD 1OL2B 3H4CA 4BCOB 1H25B 3BLQB 4BCQB 5EFQB 2QDJA 2WHBB 1H1SB 2X1NB 3QHRB 4EOIB 2F2CA 4BCNB 1H26B 4OGRB 3EIDB 5HBJB 4EOSB 1XO2A 2W99A 2BKZB 4F6UB 4BCMD 5L2WB 1KXUA 3MI9B 5HVYB 2WEVB 4ELJA 2UUEB 3EOCB 1JKWA 4YOSA 2I40B 4BCPB 1H27B 1GUXB 2CCHB 3MIAB 1H1QB 1OIYB 3G33B 4EOJB 5I5ZB 2B9RA 1UNHD 1FVVB 2IW9B 5LQFB 3DDQB 1GY3B 1C9BA 1OL1B 4YOOA 4CXAB 4I3ZB 4YC3B 1PKDB 1JSUB 4BCJB 4NSTB 2W9ZA 1QMZB 4UN0A 3O0GD 1P5EB 2WIPB 1UNLD 3EJ1B 3RGFB 5CYIB 2PK9B 1G3NC 2R7GA 4EC8B 3LQ5B 4RODA 2C5XB 1JOWA 4CFNB 2C5VB 4F70B 2IW8B 4CFUB 4BCKB 5IF1B 1W98B 2C6TB 3BHVB 2EUFA 1FINB 3POMA 5FGKB 4CRLB 2IVXA 5HBEB 5IDPB 1AISB 4G6LB 4F7LB 3K7AM 1GUXA 4Y72B 4BCIB 4IMYB 5IDNB 4KRDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMB B;  2CJM B;  3MY5 B;  2UZD B;  1BU2 A;  2UZE B;  3M03 A;  5CEI B;  2C5O B;  1H1R B;  4BCM B;  5ACB A;  1O9K B;  4EOM B;  1H24 B;  4ELL A;  3TNW B;  4EOQ B;  2W2H A;  1OKW B;  4CFX B;  4F6S B;  2PK2 A;  4F7J B;  1ZP2 A;  4BCQ D;  4CFV B;  2WIH B;  2C5N B;  4KRC B;  2WMA B;  4F7N B;  4ROE A;  3MY1 B;  4II5 B;  4BCF B;  4BCN D;  1OI9 B;  2W9F A;  2PMI B;  1H1P B;  2C4G B;  2UZB B;  4EOL B;  5ICP B;  3DDP B;  4CFM B;  3TN8 B;  1H28 B;  2UZL B;  2V22 B;  4EOR B;  4F7S B;  4EOK B;  1F5Q B;  1N4M A;  1E9H B;  1URC B;  1VYW B;  1AD6 A;  4FX3 B;  5HNB B;  2CCI B;  3BLH B;  4F6W B;  2G9X B;  5HBH B;  4BCH B;  1OKV B;  5LMK B;  1O9K A;  2WXV B;  1JST B;  1OGU B;  4BCG B;  4EON B;  4CFW B;  3BHT B;  1D3U B;  2IW6 B;  4EOP B;  4ROC A;  1GH6 B;  3QHW B;  2PHG A;  1TFB A;  1VIN A;  2JGZ B;  2WFY B;  3F5X B;  4OR5 B;  4YOZ A;  1VOL A;  3TNI B;  3BHU B;  2W96 A;  1OIU B;  5HQ0 B;  3DOG B;  2WPA B;  3BLR B;  2BPM B;  5BNJ B;  3TNH B;  4CFU D;  1UNG D;  4EC9 B;  4EOO B;  4TTH A;  2I53 A;  1H4L D;  1OL2 B;  3H4C A;  4BCO B;  1H25 B;  3BLQ B;  4BCQ B;  5EFQ B;  2QDJ A;  2WHB B;  1H1S B;  2X1N B;  3QHR B;  4EOI B;  2F2C A;  4BCN B;  1H26 B;  4OGR B;  3EID B;  5HBJ B;  4EOS B;  1XO2 A;  2W99 A;  2BKZ B;  4F6U B;  4BCM D;  5L2W B;  1KXU A;  3MI9 B;  5HVY B;  2WEV B;  4ELJ A;  2UUE B;  3EOC B;  1JKW A;  4YOS A;  2I40 B;  4BCP B;  1H27 B;  1GUX B;  2CCH B;  3MIA B;  1H1Q B;  1OIY B;  3G33 B;  4EOJ B;  5I5Z B;  2B9R A;  1UNH D;  1FVV B;  2IW9 B;  5LQF B;  3DDQ B;  1GY3 B;  1C9B A;  1OL1 B;  4YOO A;  4CXA B;  4I3Z B;  4YC3 B;  1PKD B;  1JSU B;  4BCJ B;  4NST B;  2W9Z A;  1QMZ B;  4UN0 A;  3O0G D;  1P5E B;  2WIP B;  1UNL D;  3EJ1 B;  3RGF B;  5CYI B;  2PK9 B;  1G3N C;  2R7G A;  4EC8 B;  3LQ5 B;  4ROD A;  2C5X B;  1JOW A;  4CFN B;  2C5V B;  4F70 B;  2IW8 B;  4CFU B;  4BCK B;  5IF1 B;  1W98 B;  2C6T B;  3BHV B;  2EUF A;  1FIN B;  3POM A;  5FGK B;  4CRL B;  2IVX A;  5HBE B;  5IDP B;  1AIS B;  4G6L B;  4F7L B;  3K7A M;  1GUX A;  4Y72 B;  4BCI B;  4IMY B;  5IDN B;  4KRD B; 
#chains in the Genus database with same CATH topology
 2WMB B;  3MY5 B;  5CEI B;  1H1R B;  3BG9 A;  3X24 B;  3QYE A;  2WIH B;  2C5N B;  4ROE A;  4BCF B;  4BCN D;  1OI9 B;  3HO8 A;  4AKI A;  4EOL B;  3KHI A;  2ZCF B;  2KMG A;  4CFM B;  4EOR B;  1F5Q B;  4FM4 B;  2G9X B;  5HBH B;  1OKV B;  3X28 B;  4EON B;  2CZ1 B;  2IW6 B;  4EOP B;  4ROC A;  2PHG A;  3F5X B;  5IHY A;  1VOL A;  3BHU B;  2W96 A;  1OIU B;  2BPM B;  3TNH B;  4QSH A;  1UNG D;  4TTH A;  3QXE B;  3QZ5 B;  3H4C A;  5EFQ B;  2WHB B;  4BBR M;  3QHR B;  1H26 B;  1UGR B;  2QDY B;  5L2W B;  1KXU A;  3MI9 B;  4HLQ A;  3G33 B;  2IW9 B;  2ZPE B;  3X25 B;  4YOO A;  4CXA B;  1PKD B;  1UNL D;  2R7G A;  2CYZ B;  2C5V B;  2DPP B;  5IF1 B;  3DTO A;  1ENW A;  2EUF A;  1AIS B;  4BCI B;  4MFD A;  2UZD B;  3DL1 A;  4BCM B;  4ZGE B;  4OB2 B;  4BCQ D;  4KRC B;  2WJ9 A;  1V29 B;  2PMI B;  2CZ0 B;  2KR6 A;  1H1P B;  2C4G B;  2UZB B;  3X26 B;  4EOK B;  1N4M A;  1URC B;  4BY1 X;  1UGP B;  2G77 A;  5LMK B;  2WXV B;  1JST B;  1UGQ B;  1OGU B;  1D3U B;  3DJB A;  1TFB A;  4OR5 B;  2AHJ B;  3TNI B;  1AHJ B;  5BNJ B;  4EOO B;  3VYH B;  4BCO B;  5DQW A;  4EOI B;  4BCN B;  3HBL A;  4EOS B;  2W99 A;  4JX6 A;  2QQ8 A;  1JKW A;  1GUX B;  4ZGD B;  4AKG A;  3MIA B;  1H1Q B;  1UNH D;  4AKH A;  3A8H B;  4YC3 B;  3A8G B;  1E7P A;  3O0G D;  3HZJ A;  3EJ1 B;  4Z6Y A;  1G3N C;  3A8O B;  4OB0 B;  3LQ5 B;  2C5X B;  1JOW A;  4BCK B;  3VKH A;  2CZ6 B;  4CRL B;  1GUX A;  4Y72 B;  4IMY B;  1FKM A;  2DD4 B;  2CJM B;  1BU2 A;  2C5O B;  5ACB A;  1O9K B;  1H24 B;  2D0Q B;  3TNW B;  4ELL A;  4EOQ B;  1OKW B;  4CFX B;  4F7J B;  4JX4 A;  3VYG B;  1ZP2 A;  4F7N B;  2WMA B;  4II5 B;  3PO3 S;  3TW6 A;  1TD6 A;  3GTM S;  3DDP B;  4M6V A;  4OB1 B;  4BBS M;  1VYW B;  4FX3 B;  5HNB B;  3BLH B;  4LOC A;  4BCH B;  1O9K A;  2LW4 A;  2PJQ A;  4HNU A;  1QLB A;  3BHT B;  1GH6 B;  3QHW B;  2ZZD B;  2DXC B;  3DOG B;  4CFU D;  2ZPF B;  4HNV A;  3HHT B;  2I53 A;  2IN3 A;  1H25 B;  3BLQ B;  5EJC A;  2DD5 B;  4BCQ B;  3NDQ A;  2QDJ A;  3HB9 A;  1H1S B;  5HBJ B;  2ZPB B;  4BY7 X;  5HVY B;  4ELJ A;  2UUE B;  3EOC B;  4BXX X;  3BG5 A;  2I40 B;  1H27 B;  2CCH B;  2B9R A;  4OB3 B;  1FVV B;  5LQF B;  3DDQ B;  1C9B A;  5DQV A;  2W9Z A;  1QMZ B;  4ZGJ B;  4UN0 A;  4ROD A;  3BG3 A;  5HBE B;  2C6T B;  2IVX A;  4F7L B;  4KRD B;  2BS4 A;  2UZE B;  3M03 A;  2QF7 A;  3A8L B;  4EOM B;  2W2H A;  4F6S B;  2PK2 A;  4CFV B;  2CZ7 B;  2ZPG B;  3MY1 B;  4AI6 A;  3QYH B;  2W9F A;  3A8M B;  3TW7 A;  5ICP B;  3TN8 B;  1H28 B;  2UZL B;  2V22 B;  4F7S B;  3VKG A;  3X20 B;  1E9H B;  1AD6 A;  3QZ9 B;  2CCI B;  4F6W B;  3WVE B;  3B57 A;  1IRE B;  4BCG B;  3QWL A;  4CFW B;  4MFE A;  4MIM A;  1VIN A;  2JGZ B;  2BS3 A;  2WFY B;  4YOZ A;  3QYB A;  4JX5 A;  5HQ0 B;  2WPA B;  3BLR B;  4HL4 A;  2QFZ A;  4EC9 B;  2BS2 A;  1H4L D;  1OL2 B;  3QYG B;  2DME A;  2X1N B;  2ZPI B;  2F2C A;  4OGR B;  3EID B;  1UGS B;  1XO2 A;  2BKZ B;  4F6U B;  4HNT A;  4BCM D;  2DXB B;  2WEV B;  4YOS A;  4BCP B;  1OIY B;  4EOJ B;  5I5Z B;  3WVD B;  1GY3 B;  1OL1 B;  4I3Z B;  1JSU B;  4BCJ B;  4NST B;  2QGS A;  1P5E B;  2WIP B;  3RGF B;  5CYI B;  2PK9 B;  4EC8 B;  4NC6 A;  4CFN B;  4F70 B;  2IW8 B;  4CFU B;  1W98 B;  3BHV B;  3POM A;  5FGK B;  1FIN B;  5IDP B;  2ZPH B;  4G6L B;  3K7A M;  5IDN B; 
#chains in the Genus database with same CATH homology
 2WMB B;  2CJM B;  3MY5 B;  2UZD B;  1BU2 A;  2UZE B;  3M03 A;  5CEI B;  2C5O B;  1H1R B;  4BCM B;  5ACB A;  1O9K B;  4EOM B;  1H24 B;  4ELL A;  3TNW B;  4EOQ B;  2W2H A;  1OKW B;  4CFX B;  4F6S B;  2PK2 A;  4F7J B;  1ZP2 A;  4BCQ D;  4CFV B;  2WIH B;  2C5N B;  4KRC B;  2WMA B;  4F7N B;  4ROE A;  3MY1 B;  4II5 B;  4BCF B;  4BCN D;  1OI9 B;  2W9F A;  2PMI B;  1H1P B;  2C4G B;  2UZB B;  4EOL B;  5ICP B;  3DDP B;  4CFM B;  3TN8 B;  1H28 B;  2UZL B;  2V22 B;  4EOR B;  4F7S B;  4EOK B;  1F5Q B;  1N4M A;  1E9H B;  1URC B;  1VYW B;  1AD6 A;  4FX3 B;  5HNB B;  2CCI B;  3BLH B;  4F6W B;  2G9X B;  5HBH B;  4BCH B;  1OKV B;  5LMK B;  1O9K A;  2WXV B;  1JST B;  1OGU B;  4BCG B;  4EON B;  4CFW B;  3BHT B;  1D3U B;  2IW6 B;  4EOP B;  4ROC A;  1GH6 B;  3QHW B;  2PHG A;  1TFB A;  1VIN A;  2JGZ B;  2WFY B;  3F5X B;  4OR5 B;  4YOZ A;  1VOL A;  3TNI B;  3BHU B;  2W96 A;  1OIU B;  5HQ0 B;  3DOG B;  2WPA B;  3BLR B;  2BPM B;  5BNJ B;  3TNH B;  4CFU D;  1UNG D;  4EC9 B;  4EOO B;  4TTH A;  2I53 A;  1H4L D;  1OL2 B;  3H4C A;  4BCO B;  1H25 B;  3BLQ B;  4BCQ B;  5EFQ B;  2QDJ A;  2WHB B;  1H1S B;  2X1N B;  3QHR B;  4EOI B;  2F2C A;  4BCN B;  1H26 B;  4OGR B;  3EID B;  5HBJ B;  4EOS B;  1XO2 A;  2W99 A;  2BKZ B;  4F6U B;  4BCM D;  5L2W B;  1KXU A;  3MI9 B;  5HVY B;  2WEV B;  4ELJ A;  2UUE B;  3EOC B;  1JKW A;  4YOS A;  2I40 B;  4BCP B;  1H27 B;  1GUX B;  2CCH B;  3MIA B;  1H1Q B;  1OIY B;  3G33 B;  4EOJ B;  5I5Z B;  2B9R A;  1UNH D;  1FVV B;  2IW9 B;  5LQF B;  3DDQ B;  1GY3 B;  1C9B A;  1OL1 B;  4YOO A;  4CXA B;  4I3Z B;  4YC3 B;  1PKD B;  1JSU B;  4BCJ B;  4NST B;  2W9Z A;  1QMZ B;  4UN0 A;  3O0G D;  1P5E B;  2WIP B;  1UNL D;  3EJ1 B;  3RGF B;  5CYI B;  2PK9 B;  1G3N C;  2R7G A;  4EC8 B;  3LQ5 B;  4ROD A;  2C5X B;  1JOW A;  4CFN B;  2C5V B;  4F70 B;  2IW8 B;  4CFU B;  4BCK B;  5IF1 B;  1W98 B;  2C6T B;  3BHV B;  2EUF A;  1FIN B;  3POM A;  5FGK B;  4CRL B;  2IVX A;  5HBE B;  5IDP B;  1AIS B;  4G6L B;  4F7L B;  3K7A M;  1GUX A;  4Y72 B;  4BCI B;  4IMY B;  5IDN B;  4KRD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...