1H1SB

Structure of human thr160-phospho cdk2/cyclin a complexed with the inhibitor nu6102
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Structure-Based Design of a Potent Purine-Based Cyclin-Dependent Kinase Inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h1sB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h1sB02
1OL1B 2PK9B 2W96A 3TN8B 4Y72B 4CFUB 1KXUA 3QHRB 1C9BA 5HBHB 4BCHB 4BCOB 1UNGD 4BCIB 5IDNB 5I5ZB 4EOJB 1D3UB 2BKZB 2CCIB 5HQ0B 2I53A 2UZBB 4I3ZB 4CXAB 2I40B 1VINA 3G33B 3DDPB 2EUFA 1GH6B 1JOWA 4F7SB 1UNHD 4OR5B 4KRDB 4ROCA 1O9KA 1OIUB 2V22B 3EIDB 5FGKB 1TFBA 3M03A 4EOQB 5HVYB 5LQFB 2WHBB 3MY5B 3RGFB 2X1NB 3H4CA 4F7NB 3TNIB 4KRCB 4UN0A 4BCQD 2WXVB 4CFXB 3POMA 2C5OB 1JSUB 4F6SB 4EC8B 1FINB 2UZDB 1OGUB 3BLRB 2WIPB 1G3NC 4BCNB 4CFVB 3DOGB 2B9RA 3TNWB 4EOIB 2IW8B 4EONB 4ELJA 4CFUD 4BCFB 4BCKB 4ELLA 3DDQB 1VYWB 1H24B 3MIAB 4EOPB 4CRLB 4G6LB 2IW9B 4IMYB 2WEVB 2W2HA 4BCMB 3EJ1B 2WIHB 1H28B 3BHTB 2UZEB 3EOCB 1F5QB 5HBEB 4F7LB 1GUXB 2IVXA 1OI9B 2WPAB 5HBJB 1OKWB 4CFWB 4NSTB 5IF1B 1JKWA 4BCMD 1H26B 5IDPB 4BCPB 3K7AM 1H1RB 4YOOA 2UZLB 3MY1B 4CFMB 1H25B 1W98B 2QDJA 3BHUB 1BU2A 2C5XB 2CJMB 2JGZB 2WMBB 4EC9B 4FX3B 4CFNB 1XO2A 2R7GA 2C5VB 2PMIB 4BCND 5L2WB 2W9ZA 2UUEB 1QMZB 3TNHB 1JSTB 4BCJB 4F6WB 1PKDB 4EOKB 4YOSA 3O0GD 5CEIB 2C5NB 2IW6B 2W99A 3BLQB 5CYIB 1FVVB 1UNLD 5ICPB 4EOSB 5HNBB 1OL2B 2BPMB 2C4GB 2WFYB 2G9XB 4RODA 2W9FA 2PK2A 4F7JB 4F70B 4II5B 1AISB 1OKVB 1GUXA 3BLHB 4EORB 1OIYB 4EOMB 1E9HB 1H1QB 1N4MA 1H4LD 1VOLA 1AD6A 1O9KB 2F2CA 5EFQB 4BCGB 4EOLB 1ZP2A 1H1SB 4OGRB 3MI9B 5LMKB 4F6UB 2PHGA 4EOOB 1H27B 4YC3B 2WMAB 2CCHB 4BCQB 1H1PB 4TTHA 3LQ5B 1GY3B 4ROEA 5ACBA 3BHVB 5BNJB 2C6TB 1URCB 1P5EB 3F5XB 4YOZA 3QHWB
chains in the Genus database with same CATH superfamily
4QSHA 2PK9B 4CFUB 2KR6A 3VYGB 5I5ZB 2BKZB 2CCIB 5HQ0B 3QZ9B 4I3ZB 1TD6A 3DDPB 3QYHB 4F7SB 2QDYB 2ZPHB 2LW4A 5HVYB 3QYEA 2X1NB 4OB2B 2C5OB 1JSUB 2CYZB 1G3NC 2BS4A 4BCNB 4EOIB 2IW8B 4ELJA 4AKHA 4JX4A 1VYWB 4CRLB 4G6LB 2IW9B 2UZEB 3EOCB 1F5QB 1OI9B 1OKWB 1H1RB 2UZLB 2DXBB 3MY1B 4CFMB 1W98B 3BHUB 3HZJA 2C5VB 2ZPFB 3HB9A 4F6WB 3HHTB 3O0GD 3VKHA 5CYIB 1UGRB 1OL2B 2C4GB 2G9XB 2ZPEB 4RODA 2W9FA 4ZGDB 3QZ5B 1OIYB 2CZ1B 1E9HB 1O9KB 3KHIA 2PHGA 4BCQB 4TTHA 2KMGA 3BHVB 3F5XB 1OL1B 4FM4B 4Y72B 5HBHB 5IDNB 4EOJB 2I53A 3QYGB 3X25B 2EUFA 1JOWA 3PO3S 1UNHD 4OR5B 4BBSM 1O9KA 1OIUB 4EOQB 3MY5B 3H4CA 4F7NB 4KRCB 4UN0A 4CFXB 4F6SB 2UZDB 1OGUB 2PJQA 2B9RA 3TNWB 4BY7X 2ZPGB 3DJBA 1H24B 3BG5A 2DD4B 2WIHB 1ENWA 4CFWB 1JKWA 5IDPB 4BCPB 3BG9A 3HBLA 3A8OB 1E7PA 1H25B 2WMBB 4FX3B 2DD5B 4MFDA 2R7GA 2QFZA 1QMZB 1JSTB 1PKDB 2CZ7B 4EOKB 5CEIB 2IW6B 2ZPBB 4AI6A 2QF7A 1UNLD 5ICPB 5HNBB 1FKMA 3HO8A 4F7JB 4F70B 1AISB 5EJCA 4HNTA 3X26B 1H1QB 1N4MA 4HNVA 1H4LD 5EFQB 3MI9B 5LMKB 4EOOB 4Z6YA 1URCB 4HNUA 3X24B 2W96A 3TN8B 2ZPIB 3QHRB 1C9BA 4BCHB 1UNGD 2UZBB 2I40B 2IN3A 4OB1B 1VINA 2BS2A 1GH6B 4ROCA 4KRDB 1UGPB 3VYHB 2DMEA 2V22B 5FGKB 5LQFB 4AKIA 3VKGA 3POMA 1FINB 3BLRB 3WVEB 3DOGB 4EONB 4M6VA 4CFUD 4BCKB 3A8MB 4ELLA 2G77A 2BS3A 2WEVB 2CZ0B 2W2HA 4BCMB 3EJ1B 5HBEB 4F7LB 2QGSA 1GUXB 2ZZDB 5HBJB 2WPAB 4NSTB 1H26B 3QWLA 3K7AM 4YOOA 2QDJA 4EC9B 4CFNB 2PMIB 4BCND 2W9ZA 4NC6A 2C5NB 2W99A 1FVVB 2BPMB 4ZGEB 2AHJB 1OKVB 1GUXA 3BLHB 4EORB 2D0QB 3X28B 4EOMB 3TW6A 3GTMS 4EOLB 1ZP2A 3A8GB 1H27B 2CCHB 1UGSB 1H1PB 2QQ8A 5BNJB 2C6TB 4YOZA 3A8HB 4BY1X 2DPPB 5DQVA 1KXUA 4HL4A 2CZ6B 4BCOB 1QLBA 4BCIB 1D3UB 3X20B 4CXAB 3G33B 4ZGJB 4AKGA 5DQWA 3EIDB 1TFBA 3M03A 2WHBB 3RGFB 1AHJB 3TNIB 4BCQD 4BXXX 2WXVB 3BG3A 4EC8B 3QYBA 2WIPB 4LOCA 4CFVB 4BCFB 3DDQB 4EOPB 3MIAB 4IMYB 4MIMA 1IREB 1H28B 3BHTB 2IVXA 4OB0B 5IF1B 4BCMD 3QXEB 1UGQB 3NDQA 3WVDB 4OB3B 1BU2A 2C5XB 2CJMB 2JGZB 3DTOA 1XO2A 3A8LB 5L2WB 2DXCB 2UUEB 3TNHB 2WJ9A 4BCJB 4YOSA 3BLQB 4EOSB 2WFYB 5IHYA 1V29B 2PK2A 4JX6A 4BBRM 3TW7A 4II5B 4MFEA 4HLQA 1VOLA 1AD6A 2F2CA 4BCGB 4JX5A 1H1SB 4OGRB 4F6UB 4YC3B 2WMAB 3LQ5B 2ZCFB 1GY3B 4ROEA 5ACBA 3B57A 1P5EB 3QHWB 3DL1A
chains in the Genus database with same CATH topology
1OL1B 2PK9B 2W96A 3TN8B 4Y72B 4CFUB 1KXUA 3QHRB 1C9BA 5HBHB 4BCHB 4BCOB 1UNGD 4BCIB 5IDNB 5I5ZB 4EOJB 1D3UB 2BKZB 2CCIB 5HQ0B 2I53A 2UZBB 4I3ZB 4CXAB 2I40B 1VINA 3G33B 3DDPB 2EUFA 1GH6B 1JOWA 4F7SB 1UNHD 4OR5B 4KRDB 4ROCA 1O9KA 1OIUB 2V22B 3EIDB 5FGKB 1TFBA 3M03A 4EOQB 5HVYB 5LQFB 2WHBB 3MY5B 3RGFB 2X1NB 3H4CA 4F7NB 3TNIB 4KRCB 4UN0A 4BCQD 2WXVB 4CFXB 3POMA 2C5OB 1JSUB 4F6SB 4EC8B 1FINB 2UZDB 1OGUB 3BLRB 2WIPB 1G3NC 4BCNB 4CFVB 3DOGB 2B9RA 3TNWB 4EOIB 2IW8B 4EONB 4ELJA 4CFUD 4BCFB 4BCKB 4ELLA 3DDQB 1VYWB 1H24B 3MIAB 4EOPB 4CRLB 4G6LB 2IW9B 4IMYB 2WEVB 2W2HA 4BCMB 3EJ1B 2WIHB 1H28B 3BHTB 2UZEB 3EOCB 1F5QB 5HBEB 4F7LB 1GUXB 2IVXA 1OI9B 2WPAB 5HBJB 1OKWB 4CFWB 4NSTB 5IF1B 1JKWA 4BCMD 1H26B 5IDPB 4BCPB 3K7AM 1H1RB 4YOOA 2UZLB 3MY1B 4CFMB 1H25B 1W98B 2QDJA 3BHUB 1BU2A 2C5XB 2CJMB 2JGZB 2WMBB 4EC9B 4FX3B 4CFNB 1XO2A 2R7GA 2C5VB 2PMIB 4BCND 5L2WB 2W9ZA 2UUEB 1QMZB 3TNHB 1JSTB 4BCJB 4F6WB 1PKDB 4EOKB 4YOSA 3O0GD 5CEIB 2C5NB 2IW6B 2W99A 3BLQB 5CYIB 1FVVB 1UNLD 5ICPB 4EOSB 5HNBB 1OL2B 2BPMB 2C4GB 2WFYB 2G9XB 4RODA 2W9FA 2PK2A 4F7JB 4F70B 4II5B 1AISB 1OKVB 1GUXA 3BLHB 4EORB 1OIYB 4EOMB 1E9HB 1H1QB 1N4MA 1H4LD 1VOLA 1AD6A 1O9KB 2F2CA 5EFQB 4BCGB 4EOLB 1ZP2A 1H1SB 4OGRB 3MI9B 5LMKB 4F6UB 2PHGA 4EOOB 1H27B 4YC3B 2WMAB 2CCHB 4BCQB 1H1PB 4TTHA 3LQ5B 1GY3B 4ROEA 5ACBA 3BHVB 5BNJB 2C6TB 1URCB 1P5EB 3F5XB 4YOZA 3QHWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OL1 B;  2PK9 B;  2W96 A;  3TN8 B;  4Y72 B;  4CFU B;  1KXU A;  3QHR B;  1C9B A;  5HBH B;  4BCH B;  4BCO B;  1UNG D;  4BCI B;  5IDN B;  5I5Z B;  4EOJ B;  1D3U B;  2BKZ B;  2CCI B;  5HQ0 B;  2I53 A;  2UZB B;  4I3Z B;  4CXA B;  2I40 B;  1VIN A;  3G33 B;  3DDP B;  2EUF A;  1GH6 B;  1JOW A;  4F7S B;  1UNH D;  4OR5 B;  4KRD B;  4ROC A;  1O9K A;  1OIU B;  2V22 B;  3EID B;  5FGK B;  1TFB A;  3M03 A;  4EOQ B;  5HVY B;  5LQF B;  2WHB B;  3MY5 B;  3RGF B;  2X1N B;  3H4C A;  4F7N B;  3TNI B;  4KRC B;  4UN0 A;  4BCQ D;  2WXV B;  4CFX B;  3POM A;  2C5O B;  1JSU B;  4F6S B;  4EC8 B;  1FIN B;  2UZD B;  1OGU B;  3BLR B;  2WIP B;  1G3N C;  4BCN B;  4CFV B;  3DOG B;  2B9R A;  3TNW B;  4EOI B;  2IW8 B;  4EON B;  4ELJ A;  4CFU D;  4BCF B;  4BCK B;  4ELL A;  3DDQ B;  1VYW B;  1H24 B;  3MIA B;  4EOP B;  4CRL B;  4G6L B;  2IW9 B;  4IMY B;  2WEV B;  2W2H A;  4BCM B;  3EJ1 B;  2WIH B;  1H28 B;  3BHT B;  2UZE B;  3EOC B;  1F5Q B;  5HBE B;  4F7L B;  1GUX B;  2IVX A;  1OI9 B;  2WPA B;  5HBJ B;  1OKW B;  4CFW B;  4NST B;  5IF1 B;  1JKW A;  4BCM D;  1H26 B;  5IDP B;  4BCP B;  3K7A M;  1H1R B;  4YOO A;  2UZL B;  3MY1 B;  4CFM B;  1H25 B;  1W98 B;  2QDJ A;  3BHU B;  1BU2 A;  2C5X B;  2CJM B;  2JGZ B;  2WMB B;  4EC9 B;  4FX3 B;  4CFN B;  1XO2 A;  2R7G A;  2C5V B;  2PMI B;  4BCN D;  5L2W B;  2W9Z A;  2UUE B;  1QMZ B;  3TNH B;  1JST B;  4BCJ B;  4F6W B;  1PKD B;  4EOK B;  4YOS A;  3O0G D;  5CEI B;  2C5N B;  2IW6 B;  2W99 A;  3BLQ B;  5CYI B;  1FVV B;  1UNL D;  5ICP B;  4EOS B;  5HNB B;  1OL2 B;  2BPM B;  2C4G B;  2WFY B;  2G9X B;  4ROD A;  2W9F A;  2PK2 A;  4F7J B;  4F70 B;  4II5 B;  1AIS B;  1OKV B;  1GUX A;  3BLH B;  4EOR B;  1OIY B;  4EOM B;  1E9H B;  1H1Q B;  1N4M A;  1H4L D;  1VOL A;  1AD6 A;  1O9K B;  2F2C A;  5EFQ B;  4BCG B;  4EOL B;  1ZP2 A;  1H1S B;  4OGR B;  3MI9 B;  5LMK B;  4F6U B;  2PHG A;  4EOO B;  1H27 B;  4YC3 B;  2WMA B;  2CCH B;  4BCQ B;  1H1P B;  4TTH A;  3LQ5 B;  1GY3 B;  4ROE A;  5ACB A;  3BHV B;  5BNJ B;  2C6T B;  1URC B;  1P5E B;  3F5X B;  4YOZ A;  3QHW B; 
#chains in the Genus database with same CATH topology
 4QSH A;  2PK9 B;  4CFU B;  2KR6 A;  3VYG B;  5I5Z B;  2BKZ B;  2CCI B;  5HQ0 B;  3QZ9 B;  4I3Z B;  1TD6 A;  3DDP B;  3QYH B;  4F7S B;  2QDY B;  2ZPH B;  2LW4 A;  5HVY B;  3QYE A;  2X1N B;  4OB2 B;  2C5O B;  1JSU B;  2CYZ B;  1G3N C;  2BS4 A;  4BCN B;  4EOI B;  2IW8 B;  4ELJ A;  4AKH A;  4JX4 A;  1VYW B;  4CRL B;  4G6L B;  2IW9 B;  2UZE B;  3EOC B;  1F5Q B;  1OI9 B;  1OKW B;  1H1R B;  2UZL B;  2DXB B;  3MY1 B;  4CFM B;  1W98 B;  3BHU B;  3HZJ A;  2C5V B;  2ZPF B;  3HB9 A;  4F6W B;  3HHT B;  3O0G D;  3VKH A;  5CYI B;  1UGR B;  1OL2 B;  2C4G B;  2G9X B;  2ZPE B;  4ROD A;  2W9F A;  4ZGD B;  3QZ5 B;  1OIY B;  2CZ1 B;  1E9H B;  1O9K B;  3KHI A;  2PHG A;  4BCQ B;  4TTH A;  2KMG A;  3BHV B;  3F5X B;  1OL1 B;  4FM4 B;  4Y72 B;  5HBH B;  5IDN B;  4EOJ B;  2I53 A;  3QYG B;  3X25 B;  2EUF A;  1JOW A;  3PO3 S;  1UNH D;  4OR5 B;  4BBS M;  1O9K A;  1OIU B;  4EOQ B;  3MY5 B;  3H4C A;  4F7N B;  4KRC B;  4UN0 A;  4CFX B;  4F6S B;  2UZD B;  1OGU B;  2PJQ A;  2B9R A;  3TNW B;  4BY7 X;  2ZPG B;  3DJB A;  1H24 B;  3BG5 A;  2DD4 B;  2WIH B;  1ENW A;  4CFW B;  1JKW A;  5IDP B;  4BCP B;  3BG9 A;  3HBL A;  3A8O B;  1E7P A;  1H25 B;  2WMB B;  4FX3 B;  2DD5 B;  4MFD A;  2R7G A;  2QFZ A;  1QMZ B;  1JST B;  1PKD B;  2CZ7 B;  4EOK B;  5CEI B;  2IW6 B;  2ZPB B;  4AI6 A;  2QF7 A;  1UNL D;  5ICP B;  5HNB B;  1FKM A;  3HO8 A;  4F7J B;  4F70 B;  1AIS B;  5EJC A;  4HNT A;  3X26 B;  1H1Q B;  1N4M A;  4HNV A;  1H4L D;  5EFQ B;  3MI9 B;  5LMK B;  4EOO B;  4Z6Y A;  1URC B;  4HNU A;  3X24 B;  2W96 A;  3TN8 B;  2ZPI B;  3QHR B;  1C9B A;  4BCH B;  1UNG D;  2UZB B;  2I40 B;  2IN3 A;  4OB1 B;  1VIN A;  2BS2 A;  1GH6 B;  4ROC A;  4KRD B;  1UGP B;  3VYH B;  2DME A;  2V22 B;  5FGK B;  5LQF B;  4AKI A;  3VKG A;  3POM A;  1FIN B;  3BLR B;  3WVE B;  3DOG B;  4EON B;  4M6V A;  4CFU D;  4BCK B;  3A8M B;  4ELL A;  2G77 A;  2BS3 A;  2WEV B;  2CZ0 B;  2W2H A;  4BCM B;  3EJ1 B;  5HBE B;  4F7L B;  2QGS A;  1GUX B;  2ZZD B;  5HBJ B;  2WPA B;  4NST B;  1H26 B;  3QWL A;  3K7A M;  4YOO A;  2QDJ A;  4EC9 B;  4CFN B;  2PMI B;  4BCN D;  2W9Z A;  4NC6 A;  2C5N B;  2W99 A;  1FVV B;  2BPM B;  4ZGE B;  2AHJ B;  1OKV B;  1GUX A;  3BLH B;  4EOR B;  2D0Q B;  3X28 B;  4EOM B;  3TW6 A;  3GTM S;  4EOL B;  1ZP2 A;  3A8G B;  1H27 B;  2CCH B;  1UGS B;  1H1P B;  2QQ8 A;  5BNJ B;  2C6T B;  4YOZ A;  3A8H B;  4BY1 X;  2DPP B;  5DQV A;  1KXU A;  4HL4 A;  2CZ6 B;  4BCO B;  1QLB A;  4BCI B;  1D3U B;  3X20 B;  4CXA B;  3G33 B;  4ZGJ B;  4AKG A;  5DQW A;  3EID B;  1TFB A;  3M03 A;  2WHB B;  3RGF B;  1AHJ B;  3TNI B;  4BCQ D;  4BXX X;  2WXV B;  3BG3 A;  4EC8 B;  3QYB A;  2WIP B;  4LOC A;  4CFV B;  4BCF B;  3DDQ B;  4EOP B;  3MIA B;  4IMY B;  4MIM A;  1IRE B;  1H28 B;  3BHT B;  2IVX A;  4OB0 B;  5IF1 B;  4BCM D;  3QXE B;  1UGQ B;  3NDQ A;  3WVD B;  4OB3 B;  1BU2 A;  2C5X B;  2CJM B;  2JGZ B;  3DTO A;  1XO2 A;  3A8L B;  5L2W B;  2DXC B;  2UUE B;  3TNH B;  2WJ9 A;  4BCJ B;  4YOS A;  3BLQ B;  4EOS B;  2WFY B;  5IHY A;  1V29 B;  2PK2 A;  4JX6 A;  4BBR M;  3TW7 A;  4II5 B;  4MFE A;  4HLQ A;  1VOL A;  1AD6 A;  2F2C A;  4BCG B;  4JX5 A;  1H1S B;  4OGR B;  4F6U B;  4YC3 B;  2WMA B;  3LQ5 B;  2ZCF B;  1GY3 B;  4ROE A;  5ACB A;  3B57 A;  1P5E B;  3QHW B;  3DL1 A; 
#chains in the Genus database with same CATH homology
 1OL1 B;  2PK9 B;  2W96 A;  3TN8 B;  4Y72 B;  4CFU B;  1KXU A;  3QHR B;  1C9B A;  5HBH B;  4BCH B;  4BCO B;  1UNG D;  4BCI B;  5IDN B;  5I5Z B;  4EOJ B;  1D3U B;  2BKZ B;  2CCI B;  5HQ0 B;  2I53 A;  2UZB B;  4I3Z B;  4CXA B;  2I40 B;  1VIN A;  3G33 B;  3DDP B;  2EUF A;  1GH6 B;  1JOW A;  4F7S B;  1UNH D;  4OR5 B;  4KRD B;  4ROC A;  1O9K A;  1OIU B;  2V22 B;  3EID B;  5FGK B;  1TFB A;  3M03 A;  4EOQ B;  5HVY B;  5LQF B;  2WHB B;  3MY5 B;  3RGF B;  2X1N B;  3H4C A;  4F7N B;  3TNI B;  4KRC B;  4UN0 A;  4BCQ D;  2WXV B;  4CFX B;  3POM A;  2C5O B;  1JSU B;  4F6S B;  4EC8 B;  1FIN B;  2UZD B;  1OGU B;  3BLR B;  2WIP B;  1G3N C;  4BCN B;  4CFV B;  3DOG B;  2B9R A;  3TNW B;  4EOI B;  2IW8 B;  4EON B;  4ELJ A;  4CFU D;  4BCF B;  4BCK B;  4ELL A;  3DDQ B;  1VYW B;  1H24 B;  3MIA B;  4EOP B;  4CRL B;  4G6L B;  2IW9 B;  4IMY B;  2WEV B;  2W2H A;  4BCM B;  3EJ1 B;  2WIH B;  1H28 B;  3BHT B;  2UZE B;  3EOC B;  1F5Q B;  5HBE B;  4F7L B;  1GUX B;  2IVX A;  1OI9 B;  2WPA B;  5HBJ B;  1OKW B;  4CFW B;  4NST B;  5IF1 B;  1JKW A;  4BCM D;  1H26 B;  5IDP B;  4BCP B;  3K7A M;  1H1R B;  4YOO A;  2UZL B;  3MY1 B;  4CFM B;  1H25 B;  1W98 B;  2QDJ A;  3BHU B;  1BU2 A;  2C5X B;  2CJM B;  2JGZ B;  2WMB B;  4EC9 B;  4FX3 B;  4CFN B;  1XO2 A;  2R7G A;  2C5V B;  2PMI B;  4BCN D;  5L2W B;  2W9Z A;  2UUE B;  1QMZ B;  3TNH B;  1JST B;  4BCJ B;  4F6W B;  1PKD B;  4EOK B;  4YOS A;  3O0G D;  5CEI B;  2C5N B;  2IW6 B;  2W99 A;  3BLQ B;  5CYI B;  1FVV B;  1UNL D;  5ICP B;  4EOS B;  5HNB B;  1OL2 B;  2BPM B;  2C4G B;  2WFY B;  2G9X B;  4ROD A;  2W9F A;  2PK2 A;  4F7J B;  4F70 B;  4II5 B;  1AIS B;  1OKV B;  1GUX A;  3BLH B;  4EOR B;  1OIY B;  4EOM B;  1E9H B;  1H1Q B;  1N4M A;  1H4L D;  1VOL A;  1AD6 A;  1O9K B;  2F2C A;  5EFQ B;  4BCG B;  4EOL B;  1ZP2 A;  1H1S B;  4OGR B;  3MI9 B;  5LMK B;  4F6U B;  2PHG A;  4EOO B;  1H27 B;  4YC3 B;  2WMA B;  2CCH B;  4BCQ B;  1H1P B;  4TTH A;  3LQ5 B;  1GY3 B;  4ROE A;  5ACB A;  3BHV B;  5BNJ B;  2C6T B;  1URC B;  1P5E B;  3F5X B;  4YOZ A;  3QHW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...