1H2KA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
335
structure length
332
Chain Sequence
b'EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR INHIBITING HIF1
molecule tags Transcription activator/inhibitor
source organism Homo sapiens
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
total genus 105
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2kA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2kA01
2CGNA 2YC0A 2W0XA 1H2MA 1MZFA 4Z2WA 1H2NA 2WA4A 4NR1A 3D8CA 4AI8A 3P3NA 2YDEA 4BIOA 4B7KA 1MZEA 1H2LA 4Z1VA 3OD4A 1IZ3A 2ILMA 1H2KA 4QU2A 3KCXA 5JWPA 4JAAA 4B7EA 2CGOA 1YCIA 2Y0IA 3KCYA 3P3PA 2XUMA 2WA3A
chains in the Genus database with same CATH superfamily
3SJAC 3APOA 2AEYA 2ARHA 4DR6O 4UBGA 4BR6A 2QWNB 2DUPA 2QVSB 3ORJA 1ASJ2 4QQLA 1DGRA 2UUBB 4LF7B 4RQPC 3WHUA 5GZFA 4R8HA 4FOYA 5JJEB 1RHI1 1YEWA 5IE9A 5FPLA 4A6OA 1KXGA 3SJCC 4AVCA 4UW4A 2ADQB 3AZXA 1Q6IA 3OY8A 4JI0O 4ES9A 4D0QA 2UXBB 3CB2A 1QU7A 1M56C 1OHHG 1P8JA 3RWRD 1JZ4A 3SC7X 1UMZA 1AR63 4BMEA 2Y33A 4UXNA 1DG6A 2WAMA 4J1XA 1S2EA 3JD2A 2BOIA 1FV2A 4IEOA 4JI5O 3A2FA 2ZE7A 1TGOA 5EBLC 2FDGA 4ASKA 4TWTA 2LO1A 2JS3A 4FVMA 1PNFA 4BA6A 2WO2A 1Z0HA 4PDWB 4OX9O 1YSCA 4K9SA 3AK0A 4PDVA 4K0KO 1N47A 1UL9A 4LLOA 1XE8A 3FBYA 3SR2C 5TISZ 3WOGA 4OX9B 4N43A 2B46X 3MZHA 5A7QA 5LXTB 2VMEA 1OZ0A 1ND3B 4DV5B 3H1JH 2DWRA 1WA8A 4JAUA 4A4AA 3W7TA 5DDJ3 3OMNB 3CZUA 4IV3C 2QKAA 1SLIA 3ME2A 1K73W 4B3RO 4GH4B 3GCXA 4P9WA 1VB4A 5IATA 1WBFA 2ET1A 1HNXB 4TV9A 4MHUA 5FYSA 2RS32 5D8AC 3HPNA 4XFHA 3GBFA 2ZE6A 2F6BA 5J98B 4IESA 3AKQA 3UETA 5CA1A 5ACA3 5EJ3A 2LGWA 2WS93 3O65A 1YXWA 1VBA1 4HT1T 1PP9H 2WNEA 4GX2A 4Y20A 3H1KH 5DUVA 4L11A 3ECQA 5CB7A 1QVFU 1V9U2 2IBZH 2ZXWB 2QBXA 1NKDA 3IDEA 4YZ2A 1XMQB 1VF6A 1QXJA 3G7DA 1NYWA 5F6LB 3AP7A 4LBLA 2LW8A 5JQGB 4ITCA 3U1XA 1R73A 3HT2A 5E16A 4LE4A 3CKHA 5B1OA 3C2UA 1B35A 3L9JT 5F6KA 4YVWC 1GP4A 3SJQC 5FOBB 4O4IB 4LF8B 3FYEB 4J11A 4TT3G 2ZS6B 1OI6A 4URTA 2C0ZA 4HK9A 3B09A 5GLVA 4EQVA 1FI2A 3VBBA 4RS5B 1DFQA 4XTMA 1SFPA 3BABA 5H5NA 5KXCA 1IX9A 4KGQA 1LHNA 3IFXA 2VZVA 3E8BA 5LA6A 2WLJA 4XPVA 4CH5A 4W6YA 2N05A 1IQAA 4JHTA 1K12A 2C6SA 4RR3B 3BU7A 4BISA 2DYSB 4AEDB 1SDDB 1L8DA 5L3CA 4QXCA 4L0PA 4FM1A 4QIWF 3WSOA 1NTZH 4AGGA 5JJNB 3K79A 4XDLA 3RYIB 4J41A 1UO9A 1UZVA 2IXHA 2ORZA 1AR83 1AROP 2LUWA 2ZGRA 2QSAA 2WFF1 3PUAA 1UKGA 3OUIA 3JSNA 5IYZA 1DGLA 1M4UA 4H37A 2IZWA 3K5LA 4QX0A 2FCTA 1PNLA 4J80A 2R062 2VMGA 4GULA 3AM2A 1YHFA 1NJIW 1ENQA 4UCUA 2DTYA 1MVEA 2Y0PA 1XNTA 1UIKA 5E88A 2ZR2A 1OUXA 3TEYA 2F1MA 4LR3A 1LU2A 1FV3A 2LQTA 3NNGA 3CJHA 2VXJA 3AK3A 2IUWA 3VDCA 1MNGA 1TME2 1OH3A 2JICA 4QGNA 1G9FA 5A3OA 1UYXA 5DAVA 2Q73A 5IJ0B 4CUCA 1W8FA 4JI2O 1HXS3 2JE8A 2VNRA 4AE2A 3RN4A 1D5NA 5GZDA 1OUSA 1CAXB 3DPRA 4WM8B 3KGZA 5JR7B 4AR2A 2HBTA 4GYCB 1QIQA 3VBRA 3CPWU 5IVEA 2N74A 4QDQA 3DCQA 5J09A 4JI4B 4RQPA 3N9MA 2ZGMA 4Y3OA 3SH3A 2XLGA 1CIYA 4TV8B 3IN9A 3P32A 3I8TA 4YW3A 1K5MB 1IBMO 3W58A 5A1AA 3WQ0A 5JVDA 3B40A 4XYXA 4NVPA 3ZMUA 2C26A 2ZEYA 4KU8A 4YZ5A 3KLSA 1PD3A 4DXSA 2W6JG 1V54C 3CWBH 1GN4A 4RQEA 3KCCA 1SQGA 5E89A 5A7WB 4N7UA 1GOHA 3VBOA 5A7NA 4D69A 4UAPA 4UF0A 1SQVH 1VRH3 3VDBA 2UXDB 3MIBA 3R05A 5FXWA 2VUJA 4JI3O 5FZCA 1SQ4A 3LWCA 2D3OW 1NY72 5C3QA 3VBSA 3JB8A 5CKQA 4YVSC 3VBSC 3EB7A 1CPYA 4UCSA 4O4LB 2QTSA 5JAXA 1TZOA 1QH6A 1SF9A 4BQ5A 2HHHB 1VBB3 4GKJB 1VBE3 1NT2B 3ACGA 4HMZA 4PDRA 1U12A 4P2ZA 4RHV1 4ET7A 1P4RA 5FO8B 5ACA1 1AR62 1G7YA 4IGOA 1CJPA 3STZC 4D8MA 1ENSA 4V2VA 1I7FA 2WJSA 3FZ3A 4Y5Z0 1JH5A 2WIIB 3MFAA 1H8VA 3ZXDA 1N32B 3M2MA 4E2GA 4MVRA 5JIAA 5C3OA 4JTAB 3IZOA 4YZ1A 2PY5A 4TV9B 3WY6A 2J1RA 4P14A 3T4DA 4FAHA 2EIGA 4LMFA 1YJLA 3AYDA 5FWJA 4GZRB 2FDJA 3LQCA 1NVPD 2QQIA 3IMNA 3PJYA 4QPIA 4LKEA 3AKTA 1LGCA 3FL7A 4FPLA 5LY2A 3AP6A 3H9AA 2VQEO 1N36B 1AR4A 4XCAA 1NS1A 1F51A 1SQPH 2OPWA 1U5YA 3CF6E 3ZIXA 3N2KA 4BMBA 4DR6B 4L8JA 4XACA 5A6ZA 5BMVB 1XQNA 4PA9A 5I8YA 2A0LA 4UI9L 5IWAO 4LF9O 2BGPA 1G9CA 4MLOA 3RS6A 2KR2A 2JENA 4ORFA 3W20A 1CVNA 2VNOA 4AWDA 5IAVA 2KXLA 4BIZA 4Y22A 1PK6C 2VMDA 1JU4A 1ZA4A 4PQQA 4R9CA 1VQNV 5CAZA 3WF4A 2ADPA 4QNHB 3SYPA 4F6RB 2AHYA 2GNBA 1IVSA 4DIQA 4FZ1A 3EXUA 5I91A 2OW4A 2P5OA 2D2CB 4DV6O 4P9OA 2ODMA 2ENRA 4P9PA 1AYM2 2GC1A 2QJVA 1DU3D 2OVUA 2ZCWA 4OUMA 3VDDA 4CEYA 4B08A 2K46A 4LE3A 3N9PA 2WZPP 4I0BA 4HLTA 2VZSA 2R0FA 2BPA2 5LYJA 2WWJA 2B8MA 3DYOA 4I09A 2PYJA 5C4WC 5IK8A 1OVSA 3GHMA 1C57A 3OPWA 1FOD2 5G05L 1AL0G 2BNNA 3PL0A 5FOJB 3S5QA 3VBRB 4O4HB 4UBHA 1VP6A 4NKGB 3QH7A 4DFSA 3CJIB 1PZ7A 2P4KA 1QJX1 1ZZ9A 1VPHA 1Z2GA 3NJZA 2WAOA 1S1AA 1V00A 1DF5A 4QB2A 2VW1A 2YU1A 5HFMA 3K51A 4XBQA 1KFXL 4Y1XA 1VBD3 1NZCA 5J2UB 1QOSA 4K8XA 3I49A 4R4XA 4YW7A 3R66A 4I9QA 2GH2A 4IIJA 4CEWB 3K06A 3QVNA 1IG0A 4B4RA 1LHVA 4OVEA 4X1KA 4QT6A 1AR5A 2C9AA 1M4WA 2OTLV 1VMJA 4D6RA 2UXNA 1Y9QA 4PT6A 4N9IA 5HV0A 1D0HA 5F1RA 4URAA 2WLPA 4ZHQB 2MEV3 2BCCH 1NH2D 2UYAA 4B1MA 2B7YA 5K7PA 2VAUA 2OUHA 4LHSA 2BERA 4AW7A 4JVAA 5A6QA 3CJIA 1NQTA 1WCQA 1IQDC 2VY0A 4Z07A 5EQUA 4C91A 4KL1A 1PO13 3C90A 1EY2A 2WZ8A 1OD3A 4H7MA 2NN8A 3G6BA 4CDUB 2CTQA 5FZDA 4LBOA 3I55V 2XL7A 5LP6C 1GZCA 2SBAA 2VW0A 2X8KA 3D5OA 1QVGU 4E4SA 2GMMA 2W0FC 2VQEB 2ZKNA 5FIXA 1RFYA 3K03A 2JG8C 5FZBA 1FXKB 5FY8A 1Q8SA 2A6ZA 3NO8A 2VO5A 1ASJ1 1COV3 2ZZQA 4IETA 1BBT3 1K5MA 2WLLB 3I5DA 1PVC3 3N7LA 1NR7A 1WJZA 1A8DA 4X20B 2VULA 2Q8DA 3KWVA 5FQ0A 1O3TA 3ZMOA 3VL9A 3SCGA 2VOXA 4LBQB 5FQ0B 4JI1O 4CCJA 5IDJA 1Q82W 3Q8CA 4BIFA 1X9TA 4XJZA 3DGEA 4Q26A 1NLSA 3VGIA 2VZUA 3POBA 4UYBA 5G04L 3I4IA 3NJXA 2QFEA 4WM7C 4IW3A 3MEPA 3G6JB 3N3HA 4K8RB 4QWNA 5JH7B 1KKDA 2ZAAA 1FMD3 3WUCA 4PDLA 1JOYA 2VWJA 4DUYB 1OKOA 2G9FA 4BQXA 4DV4B 2OT7A 2R1DA 3VUOA 1DYPA 1XMOO 3B3QE 2NNUA 1BK0A 1D4M2 2A3XA 4NTXA 4DYLA 4X1KB 4Q0SA 5FY4A 1PMHX 5JSRA 4G4FA 2EULA 1HRI2 5DDJ2 4BCUA 2LALA 1W3XA 3RW0A 5KR7A 2ADEA 2QQWA 2Y69B 3A0BZ 3AG1C 1S0VA 2VG9A 4OHWA 1DZTA 3IGAC 1W6MA 2VJXA 2BYVE 3OMIB 2DYCA 3OAAG 2AZ2A 3BCWA 1XNRO 2UUAB 4DUXA 2E5LB 1R091 3E8FA 3IC9A 3CNAA 3HQUA 1DP0A 1UPSA 1FXZA 3H8OA 1OKQA 1XXNA 3GALA 4B3RB 3ABMB 1ACCA 5FZ9A 3CRCA 3QD6A 1ZA7A 1ZAUA 2WQ4A 2JRIA 2Q4SA 1WUVA 3B9CA 4XDKA 3G71V 2AENA 4MVZA 1BMFG 3VZNA 4COUA 5AC91 4DUWA 1XRUA 2LFSA 2CDOA 1Z5VA 2AHZA 3K9SA 5FPOA 1HR0B 1W2OA 3VD3A 5GZGA 1ULOA 2X6AA 1Z7S1 4CBCA 3IDBB 3ZRVA 2BRTA 4RN5A 3LSQA 4K8ZA 1YIPA 1I9RA 1NR1A 2HFEC 3JD4A 4YPJA 4NYKA 1X33A 4EE2A 1YUDA 5M0TA 1KU9A 4XBNA 2XTAA 1QBZA 4OCTA 4RS5A 4ZY9A 1ZRIA 4FPCA 1ENXA 3LB9A 1W6QA 1ZZ6A 1DYKA 5FZOB 1FXVA 1VBD1 1UXXX 1CQ9A 1H2SB 3AK1A 1YRZA 1A8MA 1A6CA 2A3WA 4O2BB 1V9U1 1WP7A 3FB8C 3NRUA 4YG3A 3H3ZA 4OPHA 2XJQA 5JQGA 1AXYA 1DQ2A 1O3RA 4GKXA 1HRI3 2EVXA 2OZ6A 3N2GB 2ZX4A 1RUJ2 5SV5A 4IEXA 4LF5B 1APNA 4FFGA 3HKCA 3NW4A 5IFTA 2HLDG 2JG8A 2DCTA 3ZYRA 2ET7A 4GB32 3WG1A 2K9PA 1W9WA 2RMKB 5APAA 5A70A 1HW5A 3UK9A 1SQFA 1JYWA 3FN9A 4G9SB 4HPKB 4TXWA 1VJ2A 5FR3A 4K21A 4YVSB 4ZKTB 1QQCA 4I7ZB 5DAWA 3ROUA 4GX5A 3SPCA 3K4ZA 3HB3B 4JV4A 3RSJA 3N27A 1EN4A 1Q90D 1CAVA 5JXJA 4HFSA 1X59A 4OI0A 3G67A 4LO6B 1AJNA 5LRRA 2OUJA 1M9NA 1R1A3 3ZHUA 2HWF2 4XDJA 5CB4A 2E5LO 4X6RB 4FT8A 3JD1A 4QB6A 2VQ0A 1WMFA 5K0UA 2JGDB 3NNLA 4S2DA 5KX5A 5CA0B 3AMPA 3I3BA 3MHZA 4NPRA 5FUNA 3WB2A 1UU5A 1GNHA 5D5QA 2XAFA 3P3PA 2P37A 3GM8A 3NKTA 2JVDA 4W6XA 4U3JA 4QX5A 3IC7A 4LK7A 3O1UA 3O12A 4E4HA 3ABMC 2IXJA 4AVTA 1FD9A 3UGGA 1QXRA 3B01A 1K4DC 2V4DA 4CH6A 4J7ZA 5LMNB 5A3TA 5LOVA 2P22C 4FLUA 1ZX3A 1H4GA 3M3CA 3M7AA 3UV9A 5GLWA 3ABLC 2CWMA 2IH3C 3MPBA 1COV2 1HIXA 3V56A 4F3JA 1S0FA 3LDRA 4XUOA 1K97A 1NA1C 4HKLA 4LF8O 4FPYA 2A70A 3HNMA 3PVBB 4IV3A 3MV11 2L35A 1IPKA 2IFRA 1EN6A 2CH7B 2FHRA 3NMBA 4YJ2A 3BALA 1POV3 1YF2A 4KHPB 1LENA 4JRLA 4QQPA 4AQ6A 3LNNA 1CXZB 4R9BA 4XFGA 4JV5O 3W9AA 3VLBB 4KWJA 1TVKB 1RUI1 1SFYA 3MLLA 4HPKA 3EO6A 5FZ1A 2WLNA 4EZHA 5KWRA 4LWSA 4RFRB 1JVMA 1OMIA 3G6EV 3JUUA 1JUIA 1D4M3 1K33A 3H50A 2FCVA 1W2UA 1G8MA 2ZXQA 2BSKA 5LOVB 1SS3A 5H9QA 1Y9MA 1DQ4A 1RUC2 4A3ZA 3H8UA 2UXXA 3PN1A 4MXWA 1LOCA 1VAMA 4B3MO 3B5LB 2EXJA 4Y33A 4Q4Y2 1WBLA 2RS13 3IKWA 2EALA 4FM2A 4XTPA 5EP9A 2QM8A 2FDFA 3RZGA 2E3CA 1KYOF 5BNNC 3MFCA 1EV12 3KHBA 1JJOA 3BCCH 1EAH3 2Q68A 1FS0G 5FLJA 3C3TA 3USUA 4JI1B 2PAMA 3AYCA 2VOTA 1NZ6A 5BNPC 4FTEA 3OYWB 3OGIB 3DXRB 2GV9A 1PO22 1R6TA 1XE7A 2VOWA 4JI0B 2VL4A 2BU9A 1XNDA 3P1IA 3ZXLA 5IK5A 4CXYA 2DCKA 2BWAA 1WMDA 2ZNIA 4NB5A 1NQJA 2VNVA 1BEV2 3IWZA 1ZVFA 4BM8A 4FPFA 3NL1A 1O59A 2D5HA 2C24A 5JZGA 3DSQA 2MHFA 2OT5A 2W1UA 5F5QA 3SNMA 3GZUC 4D6SA 4QPGC 3ZKUA 4NTWA 3BA9A 3ZFEC 2YXYA 1VF7A 5CFDC 1ULCA 1AF9A 1EZJA 4HYOA 2HJFC 3JU9A 1SPPB 3CMAV 4AVBA 1M93A 2KG7A 1W04A 1IDSA 3MLKA 5LASA 1JYIA 2WSVA 3IIAA 3CC4V 3GJBA 1XNAA 4PA4A 1JYVA 2CAUA 4IHJB 1H1AA 3ABKB 1GV9A 3HQRA 1IKPA 2B9UA 4PIZA 2EJ7A 3M8AA 1AUYA 5J36A 4B1LA 4X89A 1J3RA 4B7EA 3TN91 4CXXA 1H9PA 2X5IC 4EEQA 5KBFA 2FYUH 1H9WA 1UZYA 5FP4A 1LEMA 2E33A 1VQPV 3LSEA 1UY1A 2Y6LA 2NLJC 5FYYA 4GB31 1N3OA 4LBKA 3HBZA 1LUWA 5IT9N 5IUQA 2EXIA 3BRCA 1JHNA 4XW3A 5FY5A 4ASUG 1IS6A 3SJBC 1PK6A 3L71H 3I2FA 2GSYA 1ZUQA 2WSUA 1AXZA 1Y43B 1ZZ8A 1GMMA 1CAUB 2N7GA 4JKKA 1M5IA 4A41A 4UFKA 4J10A 2QDNA 4FPPA 3N7MA 4XJ8A 2PHWA 4CP9A 5H9SA 2JGUA 1H1IA 3A23A 3RYRA 2XJSA 1VBC2 4DR1O 1XNRB 3JZVA 1NBMG 4KNCA 2D43A 3D3IA 1IHMA 4KQ7A 4WVZA 5A80A 3FX7A 2YIDA 5FK8A 1IBKB 1S2BA 3NNJA 1H2MA 5FP7A 4LK6A 1XSRA 4TN7A 5B1AC 1DLBA 3ACLA 3AG4B 5JZGB 1N34B 3O1MA 2MK3A 5AG2A 1UOBA 4MX3A 4IEVA 4OZOA 3TCUA 1S0IA 1N3QA 4ZI7A 1UJWB 2LP7A 3PHMA 2XBO3 1SLAA 2DOSA 3ZN1A 1BEV1 3FFQA 3N9NA 4X1IB 3H3LA 3S6PA 1O8PA 4E27A 2L9LA 2ZABA 5CKNA 2LROA 1YJNV 4FIPC 3BAAA 5HCFA 5HI0A 2BGCA 3WDWA 2VECA 1R1A2 1GFF2 2B5HA 1BSMA 4RSUA 2ARAA 1SBFA 1JU3A 2DU0A 2CTWA 3TAYA 3ZN6A 1ZRFA 3LOIA 4X6QB 2QQUA 3VDAA 4H33A 4HZFA 1W59A 3ACIA 1UMIA 4X88A 3UT5B 4MHRA 2YGMA 2VW2A 1U97A 4Q4X1 1MS4A 2O57A 3AYEA 1OPOA 3QLQA 1LNSA 4I5SA 1RUE1 4B7KA 4XUPA 4KBBA 2X29A 1I94B 3JARB 2P3YA 5J3UA 1Y76A 4EZ4A 2Y6HA 4AQYO 4OULA 3NV2A 2J1UA 2DN9A 2WZR2 2Y64A 2WYFA 4CZSA 2PHUA 3HN1A 1S72V 1VMGA 5AC93 5BXXA 3UCSC 1RM1C 5CG8A 2A3YA 2Q1ZB 2XGXA 2RS51 5KLVH 1TVKA 3IAQA 2NM1A 3QTCA 3RFRA 2AZ0A 5DXDA 4R7CA 2WLQA 1Z7S3 3T0BA 4PELA 2IWGB 4IE5A 4CS2A 3R65A 4JGZA 4XAEA 5FYBA 4UFJA 2BFUS 4W50A 3ZHQA 4YJ2B 3VZLA 1JFFB 4LA3A 3I3DA 2JDHA 2LJ2A 2WT0A 1BQ0A 1FMD2 1BCXA 4NAMA 3GVMA 1W0JG 1KP2A 2VVFA 1B6QA 5LA2A 3K57A 1MA1A 2YIAA 3MHSC 2WFPA 3QOPA 4BW9A 4DXTA 5H2FZ 4JTCB 4KWKA 3IIIA 2E74B 4ZHQA 4K1ZA 3ST7A 1GWLA 1S3JA 3OGVA 1DF4A 3R4UA 4O2BA 5CB4B 4YM3A 3H7JA 3ALQA 3NWKA 1ZSPA 3JXSA 4JI8O 4C90A 2VZOA 3TETA 3P30A 3DL3A 2R063 4QPIB 5AFBA 5FYCA 3MGUA 1YIJV 3ZSJA 3LOBA 2ZEXA 1UYZA 4QXKA 2P06A 1HB3A 3K46A 1V55B 5DZFA 2R072 4YHHB 2Q67A 3FAVB 4UF0B 2WNVA 1LOFC 2JJ6A 1GZWA 1J1LA 4NROA 4F7ZA 1D5AA 2VRZA 4NHKA 3JBG3 4PA7A 1WCKA 3VZOA 2WNUA 2ZGKA 3RZJA 1TMF3 2WWUA 1LECA 1RTVA 4EN6B 3ZXEA 5FKBA 3WNOA 4CU9A 1ONAA 1U5XA 1GICA 3BOPA 4RGKA 5HXVA 1RPRA 4DOUA 3SYQA 1RUI2 2P17A 2YXSA 3CD6V 4HN1A 1URXA 1VMFA 5JOYA 1NCQA 3ZN0A 2JEMA 4AEMA 3K08A 2VCMA 2TUNA 4GUNA 1XU2A 4FMTA 5EZYA 4B4QA 3HJRA 3LDKA 5IY5C 1IBLB 3RWNA 2CGNA 2C1FA 4IL6Z 3HKEB 2Q8VA 1HR0O 3L74H 1FAFA 1K5SA 1OFSA 5ITZB 1QMJA 2ZA9A 3T09A 4P30A 5T50A 1KUQA 1HRV1 5E8AA 2OIEA 1EV11 1J84A 4XMIA 3TNQA 3VQVA 2ATFA 2P3IA 5JXGA 4QXBA 3M1HA 1RUF1 2A6VA 4LIVA 2IU3A 4JI4O 5FZAA 4LHNA 1VBC1 1WN7A 3OMAB 4DV1O 2R0HA 2D6OX 3QH6A 2WLKA 3U4SA 4YG0A 1T5EA 1SZBA 5JMOA 4JTOA 5EYXA 2BGOA 4O65A 3WCRA 3WQBA 4AOCA 5GONA 2WABA 4LBJA 3ZN6B 4IYHA 3RBZA 4YVWB 3I3QA 4IEPA 3ZYGA 4R8CA 5F8PA 3RQ0A 4QX7A 4RGAA 1Q8IA 3NVCA 2ZDIC 2D93A 4PCRA 3SXWA 3U14A 4XABA 4EWAA 4JCKA 3GGLA 4NPLA 4QE7A 1ND2A 3ZOIA 1TMF2 3PIGA 1DZQA 3WG4A 2HYKA 2A06H 4K1YA 4CDWC 3UKVA 3FHAA 1NTMH 5H9RA 1SZTA 4DUYO 2YUAA 3K59A 2VE1A 5F2SA 3JYCA 2ZXWC 2DVBA 1RUH3 3QG5A 2M7WA 1GNZA 3T1MA 4DV2B 3DYMA 5F7UA 1QQP2 3KVBA 1GH6A 4Z1MG 5LA6B 2XH6A 4CP0A 2LW7A 1L0NH 1O6UA 1QF3A 5EBMC 2QQNA 2HWB3 3FFZA 1OSGA 3AFKA 4J42A 4PDWA 2CTVA 2Q8CA 3ETQA 3L73H 5D2AA 2YI8A 1UYPA 3LEKA 4XBLA 2ZGUA 4OI2A 5C70A 2N04A 3I56V 4AFMA 1Y74B 2Y38A 4NMIA 2X0LA 1LODA 3OYWA 3ZHTA 4FSJA 4FLZA 4AFCA 2OIIA 4O4IA 1JZ7A 4DR2B 2B9ZA 4DR1B 1KKCA 4LNUB 4CP2A 4QPGB 1FNYA 4IE7A 4PBOA 4MGTA 3FLPA 2ZX1A 2QKCA 2CL2A 4FFBB 1GQPA 1OQEA 1Q6HA 4J25A 5L9BA 1IBKO 3WDUA 4J7JA 4BU2A 3RZKA 5FAXA 1LU1A 2XBO2 1WNSA 3LZZA 4XF9A 1SDWA 2VQTA 3LIHA 4W8JA 1YLLA 2QDRA 1OA2A 2ATKC 1H2LA 3IPVB 1STMA 3EYPA 3OUJA 1IZ3A 4KFMA 3AJYA 1L0LH 2GN7A 1JMKC 1JYNA 3SKJE 1W6OB 5I0UA 4B4PA 4BWOA 1MEC3 5EYPA 1QJU3 3Q8EA 4ZU7A 4X9QA 5A7SA 2BOJA 5FP8A 4QX1A 1JOJA 4MSWC 1R1BA 3H3UA 5BNPB 3K48A 2HWE2 2KG7B 5IVBA 5LW9A 5JPNB 3KF5A 5C4WB 1TG7A 2FMDA 1WLTA 4XF0A 1HB4A 1QJFA 4LTAA 3ZR5A 5F3EA 3ZSMA 2R1BA 4TV8A 3T4HB 5IWAB 4Y1VA 1H8HG 1XJAA 2K2SA 3OEHG 3JARA 1WWYA 3A0NA 3T2PA 4DEQA 2ZX0A 4J6GA 5IYDO 3CCJV 4B3MB 1ZYBA 1K34A 1O4YA 2B9VA 3AG7A 2IM9A 1QOOA 1E1QG 1US3A 2ZACA 3KV9A 1PM4A 4GB33 2XAJA 2EAKA 4NHXA 1AJQA 2RJZA 1F9KA 1XYOA 4MOAA 1QQP1 5IJ0A 3N36A 5H6RA 3B00A 3RYHA 4GKKO 1DK1A 1RUE2 4L9BA 3DXUA 1D4VB 4V2WA 1WCSA 2ERFA 4YW5A 3OUFA 2XONA 4UFMA 4OHVA 3CCUV 1ULGA 3CLPA 2K9ZA 4EN7B 4WZCA 1MS0A 2TEPA 3SCFA 2JE7A 4GMP3 4LHLA 3ZXAC 4LF5O 3O1RA 1Q8PA 1CPNA 3K0DA 4I50B 3E86A 3M8LA 1UKRA 2BOBC 4JZ2A 5FYUA 1LB2A 2ZX2A 4DR3B 2Q1MA 3AG3B 3PJSK 3T0AA 3JATA 1OCRC 4AHCA 1VBB2 3WG7B 3H8RA 3EBRA 2RS33 3KF3A 4ZZ8A 4Q20A 4NN0A 3P6BA 1IXMA 1P84F 2FB5A 1GM7A 3O1VA 2Y6KA 1AYN3 4B8EA 3E8HA 1HB2A 2WS92 2JDMA 1GO3F 2RJ2A 1W2AX 3KV5A 4RR3A 2RMU3 5LXTA 1KDKA 1SQQH 3LCPA 4WM7A 4QGLA 1V6JA 2JJ1G 2YGLA 2KKWA 1TUBB 2PLV1 1RUF2 2W3JA 4CU8A 4NRMA 1F8VA 1H38A 2JGDA 3CBNA 1AR61 5ACA2 1I0HA 1Q86W 1S0GA 2UURA 2QQJA 3K4DA 1DCSA 3AMHA 3N2KB 1DBNA 3BN6A 4K40A 4O2AA 1V9U3 5TSWA 1FXHA 1YZBA 3ZFFC 4X62O 5A3MA 1PMJX 3K3WA 4LWSB 1C8NA 2E76B 3UQ8A 2C9KA 4BLIA 5A33A 4Y20B 1W05A 1PPJH 3HD8B 1KEXA 3MIGA 5FPRA 5KUMA 4JDOA 3M4FA 1UU4A 1PGW1 3I3EA 4YHHO 4FBFA 2HKXA 2GP5A 2YBSA 4QQ2A 3PMEA 3HEIA 3ZMTA 5FREA 3D36A 4BIUA 1B06A 2O8QA 4LOTA 1M06G 2F4VB 4F8AA 2J1AA 5FPVA 3RI9A 2BQPA 2YIBA 4QPYA 1S5JA 3N2GA 4HONA 3ZDVA 4AF9A 1AILA 1AI7A 2YEVB 1AR81 4BJ0A 5FLIA 5FDBA 1V54B 3M99B 3GZAA 4MVOA 5JWPA 3AZZA 5IWFA 1ZL8B 4DRXA 4O9GA 1XMQO 3THCA 2R9RB 4YIPA 1NE6A 4QKNA 1RUD3 3JASA 1YFUA 1HQNA 3CXHF 5EC1C 3MAQA 2EXKA 2X10A 4J1WA 2ZGNA 2BV4A 2RDCA 4DK0A 3PIJA 2IJIA 3T2OA 4O4LA 4BXFA 3MO4A 4Q1RA 4ES8A 3AFGA 1XI1A 4Q4W2 1OA3A 2XDVA 2WFF2 2WPDG 3MIDA 4NXMO 3G4SV 4GWMA 4D6QA 1RMU2 1PZ8A 3MICA 1BHGA 3JCIA 4Q4Y1 1R64A 1W99A 4XFBA 4BAYA 2JKXA 4LEJA 2WRAA 2JJ2G 1MS9A 2XMLA 2A5ZA 4UT5A 3OOXA 3OG2A 1N8RW 3LFMA 4D3WA 1TME3 4HSJA 4JDNA 3KVAA 1RXFA 4FPJA 1IKQA 4RO2A 5KMGB 4CVUA 1I94O 4ZONA 2UUBO 3ZDSA 3ZPYA 1AI4A 1LHOA 1JTZX 2BUKA 4Z1VA 4WFBV 3UGHA 1YTFD 1VAVA 3DN7A 1WLCA 1R3IC 1VARA 1LR1A 4CCMA 1JZ8A 3E5QA 3A0RA 4JQRA 3CMEV 4AGRA 4CCOA 4TSFG 1RUC1 1H2NA 1QJZA 4PJ0Z 1TMF1 1OBNA 3NQHA 1W6QB 3ZFFB 1UU6A 4UV9A 4SLIA 1X8EA 3RNSA 5LYJB 2DFCA 2W87A 4N53B 2R071 1SRYA 3K2OA 4LOSA 1DF0A 4I0XA 2ZNJA 2WBKA 2VMHA 4AEKA 4ARYA 3HNBM 1NA1B 2QM7A 4ZS2A 1GKFA 3HKDA 1GQGA 4JDMA 4E9KA 2DYSC 3CJHB 2O14A 3CMGA 4XURA 4I55A 4IQPA 1AHSA 2XHBA 1BVVA 2F23A 1VR3A 2G38A 5BNPA 5L3GA 2UUCB 2VBPA 4XF1A 3L70H 1W8NA 3POWA 1O5UA 5BY1A 4GWJA 4RHV3 4XIOA 3B2EE 4W4LA 3ETDA 1R6NA 3J7LA 5FYTA 3QO5A 1XNCA 3ZKYA 4Q6GA 1RMU1 1FFXA 2X5IA 4YGEA 1ULEA 3I54A 3BU0A 4EB6A 1X82A 2W1QA 4ZZ5A 2ZEWA 2ZE5A 4WFHA 1H8TA 2H6CA 5BXZA 2OX0A 3ZEDA 2YV8A 3E97A 2RQ6A 4X65O 1F2NA 3Q9OA 4AK3A 4QD2A 2GU9A 4FOQA 2ARXA 2ZKOA 2PAKA 4HVRA 1Y4WA 3AKSA 5JR2A 4YW6A 1QNMA 5F5IA 3GHNA 2XQXA 3WF2A 3U4XA 1D2QA 2EIKB 1J1TA 2JDYA 4LP8A 4I0AA 4QMAA 1ZL8A 2YBPA 4AQYB 2MEV2 2PN5A 2RV9A 3POFA 2EINB 4PF1A 2WT2A 3WNKA 1UY0A 4K0KB 3UL2A 3PVNA 5FMOL 3MW4A 4LNVA 4IEWA 3KHCA 2JWPA 2P7TC 4YGCA 3WZ1A 2UU9B 2OIGA 1VQ4V 2HWE3 3RYCB 1MOFA 1QH7A 3SEPA 4NPMA 4BIOA 4NIIA 2Q1FA 4DRXB 3ZFEB 2JDUA 3E6CC 2WUHA 3S3XA 1WB7A 2PHXA 3Q8AA 4LULA 4LFCO 4XJ9A 2V09A 3SYAA 5FUIA 2A73B 1PVC2 2B1IA 1LOEA 1R6KA 2CDYA 4CDUA 2RMU2 3AKPA 4CDUC 2DYRB 3ASIA 1VBB1 2G1MA 3UT5A 5I8TA 4MVUA 3DYPA 1SKVA 5FY9A 3W7UA 3VKOA 1E5HA 5JXIA 3AL5A 3MHHC 1EN5A 3WEZA 2BTOA 4LR4A 2PQSA 1YQ5A 3BODA 1ZTEA 2A9HA 3I2GA 1Y6XA 4W6WA 1JZ5A 5FYHA 4MW3A 3RZZA 3LEMA 1QCEA 1NQDA 4FPKA 3N9OA 4DV7B 1PIV2 4FLXA 3TWIA 4CEWA 1G9BA 5SV8A 4N53A 1OD5A 3JB4C 5T55A 3OBTA 4K7JA 3ILFA 2VPVA 2QM4A 4PDWC 1CEZA 1UD1A 1ZWIC 2Y34A 2YC4A 2Z0AA 1KS4A 4YSFA 4X8AA 4UVBA 4L97A 3CCMV 1RVF1 5FZKA 3K3OA 4DR2O 1AR91 1DLLA 1YFWA 1I6XA 5BNNB 1PV0A 3LIGA 4DINB 4HKWA 1S5LZ 1U5ZA 4GX0A 3CU7A 2JDKA 5C71A 4AI0A 1W3VA 1C3HA 4X1IA 5BYNA 1SC5B 5JI7A 1ZBE2 3WX5A 4CCDA 3J81N 2GTAA 1A3KA 4LF4O 2J22A 5GTIZ 5KHHA 4IEYA 3TYJA 4LH7A 5I8SA 1PO23 3MW2A 1WPXA 5FNVA 4XBFA 4EROA 2VM9A 4TZDA 4WFAV 3ZX6A 1NOVA 1RL3A 3OJBA 5HFLA 4MYEA 4A44A 5B1BC 1AR1B 1R083 2OKXA 3CDZB 2IW5A 3L2HA 1THZA 3O1TA 5C4WA 4UB6Z 4M3CE 4RD7A 4YW2A 4RUEA 1FPOA 2YU2A 1FPN1 4G3YC 3W7WA 1YJ9V 4TTGA 5D1IA 1QJU2 4Q4W3 3WP4A 4YLZA 2PI4A 3AZWA 1ODMA 4A5UB 2P3KA 2ZHLA 1WCDJ 3OGCC 1HV0A 2UWBA 3WD5A 1V6NA 3C7EA 3OGRA 4CCKA 1JZ6A 1OF3A 1FYUA 2DBIA 2VBDA 3FB7C 5A33B 4CS3A 4K35A 5I0DA 3MIHA 2RS53 2YC2A 2DF7A 1ROPA 3B02A 1KJLA 4IE0A 3TOJA 1VMHA 4RUFA 2HJDA 4TUYA 5JUVA 5JCOC 1Y4MA 1VBD2 4LQRA 4BQ3A 2PHTA 4JI6O 3POJA 1F4HA 4AEDC 1OPMA 4KBZA 1OA4A 1TNRA 1GKBA 3AG4C 4XOGA 4ZOLB 2GDSA 2VUDA 1D2SA 4K6BA 1UPGA 4W65A 2EIJB 4UWDA 1XBLA 2OXBA 1V55C 2XB6C 3C7OA 3OGSA 4U3FH 2Y6FA 1IS3A 4U2AA 2HYXA 3IT8A 2WNUC 1PO12 3VV1A 1QNYA 2ZM6O 4JI2B 2PFWA 4MVQA 4YWAA 2WSSG 1I5XA 3T2TA 5LGNA 3AX4A 3RZMA 1WAZA 4FPHA 1XYNA 1QGLA 5CN0A 4Q0UA 3RZHA 4AEDA 1UY3A 4LO5B 1GP6A 5FBZA 3ATGA 3W21A 1UX6A 5FYVA 4LFBO 1O4TA 2BE3A 1UAIA 2RR11 1GNYA 1RUH2 3W5MA 2DCYA 2BZDA 3ZM8A 4HNAA 2RDNA 2GN3A 5ANQA 3VBOC 4Q4X3 1T6BX 3Q4HB 3T1LA 3PU8A 3OW2U 1R3KC 1AR92 5EFUA 4GMP0 3U10A 1IBMB 3LGRA 4BW5A 1H8TB 2F17A 3GDBA 1KMIZ 2PTMA 1JZ3A 4WM8A 4BQ4A 3VBSB 1VBA3 1J5EO 5FMBA 4NXNB 4CA9A 3ZS8C 3M3EA 3S7IA 1VQKV 5LB6A 2EIJC 2OCCC 4Q4V3 3AZVA 4FZ0A 4I0WB 3ZXJA 5FO9B 4FTSA 1LNQA 4P9JA 1GWMA 3GB7C 3SH4A 1PL4A 2VUAA 3WW3A 3BVOA 1JW6A 3SGIA 2WZR3 1E1RG 2ZINA 5LCWL 2ETNA 1VF5B 4GKJO 4NIGA 4PLOA 3WG2A 4DNYA 2ZIOA 4EYUA 5H9PA 4QX8A 2LW1A 4AFDA 2X09A 3GWOA 1XU1A 2ZQMA 3HQXA 3W59A 1FPN2 3CRQA 3T3YA 4QU2A 1URFA 4INDA 2M6YA 2W5FA 3B69A 2HWD3 5L3EA 3HKEA 4FLVA 4YVWA 1SACA 2EIDA 5D5PA 4FM0A 1SHWB 2R6QA 1MSWD 2IJJA 4WM8C 4XEZA 3TB0A 4XAAA 4YW1A 4XUQA 3BUCA 4F6RA 2TBVA 2I2SA 3ZMVA 4SBVA 4UV8A 4WBNB 3ZSKA 1US2A 1RM1B 4IGQA 3OD0A 3ETPA 3WT3A 4Z2WA 3LDCA 5L7OB 4XUTA 1K4CC 2NYYA 3UO3A 3JATB 1YFYA 2B45X 1UCXA 2BVVA 3B77A 1PNMA 2DCZA 5EC2C 1XREA 3ZMNA 4RR3C 4RQFA 3RVHA 1WD4A 3CL1A 3ZRXA 1X9PA 1O9GA 5J37A 1UYYA 1NXD1 1T2XA 4G27B 1AXKA 2YG0A 4QHOA 2E75B 1WZXA 4OMCA 5JPMB 5J1XA 2XKPA 2EXHA 4G2KA 1HRV3 2Y26A 2YFUA 3KZIZ 5HCBA 4UFLA 2WO3A 3D3AA 1Y66A 1JI6A 3U78A 1DGWA 2XJRA 4YZ4A 2YYOA 5DMYA 4PA6A 1DYOA 2YROA 1Q8OA 3WNXA 3OFNG 4E2LA 4GH4A 3VBUC 1GWKA 3FHIB 1C5HA 2Z2SB 5GW7A 4XC9A 3THDA 4LT5A 2NZ9A 5CISA 3F95A 4HK8A 2AH2A 3MW3A 2UU9O 5FZEA 2UXBO 1RMU3 2VR4A 3RYFB 1KS5A 2R7EB 2R043 3GF6A 1XQ8A 2HWD2 3LDBA 1H1MA 1UW8A 5JOZA 2WA4A 2W9XA 4QQHA 4JYYA 2WZEA 5FMCA 1RHI3 3A8TA 2XWBB 3VD7A 2YICA 4DO0A 1XBFA 1C4RA 1M1KW 5KHKA 1RUJ3 5T54A 4PIXA 1F35A 1TE1B 2DU1A 3VKFC 4BQ2A 3DPRC 4JQTA 1VQMV 3I2JA 1G1XB 1FMD1 1MZEA 1S0CA 1UQXA 2OS2A 1IG3A 2A6XA 1RJ8A 3X2QB 4Z92B 2VXRA 3CP1A 4DRRA 3MUZ1 5J96B 1YDXA 3MD0A 4QPKA 3VD4A 4KHPO 4EN8B 3BFRA 3EHKA 5HPOA 1SLLA 5K0UC 4M0HA 4OUEA 3MBWA 4BH9A 2Q8OA 3HKCB 4X8NA 3ZMZA 4I02A 4IV1C 4LHKA 3FC0A 2DVGA 2J1VA 4R6ZA 2GTSA 4XE9A 2W2IA 2Q5TA 3NJYA 3WINE 3DGTA 5IVFA 1CD3G 2V4VA 5EZYB 1A78A 1R1A1 3QO7A 1N0NA 5LA0A 1NCQB 2EAAA 2H0VA 2EIMB 4JHZA 1G9AA 5EWSA 5CFDB 1ZM1A 3F2ZA 2O1QA 1N0JA 4X65B 3DC5A 5F3IA 4ASMB 2HWB1 5A6XA 1MACA 5HCAA 2DV9A 2XPJA 4KWUA 3HOBA 1LESA 1M56B 4QJFB 3IMMA 5ABJA 5BNOA 4LO7A 1QOTA 1J3QA 1BE3H 4WVWA 4M00A 4UCVA 2ZHKA 3PNAA 4D7YA 2Y4TA 2GHYA 4JASA 1YITV 1F4NA 3VBUB 4DR4O 2FD8A 3T1CA 2DW4A 3T2QA 5EK0A 4Y5TA 4O4JB 1IS5A 3OGGA 1HX6A 3W7SA 4XFAA 3RMXA 4IEZA 1GMGA 5FPZA 3EHBB 4JGSA 2HWD1 4CSWA 1VBE1 5A1FA 3KT7A 3VKLA 1TEIA 4CP1A 1N33B 2NQYA 5EYYA 1GTOA 3OR6C 3GBWA 5L9VA 4QPIC 3THOA 1ORQC 3T1YO 1FOD1 3X29B 1I5ZA 2A79B 2Y48A 5GONB 5K9YA 2QNKA 5IYYA 2ZGTA 4DO2A 2RE9A 4X8PA 5LEKA 5A7WA 4UVAA 1LOAA 2RS31 5EXOA 3ASOB 2EX3A 3CJXA 3D82A 3LPGA 5B66Z 1RSOA 1XDCA 4AI1A 1XILA 4W4ZA 4KMQA 1W6NA 3IAYA 1WLWA 2A6YA 1NT0A 1HXS2 3NAPC 5CU1A 4MTXA 5BR8O 5JIUA 4GMP1 3WNLA 3HT1A 2Z69A 5GALA 2D6PA 1OQDA 4DK1A 2DCJA 1X36A 4PF5A 3A4UA 3ZFFA 2ZM6B 5KXEA 3BPZA 2D98A 1Q6UA 2P3JA 4R9AA 1VAKA 2GUZA 1NUKA 3SQOA 2E31A 1FPN3 5IT6A 4TQDA 2XG3A 1J5EB 1HDKA 1H30A 1MEC2 2MW2B 2GALA 2WO7A 2C2AA 2XUMA 3ZX7A 4M0NA 1XMOB 1PM7A 2D6NA 5JXHA 4ZXKA 2IVJA 3NV3A 3ACHA 4JGYA 1GP5A 1YIFA 1REDA 4IIJB 5LATA 2ZGPA 2WT1A 1TA8A 1UMHA 2FDHA 4Z2AA 2VWKA 2JB8A 2AEZA 2ZKLA 1YO8A 3ZFGB 4FI9A 1DQ1A 2ZHNA 3ITQA 4TLFA 3ES1A 3WHTA 4AQTA 5GZCA 5DABA 5IJ9B 1W0NA 4MGIE 3VBHB 5F3CA 4D94A 2AREA 3HMYA 3LA7A 4CEYC 3RYIA 1PMIA 4U7NA 3CEWA 2UXDO 5GLTA 3VKNA 1VQ8V 4ZI7B 4JPRA 2OQ6A 3TBDA 4IE4A 3VOUA 3RYFA 1OVPA 5JCOA 4PBPA 1W9SA 1N34O 3W7XA 1ST8A 2ZOEB 4NUBA 3OUSA 2UUCO 1XYPA 2EF6A 2CNAA 4Q29A 2OQ7A 4JTNA 1AVMA 1K5MC 4MGZE 4M3CA 4GKYA 3WNPA 4TLGA 2B4KA 3MUY1 5FFOC 2WLIB 4B3SO 2VCCA 1RIRA 4R50A 3KV4A 4IERA 5FZFA 4RFT0 2DFBA 4C0BA 3FD9A 5FUPA 1EPWA 1AX2A 1BK1A 2E51A 1N36O 5KAFZ 2OYZA 5IVJA 2H94A 2BTQA 4MGYE 5EPAA 2RM23 3ZXGA 4XDOA 4UFIA 5ABJB 3AKRA 5CYYA 4I55B 1LKNA 2MEV1 5FZ6A 2VZTA 3ZIAG 1DTOA 1XEQA 4FFKA 5A7PA 5LHHA 1QNWA 4YYOA 2IXIA 5E1RA 3W5NA 1ND2B 2VH9A 4CCLA 2VCAA 3D4KA 2AACA 1CAWB 4Q2FA 1UZWA 1JA8A 3GZEA 1BXHA 1C8M3 3QCWA 3TNPB 1FFXB 2X5IB 1I1EA 1L7RA 1B09A 3ML0A 1TME1 5DUWA 1TQ5A 5FJHA 1JPXA 3ZYBA 1G8WA 3ZLIA 3ZRWB 2TNFA 3FBMA 3LDDA 1GU3A 4ATFA 3R4DB 1RUF3 5A32A 1SQBH 3AG2C 2QQPA 2D7FA 4EV0A 1K92A 1JQ0A 2AYHA 4CDWA 4O4JA 5LGUA 3E89A 4UFZA 1CR7A 4PI2A 4IV3B 2QR4A 4LH6A 3LNMB 4GQ7A 3C3SA 3MDPA 2NR5A 2AR6A 2R16A 2J7MA 1WW5A 2RS52 2XJUA 1XPWA 4PQ9A 3BGAA 5BZBA 2EBOA 2QWRB 1HQLA 2XBO1 4R9DA 2JE9A 2XXZA 3AMNA 1VRH2 1RUG1 4XVHA 2BNOA 2JDIG 3PUIA 1OCRB 5GKAC 2CTPA 4DV7O 2JD4A 3NV1A 1PZ9A 3K3NA 5DUUA 2VQFO 3PURA 4KXRA 4BQYA 1H6XA 3QF7A 2P67A 1W9FA 3MV01 1QDCA 4BZ4A 1Q81W 2EINC 1HB1A 1FATA 4ZHNA 4QM9A 4C7UA 3RG0A 1ND3A 4S2HA 3JQXA 2VTXJ 1OH4A 3VHRA 4UCTA 2HEPA 5AVAA 3RDIA 5L3FA 5E1AC 2PELA 2VZ3A 4WZFA 1ZZCA 4NHYA 5FWEA 2Q0AA 1KD1W 1YFXA 1PIV1 1UWWA 2BDRA 4GA9A 2Q30A 1W6PA 5T5PA 2YEVA 4P00B 4DV0O 4E4EA 2YY1A 1CX4A 3N7KA 4RS5C 2PUSA 2XJTA 3DXTA 2FTKA 3J7MA 2L6LA 2J1SA 2WNOA 1DQ5A 5JJJB 1YHQV 1Z5WA 1G4YB 1XB9A 3ASNC 1VF6C 3IJ4A 4WCEV 2CK3G 1VBA2 4BQWA 5C3PA 2JG9C 3KCXA 3MF6A 1XNQB 1N33O 3VN4A 4AI9A 1JX9A 4LFAB 1NCRA 4H14A 1YQCA 4XF4A 5JDBA 2BWCA 2H0BA 4TOIA 4M4RA 2GP3A 2IJKA 5IFPA 1HKDA 2CUGA 2AXTZ 4HSLA 4M4PA 1L3JA 3SEEA 1REEA 3JQWA 4EJRA 3T4ZA 2R49A 1R092 2ZCEA 2X7RB 2CY6A 3R0RA 5EIBC 3OSDA 4QDRA 4Y4RA 3BHPA 2GH8A 4JYAB 1XC6A 5C3SA 4COVA 2VU9A 3T08A 1ZZBA 1W9TA 5J2TB 4XXPA 4X66O 3QACA 3TK1A 3PUQA 1BT8A 1VEWA 3U37A 4CXWA 1W03A 2QQMA 1EAH2 2ID4A 4MVSA 3N9QA 1KQSU 5CFCA 2R9AA 1UY2A 3S3WA 2VZRA 5K0UB 4R52A 3I2HA 3MLJA 1IOAA 4K20A 1SA0A 2V72A 5EIYB 2QA4V 4EFEA 4CU7A 5DDJ1 1DIWA 2ILMA 1O3QA 3TRSB 5EBWC 3ZR6A 2BNMA 1EPZA 1K7DA 3E22A 3RYHB 5I0RA 2XAHA 3MYXA 3ETGA 5JH7A 3HKBB 4UXAA 3HKBA 1YQ6A 2RCVA 1R3JC 3SYCA 2W92A 2WO1A 4NWVA 3HAGA 1OCCB 4FFIA 1U0AA 1JYXA 3ZIWA 1YCIA 3MI8A 1HRV2 3F5TA 4EN0A 1G9DA 3VBOB 1UOGA 2QKDA 1EUUA 4EWEA 3NSTA 4M3CF 4FCAA 5FLXN 2CGPA 2Q7HA 3H1WA 4DB5A 3HBKA 3VHNA 5IYBO 4NXNO 1ZRCA 4FJCC 5C8CA 5LMNO 2UUAO 5LRSA 3CSXA 5KHJA 4A42A 1QHTA 1UPIA 1RB8G 1AL23 1EYBA 3ZJZA 1VQ7V 2VTXA 2Q4PA 4QX2A 1RINA 2W47A 4YGBA 4JGZB 5FZ4A 3WP3A 1NLRA 1B35C 3CCRV 1S0DA 5LBCA 2YZ4A 3URFA 2PA7A 4MGQA 1PVXA 3UJQA 2E6VA 3C7HA 3Q8FA 1S76D 1DGSA 5ANNA 4OYUA 3E6BA 3H8XA 1Q56A 4X20A 3JAMN 5I0SA 2E53A 3J7AU 1A34A 4XHXA 2JG8B 4UUJC 3A21A 1FYJA 2Q7EA 4Y1UA 4FFHA 4LBNA 1GN2A 3RRDA 3JD73 2XL9A 4NHMA 5LMUB 4LITA 2P2KA 1CONA 3VHPA 2Q7GA 2A75A 3POGA 4O61A 2LFRA 3KT4A 5FMDA 1J3PA 1AI5A 2Z3YA 4DEVA 2ZX3A 3ZVXA 2HJIA 1V6OA 2QEXV 1GRJA 4RL7A 5EYPB 1RUG2 4WVMA 2C4XA 1UNBA 5B1NA 1BJQA 5E6HA 3JSLA 1QU0A 4JI6B 3FX3A 3LEIA 3AL6A 2CTRA 2FMLA 1KFUL 1BKZA 5F5AA 3UO2A 4LKFA 4IGGA 2HEVF 3O7OA 3OPZA 1HNZB 2BBAA 1N1VA 4YJ3B 2NPIA 3O1OA 2DDUA 4LXLA 4GT1A 2Y0IA 4PIYA 3WNMA 3RPQA 4CDQA 1BBT2 5CBGA 2WKKA 4DS0A 1HNZO 4Q4V1 1W8TA 5C6CA 3S7EA 4BPZA 1NA1A 1POQA 1QJX3 1UN1A 4I0XB 1W8UA 2PLV3 4NHLA 2PF4E 3WR0A 2QUOA 1W8HA 1NCQC 1SCSA 5J7MA 5F32A 4D7TA 5FZ3A 2B42B 5GZEA 3L2YA 2D3RA 3V0BA 1XHZA 4H44B 2HWC3 2Q0OC 4XCBA 2D3PA 4LKSA 2UY9A 3MDSA 5CZKA 1PX4A 2Z42A 2QJ1A 4IEQA 4H13B 3RWKX 3FMGA 4HG6B 2YXHA 4YFWA 2FCUA 3WW4A 4MXWB 1JJ2U 2JXAA 4CDQC 2AGAA 3OY8B 1LAJA 3T2MA 5JOWA 2XJPA 1OF4A 1GQHA 4I4TA 3AP4A 3FB5C 5BNOC 4NOTA 1FNZA 1QQP3 3ZN4A 5FYZA 3K77A 1JYCA 1GZTA 3T30A 3ZN5A 3UNPA 4I30A 4FXKB 1DQ0A 3ZYIB 4DR7O 1B35B 5JVVA 3BYWA 1SETA 4P08A 3ZHSA 1SPPA 5JSPA 4DUZO 1OOPB 1E5RA 2XT9A 3B8NA 1NAEA 5DAPA 1ZNPA 4ZPIA 3OT7A 1AP5A 3D36C 2ARBA 2JK5C 5DG1A 3I59A 4MO3M 4QU1A 2A1XA 1VQ5V 2PZSA 2ZD9A 2UXCB 1DGRN 5LA1A 1W9YA 4XQ4A 1O9HA 1PVC1 4P5HA 1W6MB 4EWDA 5DM6V 5LL6Y 4JZRA 1CJDA 2QQOA 4XDQA 1VE0A 3C3VA 2J1TA 4PHZA 1YNAA 1WPBA 4PD4F 4AAPA 1Y74A 1IURA 1JBCA 3THTA 1M90W 2WZR1 1ZRDA 3EJKA 3K04A 3DKQA 2XUEA 3CXCU 5DQ0A 2DBNA 4XJWA 2J1EA 2DJVA 3ZBHA 3OGJA 4LF6B 3ABZA 3AXEA 1D7PM 3BIWE 5BR8B 5KXBA 3KSCA 3LA2A 5FPXA 1BQZA 3C8XA 2FKXA 2XVLA 3AG1B 3JASB 1SA0B 3LF7A 4CDXA 1OQ1A 2HWB2 1F5FA 4FXGB 3GYDA 1AR73 3POEA 4FPGA 4HXCA 4JAVA 3KQ4B 4NXMB 2D6KA 2R073 1HJFA 4JX0A 4B3NA 5JOXA 2BSKB 2XASA 2GZWA 2DVAA 3VKMA 1F23A 3OR7C 3LUTB 2FZ2A 4NJ4A 2I45A 4AFAA 3CHXA 1OCCC 4DPNA 5A32B 4Q4V2 3U11A 5F37A 2AW9A 1ZBA2 1LGBA 1QHDA 4IGPA 1V6MA 2Q9LA 4GAZA 1GYKA 1NU1H 4ISRA 5GLZA 4GWIA 5KA5A 3SLIA 4Y1ZA 3JCZA 5C9AA 1JXNA 2OYQA 1PHMA 4UCRA 1S55A 1LOFA 1F31A 2W52A 1Y76B 4DXZA 4NAOA 3VDDB 4E4DX 4XZPA 1GBGA 4CPBA 1XOYA 5FZ8A 5IK7A 4I50A 3ZPOA 3QBQA 2BBVA 4QHZA 1YQ2A 4ONUA 1UOFA 5KHIA 2CDPA 4PI0A 3O9OA 2QE7G 2NN4A 5FBJA 4AVVA 3VD5A 2R72A 2DTWA 3UYJA 4YJ3A 2CWSA 2WA3A 5I0TA 3BTXA 4Y1YA 5ABJC 3UJOA 4QX3A 3H7YA 1KB9F 5FLHA 1COV1 1O91A 1PGL2 1U96A 4B3TO 1CAXA 1I08A 5CBLA 3PU3A 3WDTA 3ZRSA 1GM9A 2ZBJA 2YI9A 4CTEA 1LOGA 3RYKA 5C9AC 2XQRA 1HNWO 1AR72 1E5SA 3S57A 1JODA 2O8OA 3IAPA 1S4CA 4AVAA 1MMMA 4GCZA 3WG3A 3JAWB 3RZLA 2QTOA 5LY1A 4QB1A 1QLEC 2KQXA 3A22A 1J83A 3WLUA 5JCTA 3PTRB 1K5QA 2CU5A 4FK5C 1AVBA 4Y4YA 2WR9A 2UWAA 1AYM3 2LS6A 3H42B 4LBMA 4S2FA 2W95A 2LTNA 3TXSA 4PLMA 2EILB 4WFFA 1DGWX 4MV2A 4JYCA 1GOGA 4OZXA 2ZMNA 4L8QA 1Y9GA 2DWEC 4MS2A 1CN1A 1OCOC 5IJ9A 3OUHA 4E4ZA 5A3UA 1JCHA 2JD9A 1MPXA 4LO4B 4CH4A 3O1SA 2A7AA 4HOOA 3CX5F 5K1XA 4RGGA 3V0AB 4CS4A 4OLLA 1VQLV 3AC0A 2XWJB 3I3MA 1OJHA 2ZTNA 1WCUA 4MW8A 3JALA 5B3SC 3ZYHA 1YTFB 1NCRC 4XF3A 5FP3A 4COWA 5A7OA 5BMVA 1OOPC 4DV3B 1GOFA 1PL0A 3LSDA 4YRDA 5AC92 2ZHMA 2EJRA 1MZ5A 5FY1A 3A7QA 1AR82 3BTAA 5LMUO 4ZXEA 1RC6A 1Z7S2 5KAIZ 3K9AA 2O0OA 1SEFA 4F6EA 4MGSA 1E5IA 2IXKA 4ABMA 2PI5A 3KZ4C 2EIBA 1Q8QA 3BB6A 4EN9B 1M57C 2YPDA 2HWC2 3BTZA 4MH0E 3WG7C 1RUH1 3GWKC 3RI8A 1W8ZA 1QXPA 3VBFB 5EHDA 4FP2A 3EXAA 3AMQA 5CNAA 4DY5A 1XE0A 3ES4A 1SBDA 1C28A 5FMOS 1JOPA 4N43C 2VOVA 2W0XA 3POIA 3N4MA 1AJKA 3B93A 5B1BB 4H3WA 4L92A 2D6MA 4BK4A 3MIFA 4LNUA 1NY71 3VBFC 5B1AB 2BFUL 4DQAA 4MZUA 4S2GA 4PJYA 2J42A 4TWKA 2ITCC 4AHZA 4XETA 4YY3B 4OMDA 4RAIA 3E8GA 2QZ2A 5ISLA 1OHFA 3O1PA 3N35A 1R1ZA 2P6JA 4AQ2A 1KQRA 3QO8A 2R042 2Y60A 2DQ3A 2GNMA 1OCOB 1R093 3L9DA 4LKDA 2HR3A 2JX9A 1CX1A 1TVGA 2YXLA 4NWWA 1FX5A 5GLUA 1NE4A 4KI5M 4WVVA 1BCCH 1GM8A 3CCQV 1YJWV 2FDKA 3OTOO 1ZBE3 5JZGC 3PVEA 2ZEZA 3UT0A 1P7GA 3RMYA 3JALB 4XIKA 2JKBA 1BHBA 1RXGA 2IVIB 4RYDA 4MTGA 5LBFA 4ZKIA 2D44A 2VBBA 4HETA 5CKMA 1S0EA 4P9IA 3FWEA 3E5XA 2R70A 5CEHA 3KV6A 5FZLA 3AVSA 4OI4A 2JDAA 3KQRA 2VS0A 3VB9A 3L72H 3WP6A 2WAAA 1PX3A 2P6HA 4B3SB 4K8FA 1VBE2 4CUAA 5C8CC 4NTYA 1X50A 5LHGA 2WC2A 4NIAA 5DUXA 1RPOA 5FPBA 4YIOA 4OHZA 5H9CA 4X62B 5LBQA 4QPWA 2F93B 4MXVA 3IM0A 1S5HC 5T5OA 1UFIA 5FYIA 1ULDA 1SERA 1ZBA1 2XOKG 3UESA 5FXVA 1N32O 5BNQA 2F4LA 1JMUB 5FY7A 2WNUB 3FYIB 1BL8A 4N7IA 1ND2C 4CYDA 5C9AB 4XQDA 1Q8VA 1QJU1 4MTFA 3QNEA 1WW6A 4NIHA 4CDXB 1RUNA 2VOKA 1XNQO 2A3QA 3JAKB 2QQLA 1LJ7A 4B29A 1N3PA 1SZXA 1V70A 3ZFGC 2WWWA 1R3LC 4DV1B 3RYPA 4JKMA 3E35A 2RR12 4M01A 3JCUZ 2P34A 4Z82A 2MPFA 1RP3B 3X2QC 3UM7A 4DXWA 1W06A 2PYLA 4LUKA 2KM2A 1UX7A 1RUG3 1ZREA 1VRH1 3CRRA 2JDPA 2VCBA 1XOUA 1CGPA 2GNTA 2VZ1A 1UY4A 4H55A 3B8MA 5EJ1B 4N43B 3AYAA 4V1PA 4P9GA 2KSDA 2YUEA 3LKJA 2OCHA 2IC1A 4XDPA 3INAA 3KD4A 4CE8A 2VNGA 2YFZA 4AI8A 3CIHA 3ZYJB 3B4SA 3SPGA 1MS5A 2QWOB 1F5JA 2WFF3 5C33A 3FAVA 5FY0A 3LDEA 1KECA 1CWPA 4XFIA 4A7YA 3WFVA 1WMXA 1WD3A 4DRVA 3M7MX 2QQVA 4N21A 5GTHZ 2RS11 4BXSV 1D0GA 2DQ0A 2WS91 2WINB 3H0OA 3U0ZA 1FJGO 2RMU1 3NNFA 2W94A 1KITA 3ASNB 1POV1 2K1EA 1O5LA 4YVSA 1VBC3 5DECA 2VMFA 5FZOA 3AXDA 4A7ZA 2JG9A 5FZHA 5DN6G 4JYBA 5IYCO 2E7TA 5L3DA 1W6OA 1OLQA 5FKCA 2ZZJA 5BV6A 1BLZA 1BS3A 2RJLA 1WA4A 1J59A 4MUVA 4A7KA 3C7FA 1IXBA 4OXSA 3AP9A 4AL9A 3M3QA 4GLXA 2I07B 5CFCB 1FXKC 2ZMKA 1ULFA 2IH1C 4DZGA 3DEMA 1MS8A 4HAMA 3P5BA 4LF4B 1VB2A 5JI9A 3AB0A 1REFA 1I3HA 4LA2A 1TUBA 5FK7A 5JVDB 4ARXA 1VIWB 1AR93 1XHXA 4UOJA 5FXZA 1NI8A 1AX1A 4HVQA 4Y5SA 1FFTB 4W4KA 2GMEA 4X1YB 2D5FA 4NRQA 2P6CA 4XFCA 1BMV2 3CRAA 3KG2A 4MADA 3JAKA 1EAH1 2RDSA 5FPUA 1D4M1 1QEXA 2PYTA 2GSMB 1MS1A 4CPBD 1YC61 2OPKA 3EVKA 5AVPA 5C5UA 1GUIA 2PHRA 3WP5A 2E32A 4CDXC 3USSA 2ZMLA 4YG6A 1ZBE1 5J9PC 1HLCA 1ND3C 4QAWA 5LP6B 4DXRA 2VQUA 2LRPA 1PNKA 1W8OA 2GNDA 2AUYA 3LSUA 5FV3A 1DZRA 4JV5B 2D6LX 2JDZA 3SITA 3AP5A 1KD7A 4WFEA 3CE2A 3ZXFA 2FZ1A 1N1YA 2WL1A 2BW8A 1H0BA 4BLJA 2QKSA 4JI7B 1H2KA 3WB1A 4A3XA 1NX9A 5I93A 1JOBA 5J48A 2JECA 4TYSA 1PIV3 1QR8A 1X7NA 3BA8A 3PMSA 2Z5WA 4XXAA 5LHIA 3FKSG 4FLYA 1GR3A 3BEHA 3G80A 4O4HA 5IJRA 2K0GA 2PMWB 3CQOA 1RUD1 5EIBD 1Y7BA 5DAXA 2G4IA 3OTFA 4CDQB 5CBFA 2DVDA 3HR0A 2Q69A 5C93A 2WN3A 2I74A 2IXCA 4U36A 4CEWC 2RDQA 3HN3A 1B04A 5C8YB 3SMHA 3HVDA 3LPFA 2EIEA 1FOD3 4A45A 3KGLA 1L7QA 1PM9A 1MABG 3PUSA 4NO4A 1QLNA 2OCCB 4FO9A 1Q43A 4JC1A 5IYZB 1UOJA 3B94A 4Q4X2 3DKWA 5F3GA 1CZSA 3BPSA 3J7HA 1C1FA 4B3TB 4ZU4A 3ZO0B 1VQ6V 5E79Z 1LGNA 4RA0A 4GJZA 4NR1A 2VQAA 3RJRA 2G9GA 1EBOA 1BGYH 1ZX5A 3OD4A 5FZGA 5CIRA 4JAAA 1PO11 4AXOA 2XR4A 1D2DA 4HL0A 1OV9A 5CVRA 4CZZA 1YJKA 2WWSA 3I2OA 2WQZC 2VTFA 3PDQA 3TN93 1ASJ3 4NRPA 1MQTB 4DR5B 1HDJA 3H1MA 4JI8B 3FJSA 2JIGA 4D7SA 1KJRA 2AZ5A 4UFHA 4DV5O 1BBT1 1RUC3 4C1XA 3ABLB 1VLNA 4RQPB 3V0AA 1LHWA 1E79G 3BI3A 4HKOA 4L87A 4FQ4A 2WYSA 1V6KA 3D3QA 2CYFA 2W1SA 4EKWA 4XILA 1ENRA 3PTYA 5LWBA 5CA1B 4WFGA 4ZIBA 1SCRA 4Y24A 5B4XA 2B1GA 3APBA 1AYN2 2XLFA 1HJGA 1WP8A 5BY5A 3OE7G 2DE0X 1SESA 3WXPA 4PLNA 3T4VA 2HHHO 3DF0A 1NZIA 4L99A 3WUDA 3ZYPA 1EP0A 1F7YA 3BTYA 2HG5C 1W8WA 1W6NB 4FQZA 3H1IH 1C8M2 1YQ8A 2DMXA 1WLEA 1PGSA 1RUOA 1DQ6A 2WQ8A 2VQFB 5FTTC 3P3NA 3SDLA 4FVVA 4IEUA 4AI3A 3EQEA 3E2EA 2R041 4H7LA 3ON7A 1BEV3 1Y67A 2BTQB 4AVSA 3AJZA 5KX5B 1W0KG 3PVOA 3CCLV 1N1SA 4ZBMA 1EFRG 4O9EA 3WDXA 1IS4A 5FZ7A 2HVJC 1H8TC 4COZA 5D8AA 4X64O 4FLWA 4LF7O 5K4LA 3F5WC 3SPIA 4OHYA 5JLVA 1J95A 2X6BA 4M3CB 1JYTA 3E22B 1AL21 1HN1A 2B39A 2LGQA 1XL4A 1MQTC 1WW7A 3B7MA 2HWF1 4IL7A 3TN92 5F5CA 2IXLA 1G6NA 1AJPA 2SLIA 2ZAHA 4JGZC 3U75A 3WF3A 5FO7B 3ETEA 4I4TB 2YMZA 5B4NA 2GAUA 1US6A 5C8CB 1WA6X 4OFGA 4FLTA 2HP8A 5J2UA 1WKYA 3ENRA 4LCUC 1QJY2 1V9PA 5FZ0A 4LFCB 5T5LA 3J80N 3CCVV 4IYIA 1OC1A 4OQ9A 3VZKA 4KWLA 4WM7B 2EIMC 5A3WA 3CRMA 5B5EZ 2IU0A 2ZPXA 5FRAA 1SLBA 2V1DA 5L7OC 5C8WA 2XOMA 1BYHA 2YPJA 4QGMA 1SLCA 3CEIA 2VZPA 4FTBA 4GX1A 3WDYA 2W91A 2B5UA 2YC0A 4LJHA 3K4AA 1CAWA 1Q3EA 4JGYB 2QWPB 4H0LB 4YXWG 1JR9A 1KC8W 2CHHA 2Q5ZA 1V0AA 5LA9A 4CCCA 1U5IA 1HW7A 4UB8Z 4IXLA 1VQ9V 1LRHA 1FXKA 4N8MA 1KBHA 3J4UH 1H6YA 5GM0A 1CIWA 2Y8KA 3LA3A 3D8CA 2LM3A 2WNVC 5T5JA 1YYNA 1MEC1 1TAEA 1FT9A 1NLQA 1E57A 1LCLA 2QCSB 1KP3A 2XAQA 1Q5OA 3B9IA 3E5UA 4A6SA 4E8DA 1XL6A 4LLFA 3GBGA 2CE4A 2FMYA 3ABUA 4AFBA 4J7KA 4CH3A 4UW5A 1N1TA 4Q1PA 1YXBA 4N23A 3OCPA 5A3NA 5D8AB 2GC0A 4AZZA 2V5YA 3NAPB 3AG3C 4QGPA 3ILRA 1C5IA 4KU7A 1S0JA 1VP7A 3ZCCA 4LFAO 4A2UA 5KXDA 1H8EG 3UGFA 4I3PA 1H2GA 3J7NA 1HV1A 4KH9A 1GK9A 1C1LA 1WW4A 2F4VO 3TEXA 4LPLA 1T6GC 1XSQA 1DHKB 3H9VA 3OTOB 2PLV2 1VQOV 1BZWA 2BTVC 2R30A 4XZUG 2V73A 2VUCA 3RGBA 3RVZA 2YS8A 3K5NA 1YI9A 3CZJA 2HBUA 1P49A 2Y6JA 1SQXH 4YY3O 5LGTA 4XHBA 4G28B 4BDVB 1COWG 4JYAO 3T1YB 4FFFA 3L75H 4CU6A 3ZFGA 4H2AA 3OM3B 4AQSA 3AVRA 4CC6A 3VBFA 5A2QN 3M3OA 3USUB 4WBNA 1IGOA 3Q8BA 4E8CA 4WBBA 4CP9B 2QTWB 4O7XA 2QWQB 4X1YA 4TQFA 4QKBA 3I97A 3IBMA 3PJQA 2KB1A 4FAGA 3S5AA 1J58A 2RJKA 2Y69C 4HN0A 1RHI2 1K3IA 1QKQA 4OUSA 2GMPA 4AILC 3K58A 5HBAA 4GIQA 1HWYA 1O8SA 4QKFA 2EIKC 3J8F1 4O2AB 1W6PB 3D6EA 2Q8EA 4AHYA 3NNMA 2RM22 1O4ZA 1PGL1 1GSLA 4XJUA 3T1HB 2WN2A 2X05A 4R4ZA 3OB8A 2XVGA 4Q4W1 4PA3A 1HQWA 1NXMA 2PXJA 1YWKA 4JZGA 2F4PA 2JEUA 3LAGA 2P1BA 1PNGA 4I3GA 3F7YC 2ES3A 3UKTA 2VMCA 2X53S 5CG9A 1GZ9A 1WGPA 3OPTA 4IE6A 2Z79A 4Z8BA 3AK2A 3APQA 4IDZA 4LO8A 2HWF3 1X8MA 2VMIA 3A0KA 1K8AW 4LBEC 3FLRA 2ETEA 3D0SA 1MS3A 3I2IA 4WVMB 1GLHA 4MGKE 2ZGQA 1RUI3 1RSOB 2RR13 4XUNA 1K45A 4ZU5A 1HXS1 2RDRA 4DR5O 5EV7A 3CYOA 4GKKB 1SLTA 1OT5A 5KC5A 2PAEA 3K5OA 2ZIMA 1LTEA 2Y6GA 4P5YA 1SBEA 2XAGA 2W6IG 3VQYA 3RYCA 4MSVA 2HWE1 4K3UA 3JD0A 3K0GA 5F39A 3AEIA 3VZMA 2P5BA 1K9MW 3IB3A 4XJAA 4GD4A 1YI7A 1LR5A 2V4AA 4YM2A 4BK5A 2QE3A 5T3NA 4EFBA 1JHJA 2XLAA 1LHUA 1ULPA 2OTJV 4N9HA 1JS9A 2RM21 1KGYA 3HWJA 2V7QG 3S0MA 1M57B 1NVPB 4KUMA 4YARA 4BQ1A 3SCHA 4IV1B 4MTOA 1CZVA 1GAXA 3FUOA 3GJAA 4QXHA 1CAUA 1QJX2 1VRBA 1MR5A 4UW6A 3NXSA 3IDAA 5BNOB 2D3SA 4XQWA 4BWAA 2CH7A 1C8M1 4N90A 3CO2A 4WF9V 3KMHA 4DUZB 1R082 5B3SB 4GWNA 4CEYB 3UKNA 1CP9A 3LSSA 1ZRRA 5DAQA 1QY4A 3VBHA 3J8F2 5FP9A 4C1WA 4LBQD 3DC6A 2D40A 3CCSV 3R6SA 1JUHA 4Q0PA 4AGVA 2ZGLA 2AC1A 1KDMA 1PGW2 3O0WA 4I9WA 1RJ7A 1OCZB 1OFNA 2NP0A 3AZYA 1EZVH 4BHPA 4XFFA 3LD8A 1W28A 1AYM1 2FDIA 2WLMA 4DW0A 1NH2B 1B3QA 3O5SA 2WLIA 1DLCA 2Z5UA 1MG1A 4LIUA 4KG8A 3Q4HA 2HLEA 4QKDA 4QPJA 4E2SA 1BZKA 3EFFK 3PLQA 4TUYB 5KA6A 1UZZA 5LBBA 4JI3B 5KHGA 4AEJA 1K5JA 3DUIA 5IY5B 1W90A 2E7QA 3OBAA 3H1LH 4YFZA 3U07A 3VBHC 5C5TA 3H1HH 3HNYM 3BIEA 2JG9B 2R32A 1LUVA 1QDOA 2W1WA 2CSGA 1YVWA 4UW3A 2JB4A 4WV8A 4CC5A 3ZHVA 3SPJA 3RT3C 2FQPA 3HR9A 5LBEA 3OF1A 5CBHA 2HH9A 3K75B 2KD7A 5A9GA 1AI6A 5HV4A 1AJOA 1MZFA 2EA7A 4U7OA 2A7WA 3M3IA 4JI5B 2YHJA 1NKGA 5FZIA 4CUBA 4F4LA 2QGNA 1L7LA 3A0HZ 2FBEA 2G19A 1RVF2 4Q0VA 3ZMSA 3N9LA 4DMIA 3J9SA 1Y3TA 1GN6A 1RUJ1 5CA6A 2W46A 1NG0A 4QPGA 4AAXA 3J8F3 4UCOA 2VGDA 1NTKH 4GALA 3AG2B 4IV1A 3STLC 3H1YA 5CA3A 5DZEA 4I01A 3NR7A 3ZSLA 5IHRA 4MVMA 4K3AA 5H6QA 2UU8A 3GNEA 4FOVA 2GC2A 3OEEG 4D6TH 1SMVA 4RHV2 4NE9A 2QZ3A 2Q6AA 3LFIA 3MIEA 3UKMA 2OWOA 5JSOA 2PHFA 1WLDA 4DR3O 1ZZ7A 1A32A 1AYN1 1UXZA 4AYUA 3N7JA 5HCHA 2P4EA 1QJY1 5AFEA 3OEBA 1GN3A 4LFBB 3JBG2 4DV0B 1DDLA 3KT1A 2BVBA 3HKDB 5L19A 4CCEA 1BVP1 3ASOC 5ITZA 2UYBA 5IVYA 1NCRB 3WDVA 4JGYC 3VHOA 4GZ9A 4QQOA 4CRQA 1ALYA 1F4MA 3FB6C 4JRAA 3VD9A 5J2TA 3NKGA 1W39A 2CGOA 2VVEA 3WW1A 3J26N 1CZTA 1JFFA 3VL8A 3WQ7A 4LC1A 1UIJA 2YDEA 3MF9A 5FCCA 4HZ3A 4LUMA 2XJVA 1AX0A 2H6BA 1OCZC 3I7DA 2EILC 4DR7B 2R9IA 5BPXA 4DR4B 1FKAO 5CADA 3THPA 3BKZA 2X6CA 1IPSA 5FPAA 5DG2A 3MPPG 2HEYF 2HVKC 4Q5OA 3CC2V 3OBRA 2F95B 5A3PA 5FJKA 2PHLA 5JMCA 4FPOB 4CUGA 4L2NA 1Q7YW 2EZOA 1OLRA 3WCSA 2RS12 4Q4Y3 4BB3A 1AL22 4JTDB 4KP4A 3HIFA 1V6IA 3E83A 2BJSA 3KB5A 3DV8A 2ITDC 1OURA 3VDDC 2NLRA 2AGSA 5FZMA 5CMUA 5A3LA 1I5YA 1EV13 5BNNA 2R061 5K8SA 2BP6A 1RYYA 4DY3A 3I2KA 2WLHA 3T1HO 2DYRC 2DVFA 4HANA 2ZGSA 3BVCA 1HNWB 2Z4FA 3V64A 2PGGA 2E26A 3O0VA 3WW2A 2JDNA 1P7BA 3ACFA 1WA8B 3FE5A 4AHXA 5FNVB 4YM1A 3VBRC 3BOWA 5C7GA 2WLLA 2DURA 3I2DA 4PV1B 4YNIA 4OPAA 3GZTB 2YB7A 1TNFA 4Q27A 4P9XA 1HNXO 4C8DA 1Z78A 2WNVB 2VVDA 1MSDA 3CCEV 1X4TA 1LEDA 3WQ1A 5CFDA 2P90A 3ELNA 4OGQB 3JBG1 3POYA 3NAPA 1CAVB 5FYMA 3E6DA 3VQWA 2WDBA 4QE9A 1ZBA3 3ZRWA 1EUTA 3SPHA 1UZ0A 1IBLO 3M70A 4ICGA 5KC6A 2HEWF 2GDFA 2HKOA 3FLTA 5IVVA 4ISQA 3TJTA 1UF2C 4LBQA 2V5DA 4OQ8A 5IK4A 1EM1A 1W0OA 4MVTA 3DPRB 1W0PA 3CC7V 2CAVA 4DUVA 4YW4A 4I2OA 3POSA 1V6LA 1AB3A 3R4SA 3BY6A 1PK6B 5F9TA 3ILNA 5ERLA 5EZWA 1S2KA 2ORXA 2GC3A 3JD71 2ZT9B 2RVAA 5LZ6A 3C7GA 4E2QA 1HP8A 2EZPA 3IDCB 5L3BA 2ZR3A 2BOCC 3RVYA 2YSUB 5L7OA 4Q8LA 2A6WA 5T52A 3FHQA 3SISA 1BQPA 2ZGOA 1L1FA 3WV6A 1I5PA 1WB8A 2H8PC 4FP3A 3KM5A 3RJ2X 3T0DA 4ATEA 2RN9A 5LK5A 4HVOA 4GXLA 1JN2P 2KA3A 3E1F1 1HN0A 2ARCA 1QJY3 5DPNA 2C5DA 1RUD2 2A71A 4X64B 3JD3A 1G86A 4META 4UVCA 5HXMA 3S30A 3LEGA 3WF1A 3DTUB 3NJVA 4FOWA 5EJZB 1CESA 3KS7A 3LE0A 1QLEB 2ZJCA 5KMGA 3K5MA 4DV3O 1FJGB 2IFWA 5C8YA 3TXQA 1LOBA 2VC9A 3ZFEA 2RHPA 4FFBA 2UY8A 4JF3A 3VQXA 3JD72 3SKVA 4ZS3A 3SYOA 3ICXA 2YBKA 2PHDA 2PQQA 3KKYA 5F2WA 1AP6A 3I59B 3WF0A 2FL4A 2Y0OA 4PDMA 2UWCA 4Q8KA 3ABKC 1OOPA 3EMRA 1OLMA 4OI1A 2GUZB 5IW0A 1TUEB 3DXRA 4TSVA 2VD7A 5D21A 4IT5A 4QM8A 1BMV1 1RUE3 5GJ6A 4HBNA 2QDOA 4BE3A 4GH4C 3VBUA 5IAXA 2XHNA 3ABTA 3D0JA 4J9YB 1SFNA 1LULA 3PUHA 3ZXKA 1WMEA 2HWC1 1H4HA 1ZLZA 4Y22B 4P9YA 4J9ZB 4MG2A 1RVF3 3GXUA 4BOWA 2UXCO 3V65A 1F4AA 4LORA 4ZOLA 1N4CA 2NMOA 3OEAA 1VALA 3WNNA 5BUVA 1K42A 4JI7O 2P4VA 1POV0 4AHWA 2JIJA 1RITA 2DWDC 3ZHRA 5C3RA 4Q0QA 2E7AA 3WVJA 5A6YA 1CPMA 1GANA 2CAZC 1XNBA 3SH5A 1IPJA 2DUOA 2EICA 2BEOA 1W2NA 3HPLC 2XHKA 2NMNA 4COYA 1W2BU 4LF9B 4IUGA 2W08A 4IHJA 1PO21 4F83A 4YZ3A 2VZQA 1HRI1 2H3OA 3O14A 3WB0A 2QQKA 1O7FA 3ZSEA 3ZYFA 5K1PA 3KCYA 1RGSA 4QHBA 3IPVA 2G9ZA 4YGDA 2XNDG 1O3SA 1SG3A 2ZDIA 3SHRA 4GJYA 2GBOA 5CFCC 3NV4A 3CS5A 5A1LA 1KRIA 1BHAA 2JS5A 3O0XA 5DN2A 4AG4A 4MT8A 4DV4O 5L9RA 4KGGA 1S77D 3H01A 2W39A 4U3JB 4DV2O 4AI2A 5FL7G 2DUQA 4BYYA 2W68A 4OHXA 5F2VO 1G6UA 2MNGA 3WU2Z 4N53C 2D97A 4P9LA 2YIBD 1GZWB 1OXCA 1S0BA 3V0BB 1AZDA 1XUQA 5L36A 2E9QA 4X66B 1QJEA 2RG4A 2F66C 4XMAA 3VZJA 3TEWA 1QWRA 1ENVA 5KUKA 4C0HA 5LK7B 1K3EA 3GCWA 5FXXA 1MVQA 4FPEA 4CCNA 4P02B 1FAYA 4HNAB 4EB6B 2OZJA 3OBZA 1AR71 4QDSA 1ODNA 2RNBA 4RWUA 2OA2A 3AMMA 1XNKA 3CJIC 5LEJA 4DV6B 2CV6A 4LF6O 1JZ2A 4NIDA 4KG0A 2E63A 2JIZG 5DEDA 5DZGA 5CA0A 2JEXA 1W2TA 4Y26A 3JAWA 2XKOA 2IJHA 2XVKA 1QR9A 5L73A 5LP6A 1F15A 1MQTA 1YI2V 2Y4UA 2F43G 3DECA 5B2GB 5IVCA 2ZE8A 3TEZA 1OLME 4DW1A 1MZ6A 4JKLA 3F7VC 4CDWB 3TGUH 4ASLA 3FUQA 2ADDA 4YM0A 1R081 1PKXA 1VIBA
chains in the Genus database with same CATH topology
4WVWA 4M2EA 4M00A 2ZHKA 2RS11 3PNAA 1D0GA 2VVFA 4D7YA 2WS91 4UBGA 2WINB 3H0OA 3U0ZA 2WFPA 3QOPA 2RMU1 2DUPA 1KITA 2QVSB 1ASJ2 4QQLA 3VBUB 1DGRA 4KWKA 1POV1 1O5LA 4RQPC 4YVSA 3WHUA 4K1ZA 5GZFA 1VBC3 4R8HA 4FOYA 1RHI1 3AXDA 4A7ZA 3ST7A 2JG9A 1IS5A 1KXGA 3OGGA 1HX6A 4XFAA 3RMXA 4IEZA 5FPZA 2E7TA 4AVCA 3R4UA 2HWD1 1W6OA 4UW4A 4J5IA 3AZXA 1VBE1 1OLQA 2ZZJA 4YM3A 3KT7A 3OY8A 3VKLA 3H7JA 5BV6A 1TEIA 4M23A 4CP1A 3ALQA 2RJLA 1WA4A 3NWKA 2NQYA 5EYYA 1J59A 4MUVA 4ES9A 3GBWA 4C90A 4QPIC 4A7KA 3DL3A 2R063 3AP9A 3M3QA 1FOD1 4QPIB 3X29B 1I5ZA 2I07B 5CFCB 5AFBA 2ZMKA 1ULFA 3MGUA 4DZGA 1UMZA 5K9YA 3ZSJA 1MS8A 3LOBA 1AR63 2QNKA 4QXKA 2ZGTA 2RE9A 4X8PA 5LEKA 4BMEA 1VB2A 5JI9A 1LOAA 2RS31 3AB0A 5EXOA 1REFA 5DZFA 2R072 1I3HA 4LA2A 1DG6A 3CJXA 3D82A 4J1XA 1VIWB 1AR93 2WNVA 1FV2A 4IEOA 1LOFC 4AI1A 2JJ6A 1AX1A 4HVQA 1W6NA 1WLWA 1GZWA 4TWTA 1J1LA 2GMEA 2A6YA 2D5FA 4F7ZA 1PNFA 4BA6A 4NHKA 3PVJA 3JBG3 4XFCA 1HXS2 1Z0HA 1BMV2 4PDWB 3NAPC 4K9SA 1WCKA 5CU1A 3VZOA 3AK0A 2WNUA 2ZGKA 2WBOA 1EAH1 1TMF3 1D4M1 1LECA 2PYTA 1RTVA 4EN6B 3ZXEA 1MS1A 1N47A 5JIUA 4GMP1 1UL9A 4LLOA 3HT1A 2OPKA 1XE8A 3FBYA 2Z69A 5GALA 2D6PA 5AVPA 3WOGA 4N43A 1OQDA 2B46X 1ONAA 3MZHA 1U5XA 2PHRA 3WP5A 2DCJA 1GICA 1X36A 3USSA 4CDXC 4PF5A 2ZMLA 4YG6A 3BOPA 1ND3B 1ZBE1 5HXVA 3A4UA 1HLCA 2DWRA 4DOUA 3ZFFA 1RUI2 2P17A 1ND3C 2YXSA 5KXEA 2D98A 3BPZA 5DDJ3 2P3JA 4HN1A 4IV3C 4R9AA 1URXA 1VAKA 5JOYA 1NCQA 2JEMA 2GNDA 2AUYA 4AEMA 1SLIA 1DZRA 2TUNA 1FPN3 3ME2A 1XU2A 2D6LX 2JDZA 5IT6A 4B4QA 4GH4B 3EATX 2XG3A 4P9WA 1VB4A 1HDKA 1WBFA 3SITA 2ET1A 1H30A 3AP5A 1MEC2 3RWNA 2GALA 2XUMA 2CGNA 4Y0EA 1KD7A 2C1FA 2RS32 3ZX7A 4M0NA 5D8AC 3ZXFA 4XFHA 2FZ1A 3GBFA 1N1YA 2WL1A 1PM7A 2D6NA 4ZXKA 1OFSA 2BW8A 2F6BA 1QMJA 1H0BA 2ZA9A 5J98B 4BLJA 5T50A 3NV3A 3AKQA 4IESA 5E8AA 1HRV1 4JGYA 1EV11 1YIFA 1REDA 1H2KA 4XMIA 3TNQA 4A3XA 5ACA3 5EJ3A 2WS93 2ZGPA 1YXWA 2WT1A 2ATFA 5I93A 2P3IA 5J48A 2JECA 1VBA1 1VZ4A 4TYSA 4HT1T 2WNEA 1PIV3 3M1HA 1X7NA 1RUF1 4Y20A 5DUVA 1DRYA 2ZKLA 1YO8A 2A6VA 2Z5WA 3ECQA 3PMSA 4L11A 4XF4A 3ZFGB 4XXAA 1DQ1A 5CB7A 1V9U2 2ZHNA 4TLFA 1GR3A 4LHNA 3IDEA 1DS0A 1VBC1 2K0GA 2R0HA 3ES1A 3WHTA 2D6OX 3QH6A 4AQTA 4YZ2A 1RUD1 5GZCA 1Y7BA 4YG0A 2G4IA 3OTFA 4JTOA 5EYXA 1QXJA 4MGIE 3VBHB 3G7DA 1NYWA 4CDQB 3WCRA 2DVDA 5F6LB 4D94A 2AREA 3AP7A 3HMYA 1OIHA 3LA7A 4LBLA 4CEYC 1PMIA 3CEWA 5GLTA 2I74A <