1H2KA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/inhibitor
molecule keywords FACTOR INHIBITING HIF1
total genus 105
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2kA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2kA01
1H2MA 4Z1VA 4AI8A 4B7KA 2WA3A 3KCXA 5JWPA 1YCIA 4QU2A 4BIOA 2YC0A 3OD4A 1H2LA 2YDEA 3D8CA 2CGOA 2W0XA 2ILMA 2CGNA 3P3PA 1H2KA 3P3NA 4B7EA 4JAAA 1MZEA 2XUMA 1IZ3A 4Z2WA 1H2NA 2Y0IA 1MZFA 3KCYA 2WA4A 4NR1A
chains in the Genus database with same CATH superfamily
5L9BA 2R061 1IPKA 1VQ4V 1VBB1 1YQ5A 5JCTA 3BY6A 3CNAA 3RDIA 3ZRWA 1WD3A 1AR5A 3VBUA 1CZTA 1NLQA 3VDDB 5JXIA 4BWAA 2VW0A 3O7OA 4BISA 3SH5A 2LO1A 3TN91 5JJEB 2BFUL 3AKQA 2ZGRA 2AEZA 4XTPA 4XXAA 5FYSA 1SESA 1SBFA 1PK6A 3JBG2 2YROA 3VD9A 4BLJA 3RZLA 2UUCO 1HNZB 4DK1A 2ZPXA 2CDOA 2PHUA 2GAUA 1D2DA 4JDNA 1W2OA 2RJLA 5C70A 5LZ6A 1M9NA 4INDA 3RSJA 1ND3B 4FFBA 1UPIA 2RVAA 4ZONA 3PU8A 4MVOA 3H8UA 3LA2A 5KBFA 5LWBA 3OTOO 1EBOA 5LK5A 3ZFEB 1MZ6A 2GNMA 3TN92 4X64B 2HR3A 5DAXA 1L7RA 1Y9GA 3PIJA 5F3EA 3WG7B 1A6CA 1V6KA 1ZZCA 4UCRA 2PXJA 2X29A 2ETNA 1YJKA 1Q3EA 1IQDC 5IVVA 2ZINA 2DFBA 4YZ1A 1EV11 3ZM8A 2GC3A 2D2CB 3K48A 4DY3A 1UYXA 5FP8A 1OLRA 5FZDA 1PKXA 3LIHA 5I8YA 4P9JA 4Q0SA 4H7LA 4ATEA 1WNSA 1S5JA 3FB8C 1HNWO 4BXSV 1IG0A 2NMNA 1JR9A 3LDDA 2DVDA 3H8OA 1HRI1 2IZWA 3I49A 1QJU3 3G6JB 4CE8A 5IE9A 2UU9O 2RR11 1UXXX 3VBHA 4Q4X2 4H2AA 4Q0QA 3LZZA 4MTOA 4WVVA 1R6TA 2VTXA 5I0TA 3J81N 3DXUA 3S6PA 2A79B 2XQXA 4DV7O 3ZRSA 1ZZ7A 4LO4B 4ZHQA 3BB6A 1Q81W 3CB2A 5E1AC 2OKXA 4CDUA 1DYKA 1NVPD 3MIHA 3CP1A 4TLFA 1MPXA 2YICA 1DZTA 3ELNA 4Q4W3 1TMF1 1JJOA 5IFTA 4YIOA 1LHOA 3T2MA 2VOVA 4FPPA 1VQ6V 1AR1B 4LQRA 1BLZA 2ATKC 2BCCH 2B9UA 3ILRA 1SDWA 4NKGB 1AX1A 4CEYB 1AYM3 1SDDB 3USUB 1QVFU 1BL8A 1MACA 1COV3 5TISZ 2LGQA 1W0OA 1BZKA 1GWMA 4MHUA 3WW2A 1J84A 3J8F1 1IS3A 4PQQA 2OYZA 1X36A 4JGZC 1W8OA 2J1SA 4IGOA 3P1IA 3SEPA 3UJQA 3JUUA 3TBDA 2WSVA 4DUZO 1H9WA 1AR73 1UOJA 4JI7B 1RUE2 1A8MA 2DF7A 1Y66A 3LOBA 2UURA 1A8DA 1UY2A 3OGVA 4JKLA 1ZREA 4YFZA 4HT1T 5IAXA 1MS5A 1G9DA 1WCUA 1LR1A 1LCLA 2VNVA 3WP6A 2OX0A 2VCCA 4JI8O 5GLVA 2WBKA 4Z92B 3BYWA 1VBC1 2C1FA 3VZMA 5FYHA 2IC1A 5A6XA 3NV1A 4IEZA 4RSUA 3CZUA 3K9AA 3U1XA 5FUNA 3J80N 5CFDB 1OI6A 1QEXA 3E5XA 2W5FA 3O1RA 3AKTA 2JE9A 1NCRC 3VKNA 4UAPA 1KDKA 2I2SA 4IE5A 3ABMB 4ZU7A 5C4WA 2FCTA 2K1EA 1KJRA 4DOUA 1CAVA 2WLJA 4CEYA 4ZOLA 1LHUA 1CPYA 1YRZA 1MMMA 2ZTNA 3QG5A 2ODMA 4GA9A 2GN7A 4K8RB 4E9KA 4MTFA 2LW8A 4WFFA 5F6KA 5M0TA 2KB1A 2RN9A 2H6BA 1S0DA 1N3PA 3LDRA 3G6BA 1ZUQA 2OIEA 4YHHB 1ULOA 1M57C 2GDFA 2Q0OC 1YO8A 4MADA 2OZ6A 1MS9A 4NXNO 1H2LA 3PUQA 4WBNB 5DDJ2 2QEXV 4MLOA 5JR2A 4BJ0A 2UXDB 3LNMB 5LP6C 1NA1A 3D3AA 1JYCA 4EJRA 2VMDA 1JHNA 5LBFA 5FXWA 3Q4HB 2CDYA 2IW5A 4X1IA 3HKDB 3KV4A 4LF4O 5T54A 4LHSA 2PHXA 1RVF2 1Q8IA 1JI6A 4B29A 1I94O 3VBSA 2Q4PA 2VJXA 2FCUA 5F2WA 1MQTA 3VZLA 1J5EB 2E7TA 3BUCA 1I9RA 5ITZA 4G4FA 1KECA 2EIMB 5GLTA 1I5ZA 3FN9A 3HN1A 4Q6GA 3PLQA 3JATB 3NRUA 3U78A 1XL6A 3BKZA 2WN2A 3ZFEC 4JI1O 5LB6A 2XNDG 2LFRA 2M7WA 2R32A 3A8TA 4AVTA 1RUF2 3AMHA 3VDAA 4PA3A 5BNPC 2IFWA 4PI0A 4HLTA 4WVMB 2FZ1A 2HWD2 5LBQA 1ODNA 1ENXA 5JMCA 1QIQA 4QKNA 3ACIA 1SLTA 1XNTA 3R0RA 4YFWA 1SC5B 2UUBO 2Z79A 1UYZA 1GZWB 4O65A 1M93A 3FD9A 4XBFA 2BYVE 3K3OA 3CQOA 3OFNG 5B3SC 2P22C 5L7OA 2UUAO 5EJ1B 2HJIA 3ZX6A 2EICA 2EJ7A 1WP8A 1AJPA 2LGWA 1S77D 1B06A 4DV4B 4DRXB 2X10A 3ROUA 3ES4A 4YJ2B 1Q8PA 5FYVA 4GYCB 1ODMA 2D43A 2DYSB 2WS92 3RZJA 4BQ2A 5JJNB 2DQ0A 3OMIB 3P3NA 1PZ8A 2ADPA 2XHNA 4CSWA 3GJBA 5A7NA 1NCRA 1I7FA 1Y6XA 1IBLB 2A6WA 3JD71 4CZSA 2NYYA 1S5HC 4CUBA 5JH7B 4MUVA 1DYOA 1SQBH 1TMF2 4GMP0 2CGOA 1NYWA 2JKXA 4RUFA 3F7YC 3MPBA 3ZEDA 2VO5A 4V1PA 1WW6A 1DIWA 1VF7A 3ZYGA 2VCMA 4XXPA 1COV2 2Q8CA 2FDFA 2EVXA 1JYNA 4GWJA 4G9SB 3OR6C 2PUSA 3BAAA 3TXQA 2BTOA 4KUMA 3PHMA 5I0RA 4S2HA 3UO3A 5FZIA 2A75A 4TOIA 3JBG3 4RFT0 3EXUA 2WPDG 5BNNB 1IBKO 3CJHB 4K3UA 4CYDA 4E2SA 2GTAA 4AEKA 5LL6Y 2FB5A 2LTNA 1SKVA 2RS52 4OHWA 1BBT2 5JVVA 5A33B 2C6SA 1UNBA 2A3QA 1Y67A 2L9LA 2NQYA 4Q0PA 2IUWA 1NUKA 2WS91 5CVRA 2EIMC 4GWNA 2JX9A 3UT5B 3HT2A 3JARB 3ZDSA 5C9AB 3GXUA 3ECQA 4JGYA 3J7LA 5JOYA 4XBNA 2D6NA 3QVNA 2XAHA 3AG2C 4LC1A 3CCEV 1DGRA 1JJ2U 3F2ZA 1AR92 2D3PA 5B4NA 2HJFC 5J1XA 4RQFA 5EIBC 1D4M1 4HVRA 3NSTA 1RUI1 3T1HB 3V0BB 2E76B 1GP6A 4OXSA 4FPKA 3QOPA 1PX3A 2D5FA 4XDKA 3NW4A 4XJ9A 4YVWB 5IATA 1WLDA 4LITA 2QA4V 3D36A 4GX1A 1YIPA 2XJVA 1XE8A 2QBXA 5TSWA 4FFIA 5JR7B 2JB8A 3LPGA 2QQLA 2RDSA 4Q26A 3ALQA 2OIGA 1VQOV 3T1YB 3A0KA 2RMKB 3JBG1 2EIDA 4YG3A 2GMEA 4IHJA 3W58A 1A78A 4WVWA 3USSA 3QO8A 1YFUA 2F43G 3HNYM 1HDJA 4GB31 2A3WA 2Y4TA 4JI5B 2YIBD 1S76D 1JBCA 1VBB2 3OG2A 1G9BA 4UCVA 1FOD1 4U7NA 1MS3A 3BPZA 2P6HA 3AG2B 1AZDA 3ZXEA 4IEWA 1OFSA 2FMDA 4AG4A 2Q8EA 2PELA 4R9BA 2LW1A 4YW4A 2VMEA 5C33A 2YGLA 3ACLA 3L2HA 3SJQC 3GWKC 3EXAA 4H44B 1KD7A 2ID4A 1GV9A 2AYHA 2BEOA 3VBRC 4KGGA 2E7QA 4DXSA 4IERA 1ZZBA 1G9AA 3NV2A 1PGL2 1UJWB 1UZWA 1QOOA 4CEWC 3FUQA 5L3FA 2JWPA 1AXKA 1ENQA 4FM2A 3FB7C 2E53A 5IT6A 1OXCA 4IGQA 3UM7A 5K7PA 2NLRA 2YV8A 4TV9B 1OQDA 2HVKC 2BOIA 5EYYA 4BWOA 2AREA 3VHNA 2MK3A 1GH6A 4CP1A 4KNCA 2J42A 1US2A 1IS6A 4I2OA 2B39A 1YTFD 1ST8A 2OTLV 4O4HA 4JYAO 3VHRA 1WB7A 1FATA 3ZBHA 2Y64A 2VCBA 1LNSA 2HLEA 3CZJA 1ASJ1 1NH2D 1C8M1 4FPYA 5IT9N 2KM2A 2HWC1 1TZOA 3ZSLA 3JAWB 1XUQA 4BIOA 4YGEA 3O1UA 1FMD2 1CN1A 3FAVB 1QKQA 2Y38A 4FPCA 2IVIB 4NIIA 5AFBA 3JAKA 1XMQO 2QKAA 3F5TA 1O9GA 1ZRDA 1PO11 4MXVA 4O2BA 4LE4A 1JZ8A 4LBQA 1QJX2 2Y26A 5J98B 4HK8A 1K5JA 3JXSA 1RFYA 4TT3G 1REEA 5FP4A 1W6QA 3DKQA 5C3OA 1Y9MA 4MO3M 4E2QA 2HEVF 1I94B 3MICA 4COYA 2IXLA 3I56V 3WINE 2XPJA 4LFBB 5K4LA 1SLLA 1RP3B 5KMGA 5J96B 3NAPA 3NJZA 1F5JA 1Y4WA 2GC1A 4F6RB 1CX4A 4TV8B 2IH1C 5LBEA 1K5MA 4WCEV 4TUYA 3HKCA 3NL1A 3VQVA 2ZXQA 4JI8B 3M8AA 2XR4A 1Q90D 4QB2A 3LEKA 1K3EA 2PYTA 2WA4A 2XJSA 2WA3A 1K45A 2HEYF 5L9VA 4X1KA 5C9AA 1V6JA 4I55B 1H8TB 4IT5A 4BU2A 4CCOA 5DAWA 1JOJA 1BXHA 3KV6A 1PO12 2AH2A 1GZ9A 2CWMA 2E26A 1XPWA 5E1RA 4ZKTB 1YUDA 4N8MA 3OPZA 2A0LA 1XNKA 1POV3 4GH4C 2Y69C 3TYJA 4JAAA 5ITZB 4TSFG 1CESA 2EX3A 4X62O 1TNFA 3FZ3A 1V54C 4O2AA 1K33A 4Q4X1 3ZMSA 2D5HA 1PVC3 4L99A 1S3JA 3DXTA 3EQEA 1O4TA 4DV2B 1I0HA 3VL8A 3AG1C 3POSA 4OHZA 4DR4B 3CBNA 3WDXA 2WJSA 3ZMTA 5BPXA 4COVA 4IEPA 1LNQA 1ZAUA 3DL3A 4Q29A 4BMEA 1BVP1 1PZ9A 1HJGA 3OY8A 3BCWA 3AVSA 4B8EA 3MIEA 1W05A 5HV0A 1OH3A 2VXRA 2P37A 3ZFGB 2DBIA 3UYJA 1CIYA 1RUC2 5FZCA 1THZA 1F4AA 4MGQA 5BYNA 3G80A 5IYZB 2ZAAA 3FBYA 3FWEA 4LTAA 4QXKA 1W8TA 5GONB 3OEHG 4G3YC 4MVTA 5FMOS 2E33A 4L9BA 3D82A 1ND2C 4X6QB 2A1XA 4XURA 3WP5A 5CBHA 1HX6A 5FL7G 5FNVB 4J9ZB 1L7LA 2EIKB 1OOPA 3O1OA 3KF5A 2QM4A 2YPJA 1CX1A 4JRAA 1JA8A 1G1XB 5FPUA 3MLKA 1NZ6A 5KLVH 2PQSA 1W3XA 1JHJA 2WAOA 3WDVA 3WQ1A 5HI0A 4AR2A 5B2GB 2ZGPA 3RYFA 2ZDIA 3M3CA 2VZSA 4RS5A 2DDUA 1FFTB 1PNKA 3POBA 4YYOA 3VD7A 4JPRA 2C9KA 2QDNA 3E89A 1FXKB 1OMIA 1VLNA 2RCVA 1BEV3 5FYBA 1PVC2 2Z0AA 2PHDA 1PD3A 3ZYBA 4QNHB 2NPIA 5DZFA 4B3TO 4QM8A 1YFWA 1OV9A 5FPBA 3BODA 1YVWA 1S1AA 1NBMG 1XHZA 4UV9A 1RHI3 1D2SA 2V7QG 3EMRA 2A6VA 5IJ9B 4RR3C 4FLVA 5FZ0A 5C8YA 2N74A 4TV8A 4HKWA 1WCKA 3B3QE 2JDKA 4FXGB 2X6BA 2PYLA 4CCEA 1C3HA 4Q4Y1 4BLIA 5DABA 1WA8B 2F17A 4GKJB 3RYHB 1NKDA 4QX5A 2G9FA 2NMOA 1NH2B 4AEJA 5B66Z 1KP3A 4CXXA 3N9MA 2MHFA 1VBA1 1X82A 3RGBA 1AJNA 4E8DA 5CBLA 4FM0A 4CP9A 2QQWA 5AVAA 3ZXDA 1M4UA 5B3SB 3IM0A 3JCIA 4CDXC 4AI2A 2VH9A 3RZMA 2B5UA 4RQPA 2BOBC 4GAZA 5GALA 2K0GA 5FY5A 5C93A 2VVEA 4DXTA 4FAGA 3CHXA 3LSSA 4LEJA 2GP3A 4HL0A 3ZKUA 1H2SB 5F5QA 4MGYE 4NOTA 1OH4A 3PTRB 2QQNA 2V73A 3WB2A 3KT4A 3J26N 1GQGA 1KGYA 4W6YA 4JI0B 3LSDA 3INAA 3MBWA 5LHHA 1H2MA 2DCJA 4MGSA 4ZHNA 2I45A 3ZJZA 1W6MA 5IWFA 3T1HO 1G86A 2WAAA 4QT6A 3SYOA 4DR4O 1V6MA 3MI8A 2WO3A 3WOGA 4TV9A 3RT3C 2JDAA 1GTOA 3O9OA 4XFCA 4JYCA 3E8BA 2UWCA 1GWLA 5FLJA 1W0PA 4XF1A 4LF5O 3BOPA 4E4HA 1OKQA 4XJWA 1C8NA 4JV5O 5FZ1A 4A4AA 2D7FA 2VQUA 2UXXA 1JZ3A 2UXBB 5BMVA 1A3KA 1TNRA 2WRAA 1K12A 2WLQA 4M00A 1WWYA 1RPRA 2RQ6A 1RIRA 3I59A 4IEOA 3SKJE 1GOGA 2JRIA 3OAAG 2IH3C 2Y34A 4AZZA 1UQXA 1LECA 4FFGA 4Q0VA 5LA6B 3OEAA 4XMIA 2ZEWA 4FPEA 3RJ2X 4I0AA 1JZ6A 3WT3A 1L7QA 2TNFA 3KLSA 4OUEA 1BGYH 3FJSA 1VQNV 4YY3B 1RYYA 3RVYA 4OZOA 4DV3B 3JD1A 4LKFA 3IC7A 4QB1A 3UGFA 3ZMNA 3ORJA 4CU9A 3CC2V 3M2MA 1ZRIA 2YBSA 4GT1A 1Q43A 4CCCA 4FPFA 1H2NA 4LBNA 3CRQA 3SKVA 4J11A 1VQPV 1CJDA 2P17A 2QE7G 1RJ7A 1Y4MA 2C0ZA 2LFSA 3MW4A 3PMEA 4QQ2A 1U5YA 1IS4A 4AXOA 2JIJA 1WCSA 5I0SA 5JVDA 4ONUA 3TJTA 2F4VB 4CS2A 3VKFC 1TQ5A 1LR5A 4XFBA 1FNYA 2Y6LA 3CCSV 4RR3A 4AFMA 1NA1B 4TTGA 3K51A 1F23A 3PVOA 4GKYA 4JYBA 4CH6A 2GNDA 2ARHA 5FYMA 1WA6X 2LQTA 2EIBA 1IDSA 2R9AA 2RS31 2QWQB 3AG1B 4CDQA 4C1XA 2VRZA 2TBVA 4IGPA 2HHHO 2DE0X 2OYQA 2BWAA 1XI1A 2RS32 1HNZO 4PF1A 3OMAB 1YHQV 5FYYA 4LORA 4W6XA 4IGGA 2H0BA 1QXJA 1R1BA 2BDRA 5LW9A 3BI3A 3O1TA 4XHBA 3AKPA 4JYYA 2NM1A 3QH6A 1UOGA 3N9OA 1TVGA 3MHZA 4E4DX 4DV5O 4GMP1 4RGGA 3SGIA 3FLTA 1Q8VA 5JIAA 3T4VA 1W8NA 1SBEA 1W90A 3POGA 1AYN1 4NUBA 1FYJA 4LLOA 4ZZ5A 1ZZ9A 4GZ9A 2QTWB 2W1WA 4LT5A 1G8MA 1R1A3 3V0AA 4QDQA 2JEUA 2Q1ZB 2XH6A 4PT6A 2HWF3 3N4MA 1FMD3 5EYXA 3E6CC 4UXNA 3AZYA 5BV6A 1XE0A 1BBT3 2R043 3PURA 4OX9B 4J25A 2A3XA 1SG3A 4Q8LA 1MQTB 1QH6A 5H9SA 1I1EA 1TG7A 4XUOA 4XIOA 1RUC3 1QXPA 3FFZA 1NVPB 1GWKA 3H0OA 5K0UB 3C2UA 4D7SA 1FXVA 1PM7A 2ZEXA 2F95B 1OBNA 5JVDB 3T1MA 4JDOA 2ZBJA 3Q8BA 5J3UA 3V0BA 4BQYA 2XQRA 1R1A1 4DV4O 1DGWX 2CUGA 1PGSA 3ABLB 2GTSA 1S55A 1SFYA 2JE8A 5J2UA 5A1FA 1GAXA 5CB4B 1HNWB 3PVBB 3E83A 1FNZA 3STLC 2IWGB 4JGYB 2P5BA 3VBHB 5F8PA 5JXJA 1N1YA 4L2NA 5ANQA 4NPLA 4I02A 1LJ7A 2ZE5A 4URAA 1I6XA 2W94A 1MQTC 2WLKA 4BOWA 4EE2A 1NZCA 1Q5OA 4Z8BA 4AQYO 3OEEG 1W3VA 4LP8A 3VD5A 2DQ3A 4MW3A 4OQ8A 1VQMV 5EWSA 3IN9A 4TWTA 1EYBA 5LMUB 1X8EA 2Z5UA 5EHDA 3OT7A 1HRI2 1MSWD 1QDCA 4AHWA 4ZU4A 4DV2O 1Z7S3 2RDCA 2QQOA 3ETQA 4A7YA 2Y6GA 2Q67A 2WWSA 2ZE7A 2ZQMA 4UW4A 3WG1A 2Y48A 4FM1A 3CWBH 3ZHRA 2GSMB 3PUIA 4UF0A 4M3CB 2H8PC 4XJZA 4BW9A 4LOTA 2ADQB 2BBAA 2ZX1A 1QBZA 3DCQA 4R4ZA 2O8OA 2XAJA 4CCLA 4Q4Y2 5ABJC 1SMVA 4WFAV 1Z0HA 2YHJA 1Q6UA 1R083 4R4XA 1VF6C 4YG6A 5T5PA 5LCWL 1UZYA 4I9WA 4HK9A 4ASUG 2FD8A 1HWYA 2W87A 4UFZA 1DF4A 4BH9A 4N9HA 4Q27A 5J09A 1WN7A 1SQVH 1IX9A 2VZ1A 4HMZA 3AYCA 4H55A 4BYYA 3VLBB 2H94A 5CB7A 3CSXA 4P9XA 5FBJA 2A06H 3S3WA 3VBBA 4WM7C 3RI8A 3CCLV 4WFBV 4QU1A 2W6JG 3PJSK 1SZTA 2LJ2A 4LULA 5FCCA 5G04L 4MVRA 2ZCEA 4P9LA 4FQ4A 2BNMA 1Z5VA 1OVSA 1CAVB 5KXEA 1IPSA 1H2KA 1WA8A 2HG5C 2XXZA 2FCVA 5F39A 4R6ZA 4QHBA 4N7IA 5FDBA 2O8QA 3ZVXA 1JPXA 1H0BA 1UZ0A 5A9GA 1MEC3 1QNWA 3WSOA 5FP9A 1SQPH 1XBFA 1K92A 1ZBE3 1OKOA 3OUFA 1MG1A 5FPRA 3FFQA 4X62B 2VQAA 2YMZA 3UETA 3O0WA 3WDTA 3OGIB 2HJDA 5FMCA 2JDHA 1H1AA 4A7KA 1RUC1 4XQWA 1DBNA 3WY6A 4QKBA 3MUZ1 4WFEA 1RM1C 4JI1B 3K04A 1M1KW 4I09A 1REDA 5FP3A 2KD7A 4H33A 3ZOIA 4UB8Z 2VMHA 1ZL8A 4C0BA 1KKDA 2P5OA 4DUYO 4I30A 5ACA3 1Y74A 3JALA 2ORXA 1SQGA 4DV1B 1JW6A 2Q6AA 5L36A 1OCCC 2JK5C 2V4AA 4PQ9A 5DQ0A 3S5QA 3B77A 1UKRA 4LF8B 4I7ZB 4Y22B 3DUIA 3CMAV 2J1UA 4KU7A 2A73B 2FZ2A 4A6SA 2GU9A 2X8KA 1G6UA 3NKTA 4BW5A 5A6ZA 3WLUA 1BYHA 4QGPA 3KZIZ 1K5SA 2GBOA 3DTUB 3JD3A 3DYOA 1UW8A 4TZDA 1BSMA 2YS8A 2Q0AA 1NLRA 2HWE2 2P4EA 1RXGA 4NXNB 1AR81 5FZEA 1VB2A 5ABJA 1DGLA 1NTZH 4IE4A 1FFXA 5D8AC 1YQ2A 2X09A 5B1BB 3OGRA 4LFCB 4CPBD 5L73A 2XB6C 3K08A 4GKJO 4LF4B 4MGKE 1C1LA 4ZI7B 3MF9A 5LRRA 4DR6B 1GN2A 3CCJV 5FZKA 2G9GA 4KXRA 1KBHA 4YG0A 4JQTA 3KCXA 3MDPA 2R7EB 2WAMA 1GK9A 1U12A 3KT7A 4QIWF 3RBZA 4CDXA 2JG8A 4HZ3A 1OA2A 1WLTA 4R52A 1NJIW 1CD3G 3MIFA 5T5LA 4ICGA 2WLIB 3GWOA 1EPWA 4IV1B 1W39A 2EXHA 1VMHA 1N32B 1UOBA 2YGMA 2E3CA 1NR7A 2KG7B 1AR82 4E4EA 2HWD1 4K8FA 1SEFA 2YC4A 1TVKB 1HB4A 3K46A 1N33B 1WKYA 2VXJA 1DQ5A 1Q8OA 3F5WC 4QPYA 2R6QA 5LGTA 1VBD3 2SLIA 1PP9H 4GX0A 2ZIOA 2O0OA 1VBD1 4HKOA 2E63A 3RG0A 1UX6A 1IZ3A 5BXXA 4NRQA 1H8VA 4LUMA 4RA0A 5C6CA 1W6NB 1U0AA 2ZX3A 4YSFA 1WMDA 4PA7A 2DOSA 2GZWA 4CP2A 5CB4A 4P9OA 1XOUA 1OLMA 1QR8A 1QJZA 5H6QA 3K0GA 3ILNA 3UT0A 5IVYA 1NTMH 3PTYA 1VR3A 3O1PA 3DKWA 3OE7G 4D0QA 3VUOA 1RVF1 1W2UA 5CA6A 2W52A 3ZIAG 3B2EE 4Z2AA 3BRCA 2EZOA 2P34A 2ZGNA 3SJAC 4OYUA 3VKOA 1CGPA 4EB6B 5GLZA 4E4ZA 4WM7B 3ACFA 5LXTB 4LLFA 4XYXA 1N34O 4PIXA 2VOTA 4COZA 4NVPA 2E31A 4DEQA 2VGDA 4OPAA 2AHZA 1WW7A 1RUJ3 1RUOA 4F7ZA 4WF9V 1JN2P 4PELA 1H2GA 1FOD2 1RVF3 3BIEA 5F1RA 4U3FH 1PL4A 4H37A 5CA1A 1Q82W 4OULA 5JAXA 1MNGA 3SEEA 1C28A 1SCSA 2CNAA 4OPHA 1NQJA 2WLLA 4XF4A 2WZR1 3RW0A 1I3HA 3HKBB 4P02B 3APBA 4XIKA 5JI9A 1B35B 3FUOA 3I55V 1P7BA 2VQEO 1E79G 4JZ2A 2FDJA 3THPA 3M3QA 1XB9A 1NAEA 4GWIA 4J80A 3BN6A 3AYEA 3WVJA 4FPJA 3F7VC 3VBOB 2VMCA 5T5JA 4ZBMA 4XDLA 1H8TC 1OD5A 4RGAA 3L2YA 3KWVA 4CDUC 4LF8O 3SR2C 3DYMA 4NTXA 1DGWA 4N43C 5FUPA 1R3JC 4GULA 3RYFB 5FQ0A 4N53B 3SPHA 4YW2A 3N9LA 3B8MA 5A3PA 1PK6B 2GC2A 5A3WA 1BQ0A 2G9ZA 2BP6A 2GALA 2PI5A 2Y6JA 4MHRA 4ARYA 4DR5B 1WP7A 3QLQA 2F4PA 2RS13 1QJY3 1F5FA 2RS51 5HCAA 4CC5A 3ZR5A 2CSGA 1ULGA 1VQ7V 3ZMVA 1W9FA 1KS4A 4Y1ZA 4EWAA 4ET7A 4BIUA 4OI4A 4BPZA 2JDNA 4QXBA 4YW5A 5FMOL 3JQXA 1H6XA 2BSKA 3CU7A 1Q8SA 5JXHA 4KMQA 4P5YA 2HYKA 5HFMA 4LHNA 3B01A 1PX4A 1XU2A 2XONA 4PBOA 1RGSA 5FJHA 4CXWA 3N27A 1VB4A 4MYEA 1T6GC 2C24A 1GMMA 2BGCA 1DQ0A 4LH7A 2ZE8A 2PHWA 3MW3A 4L0PA 2J1VA 1A34A 1QQCA 1LGNA 3ZHVA 4META 1RUE3 1PIV3 1XNAA 2DVBA 4KBBA 1MVEA 3NAPC 2M6YA 3VQYA 1WMFA 1OPMA 3JD72 4WVMA 2ZHLA 3E2EA 3IIAA 2BWCA 5BMVB 1O8SA 3LFIA 2NN8A 4FLXA 3LGRA 4UFIA 2ARBA 1LTEA 4BQ1A 1JU4A 4CBCA 4ITCA 1YDXA 1CR7A 3FLPA 2CY6A 4ZS3A 5F37A 3LQCA 1JOPA 2JIZG 3JQWA 1R1A2 4F6RA 3N2GA 1HNXO 4A3XA 1H1MA 1POV1 2FQPA 5LEKA 1F2NA 5J37A 1FAYA 3DGTA 1TME1 4XTMA 4MVZA 4WFGA 3ZYJB 1QHTA 2JG9B 2PAMA 1KU9A 4AFCA 3S0MA 4N43B 5BR8B 4XCAA 3K79A 2DYRB 1KMIZ 1JYTA 3EHBB 2FKXA 3CXHF 3UKMA 1AXYA 1ZM1A 1CAWA 4N23A 4TQFA 1V6LA 2V72A 3KD4A 2O1QA 2W47A 2BW8A 3THCA 4M3CF 5A3MA 2B7YA 2CV6A 2ATFA 2VTXJ 2BV4A 5CA3A 1S0JA 3D0JA 3N7MA 3Q4HA 2AACA 5CISA 1BHBA 2D3OW 4D6SA 5EQUA 3KKYA 4K9SA 3WG7C 3T1YO 2RS33 4XFHA 3EHKA 2OW4A 5CMUA 2HWC2 5GM0A 4CP9B 4NYKA 4Y20A 4UW3A 1NXD1 5A32B 1S0BA 4KG8A 3DC6A 2PI4A 2YEVB 4UFHA 1HIXA 4OI1A 1LHVA 1OCOB 1W03A 3T0BA 2UYAA 2XVKA 3WW3A 4CA9A 5JWPA 1HR0B 2PQQA 5FZBA 2WKKA 3RQ0A 1X4TA 1GZWA 4XDJA 3EYPA 3TNQA 4EV0A 5BNPA 3OUIA 3H1WA 2XTAA 5I91A 4DXWA 2XOMA 2DURA 4Y33A 5KHKA 1W6NA 2EAKA 1BT8A 4HAMA 1MVQA 3BU0A 2KR2A 2XUEA 4CTEA 5EJ3A 4YW6A 2D40A 3PU3A 4CZZA 3JALB 4UCSA 2ZEYA 1YWKA 4XUNA 4IXLA 3C8XA 5C7GA 1T5EA 4QX8A 4O4HB 1QWRA 1R64A 3HR0A 5EK0A 2J22A 4P30A 1VRBA 4F6EA 2RMU2 1LOFC 4LPLA 4IV1A 1FPN1 2Q7EA 3SJCC 2OQ6A 3J7NA 5ANNA 4UCUA 5L3EA 1GR3A 2OVUA 2VE1A 4YM2A 4F8AA 4Y26A 3Q8FA 3VZKA 1UZZA 3O0XA 4PJ0Z 4JC1A 4TQDA 4YNIA 1K4DC 1W0NA 2CGNA 3NMBA 4JX0A 3PVEA 1YQCA 3ME2A 2ZGOA 5A7SA 1RHI1 2DTYA 3K9SA 3OJBA 2ENRA 3THDA 4LKEA 3EVKA 2X05A 2PHLA 1H9PA 3VZJA 1MZEA 3CMEV 3STZC 1PK6C 2CTPA 2J7MA 2LRPA 4LFCO 3J7HA 1POQA 2Q8OA 4JGSA 1O3SA 4YGCA 5KAFZ 4DFSA 4L92A 5IFPA 2X53S 2F23A 5JSRA 1VPHA 1RUE1 3VDDA 4ZXKA 4EN7B 5FZFA 1VRH3 4NIHA 2PYJA 3H3LA 1GZCA 2F6BA 5IAVA 2RDRA 4TWKA 4PA6A 1W0KG 2VMGA 3ZRXA 2AHYA 3U37A 2QE3A 1L0NH 1YZBA 4ZY9A 5I0UA 5A1LA 1NE6A 4P9YA 1PNLA 1LUVA 2BU9A 4QPIA 3JAWA 2GMMA 3OD0A 5FYTA 2ZHMA 3POWA 3UESA 3P3PA 1RPOA 3CCQV 3M70A 4AOCA 1R6KA 5KHJA 3E22B 2P3KA 3ZN6B 2XAGA 2X6AA 1DU3D 4CCDA 4TXWA 1NCQB 4AI1A 3QTCA 3RYCA 4ZU5A 4S2DA 4AFDA 1XBLA 5FLIA 1K5MC 2YFUA 4J7KA 3WFVA 1XSRA 1W0JG 4L11A 3AJYA 4I4TA 3AM2A 4RD7A 1NCQA 2QDRA 4P00B 5KX5B 5LMNB 2D6OX 3O14A 4DR1O 2VBBA 2QM7A 2HWF2 5CEHA 5F32A 4KU8A 4C1WA 2KKWA 4PDWB 3WV6A 5FREA 5JXGA 4AGVA 1QJU2 4KHPB 3NV4A 3AP5A 3K58A 2ZXWB 4GQ7A 2D6LX 2BOJA 4UW5A 4I0WB 4R50A 4DW1A 5KC6A 5LA9A 1RXFA 5FZ3A 4O4JA 2OTJV 2RG4A 1XMQB 1HQLA 2ZGLA 4IEYA 3VBSC 3GB7C 1YQ8A 1I5XA 1DF0A 1L8DA 1LGCA 1W6OB 2QKDA 4JV5B 2W2IA 1P84F 3AYDA 2Q8DA 5LATA 3SPCA 3ETGA 1FV3A 5AG2A 3AP6A 3OPTA 3C90A 4UFKA 4FLTA 1OCOC 2GP5A 4CRQA 3RVHA 3K06A 1D0HA 1XYPA 1V9PA 1GSLA 4WZFA 4L8JA 4TSVA 3UV9A 2DCYA 3A0RA 4XILA 3B00A 2I07B 3ETEA 2XL7A 5EBMC 4URTA 4W50A 3GALA 3POIA 4RGKA 1RUF1 2Y0IA 3JYCA 3H3UA 3W59A 4CCMA 1BCCH 3U11A 1YF2A 3E6DA 3WDWA 3HR9A 1YXBA 2A71A 5FXVA 5FZHA 4CCNA 3R66A 3ZHUA 1IKPA 4X65B 3ZN4A 4AEDC 3UKTA 3VZNA 4XABA 4BXFA 1DK1A 3LDEA 5DEDA 4XDOA 3ZDVA 1OA3A 1SQ4A 3FC0A 3LDBA 4X20B 3PUAA 4TN7A 4K6BA 3VKMA 5KXCA 4JTOA 4XJ8A 1BK1A 5IK8A 4DR7O 1XRUA 5LMUO 4PLMA 1IQAA 3J7MA 4EN6B 2XWBB 4QU2A 4UVAA 3FHIB 2N7GA 3D8CA 3ASOC 1Z5WA 2BVVA 1O6UA 4UWDA 4FTSA 3M3IA 2NN4A 3ZX7A 4QE9A 2VS0A 2ZGQA 5FIXA 5B1AC 2R16A 3RYIB 1GYKA 3NAPB 1LAJA 4XF9A 2VECA 1N3OA 3CXCU 4FLWA 2VZ3A 4W4LA 1N33O 1VRH2 4MX3A 1J5EO 3SXWA 1FAFA 3VBSB 4N53C 1WUVA 2XLAA 2KQXA 2GSYA 1QLEB 1PNGA 2VW1A 4HVQA 1LU1A 1HNXB 3H1HH 3WNNA 3K4AA 1ULEA 2DTWA 5E89A 2ZGUA 2P6CA 3UK9A 1V6IA 1QU0A 4O4LA 1W6PB 2RV9A 1LOAA 5C4WB 1H30A 1X8MA 2CH7A 3GZUC 5H5NA 4EZ4A 5LOVA 3DC5A 2B8MA 3C7HA 3SPGA 4YHHO 4XBLA 4D6QA 2HBTA 4NAMA 5JQGA 5FY1A 2VZOA 4G2KA 2EILB 4AHZA 2B4KA 4DR2B 5FZOB 2IU0A 5ISLA 1ULDA 1M06G 3GCWA 3WNXA 3WG3A 4LK6A 1DFQA 1B04A 4DO2A 4FLUA 3WG4A 4NHKA 2PN5A 3AK3A 1UF2C 5IVCA 3JCUZ 3SHRA 2ZDIC 3AG3C 4IUGA 2AXTZ 3MAQA 2ZNIA 3I2OA 2R073 3WNKA 2FTKA 2E9QA 4LE3A 5FOJB 4B08A 1CP9A 2P3IA 5CG9A 3WW4A 5JCOA 4MSWC 2YXYA 1TME3 3U4SA 5F5IA 1ZSPA 4BB3A 2L35A 4PDLA 5FOBB 1W04A 2JDPA 1W59A 4IIJB 2JDIG 4X20A 2OA2A 3MLLA 3KQ4B 2HEPA 2V5DA 1OC1A 4WBBA 3B94A 1RUI3 5DZGA 3O1VA 3B69A 1KUQA 4NIDA 3L74H 3WZ1A 2VOKA 2C9AA 2IXCA 4N90A 3LE0A 2X7RB 5JSPA 2RMU3 4JV4A 2ERFA 2AUYA 1OT5A 4I01A 1VALA 1QU7A 1C8M2 5DUXA 5L3CA 2QDOA 1ND3C 5LHIA 1AHSA 1QOTA 4IHJB 3B5LB 4LBEC 5CG8A 4LF7B 1B3QA 5LXTA 4CS4A 2DJVA 3WHTA 5IJ0A 1LEMA 3VBUB 4X1YB 2K46A 2A6XA 5JH7A 2RR12 2ZMKA 1W9TA 4DV0O 3RZZA 2HWE3 4NR1A 5C3QA 4JDMA 1YI9A 4LR4A 2UU9B 1RUD1 5JOXA 4QWNA 3JAKB 1FPN2 2XAQA 5FZMA 3HPLC 4XF0A 2JIGA 2A7WA 1UY0A 4IL6Z 4PIZA 4XQDA 4RYDA 4YJ2A 4BIZA 1W9WA 4ZXEA 2FDKA 4HG6B 1PGL1 3OY8B 4JQRA 2JEXA 5BZBA 5KA6A 3BEHA 1BEV2 2LS6A 3AYAA 2QQMA 4KI5M 2GMPA 5C8WA 4N53A 2BZDA 2HLDG 1SLBA 1AROP 4PDWC 3ZN1A 3V56A 4B1LA 4XUQA 2VU9A 1SF9A 2RJZA 4YVWC 1WJZA 1H6YA 3VD4A 3ZYRA 1F7YA 3EJKA 3OR7C 1RITA 2EIEA 3I3DA 2WNVC 1UYPA 3MIDA 3A21A 4D7YA 2G4IA 1YTFB 2W3JA 3I59B 2QJ1A 1LOCA 3K5MA 4FOVA 4GB32 3U4XA 3SITA 1HRI3 5G05L 1D0GA 3DSQA 3S57A 1QQP3 4UUJC 4UFLA 1BMV2 4HKLA 1E5SA 3IDBB 4ATFA 1QDOA 1WMXA 3K75B 3WR0A 5CFCC 2ZGKA 3R65A 1LODA 5FK8A 2Q68A 5KHGA 2W1UA 4X1KB 5LY2A 5BNOA 3HOBA 4Q0UA 1FXZA 1D4M2 5AC93 1VBC2 3THOA 5JQGB 4B3MB 5FZOA 4QDRA 2ZX0A 2X0LA 1NQTA 3ASOB 2RR13 4O61A 1U96A 4W4KA 1RUI2 4NPRA 2FMLA 2MEV3 4AL9A 1AVMA 3TNPB 1OOPB 4AEDA 1O91A 4DMIA 1O4YA 4DYLA 1NCQC 1DLLA 2N04A 1ND2B 4QM9A 5I8TA 4Q4X3 1DQ4A 1LHWA 5T3NA 5L9RA 1TA8A 1NLSA 4CUAA 3OEBA 4RO2A 5EP9A 2GV9A 2DCKA 3FHQA 4OHVA 2VZRA 5EV7A 2HP8A 3HMYA 2ZJCA 4GUNA 4KWLA 4XAAA 4NIGA 1VBE3 1T6BX 2CAZC 4FJCC 4J10A 3SQOA 1OJHA 2R071 3HD8B 5H9RA 1S0VA 4M01A 4H3WA 3HJRA 4MVUA 1YJLA 4GD4A 4FBFA 3MV01 5D5QA 5EBWC 4IEQA 4U7OA 4X66O 1NU1H 2JDYA 1W28A 1AJQA 5CA0A 2ZZQA 3J8F3 4JKKA 1SLAA 2JJ6A 4YGBA 3I2DA 1COV1 3D3QA 3GYDA 2WQ8A 2JG8C 2VVFA 2JXAA 1M56B 3ZLIA 1DZQA 4EN8B 1R3IC 3CE2A 3MGUA 1R3LC 2HEWF 3CCVV 3ABLC 3U07A 4NE9A 1LGBA 3BALA 3PNAA 3ZCCA 5IJRA 1AP6A 3K03A 2UY9A 1N1SA 3NNJA 1KYOF 1XXNA 1IBKB 2IJKA 1GP4A 3DPRC 3ASNB 4CU7A 2W0FC 2VQEB 5KXBA 3IAYA 3L9JT 4DUYB 2W9XA 4JZRA 1SFNA 3K4DA 4QHZA 1AR63 4IESA 1W2AX 2YEVA 2V4VA 3C3VA 2QWPB 5K0UC 4Y20B 1O5UA 1WAZA 4EQVA 2XLGA 1DF5A 2DUQA 1XOYA 4BCUA 3H8RA 2XLFA 4XAEA 4HSJA 3UNPA 1UMZA 2P7TC 2ZKOA 3HEIA 5GW7A 4PJYA 1OQ1A 4HN0A 1UKGA 1O7FA 3I7DA 1PO23 2ZA9A 1HW5A 3I4IA 2Q73A 2UXBO 2V09A 3OB8A 3M99B 4HANA 1L3JA 1BZWA 4COWA 5B1OA 1R093 1UY1A 3D0SA 1IXBA 4X65O 2CWSA 4UYBA 1XNCA 4YW1A 1H4HA 1OOPC 2ORZA 2Q30A 3WNMA 1ZBE2 4LF9O 3HBZA 4AGGA 3T2QA 3WF4A 1J3QA 1EAH1 4FT8A 2RDNA 1VAVA 5FO7B 4IW3A 1EUTA 1WLEA 2K2SA 3WB0A 3MF6A 3L71H 2CHHA 5J9PC 1GN6A 2JGDB 2ZEZA 1TMF3 2RM21 1EPZA 4DUZB 4QPKA 1RUG1 2P1BA 1OURA 3O5SA 2W95A 3CJHA 3VBFC 3C7OA 1HXS3 4YZ3A 4J42A 5B4XA 1QLEC 3MD0A 2CTWA 1U5IA 4UFMA 1WPBA 2XUMA 4XE9A 3SH3A 5EIBD 1H8TA 1K42A 3H50A 2Q1MA 3KVAA 2AGSA 4NHYA 1X59A 3RYCB 1US6A 1SCRA 3ZMOA 2FDHA 1S2BA 3WEZA 4U36A 1OPOA 2FHRA 4MSVA 4ZKIA 2VNOA 1LB2A 1EN5A 3SLIA 4FPGA 1BCXA 5BNNA 4N7UA 3SYCA 2Q8VA 1JFFA 1AYN3 1D4VB 5A2QN 2VZVA 3UGGA 4JGZA 4FFBB 3EB7A 4QPIB 3KV5A 5GJ6A 5J2TB 1UPSA 3AFKA 4GMP3 5FR3A 3NWKA 3APQA 1VBA3 3WP4A 5JCOC 2XWJB 2CDPA 1KRIA 4EEQA 1ULCA 2FBEA 1NOVA 3IMNA 4RL7A 3LCPA 2ADEA 2VNRA 4RQEA 5IJ0B 4DR1B 1H38A 3AJZA 4Q4Y3 3O1MA 4JYAB 4JTDB 2QM8A 1UIKA 1DGRN 1UL9A 5A7QA 2OT7A 3DPRA 2YXHA 4FIPC 3ATGA 4A5UB 3N9PA 4DR7B 2XGXA 2FL4A 4LF6B 2YY1A 3LF7A 1ALYA 2VZUA 1SZBA 3KGLA 3RZHA 5F9TA 1WW5A 3ENRA 3EO6A 2OT5A 1O3QA 3AMMA 4Z2WA 1HV0A 1W2NA 4QX7A 5GKAC 4LO5B 1FT9A 3W21A 4JKMA 2VBPA 3MO4A 3TGUH 2V1DA 5F7UA 3LDKA 5A6YA 4EROA 1H1IA 4X8PA 1QJX3 1XL4A 1W99A 2Q9LA 3Q9OA 4KP4A 2HFEC 2UWAA 1GOFA 2OCCC 4M3CA 4OMDA 3CC7V 2W92A 3D36C 4LO6B 4AVSA 3TEZA 1DTOA 2XL9A 2AENA 4ABMA 4MG2A 4LBLA 2IJHA 3CIHA 4B4PA 1EN6A 1PV0A 3O0VA 1AI6A 2BRTA 3AZXA 2B9VA 1JZ7A 1K4CC 3T2PA 4I55A 2D6KA 3S7IA 4UCTA 3R4DB 1JQ0A 1PIV2 2EXJA 4B3MO 2JGUA 2YSUB 3ZN6A 1PM9A 4CUGA 3S30A 3LFMA 2YC2A 3WHUA 3S3XA 2MEV2 1BJQA 2XJUA 3WX5A 1CZSA 1VMFA 5LGNA 4OI2A 3VBFA 5A3OA 3H01A 4JHZA 5DUVA 4AYUA 5T50A 5BNPB 3SC7X 5HCHA 5SV8A 4K1ZA 2EIJC 3PJYA 4R8HA 4BDVB 1VQKV 4Q8KA 3P5BA 3H7YA 3CDZB 2YIAA 2UYBA 3QH7A 1OCZB 1PZ7A 5DG1A 2NP0A 5KHHA 1VBA2 1Y43B 4R7CA 5IUQA 5FWJA 2DWDC 3QACA 5LBBA 3O1SA 5FAXA 1MEC2 4LF6O 4C0HA 2BNOA 1NCRB 1EV12 3T4DA 1UU6A 2BNNA 2D97A 4Z1MG 3K57A 5IHRA 1W8FA 2RM23 1XU1A 4AI8A 4WBNA 3ETDA 2VZPA 3CLPA 4JI6O 4QXHA 4B3RO 4XPVA 5FY0A 3PL0A 2R1BA 2WL1A 1KKCA 4LHLA 2ETEA 1JZ4A 3TXSA 4XJAA 3A4UA 4YIPA 1RSOA 3HNBM 3P30A 2UWBA 3U10A 5LP6B 1GKFA 3P6BA 3HBKA 2DYSC 5A7WB 3VBFB 2VD7A 1ZRRA 3V0AB 4YW3A 5GZEA 2VZTA 3I2JA 3CD6V 4LCUC 5HCFA 3VHPA 1KD1W 1AYM1 3WUDA 2WNUC 2Z2SB 3N2KA 3LA3A 4I50B 2VQFO 2UU8A 4I9QA 2Q1FA 3FL7A 3MDSA 4QPGC 1HB1A 3CCRV 1B35A 3MIBA 2BTVC 3H7JA 4FVMA 1K97A 4RHV1 4AI9A 1GNYA 1NT0A 4PLOA 4YVSC 1ACCA 2ZABA 2ZKLA 1MS0A 4RHV3 4X6RB 4EN9B 1XNDA 3I97A 1W9YA 1ZNPA 3LDCA 2BVBA 2DU1A 4H14A 3AZZA 2HWC3 3E97A 4QGMA 4P08A 4CUCA 4QDSA 2DW4A 2B1IA 4GKKB 1W2TA 3BIWE 3ZYHA 5C8CB 1OQEA 1XEQA 1LRHA 2XJQA 1P7GA 1M56C 1ZRFA 4H7MA 2BUKA 5FZGA 3DN7A 5KA5A 2DCZA 5E6HA 5C9AC 1AX2A 2ZS6B 1VBE2 5JZGA 5CZKA 4LK7A 3CJIA 2QWNB 3RJRA 4BR6A 2VZQA 3QNEA 2OCHA 3FX3A 4WZCA 2BE3A 1QMJA 4L87A 3ZSMA 2Y0PA 1YI2V 3RNSA 3ZXLA 1N4CA 2ZHNA 4NROA 1A32A 4HSLA 2VWJA 1IBLO 2AGAA 4IQPA 5JOWA 3BFRA 2XBO2 3H1YA 1RL3A 4X1YA 3N9NA 3AMNA 4E8CA 5LA1A 3DPRB 2R9RB 5BNNC 3G71V 2JB4A 2D93A 3D4KA 3TRSB 1LULA 2JJ1G 4B1MA 1JYXA 1V00A 1RUH3 3LEGA 5C8CA 2G38A 1RJ8A 4Q4W2 4LHKA 3GJAA 2AEYA 3H42B 4AQ6A 1V55C 2AZ5A 4FCAA 1KEXA 4LH6A 4YXWG 2ZCWA 4UVBA 1HQWA 2JG9C 3NO8A 5JIUA 2JS3A 2F4LA 4RN5A 3TCUA 4I0XA 4M4PA 5HXMA 5C8YB 1AF9A 2XT9A 4QXCA 3SCGA 1JS9A 3RYRA 2QR4A 4G27B 2LROA 2BQPA 1G4YB 3ACGA 4OUSA 4NJ4A 4RUEA 1QNMA 1N8RW 5CADA 1GMGA 4X88A 1VIBA 3CRAA 3OUJA 4JI4O 2KA3A 2R042 2ZGMA 4LNVA 4JVAA 1AX0A 3GDBA 3HPNA 2WINB 1R081 1XSQA 3O12A 3C7GA 2CTQA 4OI0A 2ZT9B 4RS5B 3RZGA 3V65A 3G6EV 1DDLA 1POV0 3I2FA 1URXA 4Q4V2 4JI3B 1RB8G 5GTHZ 5AC92 1CVNA 1G9FA 2JGDA 3FX7A 5CNAA 2IXJA 4DV5B 1AB3A 2GUZB 4K20A 5DMYA 5JPMB 4HNAA 2BPA2 3T08A 3VOUA 2ARCA 1O59A 3IPVB 3HIFA 3PUSA 3ILFA 2PLV3 4QQLA 1O3TA 1W8ZA 5HBAA 4PD4F 5LA0A 1K73W 1BQPA 4U3JB 4OZXA 2BTQB 4DXRA 5ABJB 4Y24A 5LGUA 4B3RB 4AVBA 1XE7A 5EZYA 1YYNA 3OCPA 5IWAO 4BK4A 3SCHA 1AYN2 1UZVA 3OBRA 1UO9A 5LMNO 2DUOA 4B7EA 4DV6O 2RS12 1ASJ2 3E5UA 4PLNA 2XVLA 3GVMA 2ZM6O 3OM3B 4HZFA 3DF0A 2VUDA 2HKXA 1NY72 5CFCB 1FOD3 3I2GA 2JS5A 1RUJ2 4FOQA 3SH4A 2JDZA 2X5IC 4XDQA 5FQ0B 2H3OA 4PDRA 4GB33 5FZ4A 3AEIA 4V2VA 4DV0B 3W5NA 1FXKC 1J59A 5LYJB 4LKSA 5DECA 1JZ5A 1GANA 1XNRB 4QX0A 4IE0A 4LXLA 3MIGA 1S72V 1C57A 3JASA 5EYPA 5DDJ1 3I2KA 1AR83 2HH9A 3MHHC 1X9PA 2QZ2A 4NXMO 2RS53 1D4M3 3OTFA 2OQ7A 4F4LA 1SETA 4GH4B 1IBMO 1Q7YW 1DCSA 2XJTA 4PF5A 5FXZA 5CKQA 2JG8B 3KM5A 4LO7A 2XDVA 5FZAA 1Q86W 2YC0A 3K3WA 2BERA 3BHPA 4K21A 1JZ2A 3UCSC 2WC2A 1US3A 3CO2A 1E1RG 2IXIA 2E5LO 1NQDA 3GZAA 3U75A 3GBWA 2VTFA 4XZPA 5FO9B 3L73H 3OBTA 5A7PA 4NWVA 4Q2FA 1ZA4A 2RDQA 5LOVB 2ZR3A 3E6BA 4Q4V3 5C3SA 4I0BA 4A7ZA 1S5LZ 4WM7A 3ZFGC 3UL2A 5ACA1 3W9AA 4ZPIA 3AP9A 4XCBA 2L6LA 3ASIA 5CIRA 4MXWA 3R6SA 1IPJA 1RM1B 4DR3O 2P4KA 5LA2A 4BQ4A 1PMJX 1GU3A 4IEUA 1N0JA 4QX3A 1PNMA 2ZE6A 1V9U1 5J36A 1EN4A 4XMAA 2X5IB 1AR91 2YPDA 3ZMUA 2WT2A 1GICA 3HB3B 1DG6A 5FYIA 1W2BU 3LEMA 5T55A 2JJ2G 1HDKA 5LRSA 4LBQB 2F93B 4LUKA 3NR7A 5A3TA 4ZOLB 2W1QA 3AC0A 3ZKYA 2WQZC 4QPGB 4LNUB 5FBZA 1MZ5A 3AXEA 1F4MA 3DGEA 3E5QA 4CC6A 1N32O 5T52A 2AZ0A 2ARXA 1DQ6A 3JD73 3RS6A 5JZGC 1MOFA 2WNEA 1EM1A 3RYPA 5EBLC 2R30A 5HFLA 2ZZJA 2N05A 3M3OA 4I3PA 2XAFA 4PDWA 3HNMA 3UKNA 3LD8A 1RUH1 3PUHA 4DV1O 1IKQA 4HYOA 4KWJA 5BY5A 4YPJA 4JHTA 2VC9A 5EPAA 5A7OA 4OUMA 5IWAB 4AAXA 4BHPA 4DRRA 3SDLA 2QQVA 1GQHA 1TE1B 1OFNA 1SQQH 2PHTA 5EC2C 2IBZH 3T2OA 3ZFEA 5HXVA 1COWG 4XACA 1OCCB 3K5LA 3I3EA 4NHLA 4Q1PA 4DZGA 1ND3A 3E8GA 1AVBA 2YDEA 4B4QA 4DR2O 3ITQA 3KB5A 4DW0A 4DRVA 4TUYB 2BSKB 5CKMA 4FSJA 3FLRA 3N36A 3WCSA 1XNQO 2OIIA 3NNLA 5CA0B 1MSDA 2Z4FA 2WQ4A 3IAQA 4RS5C 2RJKA 5H9PA 1OCRC 4LA2A 4PV1B 5FZLA 1CAUB 2OUHA 5AFEA 4I5SA 1QLNA 1AJKA 3N7JA 2RMU1 3LSQA 1V6NA 4PA4A 2QCSB 2XKPA 1YIFA 5C3PA 1C5IA 4CDUB 2ZACA 1W6QB 1QQP1 4NO4A 4QPJA 4OQ9A 3V64A 3VBUC 3IDAA 4B3SO 1I5PA 1QVGU 1N36B 4AQ2A 4Y5Z0 1FV2A 1VP7A 1IBMB 2BTQA 1W8HA 3ZPOA 2D98A 3NQHA 1TUEB 2JDUA 1RUG2 2RM22 2D44A 4LWSA 3ETPA 3K0DA 1J95A 4WVZA 3FYIB 1PMHX 2XKOA 3ICXA 4FO9A 1DLCA 3HN3A 1PVXA 4UT5A 2YIDA 4DV7B 3KMHA 4J6GA 3AXDA 2W46A 1VMGA 1XNRO 3WB1A 4IETA 4D94A 5IK5A 5FUIA 4ES9A 5L7OB 2CTRA 2Y6FA 3VD3A 3PN1A 3H1MA 4MOAA 4J7JA 1UYYA 3C7EA 4Y3OA 4NHXA 3K2OA 5D5PA 4Y4RA 2DVAA 1UAIA 4LBQD 1UMIA 1VJ2A 4MGZE 3CS5A 1VBB3 1YCIA 1KFXL 3A0HZ 1FPOA 3OUHA 2DCTA 3NNGA 4W65A 1APNA 1F51A 2Q5TA 5EYPB 4Y1UA 2J1TA 2VL4A 1PGW1 1N34B 1Z78A 4W8JA 3B93A 4XEZA 2A3YA 2YI8A 1EZVH 1AI7A 3NJVA 5K8SA 2IM9A 2CGPA 3Q8EA 4AGRA 3WQ7A 4R9AA 4EN0A 3K3NA 1AR62 2VMFA 4E2GA 1WZXA 2XVGA 3T4HB 4FFFA 3CRCA 1K34A 2WWWA 5CFCA 2HVJC 2BFUS 4ORFA 3GHMA 1ULFA 2BBVA 5B1BC 1KC8W 1GZTA 2TUNA 3VV1A 3MV11 1EP0A 1RTVA 5CBGA 3FYEB 2CH7B 2ZX2A 4ZHQB 2X6CA 1OA4A 5DAPA 1FKAO 5FV3A 1OHHG 1JOBA 4Y5TA 4KG0A 5F3IA 2ADDA 4IE7A 3AVRA 4LFAB 4RR3B 2BGOA 1HP8A 1ZBA2 3OYWB 1K3IA 2G19A 5FZ6A 5BUVA 3AFGA 4IL7A 4GKKO 4AF9A 1SA0A 2XBO3 1GFF2 1RC6A 1YXWA 2W08A 2WNOA 2WO2A 5JLVA 4OLLA 4AVVA 4LIUA 2XJPA 3IPVA 1S0FA 1Y7BA 5DPNA 1VF6A 1NA1C 4OFGA 3C3SA 2UY8A 3M7AA 1Q6IA 5F2VO 2B46X 1VRH1 5DZEA 1J3PA 4X66B 4OHXA 4XJUA 1CIWA 1OZ0A 2PMWB 4DS0A 5FK7A 2YXSA 3ZN0A 4NRPA 5T5OA 3JU9A 1H4GA 4MVSA 5L19A 4JI6B 3EBRA 3VB9A 1AR61 1CJPA 3P32A 3KGZA 4U2AA 4D6RA 4E2LA 2UUAB 3J8F2 1P49A 2E5LB 1X7NA 1HB2A 3HKBA 2OZJA 2HWB2 5F2SA 1D7PM 1BMFG 1FXKA 2IVJA 2ES3A 2XJRA 4Q20A 4HPKA 2AR6A 4UXAA 1JMKC 1ZZ6A 5A3NA 2QKSA 3QCWA 3RWRD 3NJYA 2P3JA 1FMD1 2WR9A 5KUMA 4X8AA 2QQIA 3BOWA 1WCQA 5J48A 2FDGA 4A6OA 4FI9A 4YW7A 1WPXA 3W7WA 3RPQA 1ZBA3 3OPWA 2NNUA 5I93A 4LF7O 1JXNA 4BQ3A 3CCMV 4YLZA 1FPN3 1V0AA 4XQ4A 2EA7A 4NMIA 3USUA 5D8AA 1KXGA 4UFJA 1XHXA 5GZFA 4M3CE 2IXHA 5HCBA 3K5OA 5C3RA 4BA6A 4XFIA 1AP5A 2Q7HA 3G7DA 5H9CA 1UU5A 5GONA 5CFDC 4EWDA 4CEYC 2NZ9A 4OCTA 1P8JA 2GUZA 3IDEA 3IIIA 1WBLA 4DPNA 3CRMA 4NWWA 1LOBA 1YJ9V 1UPGA 2WSUA 4Z07A 1RUNA 2Y6HA 2IU3A 2YG0A 3ZMZA 4P9GA 2EXIA 2DU0A 2B9ZA 5KR7A 2VVDA 2C4XA 4IV3C 4CDWB 1VQLV 2QVSB 4KH9A 3GM8A 1NT2B 3WXPA 4AE2A 1SACA 3I2IA 4LJHA 2Z3YA 4P5HA 5EFUA 1YJWV 1PO21 4JRLA 4M0NA 3ZSKA 4ES8A 1WW4A 5FLXN 3ZHSA 2HWB3 1PMIA 3H1JH 4A3ZA 1GOHA 3WQ0A 3AB0A 3ZYFA 3MW2A 3FKSG 5BR8O 2PGGA 4UOJA 3TK1A 3WDUA 2R72A 2QQKA 4BE3A 1AL0G 3BVOA 5JUVA 1N36O 2A5ZA 1YQ6A 4YZ5A 2P2KA 2QWRB 4IYHA 4HN1A 2MEV1 4O7XA 1KB9F 3OGJA 3X2QC 2XHKA 1ENVA 3H8XA 2J1EA 1AR93 1P4RA 2DBNA 2BOCC 1VF5B 4AEMA 5KMGB 1AUYA 1RMU2 1GM8A 3POYA 1Y3TA 3JSLA 1GKBA 4QPWA 2YU2A 1ENSA 4XUPA 1S0GA 1LOGA 5APAA 5FYUA 4X64O 1AR71 4YARA 4AFAA 4X1IB 1GNHA 1HR0O 3IJ4A 4Y1YA 5FNVA 4LWSB 3OBAA 4NB5A 5C71A 4MXWB 3HVDA 4FZ1A 5AC91 2WDBA 2OUJA 2EIJB 3WF1A 4R8CA 3A22A 3A2FA 2C26A 3D5OA 4WM8A 1BQZA 5IVFA 4RWUA 3KF3A 4A41A 3VDDC 4JASA 5IYZA 1EUUA 1HN0A 3ZHTA 1H8HG 1YFYA 2E7AA 4ISQA 3PMSA 1R73A 5D1IA 2R1DA 5A6QA 3KHBA 2R9IA 4D8MA 5EC1C 3FHAA 1AXZA 3HAGA 2DYCA 2EJRA 1V54B 3UQ8A 3RYHA 4YZ2A 4NXMB 3VQWA 4N9IA 4K3AA 1AJOA 3SPIA 4MZUA 5E79Z 4JI2O 1STMA 1W8UA 1JFFB 4XDPA 3M8LA 1Y74B 4AVAA 3GZTB 1ORQC 2ZOEB 2VQTA 5KXDA 2WLNA 4QGLA 5DXDA 1D5AA 4E27A 2AZ2A 3ZXFA 4Q4W1 2P67A 2WFF1 1N3QA 5FFOC 3MLJA 2YZ4A 3H1KH 4OMCA 1HJFA 2A6ZA 4CDXB 4JAUA 2IJJA 4P9IA 3RVZA 4I0XB 5H2FZ 2PLV2 1WBFA 5GZDA 1SBDA 1NS1A 2K9PA 3ZSEA 3THTA 3S7EA 2ZM6B 1LUWA 1PO13 3H9AA 1MS1A 1DZRA 1YITV 3SJBC 1QOSA 3VBHC 4A44A 2C5DA 2WS93 2PAEA 5FY9A 3WW1A 2JICA 2VOWA 3POJA 1VP6A 2DWEC 1HB3A 3ZHQA 5L3DA 5F3GA 1CAXB 1VARA 1Z2GA 2JD4A 3OGGA 4O9EA 5IYBO 1F31A 4K8XA 1EZJA 3TEYA 1FFXB 1O4ZA 3X2QB 1J58A 2O57A 2CK3G 1DHKB 4NHMA 4B3TB 1M4WA 4HVOA 1Z7S1 4RQPB 2ZGSA 4AEDB 3F95A 5K0UA 3CJIB 4JGYC 4J7ZA 4CH5A 4XFGA 3H1IH 3UJOA 5IW0A 2WNVA 3JD4A 4KHPO 3G67A 1HW7A 2E75B 1FXHA 1YJNV 2ZD9A 2ZNJA 2Y33A 2WLHA 5FXXA 3JD2A 5B1NA 4FPLA 5IK4A 5BNQA 4B7KA 4AQSA 5CAZA 5FYCA 2OS2A 3DXRA 5DAQA 1M57B 2UUBB 4GZRB 1JYVA 4AQYB 3RI9A 1F9KA 1BKZA 1S2EA 5A33A 4QHOA 4IIJA 5DN6G 2KXLA 1G7YA 4KL1A 2QSAA 4XC9A 4DK0A 1ZX3A 3I5DA 4GXLA 1JU3A 5EZWA 3L72H 4YM3A 2HKOA 3LIGA 1X50A 2D3SA 3N7KA 4AFBA 1TVKA 1TGOA 1J83A 1QQP2 1G9CA 5KC5A 4YJ3B 4FLYA 1TME2 3NKGA 1FJGO 1JVMA 1FS0G 3CEIA 3VQXA 1U5ZA 2DYRC 1MS8A 4BIFA 3OD4A 2YU1A 4NTYA 2C2AA 4M4RA 5EXOA 1OUXA 1RUD3 3E22A 3SPJA 1X9TA 3D6EA 5IVBA 1HRV1 1R3KC 5FKBA 2PLV1 5ERLA 3OSDA 4YM1A 5D2AA 3T2TA 4IEVA 4YM0A 4AHXA 5GLWA 2VY0A 3WDYA 1IVSA 1HLCA 3A0NA 4IV3B 4CDWC 3KQRA 2E74B 2WZ8A 2PY5A 3TOJA 1XYNA 3FE5A 3CYOA 3BTZA 1I08A 4MTXA 4NTWA 4CEWA 4MVQA 1CZVA 1REFA 3A23A 4S2GA 3VBRB 1S0IA 1UX7A 4NIAA 1NXMA 2FDIA 4PCRA 2HWD3 4LIVA 2MW2B 3GCXA 2QKCA 1XMOB 4AAPA 2JECA 3KHCA 1WD4A 3NV3A 4DIQA 5KAIZ 2HWF1 4TYSA 2ZMLA 3LB9A 5DM6V 1PNFA 2VQFB 1ENRA 4BM8A 1DGSA 1GRJA 5DUWA 1GN3A 3BA8A 1QHDA 1AILA 5A3UA 3FB6C 1S2KA 3HWJA 4QE7A 2HYXA 2DVFA 1RUH2 3ABKC 3QBQA 4YGDA 4AHYA 1AL22 2W91A 4GX2A 4GALA 5JDBA 1OCRB 3FAVA 3ZPYA 2WWJA 5I0DA 5LA6A 4NAOA 4GLXA 2EAAA 4A2UA 3WP3A 4JI3O 3LKJA 3HQUA 5C5TA 1QH7A 1NKGA 3U14A 2EINC 3ABTA 1EFRG 4LBMA 2VOXA 3W20A 1MZFA 4WV8A 3AX4A 1MABG 1RINA 4DQAA 4HETA 2Y4UA 5IVJA 1Y9QA 1QCEA 2PTMA 4C8DA 1N0NA 1UOFA 1YHFA 3CMGA 4MS2A 4X9QA 4FZ0A 4FVVA 3J7AU 1AL21 4I4TB 4CH3A 3PVNA 3KS7A 1JOYA 3JATA 3ZYPA 2BJSA 3K77A 2A9HA 2I74A 1B6QA 4M0HA 4QMAA 3MZHA 5A3LA 2EALA 5LY1A 1WLCA 4ISRA 4BZ4A 3KZ4C 1AR4A 2CU5A 3HKCB 4B3SB 3OBZA 3R05A 4AI0A 4LBJA 1ZTEA 1U97A 4KFMA 3ABKB 2CAUA 1F15A 1U5XA 2UUCB 4QX2A 3TAYA 4YWAA 4XHXA 3IMMA 1ZBA1 2Q4SA 5L7OC 2QGNA 4IEXA 1V55B 4YRDA 4WFHA 1UMHA 1VBC3 3H1LH 5LP6A 3W5MA 5FPAA 2V5YA 1NR1A 5FWEA 1OSGA 2YI9A 1DLBA 3LSUA 3IT8A 3OOXA 2Y60A 4W4ZA 2CE4A 2H0VA 3IC9A 3QD6A 5I8SA 2Q7GA 4FTBA 3HKDA 4FPHA 3J4UH 2ZXWC 3EFFK 5DG2A 3BTAA 3LUTB 3AG4B 1OCZC 3LAGA 4J1WA 3LWCA 3AG3B 2P90A 4O4JB 3I3BA 1EAH3 1M5IA 2WO1A 5CKNA 1Y76A 1ND2A 3RMXA 3CC4V 1MEC1 4W6WA 2DV9A 4HNAB 3WNLA 3T30A 4RQPC 3WCRA 4R9CA 1L1FA 4ASLA 1PGW2 3TB0A 4L97A 5E8AA 4AILC 3VBOC 1HXS1 1KS5A 3ZS8C 2WSSG 2F66C 4UVCA 2P06A 2W0XA 1RUJ1 1SQFA 5A70A 1CXZB 5JOZA 3GZEA 3JARA 1ZZ8A 3VDCA 3SCFA 2ZMNA 1C8M3 1V9U3 5LK7B 2VQ0A 1FYUA 4A45A 1VQ5V 2VBDA 2ZR2A 2CL2A 2ZX4A 2NR5A 2Q5ZA 5FTTC 4D6TH 4F83A 4MGTA 2XG3A 5FZ7A 2DVGA 1ZRCA 2SBAA 4XW3A 3M4FA 3LA7A 2G1MA 3ZR6A 1IS5A 2R062 1SPPB 5KWRA 4MTGA 2WNUA 4LBOA 5GLUA 3VGIA 4JTCB 5LEJA 3KCYA 1TUBB 4QPGA 3OUSA 4JTAB 1X33A 1ROPA 4EFEA 2YFZA 1VQ8V 1G8WA 1TAEA 3I8TA 1R1ZA 2Z5WA 2Y8KA 4YVSA 2WNVB 3AG4C 4Q4V1 5HPOA 3SMHA 3BA9A 1OF3A 3AG7A 4IE6A 4BMBA 3E35A 1R6NA 2P6JA 1XQ8A 1W6OA 3IKWA 1FJGB 3POFA 3C7FA 2WLMA 1F4NA 4BK5A 2A6YA 4WM8B 5F3CA 4FTEA 4XUTA 1YSCA 1MA1A 2PAKA 5F6LB 2A7AA 1VAKA 5E88A 1N1TA 1AI5A 1N1VA 2WFF2 5K1PA 3KCCA 4JGZB 1QJY2 3LPFA 1W8WA 1S0EA 4GJZA 1R092 4OHYA 5FYZA 1CAWB 1JYWA 1C4RA 3ABMC 2GH2A 1K7DA 2MNGA 5K9YA 2GNTA 3ZSJA 4H0LB 3N9QA 4UF0B 4N43A 2QUOA 1UCXA 2NLJC 3HQRA 4K40A 4ASKA 1R091 1QGLA 2EZPA 1ZX5A 2OPKA 4BAYA 3A0BZ 1XNQB 5FY7A 2XBO1 3ABZA 1OD3A 5CN0A 5IY5C 2YUAA 4KWKA 1WB8A 1NI8A 2IXKA 3RRDA 5JPNB 4FQZA 3L70H 1VMJA 5FZ9A 3WF3A 1OLME 2P3YA 2CAVA 5AVPA 2R70A 2MPFA 1ZLZA 2VUCA 1QNYA 5FPXA 1WLWA 2GNBA 1WCDJ 5F5AA 1VEWA 4K8ZA 2R072 3A7QA 1MS4A 2EBOA 1YNAA 2QQUA 3T1LA 1OUSA 4MT8A 3DXRB 3TN93 2YIBA 3ZIWA 1GN4A 5FJKA 3AKRA 3B09A 1BHAA 1K8AW 3ES1A 3KSCA 5CU1A 1CONA 4LMFA 1RSOB 3BCCH 5FPOA 5J2UB 1UXZA 5IYCO 3QO7A 3RZKA 2YUEA 3MHSC 1BHGA 2Y0OA 2Y6KA 1GM9A 4FLZA 3AMPA 4CVUA 3AP4A 2VPVA 4RHV2 1RMU1 4DNYA 5A32A 1QY4A 1NTKH 5LASA 3CX5F 3HT1A 1PVC1 1W06A 1EAH2 1LEDA 1OVPA 4AK3A 3POEA 1GUIA 1E1QG 1D2QA 1PM4A 3CJIC 4KGQA 3CF6E 1ZBE1 4MV2A 2WYFA 5GZCA 3I3QA 1JTZX 4MW8A 4DY5A 3MPPG 2J1AA 4FFHA 3ML0A 4FP3A 3JB4C 2Y69B 3TETA 1AYM2 1E5IA 1BVVA 3J9SA 3URFA 3H3ZA 3R4UA 4DB5A 2E32A 1YFXA 1XDCA 5KUKA 3PJQA 1TUBA 3VBRA 3RWKX 5C8CC 1L0LH 2WABA 1CAXA 1BS3A 4FXKB 3AP7A 3B9CA 1RUF3 3AMQA 3GF6A 3MYXA 1BE3H 3BGAA 2WZPP 2IFRA 3T1CA 4KWUA 4Y1VA 4DXZA 3W7TA 3SYQA 4OVEA 4D7TA 1KQSU 4PDVA 4UB6Z 3IFXA 2AC1A 1KITA 4Y4YA 4CS3A 4DUWA 4LKDA 3T09A 3OGSA 4CCJA 1RMU3 3T0AA 4BQXA 3I2HA 2W68A 5LHGA 4DUVA 3NNFA 2Q69A 4XZUG 1V70A 2WN3A 3KV9A 2UXCO 2FMYA 3ABUA 2B42B 2QNKA 1UWWA 2GN3A 4XF3A 5H6RA 3JD0A 3ZXAC 2OCCB 1RUD2 5D21A 2TEPA 2B45X 3B02A 4EYUA 3RMYA 5IY5B 4QQOA 4LBKA 3OMNB 4K7JA 2WO7A 4JI0O 1OLQA 1QJU1 3M3EA 4HBNA 1LKNA 2RJ2A 4FOWA 1Y76B 4QGNA 3B40A 4ZI7A 5LYJA 2HBUA 1FD9A 4P9PA 2E6VA 2GH8A 4FAHA 5EZYB 2D3RA 4JI2B 4JCKA 3GNEA 4DV3O 3DEMA 1URFA 2GC0A 1O5LA 1K9MW 3I3MA 2HWB1 3LNNA 1UD1A 3OTOB 2EIGA 1FX5A 5FY4A 4C91A 5IDJA 3WG2A 4QX1A 4XVHA 3ZFGA 1KJLA 1QF3A 2E51A 4IYIA 4SBVA 1UU4A 4Y5SA 3WU2Z 1YI7A 4JI7O 4JF3A 3FBMA 5FPZA 4YVWA 3TWIA 1J1LA 1E57A 1WMEA 3CKHA 4Z82A 1VIWB 1KP2A 1HN1A 3L9DA 5JJJB 3RFRA 5IJ9A 2LM3A 3N35A 1GBGA 4HPKB 1EY2A 1SPPA 1V9U2 2VR4A 2J1RA 2LW7A 3E86A 1IXMA 1XYOA 5H9QA 1E5RA 1XQNA 5IYYA 4CXYA 1JUHA 2EULA 4D69A 5KX5A 1NG0A 5L3GA 2DWRA 2Z69A 2OWOA 2DFCA 3HQXA 3IB3A 3UKVA 3N2GB 4JZGA 2WLLB 5GTIZ 3VKLA 3ZRVA 1GP5A 4LO8A 1XMOO 3B7MA 5IK7A 1ONAA 2RHPA 1UN1A 2PHFA 3T0DA 4YJ3A 4RAIA 2R0FA 2VAUA 3NXSA 3N7LA 4DO0A 4CPBA 1VE0A 3R4SA 3T4ZA 3W7SA 4Z1VA 2QWOB 1IGOA 4XETA 3IAPA 2EXKA 3NNMA 3IWZA 3ZXJA 1K5MB 3FB5C 4A42A 2JEMA 3SNMA 3K5NA 3LEIA 1B09A 3ZFFC 1BEV1 1KQRA 2YYOA 4AWDA 5SV5A 5A1AA 1S4CA 4R9DA 5L3BA 2WWUA 4K1YA 1KDMA 1D5NA 4ASMB 4NRMA 4DUXA 4HONA 4J41A 2VWKA 3AL6A 3W7XA 1JCHA 1KFUL 4JAVA 4PDMA 2UXCB 4U3JA 4ZZ8A 4UBGA 2P4VA 4UW6A 1NY71 3FMGA 3E8FA 2QQJA 2F4VO 3LSEA 1SLCA 2XASA 2K9ZA 4C7UA 4Y1XA 4XFAA 3KVBA 4CEWB 2WLPA 2JENA 2EILC 3UGHA 4O2AB 4QAWA 3B9IA 1LOEA 5FPLA 2QQPA 5CFDA 5FP7A 1JUIA 3WUCA 4AW7A 1ZL8B 1RUG3 1G6NA 1C1FA 4CH4A 2PFWA 4FOYA 2UXDO 5GZGA 4QJFB 3CEWA 4NPMA 5FLHA 1O8PA 4HOOA 1F4HA 1Z7S2 2WLIA 3TEXA 3GHNA 1B35C 4AHCA 1O9HA 1QJFA 1HXS2 4UBHA 1VQ9V 2YBPA 1CPNA 1YLLA 2QFEA 3IZOA 1GNZA 1IURA 2WT0A 2VNGA 1EV13 4DEVA 4DR5O 5LBCA 1JH5A 2GHYA 1R082 2F1MA 4LNUA 3AL5A 3PDQA 4EB6A 1S0CA 4PIYA 4LA3A 3VZOA 2R041 2PA7A 3ZN5A 4NN0A 2W6IG 4AVCA 3BTYA 1QXRA 1SS3A 2PHRA 1IOAA 1YC61 3RN4A 4CP0A 3BTXA 4O4IB 1BBT1 2JDMA 1Q6HA 2WZR3 2VG9A 5DAVA 4ZIBA 3NVCA 3ZRWB 2DN9A 3E8HA 3H9VA 4V2WA 1CEZA 5DDJ3 1SRYA 4O4LB 1W6PA 1SZXA 4GKXA 3ST7A 1LHNA 4KQ7A 3CJXA 3T3YA 2DMXA 4J1XA 1DYPA 1JMUB 4IV1C 1JYIA 1HRV3 2ZAHA 3OW2U 1E5HA 3HKEB 2IJIA 3VL9A 3U0ZA 2WYSA 1JODA 2YB7A 1CWPA 3E1F1 4CDQC 2VM9A 3K4ZA 3JB8A 1ZVFA 5JSOA 2GDSA 1IG3A 3C3TA 1PPJH 4WM8C 4ARXA 3K59A 1PIV1 4B4RA 4IDZA 3ZFFA 3TEWA 2QZ3A 3WD5A 2JG9A 1T2XA 2VMIA 4PBPA 2A70A 1DQ1A 3RYIA 4S2FA 3B8NA 5FZ8A 1QJEA 2R0HA 5BNOB 2VW2A 1XREA 2XHBA 4EFBA 4GWMA 5EJZB 5FRAA 3UT5A 1VBE1 2FYUH 2LUWA 4GH4A 4P9WA 4B3NA 2W39A 4QQHA 3GGLA 4XBQA 1LENA 4E4SA 2PZSA 4GX5A 3MUY1 3AK1A 3I54A 3BU7A 3ZXKA 1WA4A 5HV4A 4COUA 1AR72 5B1AB 4JI5O 3GBGA 1NE4A 4K0KO 5A80A 4YY3O 1LOFA 4QKFA 1FI2A 4FPOB 3CPWU 2ET7A 4CU6A 4DR3B 4N21A 5KHIA 1ZA7A 3AZWA 2ZHKA 1W6MB 4I3GA 3O65A 5FMBA 3L75H 1AI4A 1UFIA 5ACA2 4J9YB 3ZFFB 2WZR2 1F35A 3IDCB 3JAMN 5J7MA 1BMV1 4L8QA 5E16A 3X29B 4CDQB 3OF1A 1AL23 3M7MX 4ZS2A 2ZKNA 3RYKA 2X5IA 5F5CA 4LFBO 2VUAA 1SA0B 4G28B 2B5HA 3APOA 2B1GA 3SYAA 4SLIA 4O9GA 4FFKA 4XOGA 4LFAO 3WF0A 4O2BB 2DUPA 3W7UA 1PO22 5J2TA 4TLGA 3AZVA 4PI2A 3VHOA 1LESA 1W9SA 3VN4A 4HXCA 4Y22A 3JZVA 1UIJA 3VDBA 5D8AB 3CRRA 2EIKC 1F8VA 5BNOC 4MH0E 5JZGB 3B4SA 2UXNA 1HRV2 5IVEA 3M1HA 3IBMA 3QF7A 4PHZA 4DRXA 4X8NA 4P2ZA 2VULA 2WZEA 4MGIE 3IGAC 1CQ9A 2QJVA 1M90W 3AK2A 2ZGTA 3ZYIB 2ITDC 2Z42A 5BXZA 4EZHA 1I5YA 4LF5B 1MR5A 1ULPA 3BPSA 5K1XA 1YEWA 4D3WA 2WT1A 5CYYA 3BABA 3MFCA 3SYPA 5BY1A 1N47A 3N3HA 2EINB 4QPIC 2JE7A 2EF6A 1K5QA 2KG7A 2VCAA 2JVDA 1LU2A 1UY4A 4AI3A 4GCZA 3DV8A 4F3JA 1HKDA 2ITCC 4LOSA 2YBKA 1VBD2 1GM7A 3ZO0B 2RS11 4BQ5A 2YXLA 2BGPA 3RWNA 2ET1A 4CDWA 5A7WA 4EWEA 3ZIXA 1J1TA 1SLIA 2QTSA 1ZYBA 4LF9B 1BK0A 2LALA 5CA1B 1PL0A 1GQPA 1V6OA 3WQBA 5FKCA 3MFAA 5FPVA 4QD2A 1H8EG 2ILMA 1TEIA 3KG2A 3GBFA 4HFSA 3UO2A 5JI7A 2OXBA 5B5EZ 1SHWB 2O14A 4QB6A 4JI4B 5CBFA 2W1SA 2VUJA 2PF4E 3HKEA 1OHFA 2WFF3 3G4SV 3ACHA 5JMOA 4UV8A 3OYWA 4JTNA 1ZWIC 3AK0A 1QR9A 1VAMA 4YZ4A 1J3RA 2V4DA 4MVMA 1YIJV 3CL1A 2XMLA 3DECA 5FMDA 1HV1A 1NX9A 1NZIA 1OF4A 4P14A 4UCOA 3LOIA 3SISA 4KBZA 3DYPA 4YVSB 3S5AA 4FK5C 4CU8A 5FY8A 2LP7A 2CYFA 1XC6A 3JCZA 1CAUA 4O4IA 4RFRB 1QJX1 1XJAA 1UY3A 3D3IA 2WNUB 3MEPA 4PA9A 5DN2A 1Q56A 2WUHA 5C4WC 2WFPA 1Q8QA 4LR3A 2HWE1 3ASNC 4IV3A 3WNOA 4DV6B 4EKWA 4DR6O 1RHI2 3VBOA 4FMTA 4X89A 1WGPA 2XOKG 3WNPA 4Q1RA 5DUUA 3CCUV 1HQNA 1XNBA 1O3RA 1SERA 4XFFA 3N2KB 1CPMA 4QQPA 2WIIB 1QJY1 1SFPA 2RE9A 4FP2A 3WF2A 4UI9L 2H6CA 4I50A 4OGQB 3QO5A 2RNBA 1DP0A 2AW9A 4QKDA 1PHMA 5C5UA 3BVCA 3ZXGA 4K0KB 1GLHA 1SQXH 1JX9A 5IYDO 2R063 5FO8B 2CTVA 4Q5OA 2KSDA 4GIQA 4GJYA 3AKSA 4CCKA 3KT1A 4BQWA 3JASB 1XILA 4H13B 4OX9O 1C5HA 1DQ2A 2JKBA 3ON7A 5EIYB 2ARAA 4C90A 2HHHB 1IHMA 3Q8AA 2D6MA 3Q8CA 3NJXA 4K35A 3PIGA 2OPWA 3JSNA 4DINB 3OGCC 2ZIMA 2D6PA 4AQTA 2R49A 2QTOA 1GO3F 1ASJ3 2JD9A
chains in the Genus database with same CATH topology
1UMZA 1O4ZA 2R061 1IPKA 1VBB1 4HMZA 4PJYA 1OQ1A 5JCTA 3AYCA 4HN0A 1J58A 4H55A 1NX4A 3V15A 3CNAA 3RDIA 1DHKB 4BYYA 1UKGA 4NHMA 1WD3A 1M4WA 1O7FA 3I7DA 4HVOA 3VBUA 1PO23 3VDDB 3VLBB 1Z7S1 4RQPB 2ZA9A 2ZGSA 1HW5A 3I4IA 5CB7A 4AEDB 5K0UA 4P9XA 3CJIB 2VW0A 2V09A 4JGYC 4HANA 3O7OA 1L3JA 4XFGA 1BZWA 3SH5A 4COWA 3TN91 3UJOA 2BFUL 3AKQA 4WM7C 2ZGRA 3RI8A 1R093 2WNVA 4XTPA 4XXAA 4LULA 5FCCA 1SBFA 1PK6A 3D0SA 3JBG2 4M27A 2YROA 2CWSA 4BLJA 4P9LA 4FQ4A 2BNMA 1XNCA 4YW1A 1H4HA 1CAVB 1OOPC 5KXEA 1H2KA 4OJ8A 2Q30A 2ZPXA 1ZBE2 4FPLA 2PHUA 5IK4A 4QHBA 2GAUA 5BNQA 3HBZA 4B7KA 4AGGA 4AQSA 4JDNA 4N7IA 5CAZA 5FDBA 2O8QA 2RJLA 3ZVXA 1H0BA 4INDA 3RSJA 1ND3B 1J3QA 1EAH1 1MEC3 3RI9A 1F9KA 1QNWA 1UPIA 4FT8A 1VAVA 1BKZA 5FO7B 5A33A 2KXLA 1G7YA 4KL1A 3H8UA 3LA2A 5KBFA 1ZBE3 2K2SA 3MF6A 4GXLA 5EZWA 5LK5A 3ZFEB 1MZ6A 2GNMA 3TN92 3FFQA 4YM3A 2VQAA 2YMZA 1X50A 2D3SA 3O0WA 3N7KA 4AFBA 1TMF3 2RM21 3WDTA 1EPZA 1RUG1 3O5SA 1A6CA 1V6KA 3VBFC 1QQP2 1ZZCA 1G9CA 5KC5A 1HXS3 2X29A 4YZ3A 1H1AA 4A7KA 1YJKA 1TME2 3NKGA 1RUC1 1Q3EA 1U5IA 4XQWA 2DFBA 2XUMA 1DBNA 4XE9A 3WY6A 4YZ1A 1EV11 2GC3A 3K48A 3SH3A 4DY3A 1NX8A 1H8TA 1U5ZA 1OLRA 1MS8A 3H50A 2Q1MA 4BIFA 3OD4A 2AGSA 4I09A 1REDA 5EXOA 1SCRA 3ZMOA 1S2BA 5I8YA 1RUD3 3D6EA 1OPOA 4U36A 4P9JA 2FHRA 4Q0SA 4MSVA 1HRV1 4H7LA 2VNOA 2VMHA 4C0BA 4ATEA 1LB2A 2PLV1 4YM1A 3T2TA 4IEVA 4YM0A 3SLIA 4AHXA 4FPGA 1BCXA 5GLWA 2VY0A 4I30A 5ACA3 5BNNA 4N7UA 3WDYA 1HLCA 3A0NA 4IV3B 4CDWC 3KQRA 1JW6A 5L36A 2NMNA 1AYN3 1D4VB 4PQ9A 1UKRA 2DVDA 4JGZA 3TOJA 1XYNA 3FE5A 1HRI1 4QPIB 4Y22B 2IZWA 3DUIA 5GJ6A 4CEWA 4KU7A 1QJU3 1UPSA 2A73B 3AFKA 3G6JB 1REFA 4GMP3 2FZ2A 3NWKA 2RR11 3VBHA 1VBA3 2GU9A 4S2GA 3WP4A 2X8KA 4Q4X2 3VBRB 1S0IA 2XWJB 4Q0QA 1KRIA 3LZZA 3NKTA 1NXMA 3WLUA 4PCRA 1BYHA 1ULCA 2HWD3 2FBEA 4WVVA 1NOVA 1UW8A 3IMNA 3LCPA 2JECA 4RL7A 2VNRA 5I0TA 1WD4A 3NV3A 3S6PA 2HWF1 4TYSA 4TZDA 2Q0AA 3AJZA 4Q4Y3 2ZMLA 1NLRA 3LB9A 1PNFA 1ZZ7A 2HWE2 1UIKA 1DGRN 4LO4B 1UL9A 1ENRA 3BB6A 4BM8A 3DPRA 4CDUA 1DYKA 3ATGA 5DUWA 2XGXA 1AR81 3MIHA 2YY1A 1QHDA 4TLFA 1DZTA 1ALYA 3ELNA 4Q4W3 1TMF1 1VB2A 5ABJA 1LHOA 2VOVA 1S2KA 3HWJA 3KGLA 5F9TA 1DGLA 1WW5A 3ENRA 3EO6A 2DVFA 1RUH2 3QBQA 2B9UA 4YGDA 4AHYA 1O3QA 3ILRA 1AL22 1SDWA 3AMMA 4M25A 4Z2WA 1HV0A 4GALA 5JDBA 1AX1A 5D8AC 1AYM3 5GKAC 4CEYB 3USUB 4LO5B 3ZPYA 1FT9A 1MACA 1COV3 5L73A 1W0OA 2XB6C 2EAAA 4A2U<