1H2KA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR INHIBITING HIF1
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/inhibitor
total genus 105
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2kA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2kA01
5JWPA 4B7KA 4B7EA 4QU2A 2XUMA 2WA4A 2YC0A 1MZEA 1YCIA 3KCYA 1IZ3A 2YDEA 3OD4A 2W0XA 3P3PA 2WA3A 1MZFA 2Y0IA 1H2LA 4Z2WA 4NR1A 1H2MA 1H2KA 4JAAA 2ILMA 4AI8A 2CGNA 4BIOA 3D8CA 2CGOA 3P3NA 4Z1VA 1H2NA 3KCXA
chains in the Genus database with same CATH superfamily
2CH7B 4G9SB 1GZWA 2YC4A 4HZ3A 3NNFA 4JTCB 2P6JA 4EN8B 4XF0A 1BMV2 4Y4YA 3HKEA 1CIYA 1H9WA 2QM4A 2PQSA 1TEIA 3RW0A 4GMP0 2ZGTA 5A7SA 4NRMA 3VBRC 5FZ1A 3K5LA 2ZM6O 3SHRA 4I09A 2ARCA 2N05A 1UY2A 5A6XA 1R081 5H9SA 1VQKV 4KG0A 2VZTA 4I01A 2ZGRA 4UCTA 1XE8A 1LHNA 4MG2A 4XEZA 5DEDA 4AHWA 4XFHA 5IVYA 1OD5A 3N7KA 1SFPA 4WFAV 3OF1A 4JX0A 1QNWA 5HXVA 5JPMB 1R1A3 2EAAA 5A2QN 3L73H 4DYLA 4JI8B 4L8JA 3OMNB 3CKHA 4YRDA 2Q4PA 3VHRA 3I49A 2JKXA 5FPUA 2DVAA 4ASMB 4GUNA 1LUVA 2R9AA 4Q0VA 3VOUA 4ABMA 1H8TA 4U7NA 4HVOA 4MS2A 3Q4HA 1JU3A 5KC5A 4R9AA 1POQA 3G6EV 1HN1A 1JQ0A 1RXGA 2WLQA 3PUQA 2HWB2 2AACA 4OMDA 3EVKA 4GYCB 3ZN0A 1COV2 1H8TC 4RQPB 5FWJA 3SQOA 3VBFA 5FPOA 1JZ5A 3JUUA 3CU7A 5CA6A 3BUCA 3H8XA 1S0JA 3GYDA 5A9GA 4QXBA 3JASB 1RUE3 4K8ZA 3ON7A 4MXWB 1VE0A 1CAUA 2VQ0A 2VH9A 2P2KA 3R4SA 3UETA 1O3SA 5F3EA 2K1EA 1NT0A 2VECA 3UCSC 4KMQA 3SEPA 2ATFA 2ZKLA 2IBZH 1LNQA 3VBFC 4L9BA 2CYFA 3HD8B 2A0LA 3ELNA 3CO2A 1VALA 3CP1A 3WVJA 2GHYA 4IESA 3CD6V 2UXCO 3DKQA 2F4PA 2JD9A 4J7KA 1G8MA 1UY0A 4DXZA 2FYUH 3QBQA 2CWSA 2Z42A 5M0TA 4JASA 1JZ7A 4X65O 4RGGA 4N21A 1YCIA 1SMVA 4K9SA 1ULGA 1SCRA 1QDOA 1DYOA 1J84A 3LDRA 4QX5A 4QX0A 1W6QA 3WG7C 1XEQA 3MHHC 5FNVB 1QQP3 3RZJA 2DUPA 4YW2A 1ZVFA 3ZM8A 3ZRVA 3SLIA 1FXKB 4RQEA 2HWD1 3RYPA 3S7EA 3O14A 4MHUA 1B35B 4E2LA 2YDEA 4BDVB 1AXZA 3WB2A 4COZA 1W9TA 2H0BA 2VZQA 1YZBA 1NCQB 4EV0A 3TYJA 2QZ3A 1S5JA 3KSCA 4LBOA 3ENRA 2R061 4E8CA 3STLC 2Q1MA 5JR2A 1ZX5A 3WDXA 1B6QA 3R66A 1HNWB 1A6CA 4HVQA 4HAMA 3B5LB 5LGTA 3Q8BA 4IIJB 2CNAA 4I50B 3FUOA 5IATA 4Q4V1 2ARHA 4QMAA 5A7WB 1H0BA 1ULDA 1CXZB 1YFYA 5FP7A 1XBLA 1DQ0A 5KBFA 1JUHA 3IC7A 3ZN4A 3RBZA 3H7JA 3A0KA 3C7FA 1S72V 4R4XA 2YHJA 3HPLC 5E79Z 4NUBA 5LK7B 2X53S 2WBKA 1IPSA 4R9CA 5EIBD 5FRAA 1BS3A 2C26A 4CVUA 1H8EG 3ZYHA 2DV9A 4UB6Z 2Q7HA 4IYHA 5J7MA 3UGFA 3NAPB 2VQFB 4DV6O 3MIHA 3WZ1A 3I3EA 1HJFA 4JI1B 4CYDA 2V72A 1GU3A 1SLIA 1LGBA 3KF3A 2XNDG 1M4WA 1FFTB 1KD1W 2WT0A 1JS9A 4WZCA 3WF3A 1ZL8A 1ZLZA 4DV0O 3ZMNA 3KGZA 3BTXA 4K8RB 4Y4RA 4WBNA 1OHFA 1NXMA 4B3SB 1W8TA 1R6KA 1N34B 2Q8VA 3ZRWB 4A45A 1IQAA 4DO2A 1CX4A 1ULOA 3PNAA 2VAUA 1UL9A 4CH4A 2FTKA 1J5EO 3OR6C 5C8CA 1FX5A 3W7WA 4XETA 2WZR1 1HW5A 3ILFA 2R16A 3E6CC 1MPXA 1VQ4V 2PYLA 3ACIA 4BYYA 3PUHA 5FJKA 4YJ3B 4Z2WA 4DO0A 3SPCA 2A6YA 3MIFA 4IL6Z 5BNPA 3ZMVA 3O7OA 1OCCC 2LJ2A 2LQTA 5C8CC 1FOD1 4DXTA 2RDQA 4DV4O 4I9WA 4XDOA 1ZZ6A 1H2LA 1Y4WA 4H14A 4EWDA 1WA6X 1XNRB 4JI6B 3AYCA 4YG6A 3ZYIB 4DR2O 4YW3A 4YM1A 1RUH2 2PHDA 4QPGA 5F5QA 5BNPC 2D93A 1NI8A 1HIXA 5IVJA 1LOAA 2WYSA 2ZHLA 4UUJC 4OHWA 3RZMA 5HFLA 1AHSA 4FPKA 4CUGA 4FPLA 1YEWA 1RUC3 4CA9A 2QKCA 1QOOA 2P4KA 5IWFA 4EN6B 3ZHVA 4QE7A 4QPGC 2DJVA 4B4QA 5FCCA 2XL7A 5E16A 1NQDA 3LQCA 4ASUG 1QU7A 5FY1A 3MUY1 4ES8A 1LESA 1DQ4A 2PAKA 2QTSA 1XRUA 2YC2A 1FXHA 2F4LA 1XBFA 5JOZA 1WW4A 3B94A 3ZKYA 3HVDA 2J22A 3JD3A 4X66B 3FD9A 3W9AA 2XMLA 2VG9A 4C0HA 1D4M2 5DZEA 4OZXA 2NN4A 1UNBA 1AI4A 2QWRB 4RHV3 4XIOA 5E89A 1OJHA 4TQFA 3SC7X 4EB6A 4LLFA 4UV9A 2HEWF 3MLJA 1W0JG 1QH7A 4YVWA 3M8AA 1KFXL 5IY5B 1GK9A 2I2SA 1BCXA 2W95A 4O4IA 1TMF3 1WWYA 1SESA 2Q5TA 4JTOA 1VAKA 1CN1A 1FOD2 3RWNA 4GX0A 3V65A 2Y33A 4I0XB 5CA0B 4J1XA 4F3JA 3T2OA 4LHSA 4JHZA 4YVWC 2HWE3 1A3KA 1R3LC 1EV12 2D5FA 4XJZA 5FYCA 3EFFK 3ZBHA 2ZE5A 1PP9H 4PF5A 3VQWA 4RD7A 2HJDA 3ZXGA 2BRTA 4N43B 1GZTA 1VBA1 2QDNA 4UXAA 1PVC2 1LULA 1XNCA 4D6TH 5IYZB 5JJEB 4NHYA 5FO8B 3VD9A 1JA8A 4BQ5A 5J37A 3B7MA 3QO8A 2DE0X 5IJ0B 4YZ5A 1AL0G 2XT9A 4NIGA 5FUIA 3ILRA 5FYIA 2RDRA 1WD3A 2AZ2A 4DFSA 1EUTA 3S7IA 3AZWA 3LA3A 4JRAA 3SJCC 3NNGA 2V5DA 5J2UA 4OHYA 2B45X 1WB7A 1V6MA 2BDRA 1FS0G 4IT5A 5JMCA 2W0FC 2HKOA 3O0XA 1KS5A 1UWWA 2D3RA 2KA3A 2P3JA 3GZUC 4Q20A 2I07B 2FZ2A 2AREA 3IMMA 4JYAO 1VRH3 3LFIA 5JIAA 4LQRA 1N47A 3MUZ1 1CWPA 3HN3A 5FZ9A 1X9TA 2UUAB 3JSLA 1QEXA 1HRI2 4P30A 1F23A 4QXHA 2VQAA 1NE6A 5H9QA 2ZX4A 5ISLA 4Y33A 1BHBA 2VVDA 2JG9A 3CLPA 3IAYA 3POJA 3AM2A 1W0NA 4XHBA 1AYN3 2FDJA 5K7PA 2PHUA 4XAEA 4CTEA 5D5PA 3NKGA 1W6NA 3E35A 3OYWB 3ZXDA 1OCRB 3SGIA 5I93A 1KBHA 4P9WA 4O2AA 1W6PB 2JG9C 3HQRA 4OPAA 1NYWA 5A3PA 5EP9A 3N35A 3OT7A 3CC2V 4DR7O 4FCAA 3ME2A 4LKEA 2DCYA 4X8AA 1MQTB 1HNZB 5FTTC 3ZPYA 3T2PA 2O8QA 4PBOA 5B1BC 3MZHA 4MSVA 4A5UB 3VBUB 4JGSA 2Q9LA 5IT9N 1OSGA 2J1SA 1EAH3 4MGKE 1K34A 2JIZG 2DW4A 2P1BA 2P4VA 5LZ6A 4LF8B 5A6ZA 5DAPA 1ULPA 3IPVB 4FPHA 2R49A 3WEZA 3T2MA 1RIRA 1NVPD 1E5IA 4DUYO 2GC2A 3AXDA 2HLDG 2EIKB 2RDNA 3A8TA 3I5DA 3A7QA 2V7QG 2ZX1A 4YM0A 2F66C 4COWA 4Q4X3 3OUSA 3RG0A 5CFDB 4CS4A 5LRRA 4RS5B 4X1YA 2OCHA 1OLRA 2D44A 2AW9A 2R041 4J7ZA 4Q4W2 4AAPA 1YJNV 1GZ9A 3OPWA 2VCAA 4I55A 2QQIA 3UKTA 2JGDB 4I2OA 1LR1A 3AG1C 5CNAA 1W28A 3MDPA 5LBBA 3DECA 5EBWC 4B3NA 1W2TA 2AEYA 4JV5B 4K3UA 3N9NA 3AX4A 4DY3A 4YPJA 3WW3A 1FD9A 2LUWA 4LBKA 4FPOB 4FPFA 4CDQA 2ZXWB 1V9U2 1HXS3 4IV1A 3HN1A 2YUEA 3DSQA 1UIJA 1XL6A 2X6AA 4BU2A 5IYBO 1Q6UA 4DS0A 1F8VA 4PLOA 2F4VB 2HWC3 1Q8IA 4Z8BA 5BR8B 1WLDA 5ANQA 3NWKA 2IH3C 4CDQC 1SS3A 3OAAG 4IV1C 4IEVA 4PA6A 1QJY3 1K4DC 4CDXA 2ZXQA 2ZGPA 3JAMN 2CHHA 2WAOA 1UOGA 5LBQA 4CP0A 1RUI2 4ES9A 5JOYA 1CZVA 3FB7C 3OG2A 4U7OA 5HXMA 4L2NA 4YSFA 3BU7A 4WV8A 2RCVA 3KS7A 5D8AB 5FOBB 3K06A 4LO4B 1OT5A 2UUCO 1JZ2A 1KRIA 4CDXC 3OGIB 1VBC1 4XW3A 3U4XA 3PJQA 5H5NA 1OA3A 3IDCB 1H6XA 2BNNA 2IXJA 4UCUA 3D3AA 4LORA 4EJRA 2W87A 3D3QA 4M3CE 4FPCA 4YARA 2KD7A 2ZE6A 4QGMA 5LOVB 4BXSV 3PUAA 2B8MA 5LA0A 1BCCH 1J59A 4YHHO 2R042 2FQPA 4LF7O 2VVEA 4P9IA 4X8PA 2IZWA 3H01A 3VQXA 1NBMG 4TUYB 1R6TA 4QM8A 4M3CB 3AZXA 1FMD2 4A6OA 3TJTA 1NCRA 1L8DA 5DECA 4LTAA 3WOGA 2HJIA 1AR1B 1HQNA 4BCUA 1PIV2 2DWEC 1ENVA 3PVOA 2JIGA 5IFTA 2UWAA 4OXSA 1Q8SA 2DURA 2RS12 5A80A 5JQGB 2YIBA 1PM9A 3VV1A 4JKMA 1TG7A 1UXXX 1NCRC 4M01A 1BVP1 4NYKA 1SDWA 2HKXA 5A1LA 3WDYA 4UB8Z 3BEHA 3LNMB 5FO9B 4QQPA 5LL6Y 1DGRN 1JHJA 5FPAA 1UU4A 3MHSC 3KF5A 2OW4A 1W05A 4LNVA 4LK6A 3GBFA 5GKAC 2PAMA 1OXCA 4DZGA 1KJRA 4PBPA 4AQYB 5T50A 3WNKA 3U0ZA 4XACA 1J1TA 3HBKA 3WNNA 3CCVV 5C3RA 1X59A 2W91A 4OFGA 1LUWA 1QR8A 4FO9A 2AGSA 2RS31 1L7RA 4BQ4A 2A9HA 5FWEA 2C4XA 4AXOA 5LHIA 3PN1A 4QDQA 4CXYA 1RM1C 3T3YA 5F7UA 5CBLA 1U5XA 3OSDA 2PYJA 2Y6GA 3BODA 4CDWB 4H7MA 2RDSA 4AHXA 4Y20A 2XG3A 3B4SA 4XE9A 1VBE1 4XCAA 5ACA1 1Z7S1 4FFGA 3W20A 2OQ6A 5FPXA 1QF3A 4JI3B 4ZPIA 4P9LA 4KWKA 1QH6A 2QDOA 2JG8B 1FXZA 1HWYA 1QJFA 4MXWA 4RQFA 1UY3A 1UXZA 5J2TA 5KR7A 1F5FA 5A6YA 3T2QA 2XVLA 2XOKG 5LMNB 1C8M3 2G38A 3M3EA 1R1ZA 2L6LA 1QJZA 1ZBE2 2HWF1 1F9KA 1PX3A 4GT1A 4PA7A 2FDFA 4MSWC 4W4KA 4TT3G 2H94A 3AMHA 4Z82A 1RSOB 2TNFA 4ZONA 4QWNA 2XLGA 2L35A 4PJ0Z 3QNEA 2Y64A 1KQRA 3T0BA 4Q1RA 2KG7B 3POEA 4I3GA 3SMHA 2CGOA 1O8PA 4JGZB 3K0GA 1MACA 4AGVA 2H3OA 4KG8A 2JDAA 3VB9A 1GP5A 3SKJE 4FTEA 2GMPA 2J1RA 3WDVA 3JSNA 1S3JA 1ZWIC 1UQXA 2WABA 3UM7A 4FK5C 4UYBA 2EAKA 3OGCC 1BMFG 1FFXA 3KCCA 3THDA 1ROPA 2VCBA 1T2XA 1ULCA 4FP3A 2D6OX 5FZBA 1K8AW 2ZX0A 2A73B 1YYNA 3RI9A 3G80A 5FR3A 1VBD3 5EWSA 1NZCA 5C4WA 1XYNA 4GIQA 4CPBA 3WF1A 1VBB1 3OD0A 3O0VA 1VLNA 3JYCA 5FZ7A 2XKPA 1AVMA 5L73A 2XUMA 5K4LA 1FPN3 2BE3A 4OUSA 5L7OB 3CCQV 3O0WA 3OTFA 1Q8PA 4WFFA 5J1XA 3USUB 4BJ0A 4FMTA 5DMYA 1J3RA 1Q6IA 5IAXA 5C4WC 3B8MA 4TSFG 3ZVXA 3MDSA 2UXDO 2OIEA 4JTAB 4AZZA 1YFXA 1SACA 4IEQA 4DV3B 1FXVA 3PDQA 4AQTA 3H1MA 2YXYA 3B2EE 2UXCB 3GALA 4DR3O 4LOSA 1PGW1 4NRPA 3B09A 1W2UA 4LLOA 4KL1A 4GB32 4CUBA 3BCWA 2ZD9A 5JI7A 3WQ1A 1RUG1 4LO7A 4PT6A 3EHBB 4QQLA 3ZFGA 1AR63 4X65B 2VZ1A 1LCLA 1M4UA 4MGYE 5GALA 1MS1A 2YS8A 3GCWA 4BZ4A 2V4VA 3AYDA 3L9JT 4O4LA 5B4XA 3N7LA 4BQ1A 5EK0A 5JXGA 1RUJ2 2LFRA 2LO1A 3JAKB 2BUKA 3ZFGC 2VUAA 4DV2O 2QQMA 2JB4A 5FZKA 4SLIA 4UF0A 3DL3A 3ABLC 5FXZA 1ACCA 3K9AA 3AZZA 1JCHA 2LTNA 1X9PA 1WCUA 2PHRA 1KYOF 2QR4A 4LMFA 3VHOA 3NO8A 1OF4A 3DN7A 5IJ9A 4GWMA 1GNHA 4R52A 4A7KA 1UOFA 2GTAA 4ZIBA 3DCQA 2FCVA 4NIAA 1BEV3 2BBVA 2Q73A 3P3NA 2RS52 4X8NA 5KXCA 3OY8B 3CMEV 4CUCA 2W6JG 3ZXAC 3N9LA 4BQXA 2BJSA 4GA9A 4P9YA 4FFFA 1U5YA 3HBZA 4LR3A 4META 2ZPXA 2BSKB 4K8XA 3PURA 1M5IA 2VUCA 3UGGA 4JVAA 4JHTA 1MMMA 4XJAA 1NE4A 3EMRA 4H0LB 1MS4A 1ULEA 1DGLA 2YBSA 4ZZ8A 2WAMA 5I8TA 4DV6B 1W6OB 3ECQA 5FAXA 2EX3A 1GM9A 3FBMA 4FPJA 1LTEA 1MS5A 1SEFA 4AVCA 1NY71 3VBSA 1OH4A 2OUJA 4I0BA 1DZTA 3IDAA 4O7XA 4DV0B 3KV6A 4Y1VA 2ZZJA 5AC91 1AI6A 2VWKA 2UURA 4NXNB 1LJ7A 3BRCA 3POGA 1L0NH 4K8FA 4OQ8A 3RJRA 3OEEG 1BVVA 4XCBA 4CZZA 4NPRA 3QD6A 1Y9MA 3HMYA 4JKKA 5DUUA 1IX9A 1UPIA 4AEDB 3VBSC 1ST8A 2WN3A 5F5CA 1G9AA 1GQGA 3WNPA 1MOFA 1POV0 3CJHA 1NUKA 2IXKA 1OUSA 4BQYA 1P84F 5CMUA 5T3NA 1J3QA 4K0KO 2ZKNA 4MOAA 1LECA 2ES3A 4XFCA 5A3LA 1XE7A 4D3WA 4AQ2A 3TRSB 3NNJA 4ZXKA 2QDRA 2GN7A 3I2KA 3TN91 5JXJA 5F2VO 4XJUA 2VQEB 2WFF1 4COVA 3KVAA 1KKCA 3BVCA 3RSJA 4DRVA 5EBMC 1Q7YW 3DF0A 5EYXA 5C9AA 4A7YA 4ZBMA 2E53A 1ASJ2 3RYHB 1XE0A 4H55A 2WLLB 2ZT9B 4LXLA 4DV7B 3ABZA 4FFHA 2IC1A 4HK8A 4YW4A 1DU3D 4LPLA 1RVF3 2WUHA 2E33A 2CTWA 3S3WA 1AJOA 1MNGA 2GU9A 3SYAA 4DB5A 3VL9A 5C9AC 1E5RA 2P3IA 2PLV3 4WM8B 2ETEA 1XNDA 1NJIW 3CXHF 1HQWA 5FZCA 3AFKA 1ZZ7A 2F23A 1XILA 1PO11 4Y22B 3FHQA 1J1LA 3OBAA 5GTHZ 2GAUA 4HN0A 4FSJA 3SJAC 2VM9A 3D3IA 3SPGA 4FLZA 2UU9O 2ZMKA 4BMEA 4DUZB 2Z79A 5AC92 3HR0A 1WD4A 4JI7O 1CJDA 1WPXA 1WLTA 2NPIA 4C8DA 2VOVA 1QJY2 3MD0A 4RFT0 1H30A 4ZOLA 4DRXB 3OGSA 3A4UA 1QLNA 1IS5A 3ETPA 5HBAA 4W6XA 1JYWA 5LRSA 1AR83 5GZCA 1EZVH 3NNMA 4UFIA 3WQ0A 1X33A 4DR1B 4PDWB 1SF9A 3V56A 5DAQA 5A3WA 2CY6A 5FQ0B 3B93A 3C90A 1XNQO 5L3CA 5F3CA 4IV3B 1OQDA 1QJU3 1TUBB 4IHJA 4XFIA 4URTA 2WNUA 1ALYA 1GN4A 1Z78A 1IBKB 3DPRB 4UCVA 2BVVA 2JX9A 1QJEA 3N7JA 1PK6B 1C3HA 1CVNA 5LW9A 5EYPB 2IU0A 2VCCA 1TGOA 5KMGB 3WUCA 1N32B 3P6BA 3VDDB 3ABUA 3FL7A 2WNUC 4XPVA 4LKSA 2DFBA 1WB8A 2UXNA 4BW9A 1JOYA 4K1ZA 3ZXJA 5FZFA 1QJX3 4XQ4A 2VGDA 1R1A1 1O4TA 4HKWA 5HCHA 1CESA 3QTCA 2DDUA 2VZPA 3FYIB 3VBBA 1WMDA 4HMZA 1AL22 2XJTA 1TA8A 2WNEA 1RMU3 4Q5OA 3FC0A 2A7AA 3MFCA 2PGGA 3SH4A 3PVEA 1V9PA 4AHYA 2DYSC 2MW2B 2GNMA 4Q4Y3 2IWGB 1AJPA 1W0KG 2F93B 2VBBA 4RYDA 3RYKA 5FZ8A 3UGHA 2ARXA 2R072 3POYA 3I54A 3EXAA 3HKDA 5T5OA 1F4AA 5LEKA 5DUVA 2C2AA 2FBEA 2B9ZA 4GCZA 3FKSG 4JDOA 1SLAA 3LD8A 2MEV3 4YZ3A 3AMNA 2B5HA 5KLVH 3U10A 4XFBA 1N3QA 2PHLA 4CCKA 5FZ6A 4GWIA 2WS92 2JGDA 3O1PA 3JAWA 2VO5A 4Q0UA 1QNYA 1IS4A 3BTAA 5KUKA 3KV5A 1CAVB 2Q5ZA 4FPPA 1OOPA 4LFCB 1FAFA 3ZRSA 1PV0A 1A8DA 1DDLA 1W06A 3I2OA 3RWRD 1TME2 5FZ3A 2Y4UA 3PUIA 2JK5C 1AP6A 5FXVA 3B9IA 1V6NA 2ADPA 3JATB 5LXTB 2V09A 3ZO0B 2BGOA 3E8BA 3ZFEB 1K3IA 1OOPC 1I6XA 3R05A 2KXLA 2RDCA 3ZDVA 1WMFA 2XJSA 2ZNIA 1I1EA 5F2SA 1DGWA 3BB6A 3K3OA 1D7PM 4QU2A 1QQP1 2Y6KA 4MTFA 4OQ9A 2VW0A 1W8UA 1WP8A 2P3YA 3HT1A 1R64A 4LBMA 3ZYRA 3GWOA 2VVFA 4JI0O 1BQ0A 1TUEB 4B3TO 4Q0SA 1JH5A 4M0HA 2LM3A 5CFCB 4U3JB 4QQOA 2JS3A 2EVXA 5C71A 1CR7A 2RN9A 2GALA 4YZ2A 2GN3A 4FLUA 4LF6B 4FQ4A 3J81N 1APNA 2GUZA 3VZMA 1OLQA 5IW0A 1RUNA 3CEWA 2P90A 2QWPB 4MLOA 3ZDSA 3W21A 3AK1A 3J7LA 3PJYA 2JDKA 5F32A 1DZRA 1DK1A 1DGRA 3WP4A 4QB2A 3CQOA 5KX5B 2YMZA 1ODMA 3K51A 4E2GA 1BBT2 2L9LA 3DC6A 4OPHA 3CRAA 4NROA 4HL0A 4R9BA 1UMHA 5ANNA 1QGLA 1N36O 2JB8A 4YLZA 2WZPP 4AWDA 4MGZE 3OTOO 4YFZA 1QXPA 1YQCA 2WRAA 4IEXA 5LK5A 4TV9B 4M3CA 3ALQA 2B1IA 3MICA 1S0CA 3U37A 2IM9A 1AYM3 5B3SC 5H9PA 4H33A 4QXCA 2EINB 1LRHA 4FI9A 2WC2A 1AR72 2HLEA 4KHPO 1RUD2 1MZFA 2YXSA 1CAXA 3AL5A 4OZOA 4W4LA 5BMVA 2E3CA 1MEC3 2XQRA 4N8MA 2WIIB 3RQ0A 3PVBB 3H1JH 3WDWA 2XWBB 2FDKA 3ACLA 1ZA7A 4AFBA 1GWKA 3HNBM 2QWOB 2VCMA 1W39A 2A3QA 4AQ6A 1LAJA 4JYCA 5FPLA 4F6RB 5DDJ3 1JXNA 1G9BA 3MAQA 3SPJA 1YJLA 1OLME 1PNMA 1O9HA 2YIBD 3HKBA 1YQ2A 3IT8A 3P5BA 2BW8A 1RXFA 1EY2A 2C6SA 1I94B 4FXGB 1NG0A 2YG0A 4AVSA 3RGBA 4JAVA 1SPPB 5DN2A 2PTMA 4TV8B 3SJQC 4EE2A 3AMPA 1GN3A 1JMUB 4G3YC 2XLAA 2W3JA 1R3IC 5LBCA 4MTOA 3CJIB 2ZCWA 3K2OA 2RQ6A 1Q5OA 1EZJA 3SCFA 1JYNA 3IWZA 2KQXA 1CJPA 2ZE7A 5IAVA 3ASIA 4O9GA 1M1KW 2O14A 4MVUA 3EHKA 1NH2B 3ABKB 5BZBA 5EIBC 3LEKA 4AF9A 3RYIB 1O5UA 2VU9A 3I8TA 4NHXA 5FYTA 2G1MA 2P34A 5GLTA 1W6MB 3BOPA 1JZ6A 1UOJA 4LF9O 3H1KH 3FAVB 4Q1PA 1AF9A 3ZSJA 5IVFA 4LP8A 2UUBB 2JG8A 3J8F2 5JR7B 4D69A 2D3PA 2XVGA 3I56V 1V70A 3T1YB 4LBLA 2VMFA 4CCEA 4JI2O 2XJRA 4KWLA 5IFPA 3VD4A 4M0NA 4QDRA 3CF6E 4KWJA 5AFBA 4LITA 3FB6C 4BQ2A 2HWB3 4QD2A 2UWBA 3TEXA 1YI9A 4LNUA 3U4SA 2QZ2A 3I3MA 1RUC1 1OC1A 2AC1A 1COV3 2JG8C 3MI8A 4JTNA 4W4ZA 3M1HA 4FIPC 4GH4B 2BCCH 5K8SA 1PZ9A 3KM5A 1EPZA 1WGPA 4CXXA 1Q81W 2B42B 2Y8KA 4DR5B 2P5OA 2D6NA 3AJYA 4W6WA 1JFFA 4SBVA 4CEYB 2A71A 2ZGMA 1OKQA 2VTXA 1OQEA 4EN7B 2IH1C 2P67A 1AJNA 2YPJA 2IVJA 2VNVA 3AG4C 1R3JC 3PTYA 4X6QB 1ZRDA 1HW7A 3DKWA 2NMNA 4DV5B 2KM2A 3RI8A 4ZI7B 5L3EA 2B9UA 4CU9A 2DTWA 4RHV1 3N27A 1XOUA 4KWUA 4AFMA 3WHTA 3NMBA 3T08A 3W58A 1PO22 4CS3A 5LMUO 3I2IA 1X8EA 3AVRA 1RP3B 5AVPA 4EROA 1STMA 1N33O 3ZMUA 1RHI2 4KGQA 5APAA 1TMF1 4CPBD 2OVUA 1VMFA 1WBFA 1O3QA 2X29A 3B77A 2E5LO 3F7YC 2W68A 4BLJA 2BTQB 3K79A 2EA7A 4AHCA 4CP1A 5KHKA 3ZXLA 3JD72 5EXOA 2Y48A 3T0DA 5LY2A 5GONA 1VP6A 1HDJA 2HWE1 4R50A 4OGQB 4JI5O 4AI1A 3A23A 1OZ0A 3I2GA 3TWIA 1KQSU 4QX1A 4LFAB 1UIKA 1DQ5A 5IDJA 2Y69B 4CSWA 3MIGA 4JAUA 5JWPA 2Q8EA 1KFUL 1TZOA 2BQPA 4IE4A 1E5HA 4ICGA 2DU0A 3CSXA 1SZXA 2RJ2A 5IVBA 3BI3A 3HPNA 2XBO2 1Y66A 1WLEA 4QPWA 1M57B 3CB2A 1I5PA 2VMDA 2QQPA 5EC1C 2GDSA 4Y26A 2WA3A 2IJIA 4FVMA 1UZYA 1YJ9V 1YHQV 5J09A 2ET7A 4FFKA 3ZXKA 3CRRA 4I7ZB 3TK1A 3TXQA 3K58A 3AKSA 4NXMB 2JJ2G 4IEZA 1KDMA 1IHMA 5IYYA 5ITZB 3KZ4C 5A7OA 4LR4A 1VRH1 5KA6A 4CZSA 1QNMA 1NR7A 3N2GA 5HCAA 5J96B 4S2HA 2Y34A 4FPEA 3RPQA 4FAHA 1XJAA 3VHNA 3RMXA 2AZ0A 3M8LA 5K0UB 1GMGA 2A3WA 5DPNA 4KU8A 5LWBA 2UXDB 2FMDA 2EALA 4FT8A 2VD7A 2R72A 2ZEYA 2WQ8A 1SLCA 1AYN1 2QQOA 3WNOA 4JZ2A 3RVZA 1D5NA 3CZUA 5JCTA 2ZGOA 3KT7A 4DR3B 1V6IA 3POIA 3HQXA 1F5JA 1H2SB 5JZGB 1VQ5V 4GAZA 1F7YA 4XUPA 2FDIA 4FBFA 5FK8A 5I0SA 1QJU2 3BYWA 4BWAA 5T55A 4O2BA 2WN2A 3EYPA 4WF9V 2WDBA 1D5AA 4EWEA 3JQXA 1RUF2 3TBDA 4A2UA 1Y9QA 1UMIA 3F95A 2WLIB 1S1AA 1Q8OA 2X7RB 3N36A 2AUYA 4XF1A 5JXHA 1AJKA 3P1IA 4Q26A 5FV3A 4ORFA 5A7PA 3FLPA 2VZOA 4LHKA 4PD4F 2Z5WA 3LEIA 1EAH1 2QE3A 2D98A 2QJVA 4MUVA 2VQUA 5CB7A 2DYRB 1US2A 2BTOA 4NIIA 3PIJA 5BV6A 4GJYA 3LNNA 3K57A 4AI9A 1S0GA 4QX8A 4Q4X1 1A34A 3POWA 1CAWB 4AE2A 3QCWA 4J7JA 1RUH3 4GMP3 2BVBA 3FYEB 1ZBA2 3E22B 3MBWA 3H7YA 5A3UA 2LGWA 2PXJA 5JI9A 4AEDC 3M3QA 2WFPA 2HHHO 2W5FA 4B3RO 3ZSLA 3E2EA 3PIGA 2VUJA 1LNSA 1SZBA 3E8HA 1HXS1 2Y60A 2JENA 1IBLO 4LF5B 4MTXA 5E8AA 1JI6A 1QIQA 3O1OA 3RYRA 2H8PC 1LU1A 2VOXA 2YBKA 3R65A 2HWC1 4OYUA 2WYFA 2P6HA 4I0AA 5FP4A 3B01A 3VBHA 2VOTA 1VQ6V 2OZJA 2JEXA 4JGYB 1W0OA 3ZN5A 3CEIA 3UQ8A 1D4M3 4OVEA 4FJCC 4MVOA 1XQNA 1MSDA 1F2NA 2ZZQA 3WF0A 2WNOA 1GKFA 2RMU1 4Y5TA 4YFWA 1BHAA 1QLEC 1RITA 4QGNA 5C3PA 4CP9B 2DUQA 4K35A 3VBHC 3WDTA 1K97A 2A3YA 5L19A 4DR4O 3JBG2 1XMOB 3ABMC 5C93A 4BIUA 2OA2A 4RWUA 4AAXA 2FD8A 1PNFA 2W9XA 4F7ZA 3F7VC 2NMOA 1FOD3 4E4HA 1VIWB 5EYYA 1CPYA 2D6MA 3ZLIA 4CCCA 2PA7A 1U12A 2A7WA 5LP6B 3FX3A 4HBNA 5H9CA 5JVVA 3N9OA 3WB0A 2VUDA 2EIMB 2ETNA 3ETEA 3LE0A 1RUOA 4K6BA 3B69A 3ZFFB 2QBXA 4H3WA 3VN4A 2VY0A 5ABJB 5CA3A 3ZXEA 3DC5A 5GZDA 1PVC3 3MIEA 3K9SA 3X2QB 1HLCA 5FPVA 2YI9A 4CUAA 1TVKA 2RM22 4P9PA 4IV3A 2R32A 5CN0A 1TUBA 1WZXA 2MK3A 1XNKA 3ASNC 1HR0B 3DPRA 2WNVB 3HQUA 2EXIA 3I59A 3VD7A 1PK6A 2QQLA 4LBQA 5KA5A 5CA1B 5CKNA 4DY5A 4QU1A 1QDCA 4I4TB 3MIBA 1EN4A 4PDMA 2GSYA 4EQVA 1OCOC 1R3KC 4IV3C 1O91A 1K5MB 2VQTA 3FLRA 1W2OA 5EBLC 4LO5B 5F3IA 1VF7A 2E7TA 1S2BA 1ND3B 4R8CA 3DPRC 5C8YA 1PK6C 3H1WA 4N9IA 2UU9B 4WVZA 4NTYA 4HNAB 2IXLA 5H2FZ 4XURA 1UKGA 3AKRA 3HT2A 5FLIA 1Z2GA 1MABG 2UXXA 4EEQA 3LKJA 5J36A 2ZQMA 1Y76B 3LUTB 2UXBO 1RGSA 1MVEA 2CL2A 3W5NA 1MEC2 2RMU2 1L7QA 2BV4A 4CXWA 3OGVA 1SETA 4Q0PA 1OQ1A 5JJNB 5BYNA 1DGSA 4X1IA 1AR5A 4D7TA 4TWTA 4RGAA 4LULA 3K04A 1YNAA 1VIBA 4NVPA 4TLGA 1R092 2XWJB 4DK0A 2VTFA 4MVTA 1M56C 4LHNA 4L8QA 5BNNA 4B3MB 1LEDA 1XNQB 4O61A 2CGPA 1W2NA 3OOXA 3Q9OA 1WPBA 2JE9A 2HYKA 1LGCA 3JXSA 3AK0A 3B3QE 2WLHA 2GNBA 1V6KA 4OHXA 2Y26A 5E1RA 4BB3A 1LB2A 3ASOC 1Q43A 4YG3A 1UCXA 1G1XB 5BNNC 3WNXA 4S2GA 2YFZA 1HRV2 1PGL2 4WFBV 3APOA 4MZUA 4P00B 2EZOA 4FVVA 2YEVB 1A78A 2RR12 4QHBA 1C8M1 3FMGA 2P7TC 2V73A 3OB8A 4MVQA 4JI8O 3SISA 1GLHA 1AI7A 1GOFA 3E97A 3K46A 4RAIA 2YGMA 5LYJB 5FZOA 3UT5B 1JZ8A 5IYCO 3PHMA 5JDBA 1ZTEA 3RYCB 1SERA 3UO3A 4X1KB 4RGKA 4IGOA 3T1HB 1YFWA 4IGPA 4NR1A 2JDUA 3B00A 3GHMA 4Q4W3 3OUHA 3A21A 4RR3A 4MH0E 4CU7A 1UZ0A 5JH7B 2W6IG 4NHMA 3N2KA 4CE8A 3NV1A 4J9YB 1JUIA 3BABA 5FO7B 3Q8EA 4XXPA 1JJ2U 3SH3A 5L9VA 4A41A 2DN9A 4ARXA 3OM3B 1V9U3 2MPFA 3IZOA 1VBD1 4RR3C 5EPAA 3E8FA 5LBFA 1YF2A 2UY9A 1AI5A 3CS5A 3GDBA 4D7SA 3WQBA 1JOJA 3ZHSA 4NHLA 1FPN1 4GKKO 1GANA 1UYZA 4XJ9A 1S0VA 3M99B 1V0AA 2DVGA 5F5IA 5I0DA 1O4YA 5F5AA 2G9FA 1AVBA 4OULA 1DF0A 1WP7A 1RUI3 3I2DA 3L2HA 4ISQA 2ZGQA 5CADA 4ATEA 1KU9A 4KFMA 4LFBO 1BHGA 1R082 5ERLA 2RJLA 5FMOS 1G6NA 2ARBA 4KI5M 1H8TB 1NKDA 1PPJH 4FOVA 3CC7V 1NA1B 4FFBA 1BT8A 3Q4HB 4X64B 1P8JA 3O5SA 1KS4A 3VDCA 2VZRA 3I2HA 3CMAV 4FQZA 1SCSA 3KT4A 2JDMA 4YVSA 1AR61 4BMBA 4K7JA 2R1DA 4IYIA 3HKCA 3RZLA 2UYBA 3NKTA 3IDEA 4AI8A 1WLWA 3BFRA 2EICA 4QPKA 2K0GA 1N0NA 2HEPA 2JDIG 2Q8OA 1UO9A 2F1MA 1RFYA 2R043 5HI0A 1NTKH 1UYYA 3M4FA 4PQ9A 5AG2A 4YVSC 4B3TB 1CAUB 4IUGA 2RMKB 4IXLA 1OHHG 3JD2A 4Z07A 3CCMV 1FMD3 2EILB 2WQ4A 2YIAA 5G04L 4N23A 4IE0A 4NMIA 4GLXA 5I0TA 1CP9A 4OI1A 1PIV3 3WG7B 4LWSA 1PM7A 1YO8A 4AI3A 1PZ7A 4CCOA 3FHAA 4OI4A 3HAGA 1AR91 1QY4A 4YXWG 2RS13 1P7BA 2O0OA 1BEV1 4QPIA 5A32A 1GSLA 5FZMA 1G8WA 2NQYA 4R7CA 3KVBA 3U07A 1CEZA 3IFXA 4Z1MG 3JQWA 5FZ0A 3BY6A 1HV0A 1W6QB 4M4PA 3H9AA 5KHGA 4CRQA 1CPMA 1PMIA 3OBRA 3RJ2X 2RE9A 2VXRA 3ZMTA 2VQFO 4JI1O 4TN7A 2FB5A 4OI2A 3W7UA 4H13B 5JVDB 3THOA 2JGUA 2WPDG 4QPIC 4FOWA 3UV9A 4NN0A 1GWMA 2OX0A 4D7YA 3T30A 1WBLA 5KXEA 3LIHA 4DNYA 4MX3A 3OW2U 2XVKA 3CIHA 2A6VA 2D6LX 5EZWA 2XAJA 3ABKC 3UYJA 2ZGUA 4PELA 3RDIA 4UCSA 1N34O 1N0JA 2P4EA 1FI2A 4CC6A 3IM0A 2QE7G 2HWD2 1E5SA 1UW8A 1PM4A 4O4JA 2Y6HA 4CDUB 4J80A 5CBFA 5A33A 1YWKA 5F2WA 1LU2A 4KBZA 4GH4A 4NJ4A 3WB1A 3PMEA 3KQRA 1ZZBA 5HV0A 3FFQA 5LGUA 1OCZB 5FOJB 4XMAA 1GQPA 2R062 5DZFA 1ZM1A 3M3OA 5L9RA 1ZBE3 4CBCA 2Q69A 5I0RA 1J3PA 4GH4C 2YXLA 5BXZA 1DZQA 1S2EA 2WLMA 5BNOA 1SC5B 4Q4V2 4URAA 2EIGA 2PQQA 1XNRO 4XXAA 3KT1A 4FLXA 5A3NA 5LEJA 5JSOA 3NJZA 3EQEA 4MV2A 2ITDC 2OPWA 4PDRA 3UKVA 4LF9B 2W2IA 2GNDA 1JJOA 1ZL8B 2JECA 5T5JA 5BNOC 4WBNB 2VBPA 2CU5A 5FYZA 1V6JA 1RVF1 2WLKA 4JI2B 2C9KA 4GZ9A 4UBHA 2Y4TA 1XI1A 4EKWA 2QM7A 4XMIA 1Y74A 3DXRA 5L36A 4ZHQA 1OBNA 3H3LA 5KC6A 2PLV1 1PNGA 4DXSA 5FLHA 2W46A 1WAZA 1YI2V 2C24A 2X5IA 1DF4A 2I74A 4CCJA 5C8CB 4UCRA 5FY7A 3UKNA 5CBGA 1Y6XA 1AUYA 4AHZA 3SCGA 3WW4A 1XU2A 4XILA 3FWEA 3ZMOA 3W5MA 3PMSA 3K08A 1YQ5A 1KC8W 4LKFA 5FZHA 5GZEA 3ZXFA 2ZINA 3TXSA 3LPGA 1GUIA 5BNPB 2X5IC 4XUOA 1HB4A 3ZN1A 4MVSA 4XTMA 1Q90D 5ACA3 2Q4SA 4J9ZB 3M3IA 1W3XA 1H38A 3OD4A 3TCUA 4YJ2A 1K12A 2WZR2 5G05L 1AR81 4L0PA 3DXTA 1KDKA 1H9PA 4QPGB 4PIYA 4GB33 4CC5A 4O65A 4KNCA 1EN6A 1SQGA 2ZIMA 2D40A 4JTDB 1JYVA 4PLMA 2VZ3A 1N33B 1XXNA 2AGAA 3D0SA 4FLTA 2A75A 4K40A 4DXWA 2K9ZA 2VPVA 1YC61 1RUJ3 1ENQA 1NS1A 1B06A 1YLLA 2JE7A 2F95B 1JU4A 3GVMA 1MZ5A 2GC0A 3WG4A 4PIXA 4XFFA 1N1SA 1TNRA 3DYMA 5C70A 4IE5A 1PMJX 4Y5SA 4UFHA 3A0HZ 4LEJA 3LCPA 5FK7A 4HN1A 5K0UC 3KMHA 2E76B 4PI0A 1WW5A 3BTZA 5FLXN 3K5OA 5FMDA 4NAOA 4ITCA 3SYOA 2DUOA 3KD4A 4EB6B 3CCUV 1QJX1 2XB6C 1HDKA 1SKVA 1L0LH 4UAPA 5A3TA 2RS53 1GWLA 4YVWB 1TQ5A 4HG6B 3I7DA 4K3AA 3OMIB 4HETA 4F6EA 5EJ1B 5IK5A 1KP3A 4O4IB 2UUAO 2DCZA 1RMU1 3C7GA 4BXFA 4QIWF 3LZZA 3GBWA 3JCUZ 3SNMA 4Q4Y1 1QMJA 3LWCA 1F4MA 1HV1A 2YGLA 2RG4A 5FDBA 4E8DA 4O4HA 3MPPG 4BOWA 4BK4A 2A06H 5CBHA 2W0XA 5B5EZ 3ACHA 3IC9A 1LKNA 4L87A 4MTGA 1UF2C 1WA4A 1WMEA 1QVFU 2MEV1 1CONA 1KXGA 1JMKC 4G4FA 5DZGA 4LOTA 5T52A 1XSRA 3HEIA 2B5UA 1YSCA 2PAEA 2V4DA 4X20A 5AFEA 1NX9A 4QB1A 3T4DA 4X9QA 4B29A 1D0GA 5C3SA 5FYMA 2IFRA 1W8FA 5J2UB 3WQ7A 4DEQA 1VBA2 3E6DA 2JEUA 4AYUA 3JARA 3QF7A 1BQZA 3K3WA 1TNFA 2EIBA 4HPKA 2Q8CA 2V1DA 5LASA 4PDVA 3I97A 5EZYA 2KR2A 4XFGA 3LDKA 4PQQA 1PL4A 3ZX6A 5LA6A 3WV6A 5FYUA 2XL9A 4YM3A 4A4AA 1SLTA 4TXWA 3A0RA 5J9PC 3OBZA 3NJYA 1O3RA 2JG9B 3ZYBA 2VC9A 1BSMA 4MADA 4JI4O 1WCDJ 4DRRA 2WINB 4N7UA 1MS3A 1V55C 1ASJ3 1H2MA 4CEWA 1QXRA 5H9RA 1ZYBA 1W6NB 2TEPA 1S0DA 1G6UA 4JV5O 1QXJA 3VBOA 4N9HA 4O2AB 4X88A 3F5TA 4Y1YA 4JRLA 3O12A 3LOIA 2EJ7A 1F4HA 1Q86W 4UV8A 3ST7A 4CEWC 2EIJC 2YV8A 1G9FA 1LHUA 2HHHB 1QKQA 4RUEA 1QQCA 3UNPA 1T6BX 3I3BA 4YWAA 4IQPA 2D2CB 3VBOC 5FLJA 3LA7A 1DQ1A 3ZFFA 3VKLA 3EXUA 1KD7A 4GKXA 1IBLB 2BNOA 1ND2A 4TOIA 4QKBA 1BXHA 4BWOA 3KKYA 4GKYA 3ZS8C 5AC93 3W7TA 4XJWA 4AVAA 1AYM1 1XHXA 3ZRXA 1K4CC 5JOWA 3AG1B 4OX9B 4WVMA 3ZFFC 1O7FA 3KHBA 2XDVA 4TYSA 5LATA 4PCRA 3ML0A 1ND2C 2GP3A 4X1YB 2VNRA 3AB0A 2VWJA 1M93A 3UJQA 1PVXA 3OMAB 4I55B 2DWRA 3ZHTA 1ODNA 5DDJ1 4LBQD 4Q27A 2OCCC 4ASLA 1G9CA 3JALA 2ENRA 2BTVC 2C9AA 4DR4B 5CKMA 2R7EB 1ZRRA 2W1WA 3ZYPA 1BMV1 1XL4A 1T5EA 5DM6V 2W1UA 4U3FH 3WP5A 1KITA 4P9JA 4CDQB 4QGPA 4ASKA 1MR5A 2DF7A 2O1QA 2WLJA 1IQDC 1DGWX 1SLLA 5CEHA 1RINA 1UYXA 3AL6A 2LW8A 2LALA 4IEOA 4J25A 4I9QA 2VOWA 4L92A 1QHTA 1IKPA 2CH7A 1W9FA 3AG3C 2XUEA 5FP8A 3U14A 3LPFA 5DUWA 4YNIA 4PA4A 4JAAA 5FY9A 3T0AA 5F6LB 4CDXB 1GR3A 3ES1A 1KEXA 3HJRA 2ZACA 4AFCA 2D7FA 2X6BA 5CYYA 4NPLA 3STZC 1QCEA 2YICA 1FJGB 4U36A 2JD4A 1VEWA 4LKDA 1Z0HA 1AL23 2QTOA 3WF2A 5FY0A 4IW3A 2C1FA 4UXNA 5J48A 2P6CA 4PA3A 4FM0A 1GBGA 2VE1A 4IGQA 2ILMA 3ZHUA 4AQYO 4WZFA 1UZVA 1C57A 3TNPB 3T4ZA 2HWB1 3ZMZA 2R073 4DINB 2DWDC 1COV1 2Y6LA 5LY1A 2UXBB 4ZZ5A 4X1KA 4AVBA 4C1WA 2VTXJ 1YJWV 4P14A 1FV2A 4OUMA 3E8GA 2Q1ZB 5LBEA 3WR0A 4XBFA 3ZEDA 3DV8A 1VBC2 2VMHA 3H50A 2WS93 4B4PA 2R30A 5JH7A 4E9KA 5KXDA 4NB5A 1NCRB 3WX5A 2XASA 1Y43B 3CCRV 1QOTA 3NVCA 5IWAO 3LFMA 3L74H 4MHRA 5E88A 2DMXA 1YHFA 2H6BA 1H8VA 3VKFC 4JI3O 4RQPA 2E9QA 1TME3 4F4LA 2XH6A 2PY5A 3LEGA 3ZR5A 4LF4O 2D97A 4NWWA 4LJHA 5LMNO 4IEYA 1W9SA 4L99A 2BOBC 3JASA 2ZM6B 4JZRA 3CCSV 2ARAA 3M70A 1W9WA 3VL8A 1UY4A 2OQ7A 1VR3A 2PF4E 1QR9A 4JQRA 3ZIAG 1SLBA 2YZ4A 4MGSA 1SA0B 4PV1B 4RQPC 4AGGA 3E5XA 4OMCA 2CGNA 2Q30A 2MHFA 3OR7C 5JSPA 3CCEV 2HR3A 4XQWA 4UCOA 4CCNA 1RM1B 1VF6A 1QU0A 2LGQA 4XDPA 4UT5A 1NA1A 3BOWA 3P30A 1S2KA 4OHZA 4QHOA 1Q6HA 1DLLA 3DXUA 4XDQA 4W8JA 1NKGA 4YW1A 4AFAA 1ZZ8A 4PJYA 5B1NA 2PN5A 3OE7G 1NXD1 2OPKA 1FNZA 4FOQA 3S57A 3QLQA 2UWCA 1VF6C 5FNVA 3VQVA 3E6BA 3C8XA 4P02B 3VZJA 1LENA 3UESA 5FXXA 4Y20B 3C3SA 2BFUS 4QX2A 1K9MW 5C5TA 5EFUA 1NA1C 1FXKA 1POV3 3OGJA 2GV9A 3VUOA 1B35A 2CDOA 3CJXA 1BBT3 4GD4A 5FBJA 1QBZA 4WFGA 2H0VA 2Q0AA 5CB4B 1E1QG 5J2TB 2RS32 3BHPA 3L75H 2VW1A 3NV4A 1JX9A 4UVCA 1NCQA 2D5HA 1FXKC 1Y67A 2V4AA 1YJKA 1B35C 2OIIA 4GKKB 4DV3O 1W8OA 2PZSA 3AP7A 3AP4A 4O9EA 1AR73 2X8KA 1XYOA 1VBE2 1RUD3 1UY1A 5ACA2 1Z7S2 4KXRA 1GFF2 4IIJA 2BOIA 2D3SA 4D94A 3PTRB 2Y38A 1UOBA 4I50A 3P3PA 2QFEA 3K77A 4CCMA 3O1TA 5KHIA 5A7WA 3H42B 1NCQC 2ZNJA 5CG8A 2AR6A 1F15A 2EILC 4LFBB 1S55A 4AI2A 4GZRB 3TGUH 1SQPH 3ETDA 2HWF2 1DYPA 3R4UA 3LSSA 3F5WC 3QVNA 5FPRA 1FFXB 1RC6A 1IKQA 2V5YA 1F31A 4RN5A 3POSA 2VZVA 3ZSKA 1RB8G 5C7GA 4OI0A 1GMMA 5JVDA 4FZ1A 3H3ZA 2ZS6B 4BPZA 2J1EA 3NAPA 4D6SA 5A3OA 5C4WB 1X7NA 1MSWD 3GXUA 1XSQA 1UPSA 1GV9A 1Y3TA 1SBDA 1NH2D 5FYHA 1T6GC 4FOYA 2NNUA 3CHXA 1CQ9A 3ES4A 3BPSA 3SYPA 5A7NA 2A79B 2AXTZ 3NAPC 4GWJA 3AC0A 4LH7A 4X89A 3K59A 2PELA 4YYOA 2XAHA 3ZRWA 4CDUA 2RHPA 1GOHA 4IEWA 3LOBA 1VBB2 1EPWA 1HX6A 5EQUA 3H1YA 3MLKA 3ATGA 1CZTA 5FP3A 3QOPA 4KGGA 2EF6A 1C4RA 3J8F3 2PHTA 1GN2A 1MS8A 4HLTA 3AKQA 2DVBA 5GJ6A 1JZ3A 2H6CA 1WW6A 1RUH1 3ZFGB 4GMP1 4CDUC 2PI5A 1C1FA 2CE4A 2A3XA 4YJ3A 1F4NA 2KSDA 3ABLB 1V6LA 4EN0A 3H8OA 3TNQA 4O4LB 4X6RB 5IVVA 3RS6A 5KHJA 4J11A 4COUA 1N1VA 2ODMA 1I5XA 1IPKA 2HYXA 1UX7A 5IHRA 3NJXA 1LOBA 1OCZC 2R9IA 2AH2A 4FLVA 1BE3H 1DBNA 4E2QA 1PGW2 1U5IA 1JYIA 3U1XA 3H3UA 4YY3O 4UF0B 4JQTA 1RUG2 3VD5A 4TLFA 5GZGA 3BU0A 4NXNO 3MGUA 5FZEA 5I8SA 1UZWA 3AFGA 2XTAA 3A0NA 1YITV 1UKRA 4QKFA 2ITCC 1BQPA 2IFWA 5D21A 4NKGB 2YSUB 5GW7A 1EN5A 3KV9A 5IJ9B 1HP8A 1D4M1 2ZHMA 4K20A 1YVWA 1D2DA 1JYXA 1VRBA 5A7QA 3K48A 4YW5A 1PO23 4MVRA 5JAXA 2CK3G 3J9SA 1J5EB 2QWNB 1W0PA 1A32A 2HVJC 2D43A 4QAWA 3JD0A 1XQ8A 1RHI3 1X4TA 4DQAA 4M00A 3J7NA 3OPZA 2VQEO 3T09A 3TEYA 1OUXA 3W7XA 1V00A 3M7MX 2HEYF 3LGRA 3NJVA 4BQWA 3R6SA 4CP2A 3JD73 5B66Z 1CX1A 1UJWB 4DV7O 2R1BA 1EV11 3CXCU 5HV4A 1KB9F 4OHVA 1WLCA 1YRZA 1IG0A 2BWAA 4X62O 4DV4B 3MIDA 3WUDA 4PDLA 5FZDA 5DG1A 3VBSB 1Q56A 5HCFA 1PVC1 2ZR3A 4AQSA 3O1MA 4DR2B 1IBMO 2QKAA 4ZU4A 4H37A 1YDXA 2ZA9A 3GJAA 3Q8CA 1DLBA 1OMIA 4I0XA 1ULFA 5CA0A 4KUMA 2XBO3 5IY5C 2XJPA 1YI7A 2IXCA 1FATA 3GBGA 5BY5A 4UFKA 2ZAAA 1G86A 4I30A 4DUZO 3OEAA 4N43A 5KXBA 1ZREA 5KAIZ 4LK7A 3NSTA 3CJHB 1NY72 4Z92B 4UVBA 3WNMA 5FYSA 3KLSA 2R9RB 3VKMA 2WO7A 2JJ1G 3L9DA 2QQUA 5IYZA 2YROA 4AI0A 4WBBA 3K4DA 3ZOIA 2JDPA 5IJ0A 2P22C 2K2SA 1YTFB 4N43C 2F17A 2VS0A 1HRI1 1RJ7A 4DR1O 4B08A 5C9AB 2YUAA 2JXAA 4KU7A 4JC1A 4AEMA 4B7EA 2FDGA 2B9VA 2I45A 4LA2A 5CAZA 3B02A 2UYAA 1K5JA 2ZABA 1VARA 2B39A 1DG6A 2OYZA 4KQ7A 1IBKO 3K03A 4ISRA 3LF7A 1X82A 3NW4A 2OTLV 3M2MA 3TN92 2G4IA 3BTYA 2JDYA 4LE3A 2K9PA 2WFF2 4BIFA 1RUF3 1IS3A 4LIUA 1N32O 2JS5A 5FMBA 5JLVA 5D1IA 2YB7A 4FXKB 2AHZA 4E4SA 1L7LA 2JDZA 3TB0A 5JCOA 1WCQA 1JHNA 3AKPA 3RVYA 2XAQA 3VZLA 2BOCC 2JIJA 3RZZA 3OYWA 2QGNA 1VPHA 1VF5B 3ICXA 3HOBA 4TQDA 5DABA 5IE9A 1W6PA 4Q0QA 4DW1A 2WO3A 2XGXA 4ZOLB 4NWVA 2CSGA 3ETGA 2VOKA 4UOJA 3BPZA 3U78A 1NLQA 5JCOC 3AP5A 1PO12 1YQ6A 4JYYA 1E79G 1OCRC 1MQTA 2R6QA 5A6QA 3ZYGA 3CBNA 2M6YA 1US3A 4KH9A 3VBUA 4XYXA 4Q4W1 2LROA 3WFVA 2Z3YA 3VD3A 4CH6A 5JSRA 1ZBA3 2LS6A 5DXDA 3TETA 2WWSA 3W7SA 2NP0A 4IHJB 3L72H 2WNUB 4JYAB 3IPVA 5F39A 1MQTC 2HVKC 1WCSA 1FT9A 4BHPA 2X09A 1W9YA 1FYJA 1KJLA 5LHGA 2XJVA 3VBUC 1S0BA 1V9U1 5CFDA 4RS5A 3BN6A 1LR5A 5FUNA 1RUE1 4LFCO 3THPA 4AR2A 2WWUA 5TISZ 2YFUA 3B40A 2EIKC 5EV7A 4DOUA 2ZX2A 2DFCA 3FB8C 4QPJA 4HSJA 3GWKC 1RTVA 1PGSA 2GP5A 5CFDC 3DTUB 4NIHA 4RS5C 5JUVA 2DYSB 5DN6G 4IEPA 1K45A 1DFQA 1M06G 1RUI1 1B3QA 3L71H 3OCPA 4UW5A 1UYPA 4UFMA 2QQNA 4Y3OA 4XDLA 3EB7A 3LDCA 5GTIZ 4DR7B 3CZJA 3D4KA 1GICA 2BBAA 2BGPA 3J7AU 2CTRA 3I55V 4BLIA 2E75B 3JBG3 1XMQO 1BL8A 2GDFA 3BA8A 1PX4A 1DQ6A 4YIPA 2W47A 1YIJV 2ZXWC 1GP6A 3ZSEA 4KBBA 1W99A 3BIWE 2BGCA 3ZPOA 2PI4A 1R1A2 2A6XA 3WT3A 3SH5A 3HKDB 2QJ1A 4HK9A 2QWQB 3KWVA 5L3FA 2Y6FA 2FKXA 3VGIA 4IETA 1UFIA 3GCXA 4LF6O 1U0AA 4DUYB 2W1QA 5E1AC 5D8AA 5KHHA 5K1XA 4N90A 3KCYA 3BA9A 4JI4B 1Q8QA 3GZTB 3I4IA 3VZKA 1S5LZ 4BIZA 2E7QA 1PZ8A 3VZOA 3JAWB 4R6ZA 4XHXA 2RM23 5IJRA 2CAZC 1FMD1 3I3DA 1OOPB 3SJBC 3OPTA 2YY1A 4ARYA 1XU1A 3H1IH 5LOVA 4TTGA 5D8AC 2GMEA 1VQ8V 4FM1A 2EIDA 2VMGA 3GZEA 1PIV1 3PL0A 3ZN6B 4LO6B 2QKDA 2HH9A 4LT5A 3LA2A 1PNKA 3AP9A 2C0ZA 4ZY9A 2RS11 1RUE2 3ETQA 3ZCCA 3T2TA 4P9XA 4FPGA 2ZKOA 5K9YA 1VMHA 1ZZCA 3HWJA 3RNSA 4V1PA 1Y4MA 5FKCA 2E26A 4TUYA 1ZX3A 2E7AA 1N4CA 4YM2A 4ONUA 4YZ4A 5DAVA 1KECA 2SLIA 2XAGA 2OKXA 1GAXA 5L3BA 2Y0OA 1COWG 3WNLA 2RMU3 2ORXA 5JQGA 3WDUA 1UU6A 4BH9A 3NNLA 1KMIZ 3LIGA 5A1FA 3AG2B 2JRIA 4AOCA 2NLRA 1LHOA 2GUZB 4I0WB 5KAFZ 1MS0A 2ZIOA 1R093 4DV1O 4QB6A 2UUCB 1HKDA 3KCXA 4C91A 1QQP2 1I94O 4ZKTB 2GZWA 3MV11 5FY8A 3VZNA 1REEA 5L3GA 3RYFB 2ZHKA 3FX7A 3UO2A 2JJ6A 5B3SB 1AXKA 2XPJA 1PKXA 3LAGA 4H2AA 5F1RA 2OUHA 1AP5A 4DK1A 4DR6O 4A44A 4BW5A 4QT6A 1JW6A 1WA8B 1N1YA 3PU8A 3CWBH 3KG2A 4AEKA 1VB2A 3A0BZ 4HFSA 4WCEV 4YHHB 1HRV3 1JTZX 1ZA4A 4CCLA 4LF7B 2TUNA 5D2AA 3B9CA 4MXVA 2RR13 2WJSA 3JD1A 1SBFA 4GX5A 4MGTA 1DTOA 3WSOA 1ZBE1 1OFSA 3LDDA 3LDEA 2D6KA 4XBLA 2DYCA 1CAXB 4CDWA 4GJZA 4D0QA 5BMVB 1W04A 2UUBO 2AEZA 4CU6A 5CG9A 2QTWB 3IGAC 5IK8A 3T1YO 1AB3A 5IK4A 1W8NA 1EP0A 4AW7A 1GO3F 1OA2A 3CRQA 5B1AB 1V6OA 1SRYA 4V2WA 2QQWA 4PIZA 5FYVA 5LA9A 3MF9A 4CDWC 4XUNA 2OS2A 1IOAA 3GNEA 3ACFA 2ZEZA 1SA0A 4BA6A 3HKBB 1YXWA 2WSSG 4EZ4A 1RJ8A 2ZJCA 3KHCA 1RSOA 3LSQA 2OT7A 1C5HA 3NV3A 3M3CA 4G27B 5T54A 3IJ4A 4DR5O 2LP7A 1WNSA 2KG7A 4JGZA 3FBYA 5A1AA 3ZHRA 1OPMA 2ZX3A 1D2QA 3U75A 3GF6A 3DYPA 4TWKA 3WP3A 3NR7A 1J58A 3E86A 2ORZA 3J80N 1GYKA 2XONA 2RVAA 5C3OA 2PMWB 3CCLV 4AFDA 2ZE8A 4DV5O 2ATKC 4TZDA 2UU8A 3FUQA 4XF3A 3KV4A 4JGZC 3CX5F 2N74A 2QUOA 5IWAB 5L9BA 1GTOA 2W39A 1VQMV 2K46A 4A6SA 3V0AB 1R083 1JYCA 5FZAA 5CB4A 4LF4B 1UAIA 3MV01 4NO4A 1JR9A 3SPIA 5L7OA 2F6BA 3H9VA 4BK5A 4GB31 3S6PA 1JPXA 1HNXO 2J1TA 1S0FA 3USUA 4INDA 4A42A 2GTSA 1DF5A 1VQPV 1AROP 4LNUB 3X29B 2JICA 2R0HA 4L97A 4QGLA 1IPJA 2J42A 4UW3A 2XLFA 1PNLA 1K5QA 2OIGA 5JJJB 1D0HA 1AILA 1SBEA 5L7OC 3AG4B 1AR4A 1DHKB 1DLCA 2OTJV 1Q8VA 3K4AA 4LFAO 1RUJ1 2E6VA 4FTBA 4FLYA 2ZEWA 2PHFA 1URFA 3CRCA 1JFFB 1WMXA 2Y0IA 3BALA 2DU1A 5EJZB 3SITA 1VMGA 3OJBA 4J10A 2NYYA 4GX2A 2Q67A 5DG2A 3SCHA 3AVSA 1NZIA 4NIDA 4S2FA 1RUC2 4HSLA 4ZHNA 1S76D 4Y5Z0 5FZLA 5FFOC 3P32A 1FKAO 4HYOA 1Y9GA 2QEXV 1WKYA 3JAKA 4YG0A 5LA1A 3RZGA 1C1LA 3FB5C 3SDLA 4XVHA 4FM2A 4NXMO 2RS51 4QM9A 1OURA 5GZFA 4GWNA 4DPNA 4OUEA 4E4EA 3BIEA 1CIWA 1M90W 3DEMA 3VDBA 1MVQA 3OBTA 4I3PA 4XBQA 1JOBA 3VKNA 4JCKA 1RPRA 1W59A 2Q0OC 5F37A 4UFJA 5FUPA 1E1RG 5DAWA 4YGBA 5GONB 4XF9A 4RHV2 3C7EA 1P49A 4P08A 1IVSA 2G19A 2D6PA 3SYQA 1KKDA 4IGGA 3F2ZA 3WU2Z 4J41A 3CRMA 4ZXEA 3OY8A 3WINE 2O57A 4AEJA 2EZPA 3I2FA 2AENA 2EIEA 4H44B 1TMF2 5GLZA 1R73A 2ZTNA 1O4ZA 1C5IA 2BSKA 2ZAHA 2YBPA 3SKVA 4MW8A 1K73W 2EBOA 2VBDA 1UZZA 4AILC 3C7HA 3ZYFA 4FP2A 3TAYA 3THTA 2HWD3 4QQ2A 4XDJA 2VMCA 5F9TA 2HWE2 2EXJA 1H1IA 2QM8A 1H2KA 2X05A 2UY8A 4QPYA 3N9PA 4DMIA 4C1XA 1W6OA 3O9OA 2OZ6A 1R6NA 4CS2A 4C7UA 1HJGA 5LB6A 2QQVA 1LOGA 5F6KA 3FHIB 2ADEA 4DV2B 5BPXA 3LSDA 3S5QA 4IDZA 3POBA 5FXWA 2R063 5A3MA 5FPBA 3AZVA 1HB1A 1BZKA 4WM7B 1YXBA 2VMIA 3ILNA 1H4HA 3N2GB 2Q8DA 2Q7GA 1XNTA 3IKWA 3N9QA 4J1WA 5FZIA 4GKJO 4Q4V3 1AR93 2NZ9A 4B4RA 3URFA 3SXWA 3I2JA 1ZRFA 5JPNB 2AHYA 5IK7A 1O5LA 2DCKA 4AEDA 2WLNA 3GHNA 5BY1A 2CUGA 1S5HC 3AYAA 1CZSA 4WFHA 4XBNA 2WZEA 3AEIA 1ASJ1 1OKOA 3J7MA 3V0BB 2Z5UA 4S2DA 2XJQA 1SFNA 4DXRA 3APBA 1VRH2 5B4NA 4BE3A 3RRDA 1VJ2A 1SZTA 1H1MA 4XZUG 1NT2B 4ZU7A 1XPWA 1KUQA 3BGAA 3S0MA 4O2BB 1FNYA 3E5UA 3PVNA 4JZGA 2JE8A 4LF5O 4J42A 1OFNA 3E89A 5AVAA 2CAVA 1H4GA 1IURA 2DCJA 1AYN2 3RYHA 1GNZA 2VW2A 2WLLA 4PLNA 3H0OA 3CYOA 2A6ZA 2QA4V 4LA3A 3JB4C 2DVFA 4IL7A 4YY3B 2WR9A 2XOMA 2PHXA 3EBRA 1HB3A 4NE9A 4DIQA 1AXYA 1TE1B 4HT1T 1LGNA 1QJY1 4WM8A 2VNGA 4B1MA 3BCCH 1VQ9V 3HNYM 4DW0A 4G2KA 2OYQA 2ZGNA 1U5ZA 4GULA 2LW7A 3DUIA 4D6QA 2XHBA 3WG3A 1XMOO 2BYVE 4PI2A 2WZR3 4Y22A 5GLWA 4E27A 1IS6A 5H6QA 2LFSA 2HFEC 4MVMA 1SHWB 5C3QA 1K5SA 2OXBA 5L3DA 3VLBB 3BVOA 4UBGA 3U11A 1EAH2 4UW6A 4WM8C 4XJ8A 2RJKA 4RA0A 3WG1A 3H8UA 1N1TA 2DBIA 3UK9A 1EYBA 2E51A 3UT0A 4K0KB 2VZSA 2Q7EA 4DRXA 4R8HA 1I3HA 1J95A 2ZBJA 3ITQA 4Q4X2 4E4DX 5LHHA 3SYCA 2JVDA 5FMCA 4GALA 5LCWL 1V54B 1WUVA 4QKNA 1O3TA 4PDWA 2QQJA 1NVPB 2XR4A 3IDBB 4EFEA 4X62B 4HXCA 2DVDA 5FQ0A 5FMOL 3LB9A 4XTPA 2EXHA 3T1MA 3G4SV 3S5AA 1WW7A 1HR0O 1XYPA 4QNHB 1QLEB 1QVGU 3VBHB 4Z2AA 1NAEA 4WVWA 2M7WA 4GXLA 1REFA 3ABMB 4FZ0A 1QHDA 3INAA 1IBMB 2QKSA 2CWMA 1JBCA 3FLTA 4BIOA 2JWPA 1HXS2 1BJQA 4QKDA 4PDWC 1ENXA 2RNBA 4YW6A 5EYPA 5DQ0A 3VKOA 5FIXA 3IN9A 4LO8A 1IXBA 3OEHG 5KMGA 1LODA 2HWC2 3VDDA 5IUQA 3D82A 1AL21 2YU2A 1K3EA 5KUMA 3D0JA 2XJUA 4XFAA 2FHRA 1XREA 2IJHA 3AKTA 4LE4A 3ZHQA 1VQLV 1RL3A 2E74B 3MPBA 4EN9B 1XB9A 4JI7B 3QG5A 1Q3EA 2IUWA 3K5NA 2FCUA 2R071 5IT6A 3VDDC 2ET1A 4MO3M 2EULA 3ASNB 4PHZA 5GLVA 3VHPA 3WG2A 3JCZA 2J7MA 5GM0A 1DYKA 4LBEC 2B7YA 3NL1A 4XIKA 2ERFA 5FY5A 4XDKA 1G9DA 1RYYA 4IERA 1VP7A 4B3MO 4PA9A 5FBZA 2OWOA 1GP4A 2C5DA 4W6YA 1RPOA 2IJKA 1TVKB 4N53B 1OCOB 4KP4A 2WS91 5FJHA 3CE2A 3C2UA 4IE6A 4JKLA 3PUSA 4NHKA 1KP2A 3TEZA 4FPYA 4Y24A 3I59B 4XABA 4J6GA 2CV6A 4LBQB 1OVPA 3MW3A 2XAFA 3A22A 2ZCEA 4MW3A 1TME1 1LHVA 1WN7A 1W8HA 1VBA3 2YXHA 2HJFC 3THCA 1BK1A 3ZR6A 5FPZA 5LA2A 3AK3A 1IDSA 4HOOA 5TSWA 2Q68A 1OF3A 5IVEA 4DUXA 3O1SA 5C8YB 2ZEXA 3AYEA 2BEOA 2CTPA 2CDYA 1CAVA 3V64A 1EM1A 1M56B 2WWWA 3T1HO 1I5ZA 4V2VA 1X50A 3Q8AA 4YZ1A 4R9DA 4QXKA 3IAPA 3JATA 3O1RA 5LXTA 4X1IB 3O65A 3VBRB 2X6CA 4AGRA 2GSMB 3WXPA 3ZFEA 4JV4A 4UW4A 4NTWA 4A3ZA 4RFRB 3ASOB 1CD3G 5J3UA 3J7HA 1GZWB 1CGPA 3WD5A 3K5MA 5BNNB 3MW4A 3OGGA 3HKEB 2BU9A 3JU9A 3AZYA 3IMNA 3C3TA 2XKOA 1F35A 4N7IA 4EFBA 2W94A 5C6CA 3ZFEC 5LGNA 1POV1 3RZHA 1K42A 2YI8A 1REDA 1O8SA 1BBT1 5CFCA 3BKZA 1WJZA 4U3JA 4XUQA 4Q29A 1GRJA 5C5UA 3S3XA 1AZDA 2HBTA 1G7YA 3O1UA 1OPOA 4QQHA 1I5YA 3WCRA 5EC2C 4I02A 2WLPA 1IXMA 2NLJC 1IGOA 2X0LA 4D6RA 3FN9A 1GZCA 2PYTA 1X8MA 4JPRA 1X36A 3TOJA 5CFCC 3DGEA 1SQFA 5FZOB 1AR71 4UVAA 1RUD1 3CPWU 3ZJZA 5C33A 3ZN6A 5KX5A 2DQ3A 3G67A 2FDHA 3HR9A 4X64O 1SG3A 2XHNA 1MZEA 4A7ZA 5IVCA 3D36A 1JVMA 1MZ6A 1SDDB 1SFYA 3KZIZ 3NXSA 3AMMA 1KGYA 2CTVA 1C8M2 4RR3B 3N3HA 1I0HA 3WCSA 4Z1VA 4TV9A 1L3JA 2BZDA 4YIOA 4XF4A 3K3NA 1C28A 3N2KB 3APQA 1JZ4A 1H6YA 4MVZA 3VQYA 1YFUA 1XMQB 1O6UA 1W2BU 1XDCA 3AG7A 5CZKA 1K7DA 1S77D 3D36C 3CMGA 1N3OA 2ZGKA 4JF3A 4YW7A 3VBFB 5JXIA 3OUIA 2YYOA 4DUWA 2GH2A 3L70H 1LOCA 5FL7G 4B8EA 4JI0B 2EINC 2X10A 4F6RA 2QVSB 3MYXA 5CISA 2DCTA 1ZRCA 1EBOA 1HNWO 1VAVA 2DOSA 4TSVA 1UX6A 3RYFA 4EYUA 3QH7A 2XXZA 4C90A 3CCJV 1DQ2A 1VBD2 4H7LA 2F43G 2WQZC 3AG2C 3FE5A 1SPPA 3ACGA 4HKLA 4TV8A 1WA8A 5HPOA 2Z4FA 2IXHA 4LH6A 4FAGA 3LEMA 3MHZA 3POFA 1S0EA 2WZ8A 1FPN2 3ORJA 4F83A 3ZX7A 4FFBB 2WSVA 1OLMA 4ZKIA 4WFEA 2A1XA 3J8F1 3CJIA 1UU5A 3MFAA 4K1YA 2AZ5A 1N36B 3J26N 4F8AA 1LOFA 2W1SA 4AVVA 3OTOB 1ENSA 4YVSB 3PLQA 2O8OA 3KGLA 4LUKA 3HKCB 2IU3A 4QX7A 3HIFA 1HQLA 1OV9A 3RYIA 1GM8A 1S0IA 1G4YB 4NTXA 1Z5WA 4JDMA 2E63A 1W6MA 3CJIC 4KHPB 1AX1A 1OI6A 5K1PA 3FAVA 4NAMA 1LOFC 2J1AA 3E1F1 1QWRA 4MGIE 3WW2A 3ROUA 1VBC3 4LHLA 2EXKA 3ZIXA 4B3SO 1JODA 4W50A 2CTQA 1H2NA 2Q1FA 3QO7A 1AR62 3C7OA 1NR1A 3SEEA 3HB3B 5SV8A 1UMZA 1AX0A 4DV1B 4P9GA 4BM8A 2WL1A 3AP6A 1MA1A 4C0BA 2ZGLA 3Q8FA 3IIAA 2P5BA 5B1AC 4LWSB 3UJOA 3I3QA 4Q2FA 1N8RW 1IZ3A 1URXA 4QPIB 5A32B 1GNYA 1LEMA 1TAEA 2ZHNA 4DR6B 1GM7A 5SV5A 3CDZB 1HN0A 4NPMA 4FFIA 1PO21 3E83A 2Z0AA 1VAMA 4CEYA 4LIVA 4P5HA 3CL1A 5FZGA 1W8WA 5FYYA 3RT3C 2XHKA 1RHI1 1THZA 1YIFA 2FCTA 5I8YA 5FZ4A 2R0FA 3T4HB 3KQ4B 4PF1A 3D8CA 1AR92 3N9MA 3LSEA 3V0AA 3JD71 4JI6O 1BEV2 4M4RA 4ZI7A 5BNQA 4CEYC 1DP0A 1H2GA 4QHZA 3PU3A 1H1AA 2SBAA 2W92A 2B4KA 3EO6A 2P06A 2E32A 4CCDA 5JMOA 1YQ8A 3HNMA 2YU1A 4LC1A 2ID4A 4HONA 3JCIA 2A70A 3O1VA 2IVIB 4EWAA 4NRQA 4O4JB 2BTQA 3QO5A 1F51A 5GLUA 5A33B 2GH8A 3OGRA 4B7KA 3G6BA 4XUTA 2IJJA 3M7AA 2XBO1 3B8NA 4Q8KA 1OCCB 1W8ZA 4Q8LA 1GN6A 4FLWA 4AL9A 3TEWA 1BLZA 2RS33 3AXEA 5DAXA 2DTYA 3BAAA 1PL0A 4LCUC 3D6EA 2E31A 3G7DA 4ATFA 4LBJA 2VJXA 5KWRA 4X66O 5JIUA 1XOYA 1W03A 3GJBA 3T1CA 3IBMA 5BNOB 2ADQB 2JDHA 1VBE3 1L1FA 1Z7S3 5CVRA 3IAQA 4RL7A 5E6HA 3RN4A 2IW5A 1JOPA 2RJZA 1GKBA 1FYUA 2Y69C 2Q6AA 2P3KA 1H8HG 1O59A 3ZIWA 3SR2C 4UFZA 4CH5A 1NLSA 2VZUA 2HWF3 2WAAA 1LOEA 5LMUB 4AG4A 1W90A 4LUMA 5ITZA 1LHWA 2WKKA 3JB8A 3R4DB 1HNXB 1M57C 1E57A 1Y74B 1K92A 4CU8A 1AX2A 3WHUA 3DXRB 4ZHQB 2GNTA 1QJU1 2ZMNA 1O9GA 3R0RA 2E5LB 3MO4A 5K0UA 3FFZA 2X5IB 1RUF1 2VR4A 3K75B 2OT5A 2XQXA 1S4CA 2B1GA 1NLRA 4DUVA 3K0DA 1NTMH 4JDNA 4I5SA 4ZU5A 2YIDA 3G71V 4U2AA 4RO2A 2MNGA 2P37A 5F8PA 3IB3A 2KKWA 4JI5B 1B04A 1Y7BA 1RVF2 3ZKUA 5JZGA 1Q82W 2ZOEB 2JKBA 1GOGA 1VMJA 2QCSB 2PLV2 4MGQA 5JOXA 3USSA 5HFMA 3H1LH 5IYDO 1VBB3 4XZPA 5FP9A 2ADDA 3LDBA 1I7FA 5CIRA 2WLIA 4Y1ZA 4YJ2B 2G9GA 1B09A 3GM8A 1PHMA 4E4ZA 5JZGC 1UD1A 5EIYB 1SQQH 3VDAA 4OCTA 3OUFA 1UN1A 2W52A 1JN2P 3MEPA 3WP6A 2IXIA 3W59A 1WCKA 2VMEA 2GC1A 2EJRA 3JZVA 4WM7A 1NTZH 2BWCA 2WO2A 1ZBA1 2VL4A 4HZFA 2HP8A 1XUQA 1ONAA 3NQHA 1VB4A 1J83A 4E2SA 2WA4A 1AR82 2Z2SB 4ZS2A 1I08A 3K4ZA 2AYHA 4JYBA 5H6RA 4W65A 4BISA 4WM7C 1CAWA 2LRPA 3V0BA 1OA4A 1RUG3 1FV3A 2Z69A 1PMHX 1XHZA 2KB1A 2NR5A 3FJSA 2CDPA 5EHDA 2YC0A 4Q6GA 2DYRC 3E22A 4IE7A 1IG3A 1BYHA 1GQHA 4QE9A 1D2SA 1U97A 2DBNA 1NU1H 3RFRA 5T5LA 3WW1A 1HNZO 4EZHA 3J4UH 2FZ1A 5A70A 4P5YA 1BKZA 1C8NA 3CNAA 2HEVF 2A6WA 4Y1UA 3C3VA 2WWJA 1MG1A 2WT1A 1CPNA 1XNBA 3DYOA 4P9OA 1JYTA 2BPA2 1US6A 3EJKA 1R1BA 4QX3A 1BGYH 4LF8O 4YGEA 1ZSPA 2QQKA 1NQJA 3JBG1 5FY4A 4K21A 1SQ4A 1FPOA 5CKQA 1ZZ9A 3WLUA 4BAYA 4UFLA 4O4HB 2BOJA 1NOVA 4LBNA 2GC3A 4JGYA 1QJX2 5T5PA 3G6JB 2Y6JA 2Y0PA 4GKJB 1UPGA 3ABTA 1RMU2 1U96A 4CP9A 1ORQC 3CC4V 1I9RA 5FREA 4HKOA 2HBUA 4IEUA 2WT2A 1P7GA 2B46X 1AJQA 1VQNV 2P17A 3AMQA 4JGYC 4Q4Y2 2ZDIA 2TBVA 5B1BB 2RM21 3ZYJB 4OLLA 4DEVA 4X20B 1OH3A 2J1VA 4GX1A 5LP6A 2N7GA 5FYBA 3D5OA 2RV9A 2R70A 4M3CF 2G9ZA 5BUVA 4HVRA 3SPHA 4D8MA 3MF6A 1ZAUA 1VQ7V 5CU1A 2ZR2A 5I0UA 2F4VO 2MEV2 2QSAA 5EJ3A 1YUDA 3OEBA 5BR8O 3WF4A 4B3RB 1Z5VA 4P2ZA 1W3VA 3JARB 2ZDIC 1YTFD 5ABJA 1PD3A 2VNOA 3RVHA 4MT8A 4HPKB 1V55B 4QJFB 3MW2A 5EZYB 5LP6C 1ENRA 1TVGA 4OX9O 1MS9A 3GZAA 2GBOA 2EIMC 5LA6B 1SQXH 3N7MA 1M9NA 4XAAA 1VQOV 4AK3A 2J1UA 2BP6A 1V54C 2WNVA 3AK2A 3H8RA 3T1LA 3MLLA 2PUSA 5ABJC 5CA1A 4XC9A 1MEC1 2WO1A 3RMYA 1FAYA 4CEWB 3X2QC 2BFUL 4BQ3A 1OVSA 4I4TA 2EIJB 1ZRIA 1K5MA 1YIPA 2N04A 5I91A 4CH3A 2GMMA 3VBOB 4AVTA 3A2FA 1ND3A 3RZKA 4Y1XA 2WNVC 1EFRG 1R091 4MYEA 1W2AX 4HNAA 3KB5A 2CAUA 1N3PA 2JEMA 3QH6A 1BK0A 3L2YA 2VXJA 2LW1A 4UI9L 3T4VA 1DIWA 1Y76A 3TN93 4BR6A 2A5ZA 1SQVH 2WFF3 4GQ7A 1EV13 1K5MC 2FMYA 4COYA 3LSUA 4IV1B 5HCBA 1ND3C 3S30A 2HG5C 1ZUQA 1DCSA 3UKMA 1ND2B 2BNMA 4A3XA 1NZ6A 4ZS3A 1HB2A 1BZWA 1HRV1 1PGL1 4N53A 2JDNA 1GH6A 1QOSA 3IIIA 4UWDA 2FL4A 2RR11 3GGLA 4RUFA 1ZNPA 2VRZA 2NM1A 4RSUA 3JD4A 3PJSK 3RWKX 4NOTA 4WVMB 1FJGO 2OCCB 4XOGA 5J98B 3OUJA 5F3GA 3WY6A 2VULA 1PO13 3N4MA 1SQBH 3H1HH 2FMLA 3NRUA 1P4RA 4XQDA 4N53C 5BXXA 4R4ZA 4B1LA 1K33A 5FKBA 2WSUA 2PHWA 3GB7C 4YGDA 2YPDA 1XNAA 4G28B 3E5QA 2YEVA 5B1OA 5C8WA 1EUUA 1AYM2 3JALB 5DUXA 2DQ0A 3AJZA 4WVVA 2NN8A 1D4VB 2QNKA 1HRI3 3AG3B 1NQTA 3ZMSA 5B2GB 2D3OW 5LYJA 4ET7A 3UT5A 3OFNG 3UL2A 3NV2A 4QDSA 4HANA 5D5QA 3RYCA 3FZ3A 3DGTA 1XC6A 1A8MA 3VBRA 2ZGSA 2W08A 4L11A 3ZSMA 2BERA 4FTSA 2PFWA 3QACA 5DDJ2 4YGCA 1OD3A 2ZMLA
chains in the Genus database with same CATH topology
4AFDA 4G9SB 1GZWA 3M3IA 3WQ0A 2UU8A 4TZDA 1X33A 4PDWB 4EN8B 3FUQA 4XF0A 1BMV2 4XF3A 3OD4A 4Y4YA 3V56A 4JGZC 1H9WA 4M2EA 2QUOA 2CY6A 2WZR2 1AR81 5FQ0B 2W39A 3B93A 1TEIA 3V0AB 4GMP0 1KDKA 2ZGTA 1H9PA 4QPGB 3MS5A 4IV3B 3VBRC 1R083 4PIYA 4GB33 1JYCA 1OQDA 1QJU3 4KNCA 4XFIA 4URTA 2D40A 4M27A 2WNUA 1ALYA 3SHRA 1Z78A 4I09A 5HSXA 1UAIA 4NO4A 4PLMA 5L7OA 3DPRB 2BVVA 2F6BA 2JX9A 3N7JA 1PK6B 1XXNA 1C3HA 1R081 5H9SA 4GB31 3S6PA 1CVNA 3D0SA 1S0FA 3USUA 4KG0A 4INDA 2A75A 4I01A 2ZGRA 4K40A 2K9ZA 2VPVA 1XE8A 1LHNA 3X29B 2JICA 3WUCA 1JR7A 2R0HA 4XEZA 1RUJ3 1ENQA 3VDDB 4L97A 1YLLA 1IPJA 2JE7A 4QGLA 4UW3A 4AHWA 1MZ5A 2GC0A 2XLFA 4XFHA 2WNUC 3WG4A 4PIXA 4XFFA 1N1SA 1OD5A 3N7KA 1D0HA 1TNRA 4XPVA 5L7OC 1SBEA 2R6SA 4BGMA 2DFBA 1GVGA 3OF1A 1DHKB 1QNWA 5HXVA 5JPMB 1R1A3 1Q8VA 2EAAA 4LEJA 1RUJ1 3LCPA 2E6VA 4YRDA 3VHRA 4HN1A 4FTBA 2DVAA 2PHFA 4ASMB 5K0UC 3KMHA 2Y0IA 3BALA 2DU1A 4Q0VA 4K1ZA 3SITA 3ZXJA 1H8TA 3OJBA 1QJX3 1WW5A 4XQ4A 2VGDA 1R1A1 2NYYA 4HVOA 1O4TA 4HKWA 4BGKA 5DG2A 3SCHA 1CESA 4S2FA 1WMDA 1RUC2 4HSLA 4HMZA 5KC5A 4Y5Z0 4C8RA 4ITCA 1AL22 2DUOA 3KD4A 4R9AA 1QJX1 2XJTA 2XB6C 2WNEA 5FFOC 1RMU3 1HDKA 2WLQA 3FC0A 2A7AA 2RS53 2HWB2 3MFCA 3SH4A 4YVWB 3PVEA 1TQ5A 3I7DA 4AHYA 2GNMA 1COV2 1H8TC 4Q4Y3 4YG0A 2IWGB 4HETA 5IK5A 1C1LA 4RQPB 2DCZA 1RMU1 3RYKA 3VBFA 2RS51 4QM9A 3JUUA 2ARXA 2R072 3POYA 3CU7A 3I54A 3LZZA 3GBWA 5GZFA 5CA6A 1S0JA 3SNMA 3GYDA 4GWNA 4DPNA 4Q4Y1 1QMJA 1CIWA 3LWCA 5T5OA 5LEKA 5DUVA 2FBEA 1RUE3 1HV1A 2YGLA 4MXWB 5FDBA 1MVQA 3OBTA 4JDOA 1CAUA 2VQ0A 2VH9A 4I3PA 3MPPG 4XBQA 2P2KA 1SLAA 3R4SA 3VKNA 4BOWA 2MEV3 1O3SA 4YZ3A 2VECA 3AMNA 4JCKA 2B5HA 2ATFA 3U10A 4XFBA 2W0XA 4M2CA 1N3QA 2PHLA 2ZKLA 1LKNA 2WS92 3VBFC 4L9BA 4YGBA 4XF9A 2CYFA 4RHV2 3HD8B 1WA4A 1UF2C 3ELNA 1WMEA 3CO2A 2MEV1 1VALA 3WVJA 1CONA 2D6PA 1KXGA 1QNYA 4Q0UA 1IS4A 3BTAA 4G4FA 1CAVB 5DZGA 4IESA 1OOPA 3OY8A 3WINE 4AEJA 5T52A 2AENA 1A8DA 2F4PA 1DDLA 1TMF2 5GLZA 1TME2 2ZTNA 4DXZA 3QBQA 2PAEA 2CWSA 2Z42A 1O4ZA 3B9IA 1C5IA 5AFEA 2ZAHA 1V6NA 4RGGA 2V09A 1YCIA 3ZO0B 1SMVA 4K9SA 1ULGA 1UZZA 1VZ4A 4B29A 1D0GA 1SCRA 1QDOA 3ZFEB 4FP2A 3TAYA 4QX5A 3THTA 2HWD3 4QQ2A 1W6QA 2IFRA 5F9TA 3WQ7A 1OOPC 1I6XA 3R05A 1VBA2 2HWE2 2KXLA 1QQP3 2EXJA 1H1IA 2DUPA 3E6DA 1WMFA 1H2KA 2XJSA 2UY8A 4AYUA 4YW2A 1ZVFA 1I1EA 4QPYA 3SLIA 1DGWA 4DMIA 4C1XA 3BB6A 2HWD1 3RYPA 4QU2A 3S7EA 1W6OA