1H2KA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
335
structure length
332
Chain Sequence
b'EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR INHIBITING HIF1
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/inhibitor
total genus 105
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2kA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2kA01
1MZEA 1MZFA 2Y0IA 2WA3A 2ILMA 4BIOA 1IZ3A 2YDEA 2CGOA 4NR1A 3D8CA 3OD4A 2CGNA 2W0XA 4Z1VA 4AI8A 1H2MA 4B7KA 3KCYA 3KCXA 4B7EA 4Z2WA 2YC0A 1YCIA 1H2NA 1H2LA 3P3PA 1H2KA 2WA4A 2XUMA 5JWPA 4QU2A 4JAAA 3P3NA
chains in the Genus database with same CATH superfamily
3HR0A 4DRXA 4PBPA 2LGQA 1CZSA 3X2QC 5GONB 3RYCB 3AKPA 3JALA 1J3RA 2JDPA 2RDCA 5FZHA 4C8DA 3GBGA 4BQ3A 4NYKA 2O1QA 4KU7A 3V0AB 4IE6A 3Q8EA 4AR2A 2FYUH 1C8M2 1YDXA 4DV7O 3MYXA 3ABLB 2CDYA 3APOA 4HLTA 1OA4A 2VMIA 4YW6A 2VQUA 1CWPA 1NTKH 1Q56A 4GULA 3HNYM 2EINC 1I94O 3AMNA 2BOIA 2EXJA 3RGBA 3AK0A 1GV9A 3KQ4B 1PL4A 1VQ4V 4AEKA 2VU9A 1CP9A 5FY4A 4DY5A 5B3SB 2F93B 2WPDG 4Z1VA 3JCIA 3CS5A 2DYRB 1GNYA 4H13B 2VZVA 3EHKA 2ENRA 2AZ5A 1V55C 4CS3A 4W50A 2VQTA 1RUE2 2WLMA 4EJRA 2VQAA 1S2BA 1C8M3 1W8FA 4AGVA 5C3SA 2VBPA 4B7KA 3RNSA 1JH5A 4UB8Z 2BNMA 1IS6A 1PX3A 5EPAA 4Y1YA 1EYBA 3K57A 2VM9A 3I5DA 1SQ4A 5IVVA 4LF7O 4QPGA 3BVOA 1NR1A 2BFUL 3RMXA 2YI8A 2QWRB 1BHGA 3H42B 4A7YA 5HCFA 1FMD2 2XDVA 4DMIA 1Y67A 3FHQA 4WFAV 3W58A 1WAZA 2UY8A 2L35A 3J9SA 5GLWA 1JYCA 4PJ0Z 1AX1A 2A75A 1NVPD 1S0FA 1RUE3 3MI8A 5FKCA 2VNVA 4DV2B 5DZEA 4J10A 3OOXA 4QPIB 3F7YC 1VB2A 3UQ8A 3RPQA 4ASMB 5JXGA 2F1MA 4LE3A 5JH7B 4ASKA 1ZZ8A 4HVQA 1CR7A 5LMNO 1F5FA 1KBHA 3BALA 3RVHA 4OI4A 3RN4A 4B3RB 1Y66A 2ZX4A 3MDPA 1NG0A 3DCQA 2ET7A 1BBT1 2HYXA 2ZGUA 3WNPA 4E4HA 5FPUA 1FMD3 3NNFA 3JYCA 1AR4A 5LBEA 5DAWA 3VD3A 3FHAA 5IY5B 4Y1UA 5ANQA 1ZVFA 2YIBD 3QCWA 1Y43B 4PDRA 1YFWA 5FYBA 1UJWB 5J7MA 2R9RB 3RYHB 1WKYA 1XE8A 5DN2A 5FXXA 1P4RA 5FZEA 2B39A 3J7LA 4XFFA 2QBXA 1TME1 2HVKC 2E26A 3KS7A 2P3KA 5JUVA 2HBTA 2JEMA 1GN2A 1JYTA 4GB31 3SYPA 3O65A 2IC1A 5C9AC 3BGAA 1J95A 4NPLA 2IU0A 4QQHA 1CJDA 1MPXA 1UY1A 4LIUA 5I0TA 2QJVA 1PO11 4XQDA 4IYHA 4Q26A 3PVOA 4NTXA 4EB6A 2CH7B 3UM7A 1AR62 1GMGA 1YSCA 3FX7A 1SDWA 2JEUA 4I4TB 5KX5B 3OD4A 4CDUA 3WNXA 1ULEA 5K0UC 3EHBB 4DXWA 4GH4C 5EJ1B 4DR2B 2YIAA 5FPZA 2PN5A 1JQ0A 3LQCA 3H7JA 2ZMNA 2YXLA 4UVCA 1IDSA 2LP7A 3IT8A 3TWIA 5FUPA 1D0HA 3ZHTA 4Z07A 3CLPA 4CH3A 1VRH1 1I0HA 3USSA 4OVEA 4Y33A 3T1MA 1W8TA 1AR63 1FKAO 1GANA 1ZYBA 3IAPA 2BGPA 4EV0A 3U37A 5CFDA 4HKLA 2ZM6B 2UU9O 2GUZA 2R70A 5KUMA 5IE9A 2B42B 3VHOA 3ASNB 5AG2A 1WA4A 4JX0A 4MGIE 1SBEA 1BJQA 4B4RA 2B9ZA 2QQIA 4NHXA 5IYYA 4QX8A 1XNAA 1JU3A 5J2TB 4Q0PA 1F4AA 4BU2A 4B3MB 2NM1A 5DN6G 4PV1B 4FOYA 1R1A1 2VCCA 1QJU1 5KA6A 4DXSA 4QPWA 3ZFFA 1TA8A 2R061 2D97A 5C8YA 5LGTA 2A70A 2HWE1 3B5LB 3T09A 3MLLA 2BNNA 1K92A 3VDAA 3WT3A 1NBMG 1OKQA 5DPNA 3OEBA 4BK5A 4A7ZA 4OX9O 1S72V 3OUFA 3H3LA 2ZJCA 2Y60A 5KXBA 3S5QA 3WV6A 2W91A 2LUWA 4YXWG 4QXBA 5E1AC 2WNUC 3KLSA 4JV4A 4A6SA 2BUKA 1CAUA 2RS52 4BA6A 2Y0OA 1NUKA 2LW1A 1NE4A 1ULOA 2HR3A 1AVMA 4I2OA 4WM8A 4AI9A 4LH6A 2XPJA 2OKXA 5LA2A 3AG2B 4RHV2 5HPOA 1UX6A 2UXBB 3VBOC 3H9AA 3IM0A 4Y20B 3U10A 1M90W 3FJSA 4XF4A 3LGRA 1KEXA 4URAA 1VF6A 4O61A 5LZ6A 1PGW2 4X66O 4ATFA 5J2UA 1JI6A 1ZBA2 2DURA 4M3CB 4I3PA 5BXZA 5JI7A 1VQPV 4I5SA 2RS53 3WFVA 1OA3A 4H44B 5IVBA 3IAYA 4CBCA 4LK7A 1AP6A 5KWRA 3AK3A 1PVC1 3KB5A 4OULA 1VMHA 1GUIA 3FLPA 4RHV3 4GXLA 2P6JA 2X7RB 3BFRA 2C24A 3URFA 2K9ZA 2JDNA 5LGUA 1NLRA 2CWMA 4COWA 3ZHRA 3WB1A 4PDWB 3D0JA 2HKXA 1LU2A 3LDRA 2UXNA 1SQXH 4OFGA 1R6NA 5KMGB 2JIGA 3UT0A 5T5JA 4IGPA 4BLIA 5EYYA 5FXZA 2A1XA 2VMGA 3AEIA 4E2GA 3I2IA 1ZBA3 1I1EA 3ZM8A 4WBBA 3T1HB 4ASUG 4J9ZB 4WFFA 1PGL1 4RS5C 5CA0B 2WABA 3I3QA 2G9GA 4JI7O 2Y6LA 4O4IA 2XAFA 1WW7A 5CFCB 4ARYA 2CTRA 4FFKA 3SKVA 2YXYA 1UY3A 4BXFA 4HPKB 1EPZA 4MTGA 2EIGA 4Y5TA 1XI1A 4AVVA 2P7TC 5A6XA 1K5MC 4JI2O 3WVJA 2RMKB 2EJRA 2XXZA 5A1AA 3Q9OA 3V56A 2A0LA 1HWYA 3FB7C 5FP3A 3R66A 1YI2V 4FZ1A 4XOGA 4CDWA 4Q4V2 4GMP3 3CRQA 4BMEA 2EXIA 1URFA 2HWF3 3CC7V 2UXCO 1FATA 5J98B 2VNRA 4MVTA 1HN1A 3IKWA 2G9ZA 3WNOA 3N9QA 2AEYA 3ZPOA 4IETA 4XETA 4KUMA 1QXPA 3O1OA 3CJHA 3ZN6A 3VBSA 2WLJA 3WDXA 3ZYBA 4XC9A 1ZBE1 1P8JA 3AMMA 5F5CA 1YVWA 1YZBA 2E74B 3CF6E 4P9PA 3CHXA 2R49A 5L7OC 4BW5A 3JAKA 3H1IH 4DXZA 1RM1B 3UNPA 2A73B 2UWAA 4NMIA 2VAUA 5L9BA 3VBUA 1OCRB 1OOPC 4AGGA 4FPHA 3FE5A 1ZUQA 4YJ3B 1RUI2 4ZXKA 3QD6A 2BOBC 1XMOO 3H3UA 1I5ZA 4NIAA 4Q4V3 4B7EA 1ZL8A 4UW3A 3KZ4C 4HT1T 1CIYA 1A8DA 4BW9A 1W6MB 3VL8A 2V1DA 4LIVA 2P22C 1PL0A 1VQOV 4B1LA 3IPVA 1OLME 2GBOA 5KAIZ 2P5BA 4E27A 3S3XA 4LITA 4PA7A 2LW8A 3CKHA 2OWOA 4HAMA 3H01A 3MD0A 3AG1C 1RMU1 3WDUA 5C3OA 4MVUA 2HBUA 1Q6UA 4KP4A 3AP9A 3JD72 2LQTA 2HWC1 3P32A 1DLBA 5GLTA 3ELNA 3FFQA 1RUI3 4MGKE 4WVZA 3NNMA 2JVDA 2XL7A 3B01A 5GLVA 2YXSA 3H8UA 1ZNPA 3ITQA 2PMWB 4TSFG 2W94A 3ZXJA 4YYOA 1V6JA 2V09A 3IMNA 5F1RA 3SGIA 1QLNA 2AENA 4GX2A 3SYAA 5EWSA 5FLXN 4DR7B 1CVNA 5E79Z 3WP5A 2WO3A 2JG8B 4HG6B 1R73A 3CO2A 3KHBA 1V9U1 3R0RA 5H5NA 4AEMA 4NJ4A 2L9LA 2IVJA 2YICA 2YDEA 3UGFA 1AR5A 4GIQA 4DXRA 2WSVA 2BCCH 1JYIA 2QQJA 3OMNB 2EF6A 3PU8A 2X6CA 1OFSA 1NJIW 5LATA 4KU8A 1KRIA 4F6RA 1N1SA 5C8CC 3MPPG 1K5JA 3ZVXA 1LECA 1IG0A 1PMIA 4DFSA 1V54B 3H1HH 2E7TA 4B3SO 3NJYA 2CL2A 4NKGB 3VBFB 4R8CA 4OQ9A 3PN1A 4C1XA 1VQ6V 5BNOC 4OI1A 3AFKA 2XJVA 1OUXA 4JGYB 3X2QB 1GSLA 3ZYPA 1U0AA 2X5IA 1P7GA 1PO22 4GWIA 4IEUA 1C4RA 2WWJA 2PLV2 1LGBA 1YIJV 5J2TA 4JDNA 4LFBB 3DXTA 2FZ1A 2QM8A 4GKKO 1PK6A 1T6GC 1W9YA 3UK9A 3K5LA 5IAXA 1BSMA 4P2ZA 1W6NA 2XLAA 1GP4A 4DV1B 3WG2A 3A0KA 2ETNA 2KG7A 1V6MA 1ROPA 3PURA 2DVAA 2Z3YA 4WBNA 4IGGA 1QXRA 5A32B 1AR91 2HFEC 3EVKA 2E6VA 1MZEA 5FNVA 1OMIA 1PO23 4LUKA 3CCLV 3LA3A 3CMGA 2PLV3 2D6MA 3STZC 1V55B 4AVBA 3S7EA 4LP8A 2K9PA 1C3HA 3AX4A 4JYAB 1JCHA 4LBQB 4FPYA 3POYA 2D3OW 1AYN2 1QR8A 1K45A 2BTOA 2YC4A 4CCMA 3P5BA 5JZGB 2YY1A 3H3ZA 5FP4A 1U97A 5FYZA 2P3IA 2GNDA 1N34O 1IPKA 5LGNA 1S5LZ 3SEEA 3GZAA 1AZDA 2B4KA 5C4WC 4IV1C 4CS2A 2FMYA 2M6YA 1C8M1 1UO9A 4MTOA 5JCOC 4FLUA 3WDYA 3LSQA 1WCSA 3ETQA 5FYUA 5FO8B 3N36A 1IBLO 2RJKA 1NQDA 5GALA 1POV1 5FO9B 5D2AA 3OTOO 3ZSLA 2VJXA 1AYN3 1IGOA 2QWNB 1OHFA 1POV0 3LSSA 3TNQA 4A41A 3LSEA 1UOGA 1Y74A 4MXWA 4FVMA 4COZA 3SYCA 1W0OA 4LBEC 3L74H 1GWLA 5LXTA 5BMVB 4JI1B 1RUE1 4GKJB 1SMVA 1PP9H 1KS5A 2ZE7A 2DCTA 3DYMA 3EBRA 1RGSA 1NTZH 4E8CA 4U7OA 3ABKC 4O2AB 4DR3B 1W28A 2FTKA 1WBFA 2UUAO 1WA8A 2VMCA 5FZAA 1J59A 3MIGA 1FNYA 3C7OA 1V70A 5JVVA 1HV0A 3OMIB 4JASA 4LF8O 3OFNG 3A4UA 4W4LA 2CSGA 2OUJA 5L3EA 1FMD1 5IHRA 3OEHG 2VG9A 4FPFA 2MEV1 5FZ1A 2ZHNA 4DUWA 5BNPA 4P5HA 2VXJA 4AGRA 2W47A 3VGIA 2KQXA 5C9AB 3MDSA 2UYAA 5C6CA 1HNZO 3UGHA 5F39A 3K3WA 1PNGA 2LO1A 4AYUA 4LFAB 3HKDA 2UYBA 3VL9A 4G9SB 4LFCO 1NH2D 3ZFEA 2LFRA 4V2VA 1CAXA 1M9NA 1Q7YW 2GTSA 1VF5B 1OLQA 5K0UB 4GH4B 1WB7A 1S77D 5CKNA 4TYSA 2WA3A 3LIGA 4RR3A 3QNEA 2X10A 5IUQA 4U3FH 2VUAA 4EZHA 2XHNA 3ETEA 1GZCA 4I9WA 1N1TA 3PUSA 4X1IB 5LEKA 1RYYA 2W39A 1C28A 2GNMA 2VO5A 2DUPA 3L9DA 3FD9A 2EIJC 1LOEA 5FZOA 3D36A 4CS4A 4JGZC 5B4XA 4DV7B 4NUBA 4YIOA 3THCA 2BP6A 4DK1A 1QCEA 4D7TA 1JMUB 4AHZA 4AEDC 2RDSA 3N9PA 4TV9A 1I94B 3CXHF 5C70A 1EY2A 3KT7A 5L3CA 1TUEB 4HSLA 2CTPA 1CAVB 3MUY1 5I0UA 4XJWA 3I4IA 1JTZX 3IDBB 4MTFA 2JKXA 2Z5WA 3HBKA 1H8VA 4EWDA 3KVBA 1AR61 4LXLA 1YQCA 1DZRA 4IEPA 2EZOA 5CA1B 3E5QA 4KI5M 3AP4A 2DYCA 3ZRWA 3JARA 1PGSA 2ZMLA 3VBRC 1XBLA 1ND3B 5C5UA 4S2FA 5EYXA 5DQ0A 4S2DA 3B9IA 3GZTB 1VAMA 3ILNA 2ODMA 4O2BA 2WAOA 4CEWA 3GF6A 5FIXA 1TG7A 3K5NA 4IEZA 5LP6C 1RUOA 1I6XA 4J9YB 3N7MA 1NKGA 4LF7B 5A70A 4XDLA 5FUNA 2BGCA 1GZ9A 1JFFB 1AJNA 3SC7X 1BVP1 2WLQA 4CP0A 4GD4A 1N32O 3JBG2 4WM7A 2ZGTA 3ATGA 2DCYA 2J1TA 3ZYHA 1J3QA 2BWCA 4Z92B 4DB5A 2JKBA 4XJ9A 1QH7A 3CCEV 3E8BA 3I56V 2LTNA 1DFQA 4DEQA 4Y3OA 3VUOA 3VBOB 1NCRC 4XABA 4PA4A 2GNBA 1MS9A 1ZTEA 2OVUA 1E5HA 4PT6A 1UPIA 4N7UA 2QZ2A 4BDVB 5T50A 5LMNB 5FZ6A 5FZBA 1UYYA 3ETGA 1NU1H 5G04L 2ZNIA 1O91A 4E4ZA 3O1TA 2EICA 2RJLA 2VULA 3ZHQA 3ES1A 5FCCA 1QGLA 4LC1A 3JBG3 4EQVA 3M2MA 1OF4A 2OYZA 1A6CA 4ITCA 2R9IA 4XBFA 3HKBA 2OXBA 3IC7A 1NKDA 3DKWA 5BNQA 2JB8A 2PYLA 4NWWA 3WDWA 5JJJB 5IJ9A 3MIHA 4UCRA 1VIBA 1AL0G 4MGYE 2DMXA 2QEXV 2QQLA 4AFMA 1OQDA 3C90A 2ZGRA 2RS51 4KWLA 4KBZA 5GTIZ 5BV6A 4LTAA 4AVAA 4E2LA 3ZCCA 2XKOA 2P4KA 1ULPA 4RHV1 2WFF3 1X9TA 5EBMC 2W68A 3B3QE 2WLNA 2KSDA 4O4JA 3I55V 2UY9A 3CNAA 1Y9MA 4JF3A 4X6RB 3OBZA 1S55A 4QPYA 3OYWB 4Y1ZA 5T5LA 1DYKA 2WSSG 1YJ9V 1PGW1 5J9PC 2Y4TA 3H0OA 4FP2A 4ET7A 1ZBA1 3O1VA 3J7NA 3JATA 3ZOIA 1JMKC 3IFXA 4XDOA 4EE2A 4DR1O 3N2GB 4ZHNA 4ZI7B 2BBAA 1H30A 1K5MB 3J7HA 3ZYRA 3TN92 4XYXA 1GP6A 5L3FA 5FLJA 2DTYA 1W2AX 2K0GA 1YF2A 4BWOA 4C0HA 1NCQA 3HIFA 4YZ5A 4UFJA 2XHBA 2BYVE 1SQQH 4XJ8A 2RS12 4XW3A 2FCUA 3DKQA 2M7WA 3BB6A 1AROP 3LE0A 3ZFGC 3AKSA 1BCCH 4DR4O 2UU9B 4XJAA 1R092 3GWOA 2ATFA 1D5NA 4DYLA 1TNFA 3KF5A 4XTPA 3PIGA 2VC9A 3X29B 2WJSA 3WLUA 4PDVA 4YG3A 4GMP1 3TN93 5L7OB 1J3PA 3ECQA 2B7YA 4EWEA 5B1AC 1US2A 5CG9A 1OOPB 1QWRA 5JVDB 3BYWA 4J1XA 2CGOA 4KG0A 3SLIA 1LHVA 2HHHO 4XUOA 1X82A 3B40A 3I2JA 3I3MA 4N7IA 2WNOA 3DXRA 1R093 4KWKA 4OX9B 3USUA 1F2NA 2EALA 2R16A 4B3TO 2GN3A 4NIGA 4L11A 2H0BA 4N21A 4EN7B 4HXCA 2C6SA 1YIPA 3E6DA 4Q4V1 3LSDA 4NAMA 2VQEO 4A5UB 3AG1B 1NA1A 3BOWA 3VKMA 5FFOC 2QNKA 2VZQA 2WFPA 4K0KO 3LEKA 4CH5A 3NV1A 4DINB 1N36O 2JGDA 4DOUA 4AFBA 2R72A 1J5EO 4NIIA 2Q4SA 3SJBC 4JCKA 4X1YA 4H0LB 1RUI1 4AQSA 4X66B 2RJZA 1W8NA 2F23A 4XDQA 2J22A 4OYUA 4LKFA 1GAXA 2AGSA 1ZZCA 5LBQA 5KAFZ 2RDQA 3HKCA 1YJLA 5FUIA 4U3JA 1JYNA 3GWKC 2E31A 4PQ9A 4DR6O 1KJLA 1HRI1 2HEWF 2AACA 3VZNA 2LROA 4FOVA 4BZ4A 1ZM1A 3E8HA 4GKYA 2WNEA 5I91A 1AX2A 4N90A 1ZRDA 1JOPA 1UYXA 3JD71 4YNIA 5C8CB 3K9AA 1F4MA 4XJZA 2P34A 2VZ1A 1XHZA 1GMMA 2VW2A 1D4M2 1AXYA 4C7UA 1WW4A 4GKXA 5FAXA 1UOBA 3HQXA 4BIUA 4TLFA 1S0BA 4MVMA 1UKRA 2XHKA 1DU3D 2EIDA 5I0DA 1NLQA 1IHMA 4IIJA 4RYDA 3SDLA 2ET1A 5T3NA 4AVCA 1WP7A 4LE4A 1Q3EA 4JI7B 4NPRA 2O0OA 4JTDB 4YSFA 3RZLA 1ZRCA 4BHPA 5A33B 2QQUA 4KFMA 5T54A 3E97A 1AUYA 2YB7A 3GBFA 5LBBA 2YUEA 2D3RA 2Z42A 3WHTA 1VBC2 3W59A 4JI2B 1D4M3 1QOOA 2JD9A 4MSVA 2PQQA 3AXEA 5A7SA 4CSWA 1OSGA 3GCWA 4AHWA 2D7FA 4QT6A 2DU1A 4EZ4A 4AEJA 2WLIB 2ARBA 4TUYA 2Z5UA 2UXCB 1GP5A 1W6QA 4DR5O 1XYPA 4F3JA 4JTAB 3K51A 1Y9GA 4XVHA 1DGWA 2ZGLA 1WCDJ 1D2DA 2BEOA 1WMDA 2Q1FA 3CSXA 1W2OA 2WNUA 1OV9A 1FS0G 5KC6A 4RGGA 3ZKUA 2BSKA 1H1AA 1MZ6A 3ZBHA 1KXGA 1VBC3 3WINE 3LOIA 1NZIA 4IUGA 4FK5C 1UW8A 3P3PA 1YHFA 3E2EA 5KHKA 1PO21 4YW2A 4HZ3A 1RPOA 2PLV1 2P06A 4LF9O 2D6PA 4X65B 2VE1A 3K77A 5C4WB 1XMOB 4IV1B 3VZKA 3SPCA 4DV3O 1SDDB 1POQA 4FLYA 4UCSA 1YLLA 2GSYA 4YGBA 5LOVB 4NE9A 3MBWA 4CPBD 1QDCA 5BXXA 3F5TA 4PQQA 1UMZA 1YITV 1W6PA 3VHNA 3R4UA 3Q8CA 1RHI2 5A6QA 3N2KB 1Y7BA 5JQGB 3M8AA 4QB2A 4U2AA 4J80A 4AAPA 3ZMZA 3KV4A 1O6UA 1E57A 3UO3A 2WYSA 1N4CA 2YROA 4ICGA 1WMXA 2VL4A 1T2XA 4MHRA 2BVBA 5CIRA 4WV8A 5FZIA 4LEJA 4OPAA 3D3AA 1VR3A 5KA5A 1H2NA 3M8LA 2BZDA 1AYN1 4TQDA 3ZFFC 1MOFA 4MW8A 3CIHA 2VOTA 3O1UA 2PF4E 1HNWO 1RHI3 3ABKB 3BOPA 4MX3A 1OLRA 3APBA 1QEXA 1K42A 4Z2AA 3ZHSA 1CONA 2V5DA 2FB5A 5A3MA 3NV3A 1W8WA 5JOWA 1WMEA 4RS5A 2FQPA 5D1IA 1W0PA 4GX1A 2HJIA 1W6OA 4YVWA 3K59A 1NZ6A 5C71A 4XF0A 3ZXLA 4QQLA 4IE7A 3O1SA 5A9GA 2DV9A 1GBGA 3CP1A 4TV8A 1BGYH 1VALA 3RYRA 5A1FA 5H9QA 1ENSA 4WM8C 1IPSA 2A71A 2YG0A 3UJQA 5H6QA 3CB2A 2JG9B 2BERA 4QU2A 2P4VA 3BCWA 1UQXA 1GLHA 4B3SB 5BY5A 2DQ3A 4DV5O 5FYIA 4R9BA 1W2NA 2PUSA 3BEHA 4KG8A 2PHFA 2NYYA 4CC6A 2IWGB 1JZ8A 5HXVA 3MIBA 1XNQO 4RGKA 2L6LA 2A6ZA 3FFZA 3M3CA 1BT8A 4RUEA 5FWJA 4GKKB 3E22B 2ERFA 2EIJB 4TTGA 3PVBB 4W8JA 4YM1A 4YG0A 2PAMA 3D4KA 2E7AA 3ME2A 4YWAA 2WRAA 5EIYB 3LNMB 4YZ1A 3WQBA 4QXCA 1N3OA 3C7HA 2Y64A 1OQ1A 4OHWA 3MIFA 2CTWA 2DF7A 2A9HA 5HFLA 3DPRB 2XTAA 5I0RA 3ILRA 3AP6A 2BWAA 3SQOA 3S57A 3O9OA 3N7KA 1APNA 2PAKA 1YTFD 1S2KA 1JZ3A 3ORJA 1AR1B 2YIDA 2K46A 3MW4A 1OH4A 4GWJA 4N53A 2OPKA 5IYDO 1D7PM 1GN6A 4LBNA 2W3JA 4NVPA 2W46A 4HK9A 3AM2A 3LPFA 1REEA 2R32A 2AH2A 4L9BA 3WXPA 5J48A 3HMYA 1N34B 5LP6B 4P9LA 2E51A 1S76D 1JXNA 4FTEA 4CEYA 1VQKV 2WLLB 3RYPA 2LALA 4QQOA 5IK4A 2EBOA 3WNNA 2ZR2A 1HB1A 1LOBA 3ZEDA 3OGJA 2DQ0A 1U5ZA 1IBLB 3I7DA 5HV0A 5HI0A 1H2SB 3AMQA 1FFXB 1Y3TA 3OTOB 4IV3A 2E7QA 5DUWA 3LDDA 4RA0A 2OIIA 1A78A 3T08A 4Y4RA 4AVTA 1GICA 4PA6A 2HWB2 5IT6A 4PLOA 3A23A 3MEPA 3JUUA 2BV4A 3RZHA 5FPLA 2ZKOA 2JK5C 1N0JA 2XOMA 3VBSC 3I59B 3P30A 4AQYO 4Z1MG 3FB6C 4X20A 2V7QG 3TEWA 1JHJA 3E6BA 1YI9A 4TXWA 5IFTA 2ZGSA 4G27B 3VQXA 5ABJC 3WF2A 2WN2A 2ARCA 4CP9A 4CE8A 1Y76B 4CCEA 3AL6A 4RQEA 2QVSB 3P6BA 4WVMB 2VOWA 1F4NA 2UUAB 3GCXA 5SV5A 2IXJA 1I7FA 3FBYA 4I9QA 4LKSA 3KG2A 2VS0A 2HWB3 5BNOA 3NJVA 4LF8B 1NY72 1HJGA 3OBAA 3JBG1 5DG1A 3KGZA 1GNHA 4M0NA 3OPTA 1MACA 1PIV2 5FMBA 2UWBA 1Q82W 1JYVA 3CCQV 1IURA 1BMV1 1DTOA 5IJ0B 1W03A 3V64A 2ZE5A 4IXLA 5EZYB 1UY2A 5JXJA 5LYJA 1Q8QA 2JD4A 1W06A 1EP0A 2HYKA 2Y6GA 1IXMA 4FAGA 4LFCB 4AL9A 5CG8A 1OI6A 4UFZA 2JDUA 4Q0QA 3PMEA 5GJ6A 1L3JA 5GTHZ 3JQXA 3OR6C 5I0SA 4JI6O 3HQUA 1RIRA 1DG6A 4CYDA 3AK1A 4WFEA 3LKJA 2NLRA 2YHJA 1PIV3 4IE0A 4ZOLA 5C5TA 4GA9A 1QH6A 1O8SA 2GDFA 2DVGA 1XNTA 2NN8A 1JW6A 3L2YA 3O0XA 3R65A 4ZHQA 4K8XA 4I0WB 5HCAA 3PJYA 5CA6A 4XBNA 1DGSA 1VBE2 4V1PA 3H8XA 1DHKB 1W04A 2VWKA 5AC91 5JXIA 5LRRA 1OCCB 1GKFA 1ULFA 2DFBA 1OQEA 1V6IA 5DDJ2 5JCOA 1GFF2 2XQRA 2ZKLA 4FFBA 1HW7A 4PIYA 2XOKG 1CXZB 4EFEA 4UBHA 1ONAA 4RD7A 3SH3A 2YFZA 2BTQA 4I09A 5B1AB 3FL7A 1CX1A 2GV9A 2P6CA 3CWBH 1I5PA 5FYVA 5K9YA 1HLCA 3ABZA 3M1HA 4AZZA 4DRXB 5BR8O 4UXNA 2ZGMA 2JJ1G 4IW3A 1ZX3A 2VUDA 1RB8G 1VBE3 1Z78A 3JALB 1WLEA 3TJTA 4DUZO 4P9GA 3TN91 4O4LA 3K08A 5ITZA 5IT9N 5FQ0A 2CUGA 5BPXA 5GZGA 3MIEA 5DDJ3 4AI3A 4Y1VA 1N1YA 3RVYA 3U14A 3H1JH 3G80A 2CNAA 4BQ4A 2IFWA 4X62O 3QH7A 4H14A 3K79A 2RS11 3FYEB 3J7MA 4JZGA 2BRTA 3T4ZA 5A7WA 2R042 5A2QN 5CA3A 1N32B 1M93A 4UF0A 2YC2A 5CVRA 3DEMA 1R091 5EFUA 3CCJV 4AWDA 1KB9F 3VKNA 2F4LA 3U0ZA 4G4FA 3WP3A 1F4HA 1IVSA 2IJHA 1UOFA 4URTA 1SZBA 4BB3A 1KP3A 5EC2C 1URXA 1GM7A 3WG3A 4JKKA 1XNKA 1QJY2 3AVSA 1HIXA 4SLIA 2HJDA 4TZDA 4OQ8A 4C90A 2PHDA 4WFBV 4LBJA 1ASJ1 5GLZA 2R043 3LWCA 5IAVA 2RNBA 2HG5C 4LQRA 4BQXA 1MS0A 4QPGB 2QWQB 3QF7A 1XNDA 3ALQA 3WW4A 1SLBA 2J1SA 1QLEB 3OM3B 1LOAA 2VCAA 5KHIA 1IQAA 2DVBA 3JQWA 1L1FA 2VTXJ 1DQ6A 2EIEA 1IX9A 1QJY3 2QSAA 5DUUA 1YJNV 2CTQA 4UFIA 2ZR3A 4GJYA 1OCOB 2WSUA 3NRUA 1OXCA 5FXWA 4JGZA 2A06H 2AGAA 4CXXA 4Q6GA 3WG7C 1O5LA 1M5IA 3GYDA 2XR4A 3HEIA 3CMAV 4AEDA 4HMZA 3DC6A 1QU0A 3N9NA 2AR6A 1PM9A 1QVGU 4E4SA 2RHPA 5CNAA 1QDOA 2ZOEB 3WF4A 2WNVA 1C5HA 2BOJA 4HETA 4R9DA 5IWFA 5EXOA 2QDRA 4XPVA 4DR1B 2VTFA 1B09A 4HNAA 5DAPA 3ILFA 4WFHA 1OPOA 2BW8A 3BPSA 4TWKA 1ODMA 2BGOA 2EJ7A 3QG5A 3VBRA 1OD3A 3POFA 3OGVA 2NNUA 2IXKA 5CAZA 2J1VA 4Q0SA 4H7LA 5BNPC 3EO6A 1Q8VA 5EZWA 2W08A 2DCJA 2ADPA 1MS5A 4JI0O 1WCUA 1VBA2 3GZUC 5H9PA 4DR4B 2PI4A 2Q67A 3TXSA 5FMOL 1D4M1 2R6QA 5J37A 1G6NA 2ADEA 1NR7A 3GNEA 1V6KA 4YW7A 1F8VA 4EB6B 3LDCA 4UFMA 2HEVF 3E89A 3LPGA 2XJTA 1XYOA 2Z4FA 4K1ZA 1JZ4A 4CDUB 3SJCC 4NIHA 1TZOA 2A5ZA 4I55A 4RR3C 1NCRA 2JJ2G 4UV8A 2PYJA 5JOXA 3KT1A 2NR5A 3K4ZA 3POWA 1K5SA 1IPJA 1CZVA 1RJ7A 3ZKYA 2HHHB 2VMHA 3SR2C 2ILMA 4GWNA 5FMDA 3S0MA 1VBA3 1AHSA 3QO8A 3THOA 1VBC1 4A3ZA 2Q69A 4DRVA 4CPBA 3AJZA 3ZMSA 1NZCA 4FXGB 1NTMH 4B3TB 2GP3A 1TUBA 3D36C 2RN9A 1X8MA 3VLBB 4ZBMA 2ZMKA 3L70H 5CFDB 2ZD9A 1DDLA 3POIA 4KH9A 2GUZB 3TETA 4L92A 2VQEB 1TQ5A 5L36A 3MFCA 4HK8A 1S2EA 4FLWA 1WA6X 4M0HA 2WINB 3AVRA 2XL9A 4K0KB 4LKEA 5F5QA 1N36B 3APQA 3LB9A 2ZXWB 1XYNA 4YJ2A 2WL1A 3ZFFB 1J5EB 2VW1A 4OXSA 3W7XA 5C8YB 4YVSC 4JGSA 1YQ2A 1CPMA 1KFXL 3FUOA 1EZJA 2ZACA 3T0BA 5D21A 3IC9A 4BLJA 2PTMA 1DGLA 3HNMA 5D8AA 5FV3A 4QX0A 5KR7A 3SXWA 5LBCA 3VBHA 5DUVA 4CEWC 4S2HA 1SFYA 1XMQO 3A7QA 3Q4HA 3EJKA 1TE1B 2E63A 4YW5A 5B2GB 2Q8OA 4DIQA 1G4YB 3NQHA 4LT5A 5FZDA 2TNFA 3J26N 3ABTA 3UESA 4DR6B 1KYOF 4LR3A 2QDNA 1RHI1 1D4VB 1Q43A 4YIPA 4D6QA 1CAUB 4LLFA 2ZEZA 3WSOA 1C1LA 4WM7C 5EJ3A 4MV2A 2Y48A 3HNBM 2WO2A 1X4TA 3NVCA 1G9BA 2YU1A 4WM8B 1UXXX 1HP8A 3OG2A 4OMDA 4UCOA 3PLQA 3AG4C 3C3TA 4MVSA 3OW2U 4JDOA 2P67A 1VQNV 2JE8A 2O8QA 1B04A 4PI0A 3CD6V 1Q81W 4A3XA 4JYBA 1WWYA 2B5HA 2P1BA 3WG4A 1WBLA 1VMGA 1F51A 2XONA 1DP0A 1NT2B 1UPGA 5C3RA 3ZFGA 1AYM2 1GTOA 2WO7A 1O9GA 3AYDA 5J2UB 3BTAA 4JKLA 1CPNA 4K1YA 1AR92 5LW9A 1R082 1LJ7A 4QPJA 1XNCA 1QNYA 5FLIA 5IWAO 1MZFA 4PELA 1MS8A 5IK8A 1MABG 4HSJA 1XL4A 5H6RA 3K04A 3DC5A 3L2HA 4CXYA 3OB8A 3GHNA 3ZR6A 5CEHA 4ZONA 4A4AA 2WR9A 5ISLA 1PHMA 5F6KA 1AILA 1X8EA 2QQVA 3MZHA 3QO5A 3AKTA 3VD5A 1SACA 5IYZA 2H8PC 2WZEA 1AYM3 1UU6A 1MQTA 4K21A 5LA9A 2OZJA 1AR93 1R083 4DR5B 4I0XA 4PD4F 1EV12 5FP9A 1BZWA 3JAWA 4FOWA 4IEXA 5DEDA 3RBZA 3M7MX 5FK7A 4ZS3A 1GKBA 4O4IB 4BH9A 4DQAA 5A3NA 4RO2A 2DOSA 2VZUA 3SPIA 1OCZC 3FMGA 4U7NA 4XMAA 4DO2A 3CPWU 4J6GA 4XEZA 2ZPXA 4W6WA 5HXMA 1QHDA 2G38A 4LF9B 2XLGA 3WW3A 3NKTA 1GOHA 2Q0AA 4CP1A 4DV3B 2GN7A 3ZMVA 1NX9A 3ETDA 2GSMB 1W05A 3VQVA 4JQTA 1EV13 2K2SA 4AK3A 2DUOA 1NCQC 3M3QA 4CDWB 1COWG 1RSOA 1COV2 3SYOA 4QXHA 1YC61 3G6BA 2HVJC 3HKEA 1POV3 1ENXA 1US3A 1GN4A 4BQ5A 1H9PA 3PVEA 4LF6O 4Q4Y2 4CA9A 3AFGA 1PZ9A 3I2GA 4NTWA 4FFFA 3CJHB 3TGUH 3ZN6B 1XE7A 3VBSB 1LUWA 1O5UA 3RWNA 3VDBA 2MEV2 3A2FA 3MHHC 4ZIBA 2SLIA 1UZZA 3JAKB 5JPMB 1QU7A 4LJHA 3VBUB 3LUTB 4MLOA 3LDBA 3EXAA 1H1IA 2I45A 2PELA 3OE7G 3BY6A 1COV3 1HNWB 1ZL8B 5CN0A 4QGNA 4J1WA 2DFCA 4NXNO 4UYBA 1K34A 2R0HA 1RXFA 3BODA 4MW3A 5FDBA 2OA2A 4Q4Y3 3WHUA 2FDKA 4Z2WA 2UUBO 3IPVB 5IK5A 2OTLV 5FPRA 5JOZA 1J1LA 4LULA 4E4EA 1HDKA 3EMRA 4R4XA 1LULA 2PHUA 2YEVA 2MEV3 4XXPA 4UW6A 1JA8A 4DV0O 1O9HA 4WVWA 1GNZA 2ADDA 3CYOA 1G9AA 1NA1C 5FLHA 1JODA 2EAAA 3CJXA 4QDSA 3THDA 4WFGA 5F3GA 3C7FA 2HWB1 2BPA2 4RFRB 2I2SA 1PM7A 1FPN2 3UT5A 1VEWA 2XJPA 5FMCA 1LHWA 5KHJA 1MA1A 2YC0A 1NS1A 2A3QA 5CKQA 1SRYA 4FP3A 3BU7A 5GKAC 4DV5B 3O1PA 3JXSA 5C3QA 3HD8B 3A0BZ 1OLMA 2UURA 3UGGA 3H1KH 3IBMA 5JMOA 2DBNA 4XUNA 4E2SA 2P3JA 3GALA 3RW0A 1XNQB 4DW1A 1B6QA 1DZTA 4JV5O 2NN4A 1NY71 4CUGA 1KKDA 2RDNA 3ZIXA 1FPN3 2GTAA 3JD2A 4D6TH 3M99B 5FYCA 1HB3A 4CCCA 3RI9A 2Z2SB 4GZRB 4PI2A 4W4ZA 1PIV1 3TEYA 1EN5A 4ES8A 5SV8A 4I01A 3VHPA 4YZ3A 2QWPB 4LF4O 1SQGA 4F6RB 4BK4A 3ZPYA 3FBMA 4K3AA 4GJZA 4X1KA 1THZA 3BUCA 2QE7G 1HXS2 2A6XA 5EP9A 5IVEA 3ABLC 3VZLA 1NXMA 1CAWA 4MS2A 3SMHA 5FJHA 3UCSC 2VNGA 2FMLA 2E3CA 3I8TA 1NQJA 2WZR2 1H2MA 2WT1A 3RYIA 1XUQA 2WAMA 3ZN5A 2X5IB 3JAMN 2JGUA 3K46A 3I2HA 4COVA 4HVRA 3VN4A 1XOYA 1PK6B 3ZX7A 2DYRC 2YI9A 3ACHA 5JSOA 3BIEA 1W6NB 4LO5B 1H8HG 5FZ7A 1FAFA 2KG7B 3IDCB 3WNMA 4L99A 1HXS3 2IVIB 2EA7A 1HB4A 2J1UA 5F3CA 3T2MA 1BHBA 1VBE1 3AKQA 2DW4A 1L7LA 1V9PA 4WBNB 3NAPA 4FXKB 2QDOA 5FREA 2JDHA 2YFUA 3S3WA 1GQGA 2B9VA 2WZR3 3RSJA 2C5DA 3ZSJA 5DDJ1 5ANNA 5CBHA 1ZREA 4Q4X2 5FNVB 4FIPC 2PXJA 1S0GA 1HN0A 1SLLA 5L19A 1XILA 3C2UA 3VB9A 3ETPA 4IGQA 2BJSA 2AZ2A 1B06A 2WLHA 1YQ6A 3KVAA 4CRQA 1XE0A 2ZX0A 4AQYB 1GN3A 2QKCA 3U1XA 1KGYA 1XL6A 4H55A 4L2NA 3ASIA 4QPIC 2VR4A 2JDMA 3K06A 3UKVA 4N23A 1REDA 1PX4A 5CISA 2FDHA 1PNFA 3BTYA 4O65A 2KD7A 2Y6FA 3KQRA 2J1EA 3RYFA 4BIZA 2NQYA 1C57A 2VXRA 4Q4X3 1BK1A 4KGGA 4QDQA 1NXD1 1FXKA 2XT9A 2Y33A 2Q8DA 2RCVA 1QQP2 2R041 4PLMA 4P14A 1NVPB 1KFUL 5LBFA 1HQNA 1OFNA 4OPHA 3RWKX 1MS1A 4A7KA 3NW4A 4MGQA 5JJEB 4R7CA 1Y74B 4MXWB 3PL0A 3WG7B 1BK0A 3SEPA 4OUEA 5LXTB 3F95A 4JC1A 2P37A 2ZAHA 3KKYA 4JI3O 3CMEV 4MSWC 1TAEA 4MT8A 1QJY1 1X36A 2HEYF 2XQXA 3ZIAG 5A3OA 4B4PA 5DECA 1LGNA 1LOCA 1N3QA 2WQ8A 4NN0A 1QOTA 3ZYFA 1QQP3 4F83A 3T1HO 3K2OA 4JI6B 3L72H 1WA8B 2RMU2 4XHXA 2X05A 4LNUA 3ASOB 4Q20A 3B77A 1W8HA 5DAVA 2VOXA 1QF3A 1UCXA 3K9SA 1O4TA 2D3SA 4LO7A 1SZTA 5JOYA 1TVGA 2OX0A 5JMCA 4YVWC 5CYYA 4JAAA 4OLLA 2PY5A 3ACFA 4DUXA 5I8TA 5BNPB 3OR7C 3SJAC 4CUAA 1VQMV 4FVVA 1WUVA 2VPVA 2W1WA 1W2TA 5FP7A 1GOFA 4TN7A 4PIXA 4FZ0A 2ETEA 3MGUA 1I5YA 3OBRA 2RV9A 3NSTA 4P08A 1RUH2 2YMZA 3HKDB 3MW2A 3FN9A 1BQPA 2C0ZA 5TSWA 4OZXA 3MLKA 3ZFEB 2RMU3 1X7NA 3OF1A 4FPPA 2VOKA 2Q7EA 2CU5A 1CAXB 5CB4A 1GOGA 1JJOA 1ND2A 3CL1A 3HPNA 4RR3B 4F8AA 4MXVA 3ZYIB 4YZ2A 4CU9A 3PHMA 1Y4MA 1BZKA 5CBGA 5BR8B 4WVVA 4LBMA 1LESA 1SPPA 3OGIB 1M1KW 1OUSA 2DYSB 4B8EA 2Q30A 1OD5A 3D0SA 2P5OA 1RUH3 1UMIA 5FZOB 2Q0OC 4NAOA 1BYHA 3BCCH 2ZNJA 4V2WA 1F23A 5ABJA 1L0LH 5A3TA 1Q86W 4X62B 4LWSA 3EB7A 3BHPA 4TV9B 5DUXA 3A21A 1VBA1 2OQ7A 2OUHA 3G7DA 1MNGA 2WLKA 1OZ0A 3W20A 1ULCA 3B69A 4H33A 5J3UA 4EYUA 3OY8A 5LASA 3ZLIA 2H6CA 1QKQA 3SH5A 2XAHA 1HRI2 5J36A 4AILC 2XB6C 4QE9A 3ZRWB 3JARB 2ZHKA 3DYOA 2JEXA 2FDJA 4FFIA 4GLXA 1VMJA 4F7ZA 4QHZA 1ZRFA 5B1NA 2W1QA 2XVGA 4N53C 5FWEA 1R1BA 4YY3O 4W4KA 3ABMC 4O2BB 1MZ5A 3AG2C 2WYFA 3SYQA 4CEWB 4SBVA 4CCDA 1LB2A 1ZAUA 4CU6A 5H9SA 4IHJA 3TK1A 1OKOA 4CEYC 1UIKA 2PHXA 1I9RA 1JU4A 1XXNA 4LO4B 2Q7HA 1HR0O 4IDZA 4WM7B 3LFIA 2F43G 1HRI3 2R072 2XVLA 3BN6A 2PYTA 3H9VA 2VZTA 5BNNA 5CB7A 1SETA 4FLXA 1Q90D 4ZZ5A 2ZIMA 4OUSA 2Y69B 1AJKA 3AG4B 4IV3C 3SCFA 3ZXDA 2OCCB 1S5HC 3JD73 5FY1A 3T1YO 5JCTA 5KXEA 1A3KA 1IQDC 4P30A 1WGPA 2X29A 4FFGA 3JCUZ 1G86A 1W2UA 2J7MA 1RXGA 1UAIA 4WCEV 3VDDA 1EFRG 3WX5A 4OGQB 4D8MA 3CRAA 4WZCA 2QQKA 3B7MA 3KV9A 2DWDC 1YJKA 3FB8C 3E8GA 2JS3A 3VOUA 1DLCA 3K4DA 4CU8A 2R073 2VZSA 4DRRA 2P6HA 4FPLA 3J80N 4G3YC 3HKBB 1ZA7A 2C26A 1S5JA 4GX5A 4JHTA 1NT0A 1MSDA 3F5WC 2A3YA 1D5AA 3K3OA 5IJ9B 3ZYJB 3DN7A 3W9AA 3FLRA 3ZN0A 4LHLA 3AC0A 2XWBB 1AVBA 5IK7A 2QKDA 1YXBA 2UXXA 4TSVA 4QGPA 1FI2A 1B35A 4LOTA 4RQPA 1G8WA 3I97A 1NE6A 4JI0B 5LA0A 4BE3A 2Q8EA 2GNTA 3HN1A 2XAGA 2C1FA 3IWZA 3UL2A 2D6KA 2YBSA 4O4JB 3AMHA 3LDKA 1YYNA 1ACCA 2EINB 4X64O 5LA6A 2ARAA 1AYM1 3J8F2 5IYBO 3KMHA 1BKZA 5K4LA 1R081 3JATB 5LHIA 1KQSU 5CBFA 5C93A 4XUQA 4ZS2A 4ARXA 3AK2A 4UUJC 4XQWA 1FFTB 4OI2A 1H9WA 4COYA 1S0CA 1YRZA 3I3EA 5A7QA 1VRBA 3RFRA 2GC2A 2XJSA 3ENRA 5CBLA 4MYEA 5H9CA 2GALA 4RGAA 4H2AA 5EK0A 1NCQB 4TT3G 1YNAA 5FPBA 5LEJA 1XRUA 4XZUG 2BFUS 4PDMA 4META 1OCRC 5L3GA 3RMYA 3OGRA 5IFPA 3OUSA 1K3EA 1EUTA 2F6BA 1EN4A 3HR9A 3J8F3 4UCTA 4QKNA 4AFCA 3JD0A 1OA2A 1Z5VA 2HWD2 3B9CA 1LR5A 1EV11 2MNGA 1J1TA 4N43A 4KWJA 4OMCA 2GDSA 1AX0A 3OEEG 2VZPA 2W52A 2BBVA 1KITA 2MK3A 4CCLA 1FOD2 1FV3A 3NXSA 2DCZA 3PUAA 5FZ3A 2CE4A 3EFFK 5FY0A 1REFA 4FCAA 2YPJA 3DXRB 3JASA 5GZDA 2WKKA 3PUQA 3ZXKA 1CGPA 3USUB 1XMQB 2HWD3 4CTEA 2W92A 1O59A 4UW5A 1ULGA 1BE3H 2K1EA 3B8NA 3TXQA 3PU3A 3LEMA 1WB8A 1COV1 3FLTA 2P90A 1AJQA 3PMSA 1FOD3 4DY3A 1B3QA 3K75B 4FM1A 1NA1B 1SEFA 1WD4A 1GQPA 4Q4Y1 3GJBA 4WF9V 1QR9A 4IE5A 2JGDB 4DV6O 1IBMO 4P00B 5I93A 5D5PA 1W9TA 2RQ6A 5GLUA 2BTVC 4N8MA 5EHDA 2KM2A 1H8TA 2Q9LA 3JSNA 1UU4A 2XBO2 1C8NA 2KKWA 4QNHB 5FZ9A 3ROUA 4MVRA 4X1YB 3L9JT 1FPOA 1GYKA 4AI1A 1VQ5V 3V0BA 4DXTA 5EYPA 3ZJZA 1CZTA 4R4ZA 3VKOA 2BDRA 1UZYA 4XFHA 1DF0A 2VMFA 3N9OA 3RRDA 4IESA 3QTCA 1W9SA 4NROA 3IN9A 5L9RA 3HKCB 3NNGA 5A1LA 4E9KA 1N33O 4U3JB 1CX4A 1AXZA 1LGCA 2RS32 3JSLA 3VBFC 1GZWA 3CDZB 1LNSA 2ZAAA 4YARA 3EQEA 5JLVA 4YGCA 1WJZA 4JGYC 3FWEA 3AZVA 1JHNA 2XBO3 4UFKA 3GJAA 3SCGA 4FJCC 5J1XA 2BVVA 4XF1A 2BQPA 3DV8A 3BA8A 1U5IA 3VKLA 3ES4A 2BOCC 1STMA 2BNOA 2GC3A 2DE0X 4YFZA 1FPN1 3MV11 3DL3A 1RUD2 1EAH2 1KS4A 4W6XA 4IIJB 1SA0A 3MF9A 3U78A 2IJJA 2RS33 2RG4A 2Q8CA 1MS4A 4LBLA 4QKBA 4RSUA 2R0FA 4JI5O 1SFPA 3ZRSA 2EXKA 3GGLA 2WNVC 5FZKA 5FOBB 4UB6Z 4B4QA 4D6SA 3I2KA 3FC0A 1JOBA 4QQ2A 3BABA 2DDUA 3FHIB 1SC5B 3T30A 4YVSA 4NR1A 4XACA 4LO8A 4KL1A 1O3RA 1FD9A 3E8FA 2P17A 1W3VA 5JZGC 2WT0A 3W7UA 1KUQA 1LUVA 3C3VA 2FDFA 1RUD3 1EAH3 3MPBA 4MUVA 1K7DA 3AP5A 5HCBA 1U5YA 4TUYB 2NLJC 1VBD2 2FKXA 1W6QB 1X50A 3RVZA 4P9JA 4S2GA 5FP8A 2A6VA 1HXS1 4GUNA 3RT3C 4LF6B 1DGRN 1JZ2A 3WB2A 1RPRA 1IS5A 2WNUB 3FX3A 2WT2A 2GP5A 4FI9A 3S5AA 2BSKB 4R50A 2DVFA 2AXTZ 2IUWA 2ID4A 2WZR1 1M57C 5DM6V 1W0KG 2AREA 1JVMA 2J1RA 3NNLA 2G19A 3KV5A 2N7GA 3R4DB 2B45X 1BMV2 1WNSA 5KBFA 4BQYA 2VWJA 1UFIA 2YV8A 3CEWA 1VBD3 1ALYA 1R6KA 4O4HA 2JB4A 4NXNB 2A7AA 3MHSC 1W6PB 2ZABA 2UUBB 4L8QA 3C8XA 4M3CF 2J42A 2WIIB 2C2AA 2QTOA 1DF5A 2DN9A 1AR81 4DEVA 4DV0B 4JYYA 3TEZA 3ZX6A 4Q29A 4Q4X1 4ATEA 1EM1A 1WN7A 4D69A 3AJYA 1QJFA 2ZX3A 2ZINA 1SG3A 1Q8IA 5IJRA 4CDXA 1CEZA 4R52A 4RFT0 5AC92 4JTCB 2IFRA 1BEV1 2R1DA 3B02A 1TVKA 4CUBA 1DK1A 5D8AC 1LHOA 4O9EA 3VBHC 2Y0PA 2VECA 2ZXQA 4RS5B 4EROA 1RFYA 4EWAA 2HLDG 4FQ4A 1WW5A 4D3WA 1UPSA 1W6OB 2V4AA 4YVWB 1O3TA 4L97A 3VBBA 5AFBA 4R6ZA 4JV5B 3R05A 4D6RA 1O8PA 1QQP1 1GM8A 3CCVV 4GQ7A 5BUVA 4PJYA 2QKSA 3WW1A 4N9HA 4K8ZA 3DGTA 3IGAC 4TV8B 2QFEA 4FPOB 5AC93 1IS4A 4LF4B 2CGPA 2ES3A 4LK6A 2OIEA 3JZVA 1NH2B 2D5HA 2ZIOA 5FY9A 4JZRA 2F66C 2W0FC 1XQNA 3T4HB 1LRHA 1NYWA 1Q8SA 5HCHA 1FJGO 2VH9A 2VQFO 1ZZ9A 3MFAA 1PNLA 2ZE6A 3ZXGA 2WQZC 3BA9A 5FY8A 3T2QA 1YI7A 1ZZ7A 3B94A 2V72A 3ML0A 1GZTA 4X89A 1E1QG 2ZS6B 2RMU1 2ZGNA 3R4SA 4FPGA 3SPGA 1MVQA 3ZXEA 2Y6JA 2YGMA 2W0XA 5C8WA 4DUYO 1KMIZ 1BLZA 4HKOA 4I0AA 1HB2A 4ZU7A 1AI6A 2ORZA 2ZTNA 3BIWE 1DYOA 4YG6A 1ND3C 2ZEYA 2RS13 4LLOA 1ASJ2 4QX3A 4MVQA 1LNQA 4IEWA 5A7PA 4P9YA 4CZSA 3D5OA 1S0JA 1AI7A 1MQTC 1M4UA 4LHSA 4A6OA 1FX5A 1RUH1 2NMOA 4RQFA 3G67A 1UU5A 4B1MA 1S0VA 2D6OX 5F5IA 2FD8A 1QBZA 5EC1C 1ZZBA 2MHFA 2VUCA 3VQWA 1EUUA 1IBKO 3G4SV 4N53B 1G8MA 2PHLA 4K7JA 3MICA 1NAEA 4TLGA 3ABMB 3KCCA 2EULA 2RJ2A 4Y5SA 4Z82A 4JPRA 4Y26A 4YW1A 3CJIC 1AR71 1KDKA 3K4AA 1ASJ3 4I3GA 5E88A 4CEYB 2QE3A 3ACIA 2QQMA 1DGWX 5E16A 1ZWIC 3OUIA 5FYHA 3FAVA 4JVAA 2YBKA 3HQRA 1HQLA 4NPMA 2ARXA 3OPZA 3O5SA 4Q8KA 5FR3A 4AG4A 1DF4A 2Z69A 1O3QA 1IS3A 4K8RB 4JAUA 2W1UA 4Y22A 2D43A 2H3OA 3POEA 4CP2A 4IV3B 4OCTA 1UMHA 3WQ1A 2XG3A 5F3IA 2KXLA 4FPJA 1K4DC 3HVDA 4J25A 1D0GA 1NI8A 4ZU5A 3OUHA 3AG3C 1K73W 2EAKA 4KMQA 3T4DA 3VKFC 3H8RA 3CZUA 4X20B 4JI3B 5GONA 3AYEA 3RYCA 3OEAA 3OBTA 1WCQA 1RTVA 2FCVA 1VB4A 1E5SA 1J83A 2E76B 3GBWA 3V0AA 4CP9B 5LL6Y 4IEYA 4EN8B 4LF5O 3D3QA 1DBNA 4FAHA 3WD5A 4HKWA 3FB5C 2IJIA 1QQCA 3W7SA 4QQPA 1G9DA 4Q1RA 2QA4V 1YWKA 4FBFA 4PF1A 4IEQA 3ZN1A 2HWF2 3CC4V 5BNOB 4AHCA 5B4NA 2J1AA 5K1PA 1K5QA 2E32A 1HNXO 2R071 2IH3C 5EBWC 3WY6A 3STLC 5FTTC 1QJX2 1R64A 4D0QA 3HT2A 4FMTA 2XAQA 1JZ5A 2OPWA 1YIFA 3POJA 3I3DA 5LYJB 3UV9A 1ST8A 4LBQD 2O14A 5EQUA 4K20A 2D98A 4EKWA 5FK8A 3L71H 3RJRA 3DECA 4MVOA 2UXDO 2FL4A 4YM0A 3I2DA 4X8NA 3DGEA 2W1SA 3WR0A 3CCSV 4AAXA 1YFYA 3B4SA 1YXWA 4NHYA 2WBKA 1PNKA 2VRZA 3JD4A 3IIIA 3NNJA 4MGTA 3T3YA 4FOQA 4JI4O 4CCJA 5LWBA 5F5AA 4BQWA 4PCRA 5L3BA 1QJX3 1DGRA 2AHZA 4C1WA 2X6BA 4O7XA 4ZOLB 2VVFA 3MIDA 2RM22 3LAGA 3ZMOA 1XBFA 3U75A 1WD3A 3ZSMA 1KQRA 3RS6A 2HH9A 5T52A 5KUKA 2TEPA 3ZRXA 4Z8BA 4ZHQB 3ZDSA 4JYCA 4QPIA 4X65O 1SBFA 2FMDA 3RZJA 1HRV2 5JH7A 4JDMA 1JUIA 2Y8KA 5KXDA 4E8DA 4YHHO 4JHZA 4JZ2A 5FPAA 4DPNA 1OVSA 1NQTA 4FFBB 1VQ8V 3OSDA 2RVAA 1N3PA 5EIBC 2ADQB 3NKGA 2RR12 4HN0A 3HOBA 1JOYA 2RM23 4BIOA 1D2QA 2BTQB 3O14A 4HL0A 3E83A 1FYUA 3J8F1 1JR9A 4Y5Z0 3I54A 2X8KA 4OZOA 2DWEC 4XFBA 3ZO0B 2I74A 2XJUA 3WOGA 2XKPA 2EIKC 3BRCA 3SH4A 4YY3B 3RYHA 2WC2A 4AHXA 1HRV3 4O4LB 3AYCA 4YFWA 1UZ0A 2XJRA 5ITZB 5FQ0B 2IU3A 1AXKA 1KD1W 2JICA 4MHUA 1DQ2A 1SCSA 3SITA 5FJKA 4LNVA 4HANA 1JYXA 4OHZA 2R30A 2ZGQA 2RR13 1GQHA 3IB3A 3ICXA 5A7WB 1RVF2 1HR0B 3SCHA 4UF0B 5A6ZA 4XUTA 2I07B 1K8AW 2PHWA 1P49A 4UCUA 3DF0A 3NAPC 3O1MA 1W99A 3AP7A 2WZ8A 2HWD1 3WF0A 2CH7A 2QTSA 1AJPA 1XSQA 4I4TA 1E1RG 5KX5A 2G9FA 3T1YB 5HV4A 2A3WA 5M0TA 1FOD1 1MVEA 3VDCA 1I3HA 3P3NA 4UWDA 5L3DA 3SNMA 2ZHMA 2JDYA 5E89A 3CBNA 3GB7C 3E5XA 4YM2A 3T4VA 3BTXA 2IXCA 3PVNA 1RVF3 4ASLA 1R1ZA 2QM4A 1YFXA 4OI0A 2ZDIA 4CXWA 2IXLA 2VUJA 3HBZA 1E5IA 2R9AA 5JI9A 2Q68A 2GMPA 5KC5A 3U4XA 1S0EA 4XMIA 2ZEXA 2VTXA 4GT1A 2Q4PA 2ZQMA 1Q8OA 2EXHA 1CIWA 2IXHA 4KQ7A 3SISA 1FXKC 2NP0A 4QKDA 1O4ZA 3PIJA 3QO7A 1UWWA 1VF7A 2WWWA 3POBA 1BS3A 4HZFA 4OUMA 3HAGA 2VOVA 4L8JA 1XNRO 1XJAA 2LM3A 1Z7S2 3M3EA 1N0NA 1LENA 3AL5A 4LA3A 3BAAA 1IKQA 4JGZB 1G7YA 1W2BU 4L87A 4A45A 1L7QA 4BIFA 4ONUA 3D3IA 4JQRA 3ACGA 4AEDB 2XBO1 4FFHA 3LSUA 1WLCA 1QVFU 4EN6B 4AI8A 3SHRA 4X64B 2OT5A 4M00A 2CV6A 5LK7B 4Q5OA 4NXMO 2NPIA 2WNVB 5LRSA 4GALA 1YQ8A 5K8SA 1DYPA 2Q1MA 2CAVA 4HNAB 3DXUA 5A3UA 4XCAA 4C0BA 1VAVA 3POGA 3OT7A 2EZPA 2RS31 4X8PA 1GR3A 1Z7S3 4UVAA 3VBRB 3SKJE 1W0JG 2CDOA 1MEC2 5FZFA 3CRRA 4I0BA 4J7JA 2LS6A 1RUC2 3KCYA 4CH6A 5C33A 2LW7A 1DQ5A 2GHYA 5JXHA 4Q4W2 1TGOA 2C9KA 4Y20A 2A7WA 3A0RA 5CU1A 1VLNA 2XAJA 1PZ7A 5B5EZ 1W39A 2HLEA 4TWTA 4FPCA 1F31A 4CC5A 1RUD1 1EAH1 3AMPA 4RN5A 3THPA 4BCUA 3V65A 1VBB2 4G28B 4M3CA 2XWJB 1LR1A 5F8PA 1M57B 2CAUA 2BU9A 4I55B 1ND2C 3D8CA 2DWRA 1NCRB 1MEC3 1K33A 4MOAA 5HBAA 1WLDA 4YM3A 4XF3A 1RUC3 2C4XA 2AYHA 2VCMA 3MUZ1 1HW5A 4IEVA 2DTWA 5TISZ 4Q4W3 3AG7A 4J42A 3O0VA 4PDWA 3WDTA 4FO9A 5KMGA 2XUEA 1TUBB 3I49A 3LOBA 5DXDA 1VBB3 4X88A 4LHKA 1WMFA 1XEQA 1VBD1 4YGDA 2YIBA 3OAAG 1JYWA 3G71V 2CY6A 4UAPA 2ZCWA 5CA0A 1WLWA 4XXAA 3AZXA 2WUHA 4Q0VA 5FOJB 4DV6B 4GCZA 1IBMB 3TAYA 4JKMA 4YJ2B 2ZBJA 1KDMA 5CFCA 4JTNA 2Y26A 4MGSA 5L73A 4CCKA 4WZFA 3OMAB 3F7VC 1ZRIA 3FYIB 5ACA2 1LTEA 2ZKNA 4HPKA 4ZPIA 5I8SA 1I08A 5LHGA 2VVEA 3WNLA 1ZZ6A 1BCXA 1H0BA 3W21A 1SHWB 4INDA 2ZA9A 5D8AB 5FPOA 4GX0A 1FXVA 5FZ0A 1HNZB 2GMMA 5C3PA 1GK9A 4J7ZA 2JIJA 3VBHB 2TBVA 4D7SA 2OQ6A 3Q4HB 3TYJA 2JG9C 1S3JA 5F7UA 4XHBA 1H2LA 1F7YA 1N33B 1UL9A 2DJVA 3UKTA 2GU9A 3QACA 4W6YA 1FYJA 2QGNA 3GVMA 4YW4A 5JR2A 1ZX5A 5EV7A 1JBCA 4AF9A 5ACA3 4A2UA 5BNNC 4Y1XA 4EN0A 2CAZC 5IDJA 3CE2A 1OVPA 4QXKA 3SJQC 1TEIA 4LMFA 2A6YA 2PQSA 1LCLA 4RUFA 1ZRRA 3VD9A 4HBNA 5E8AA 4AQ6A 4YJ3A 2Y34A 2WS92 4NOTA 3ZFGB 3VDDC 1HDJA 2YUAA 2QWOB 5FZGA 3DUIA 2CK3G 3B93A 4F6EA 2XJQA 1W6MA 3T2PA 1VMFA 2VCBA 1FT9A 3H8OA 1LKNA 3DPRC 3ZSKA 3S7IA 1PPJH 4JI5B 5GW7A 4ISRA 1QJZA 5B1OA 1VAKA 5EIBD 3WW2A 1I5XA 1AB3A 4NO4A 2OW4A 4LORA 3K58A 1OPMA 2PZSA 1W8OA 4LA2A 1VE0A 1SS3A 1PZ8A 3FUQA 1JZ6A 4PIZA 2PFWA 3B2EE 4IE4A 4MTXA 5IW0A 2IH1C 2PGGA 1MMMA 1XDCA 2Q5TA 2B5UA 1LODA 2WS93 5IYZB 3NMBA 4LHNA 1MQTB 5F37A 1LOFC 1JN2P 1B35C 4QB6A 4RQPC 5FRAA 5FKBA 3TBDA 5CADA 4HFSA 3IZOA 1RC6A 4YPJA 4I0XB 1ULDA 2OYQA 4LUMA 1YTFB 3JAWB 3OD0A 3CC2V 3UKNA 2KR2A 4NHMA 2JDIG 2B8MA 1U5XA 1MG1A 1UNBA 5F6LB 4Q27A 5B66Z 3WUCA 2JG8A 1S0DA 2G1MA 3WUDA 1N8RW 2Y6HA 2OCHA 2N05A 3CJIB 4NWVA 4HVOA 3LD8A 3WB0A 1Q8PA 1BHAA 5L9VA 1YCIA 1VARA 4LR4A 4XDKA 2FHRA 3LF7A 1ENVA 5JR7B 2HJFC 1AP5A 4B29A 5A80A 2W6IG 5T5PA 2N74A 2JENA 3BKZA 3GXUA 1KP2A 2WFF2 3ZHUA 2UUCO 1RSOB 3LCPA 2W9XA 2JWPA 5FYYA 1KECA 3S30A 3HKEB 4UOJA 3TOJA 3NWKA 4FM0A 2D40A 2DU0A 4QWNA 2EILC 3B00A 4QMAA 3BI3A 5JPNB 3L75H 2YU2A 3VBFA 5A3LA 1DQ4A 3HN3A 3CX5F 4G2KA 3ZSEA 2JIZG 1SBDA 3AG3B 2DVDA 4N43C 2GAUA 4IGOA 2N04A 4JGYA 5JIAA 1VJ2A 4IT5A 2ZHLA 4XILA 1KU9A 2VMDA 4FM2A 1RJ8A 1Y4WA 3NV2A 1UZVA 5F2WA 4IQPA 3W5NA 4IL7A 4RWUA 5EJZB 4FTSA 3WU2Z 3BTZA 1O7FA 5E1RA 2PAEA 3ZMNA 4AOCA 4M01A 5J96B 3QOPA 2CWSA 1WPXA 2MPFA 1H38A 1SERA 3O12A 4QD2A 4CVUA 4P02B 1AI4A 2EIMC 1PMHX 3SPJA 3RQ0A 5A32A 5K1XA 4UT5A 1E5RA 2YEVB 3CEIA 4ORFA 2W95A 3AKRA 1R3LC 3H1LH 2V4DA 4Q1PA 4CCNA 5LMUO 3O1RA 2ZGKA 4DZGA 3ZDVA 2ARHA 3L73H 2WLPA 4LBQA 2F4VO 1WCKA 2CTVA 2XGXA 4QJFB 5GZCA 1RUJ2 2JDZA 4LCUC 4MG2A 1OH3A 1RL3A 5JZGA 3UT5B 3KZIZ 1UOJA 5H2FZ 2ZT9B 4UFHA 1PNMA 2JJ6A 5G05L 2LFSA 5LCWL 4OHVA 1CN1A 4CDQC 2GC0A 4YW3A 1H8TC 4XBLA 4I30A 1MSWD 3AZZA 3ZYGA 1UXZA 1FJGB 2VQFB 1UD1A 4KWUA 1OCCC 4KHPO 4FLTA 1G9CA 3MLJA 5LY2A 3N4MA 4BISA 3BPZA 3KT4A 3CU7A 4XDPA 3QH6A 4KGQA 3LFMA 5IVYA 1SQVH 1Q6IA 1WPBA 5IVCA 4K35A 3CCMV 2HWF1 1JS9A 3WDVA 2Y0IA 1YUDA 5FY7A 4BPZA 1IZ3A 4DUYB 1RUJ3 4GMP0 3TCUA 3K3NA 5IYCO 1QJX1 4JI8O 1QHTA 2YXHA 5CKMA 3T2OA 4BQ2A 5DZFA 1RUNA 4F4LA 4ZXEA 2D44A 1EBOA 1YJWV 1BMFG 1H4HA 3E35A 4AHYA 5BMVA 1R6TA 1GM9A 4X1KB 4FLVA 5DZGA 5FPXA 1EPWA 4GAZA 1CQ9A 3RZMA 4QGMA 1P84F 4ZKIA 2HEPA 5F3EA 2Q1ZB 4NB5A 1AL22 3S6PA 1S0IA 4AQ2A 1CAWB 1UKGA 1J58A 2Q7GA 1SLCA 1ENRA 5DMYA 4O2AA 3RYIB 1VQ7V 1KC8W 1V0AA 1IBKB 4KXRA 4DV4O 2EIKB 2VZRA 3AXDA 2ZX2A 1OT5A 2E5LO 1YFUA 1JZ7A 1FAYA 3C7GA 2RM21 3M4FA 4NHLA 3WNKA 1VQLV 3N9MA 4AVSA 3OGCC 5FY5A 3AZYA 3ZIWA 1RP3B 5C9AA 3IIAA 2XMLA 1AL23 4ZZ8A 1HRV1 1OC1A 3NAPB 4NIDA 1L0NH 2YPDA 2VBDA 2H94A 3N9LA 3VD4A 1BL8A 2QQNA 3OUJA 4QPGC 4ISQA 4HN1A 3U4SA 5DAXA 5K0UA 4GH4A 2RR11 1QLEC 2DBIA 1SCRA 1M06G 1OHHG 1EN6A 4XAAA 3LA7A 5B1BC 3WEZA 4XIKA 2D2CB 2KA3A 3NL1A 1GH6A 1DQ0A 1XU2A 4X1IA 3EXUA 4COUA 2E75B 4XIOA 3VZJA 4HONA 3M3IA 5KXCA 4FT8A 3GM8A 1F15A 1OCOC 2FCTA 5E6HA 4LF5B 1SQBH 3RYFB 5T5OA 1TMF2 2QCSB 2B1IA 1M56C 3QVNA 4FPKA 4CH4A 4XDJA 3MO4A 4JTOA 2ITCC 1FXKB 4P5YA 4Y24A 2OZ6A 2JECA 5C7GA 1VQ9V 2QQOA 1RVF1 3ACLA 1CAVA 3AZWA 3RWRD 1HNXB 1L7RA 1G6UA 4M4RA 4B08A 1QJEA 1H8EG 1QIQA 5FYMA 3MF6A 5CA1A 1XC6A 1V6NA 3H1MA 3OGGA 4BYYA 3M7AA 1WP8A 1RITA 3A0NA 1UZWA 4AQTA 1ND3A 1TMF3 4QKFA 2UXDB 3KV6A 3PNAA 4E4DX 3VZOA 4CDXC 3ABUA 1QOSA 3VHRA 1RUG2 3K0DA 2EVXA 4JI4B 3RYKA 3NO8A 1V00A 3ZMTA 1D2SA 3PDQA 4LNUB 1W8UA 3UYJA 2QUOA 2JDKA 1JFFA 1RUF2 1X9PA 3MW3A 1L8DA 4P9OA 3N35A 1XPWA 2WZPP 5DABA 4XF9A 5FPVA 2PA7A 1H2GA 2QQWA 3KCXA 2LRPA 4KNCA 4CDUC 1F35A 1U96A 1H2KA 1SLIA 3H1WA 2DUQA 2FDIA 1K3IA 4KBBA 3VBOA 4K6BA 4I50B 5APAA 3CJIA 5GZFA 4NTYA 5FBJA 1Z0HA 2AC1A 3K0GA 2W5FA 4PA3A 3BVCA 1RUG3 1Z7S1 2ZE8A 4LBKA 4YHHB 3HT1A 2YYOA 4HOOA 5HFMA 1MS3A 1RUF3 3IDAA 1SZXA 4QX5A 4UV9A 3WZ1A 5CB4B 3CCUV 4B3NA 1S1AA 5IVJA 5CFDC 1ND2B 3ZHVA 1V6OA 4NRQA 1SFNA 5IATA 2CYFA 5FZCA 2OIGA 3GZEA 2HP8A 1SPPB 4X6QB 1K97A 4O9GA 1TNRA 2ZXWC 2D6NA 1W8ZA 1HQWA 2MW2B 2WDBA 4DV2O 1VP7A 2X6AA 5JAXA 3F2ZA 3E86A 1BVVA 1MEC1 1XU1A 3WP4A 2VZ3A 4NRPA 2A3XA 5ABJB 1W3XA 3WQ7A 1RUC1 1WW6A 1K9MW 4LWSB 2QM7A 4LH7A 4Q4W1 4QM9A 4B3RO 5CMUA 4BWAA 2CGNA 3OY8B 3OYWA 3VD7A 3JCZA 3CRMA 4QHBA 4PDLA 4IERA 3RZZA 1VBB1 2P2KA 1IG3A 4XZPA 3N2GA 1O4YA 1JX9A 4ZI7A 1AJOA 2TUNA 1K5MA 5F2VO 2D5FA 4MADA 5FZLA 1ODNA 5LB6A 2GMEA 4K9SA 5T55A 3PUHA 2ZZJA 1W9FA 4QX7A 2ZZQA 3NR7A 3UO2A 4IHJB 3CRCA 3W5MA 5H9RA 1F5JA 1QNWA 2Y38A 4MVZA 4H7MA 3T0DA 1VF6C 3K5MA 1JUHA 3R6SA 5JSRA 3P1IA 4PLNA 4GYCB 1J84A 2WWUA 1XSRA 4UI9L 3U07A 1QXJA 4PHZA 5BNNB 3SPHA 2UU8A 2NMNA 1CD3G 4BAYA 2QJ1A 4CU7A 5LHHA 3ZR5A 5FZMA 4BM8A 2V5YA 1V6LA 1YQ5A 3D82A 4BJ0A 3IJ4A 5A3PA 5JDBA 5L7OA 4TOIA 1XNRB 1KKCA 5F32A 4AFAA 4DR2O 1DLLA 1OOPA 1LHNA 3KM5A 4K40A 3E5UA 5JVDA 2XASA 1ZA4A 3AB0A 3VDDB 5ACA1 4R9CA 1E79G 2VBBA 1R3KC 1UY4A 1H1MA 2H0VA 1XHXA 4W65A 2P4EA 2D6LX 1UX7A 4H3WA 4NXMB 2WQ4A 3ZMUA 3Q8FA 4XUPA 1H4GA 1SLTA 3Q8BA 5F2SA 2LGWA 3E6CC 2ZM6O 5A3WA 4EN9B 2WA4A 2XUMA 1GWMA 4XAEA 4NRMA 4BMBA 3WG1A 5CZKA 2GH8A 1NLSA 1LEMA 1GRJA 3GDBA 1F9KA 3KD4A 2AHYA 4XBQA 5K7PA 2VQ0A 4B3MO 1PD3A 5B3SC 2ZGPA 2QR4A 5KHGA 1B35B 4RQPB 2E53A 3QBQA 3RZGA 4MO3M 2W2IA 1BBT2 1UYPA 4YLZA 2ZGOA 4DK0A 3NV4A 5LA6B 2WS91 4AE2A 4QM8A 4CDWC 3HWJA 3OPWA 3JB8A 4P9IA 1O3SA 1AR82 5AVAA 3RDIA 2P3YA 3GHMA 1HKDA 1W9WA 2ZCEA 1JJ2U 4OHXA 4XQ4A 4FPEA 1XREA 4ZY9A 3ST7A 4UW4A 2F4PA 4IEOA 1TME2 4AXOA 1UN1A 1H6XA 1BBT3 4GB32 5KHHA 3DSQA 3VBUC 5C8CA 2UXBO 1BEV2 4FSJA 1Q5OA 2VMEA 2NZ9A 1KJRA 2Z0AA 1PO12 3C7EA 2EILB 1AR83 4Y4YA 3Q8AA 2FBEA 2WN3A 4JRLA 1OJHA 4MH0E 2Z79A 1ZLZA 3K03A 3WF1A 1SQFA 4N43B 4XFIA 3LA2A 1PV0A 2RDRA 4QGLA 1P7BA 4XFGA 4H37A 1MR5A 2ITDC 3FZ3A 5I8YA 1TME3 5FBZA 2H6BA 2QQPA 4D7YA 5IY5C 1IXBA 5LA1A 5A33A 2VZOA 2B46X 4GB33 5FYSA 3T1LA 2X09A 1BEV3 4ZKTB 2IXIA 4HYOA 3CQOA 4UFLA 3D6EA 2PHRA 5GZEA 4DUVA 3JASB 1PO13 1VRH2 3MHZA 3VV1A 2EIMB 2SBAA 4QPKA 2WFF1 2WLIA 1IOAA 2OS2A 2JE7A 5D5QA 3WCSA 4UXAA 5JSPA 4BXSV 4QX2A 3N7LA 1R1A2 1QJU2 2R062 5AFEA 4BR6A 3W7WA 2D3PA 1SQPH 4XFCA 3JD1A 3PJSK 1CESA 4XE9A 5A7NA 4CDQB 2HWE2 5FMOS 1VRH3 1H6YA 1H8TB 4X8AA 1Y6XA 3LDEA 2R7EB 2RE9A 4OHYA 5EBLC 4I50A 2IJKA 5C4WA 3NJXA 4IV1A 4DNYA 4E2QA 4I02A 2EIBA 2X53S 3V0BB 5EYPB 2VVDA 5LOVA 2Y6KA 3B8MA 2ZDIC 3AYAA 4ABMA 3WF3A 1HV1A 1JOJA 2QZ3A 4QAWA 2VGDA 3N2KA 1WLTA 3UETA 5JQGA 2YGLA 3KHCA 1R1A3 5FZ4A 2ATKC 1QJU3 3PJQA 1GZWB 2R063 1Z5WA 3INAA 4R9AA 4DS0A 3JU9A 5BYNA 1FV2A 1N1VA 3ASNC 3UJOA 1CJPA 2HWE3 4YRDA 1FNZA 2X5IC 1Z2GA 3DTUB 2WO1A 1UF2C 4XURA 3B09A 1AR72 2YS8A 4UBGA 1PK6C 4IL6Z 4DUZB 1NOVA 4FQZA 2YBPA 5JJNB 1RUJ1 2G4IA 3ZS8C 2VY0A 1YO8A 3N7JA 4BOWA 2W6JG 4YZ4A 4A42A 4N9IA 1SA0B 4QE7A 3G6JB 1UY0A 4Q2FA 1W59A 3JD3A 1GWKA 3MAQA 3J81N 5A7OA 1VPHA 4XFAA 2JX9A 1PVC2 3CZJA 2XLFA 1SF9A 4AI0A 1AR73 1XOUA 3ZRVA 3KWVA 1WZXA 3M70A 4YVSB 4NHKA 4CZZA 3O7OA 4LO6B 3CXCU 3N27A 3E1F1 2W87A 2QKAA 2PI5A 3PTRB 1A34A 4Q8LA 2UUCB 3T2TA 3EYPA 2V73A 1GO3F 2JG9A 4IYIA 1PGL2 1FXHA 3G6EV 1W0NA 2VD7A 1PVC3 4AFDA 2C9AA 2WAAA 5B1BB 3I3BA 3TRSB 2FDGA 1N47A 1LHUA 4DR7O 1AL21 2CDPA 1OURA 3JB4C 1X33A 3NJZA 3RI8A 3ZXAC 3OCPA 1AI5A 3T1CA 2YSUB 4EEQA 2PHTA 1LAJA 3QLQA 2ORXA 3HPLC 3HB3B 3E22A 4QU1A 1QNMA 1FXZA 3J4UH 2KB1A 2XNDG 2ZX1A 1C5IA 3N3HA 5GM0A 2R1BA 1BQZA 1M56B 4GZ9A 4O4HB 3CCRV 3BU0A 3C3SA 4PDWC 1A32A 1A8MA 1HX6A 4L0PA 4DW0A 4K3UA 2CHHA 3DPRA 3T0AA 2B9UA 3H50A 3A22A 3O0WA 4XCBA 1LOGA 4M3CE 4M4PA 2E9QA 5LMUB 2BE3A 3K48A 1PM4A 2V4VA 5DAQA 3ASOC 4ES9A 4CCOA 1PVXA 4XJUA 1ZBE2 2AUYA 4UVBA 2IM9A 2F4VB 2GH2A 4D94A 1DIWA 2A6WA 1YEWA 5CFCC 3I2OA 4LFBO 5J09A 4RAIA 1CPYA 4CDXB 3W7TA 4J11A 5JIUA 2DCKA 4P9WA 5LP6A 1LEDA 4EFBA 2B1GA 1LOFA 2ZEWA 4AI2A 1TVKB 4DV1O 2WLLA 4KHPB 3OTFA 3WQ0A 4LKDA 3LEIA 5FYTA 1ENQA 5FL7G 3RG0A 2Q5ZA 3M3OA 3ZFEC 1TMF1 1DCSA 1UYZA 1EZVH 1ZBE3 2VNOA 3H7YA 1OCZB 1FFXA 2XH6A 1RMU2 2WWSA 2HWC2 4K8FA 4FLZA 3WCRA 1SLAA 1G9FA 3ZN4A 4JI8B 4RL7A 1M4WA 1K12A 4JYAO 1SKVA 1DZQA 1S4CA 1BQ0A 1AF9A 2HKOA 3POSA 1R3JC 2D93A 2GC1A 2VW0A 1W90A 2IBZH 2X0LA 5ERLA 2DYSC 4DO0A 3I59A 4PBOA 2Q8VA 5DG2A 5AVPA 3LEGA 1XB9A 1ZSPA 1RM1C 1VIWB 2AEZA 4MZUA 1OBNA 1Y76A 3UKMA 3ZXFA 3RZKA 1RUG1 4WVMA 1V9U2 1JPXA 5BZBA 1RMU3 4J7KA 1DQ1A 4TQFA 2HWC3 2OTJV 4DV4B 4P9XA 4AW7A 3TNPB 3U11A 1RUF1 2JE9A 4I7ZB 3J7AU 4QX1A 2E5LB 1LU1A 1R3IC 4QDRA 4JAVA 4LPLA 3VZMA 1ORQC 1Q6HA 5JWPA 4JRAA 4MGZE 4FTBA 1XQ8A 2JRIA 5BY1A 1HJFA 5IJ0A 2AZ0A 5LY1A 1T5EA 2Y4UA 3PUIA 2A79B 3TB0A 5EZYA 5FXVA 5FO7B 1US6A 5LK5A 4JI1O 4GKJO 4QHOA 4U36A 2O8OA 3A8TA 1V9U3 4GWMA 4CUCA 4J41A 4R8HA 5F9TA 2UWCA 2OT7A 3RJ2X 1PKXA 4UCVA 2F17A 3DYPA 1SESA 4X9QA 2Q73A 3PTYA 3IMMA 3THTA 1G1XB 1U12A 4PF5A 4DR3O 2EX3A 3KGLA 5IVFA 1X59A 2AW9A 3HJRA 1QMJA 3MV01 3LNNA 2JG8C 2Q6AA 1YHQV 2GZWA 3LIHA 2Y69C 3LZZA 2OCCC 2O57A 2JDAA 2JS5A 3IDEA 4C91A 3I2FA 1T6BX 1RINA 4Q0UA 4LBOA 2IZWA 3ON7A 1UIJA 3OGSA 2E33A 4CDQA 2JXAA 3FAVB 3OJBA 2QTWB 4BQ1A 4ZU4A 2F95B 1VP6A 3VQYA 3IAQA 1GU3A 1XNBA 3H1YA 3KF3A 4QIWF 1K4CC 1Y9QA 1QY4A 2LJ2A 2YZ4A 1KD7A 4LFAO 5A6YA 4LOSA 3WP6A 4Y22B 3K5OA 5KLVH 3TEXA 1BXHA 1OF3A 2IW5A 5FZ8A 4XTMA 3KSCA 5IWAB 1V54C 2XVKA 4YGEA 1IKPA 4PA9A 4A44A 2FZ2A 4QB1A 3A0HZ 1C1FA 1PMJX 3FKSG
chains in the Genus database with same CATH topology
5T54A 5I8TA 4QXKA 5BNPB 3E97A 1AUYA 3GBFA 4PBPA 2YUEA 1TEIA 4FVVA 1WUVA 2VPVA 2D3RA 2Z42A 3WHTA 1VBC2 3W59A 2A6YA 3AKPA 1D4M3 1QOOA 1LCLA 4MSVA 1J3RA 2PQQA 1ZRRA 4PIXA 3AXEA 2ETEA 3MGUA 3GBGA 3OBRA 4HBNA 5E8AA 2O1QA 4AQ6A 4KU7A 3V0AB 3NSTA 1RUH2 1OSGA 2WS92 2YMZA 3MW2A 4NOTA 3ZFGB 4AHWA 2D7FA 3VDDC 1C8M2 4QT6A 2DU1A 1BQPA 3MYXA 2C0ZA 5TSWA 4OZXA 4AEJA 3MLKA 2ARBA 3DUIA 3ZFEB 3B93A 2RMU3 1X7NA 2XJQA 4HLTA 1OA4A 2VMIA 3OF1A 2VOKA 1W6MA 1W6QA 1XYPA 1Q56A 4GULA 3K51A 4F3JA 1FT9A 1CAXB 3AMNA 1LKNA 3DPRC 3ZSKA 3S7IA 4ISRA 1QJZA 2EXJA 1DGWA 2ZGLA 1VAKA 1ND2A 1WCDJ 3CL1A 2BEOA 4RR3B 1WMDA 3AK0A 3WW2A 4F8AA 4MXVA 1GV9A 3ZYIB 2WNUA 4YZ2A 4NO4A 4AEKA 2OW4A 2VU9A 3PHMA 5KC6A 4DY5A 4RGGA 1OPMA 1H1AA 1MZ6A 4LA2A 4Z1VA 3JCIA 4WVVA 1PZ8A 3FUQA 4PIZA 1KXGA 1VBC3 3WINE 4LBMA 3LOIA 2PFWA 1LESA 3EHKA 2ENRA 2AZ5A 1UW8A 3P3PA 1YHFA 4B8EA 2Q30A 1PO21 3V15A 4YW2A 5KHKA 1OD5A 1RUE2 3D0SA 2PLV1 2Q5TA 1RUH3 2D6PA 1LODA 2WS93 4EJRA 2VQAA 1S2BA 1C8M3 5C4WB 4IV1B 5J92A 1BYHA 4LHNA 3VZKA 4AGVA 1MQTB 1LOFC 1JN2P 1B35C 4B7KA 4RQPC 5FRAA 3TBDA 5CADA 3RNSA 1JH5A 5ABJA 4HFSA 1YLLA 2GSYA 1RC6A 4YGBA 1NX8A 2BNMA 1ULDA 1IS6A 4Y1YA 4LUMA 5DUXA 1EYBA 1QDCA 5BXXA 3OD0A 1VBA1 1SQ4A 1UMZA 1W6PA 3VHNA 2OUHA 3G7DA 3R4UA 4QPGA 1ULCA 1RHI2 3UKNA 3B69A 4NHMA 1VZ4A 1Y7BA 2BFUL 2B8MA 1U5XA 3RMXA 5J3UA 4U2AA 5F6LB 3OY8A 4A7YA 4Q27A 3WUCA 5HCFA 2JG8A 2H6CA 1FMD2 1QKQA 1S0DA 4DMIA 3SH5A 1HRI2 5J36A 3WUDA 3W58A 5KEUA 1E57A 2XB6C 2UY8A 3J9SA 2YROA 5GLWA 1JYCA 3CJIB 1AX1A 3MI8A 2A75A 1S0FA 2ZHKA 1RUE3 4HVOA 4NWVA 2BVBA 1Q8PA 5CIRA 4F7ZA 4WV8A 1ZRFA 5DZEA 4LEJA 2XVGA 4N53C 4QPIB 1VB2A 1YCIA 4LR4A 3RPQA 4ASMB 1VR3A 2FHRA 1H2NA 5JR7B 3M8LA 1AYN1 1MZ5A 3ZFFC 4LE3A 4B29A 4CEWB 1ZZ8A 4SBVA 5T5PA 4HVQA 1CR7A 1LB2A 2JENA 1F5FA 5H9SA 2WBPA 3BALA 2WFF2 4OI4A 3LCPA 2ZX4A 3MDPA 1NG0A 1RHI3 4CEYC 3BOPA 2ET7A 1BBT1 1UIKA 4MX3A 1OLRA 2PHXA 3APBA 1I9RA 2ZGUA 3S30A 3O2GA 1XXNA 3TOJA 3NWKA 1CONA 4LO4B 2D40A 5A3MA 2DU0A 1FMD3 3NV3A 4WM7B 5JOWA 1HRI3 1WMEA 4RS5A 3B00A 2R072 2FQPA 4QMAA 2XVLA 5D1IA 5JPNB 3VBFA 2PYTA 5BNNA 1W0PA 2HJIA 5A3LA 1W6OA 1DQ4A 4YVWA 5CB7A 3ZSEA 1SBDA 4M2CA 2DVDA 4N43C 4OUSA 4Y1UA 1AJKA 1ZVFA 2GAUA 4IV3C 4XF0A 3QCWA 3SCFA 3ZXLA 4JGYA 1Y43B 3ZXDA 4QQLA 1YFWA 3JD73 5JIAA 1VJ2A 5JCTA 5KXEA 5J7MA 2ZHLA 4XILA 1A3KA 2DV9A 1XE8A 1GBGA 1WGPA 2X29A 1RJ8A 1G86A 1W2UA <