1H2NA

Factor inhibiting hif-1 alpha
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 103
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2nA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2nA01
4Z2WA 1H2MA 3P3PA 1YCIA 2YDEA 4JAAA 3KCXA 4NR1A 4B7KA 1H2LA 2Y0IA 2WA4A 4Z1VA 2XUMA 3P3NA 2ILMA 2CGNA 3D8CA 3KCYA 1IZ3A 1H2KA 2WA3A 4QU2A 2YC0A 4B7EA 1MZFA 1H2NA 2CGOA 4BIOA 3OD4A 5JWPA 4AI8A 1MZEA 2W0XA
chains in the Genus database with same CATH superfamily
1LOFC 2RDSA 4UXNA 3MO4A 1QJY3 2M6YA 4RQPB 1RM1C 4I02A 3PDQA 1ZBA2 2JD9A 3UV9A 4FFBB 4HOOA 2IXCA 3ETEA 2ZEWA 3B4SA 5B1AB 4MHRA 4LFBB 4BQXA 1X7NA 3THPA 4PD4F 2H8PC 3WF4A 1Q7YW 3GHNA 1VEWA 4L0PA 1R081 1K5MB 1CESA 1YF2A 1W6QB 1PIV2 2ZNIA 1VQKV 2EXHA 1DBNA 4I0WB 1ZRRA 3OMNB 1W9SA 3NRUA 4YJ2A 2VCMA 1O7FA 5LCWL 1RXGA 3POEA 5KHJA 1BBT2 3AG1C 1RUC1 1EP0A 2WWJA 4HL0A 1POV0 1R083 3WF0A 2EZOA 2XJTA 1JVMA 2DDUA 3OD0A 1DYKA 2FMDA 2HJFC 5CFCA 2O1QA 1Z7S2 3ABLB 2AXTZ 3WB0A 4XJAA 1X9PA 3HKCA 4TOIA 5B2GB 2IM9A 1AUYA 3HKDA 4MW8A 2ITCC 2PHFA 3ZFGA 1Q8PA 2D3RA 4OVEA 3WR0A 2CYFA 2WLHA 1I5PA 5HV4A 1GNHA 3BU0A 4YM2A 4I2OA 2Y6FA 3K0GA 3UCSC 3VBFA 4F7ZA 1ND2C 3BVCA 5JZGC 1VQ9V 1P7GA 3GM8A 4QXHA 1JTZX 3ZYRA 1DZTA 3AP9A 3DYOA 1WCUA 2WJSA 3K5MA 5LA1A 1O9HA 1TNRA 1YJKA 4LHLA 2VGDA 1QDOA 2JK5C 3VHRA 1KB9F 2QM4A 1SBEA 5A7WA 2ZMLA 5FPXA 4DR6B 4JTOA 2ODMA 4LF8O 5FZOA 3C8XA 1EZJA 3ICXA 1NG0A 5LK5A 2JDHA 3VKMA 1DG6A 1RHI1 3BU7A 2QEXV 1UYYA 2GHYA 4XFBA 2OZJA 1S5JA 4X88A 2Y48A 1WKYA 1XU2A 5DUUA 1T2XA 2QDNA 5FPVA 1YI9A 3DUIA 4QKDA 2YXLA 4B1MA 3RG0A 2WT1A 3QTCA 2X5IB 1SF9A 2ZGQA 4O4HB 2DU1A 1AVBA 1OVSA 5KXBA 3ZYGA 5HFLA 3RWRD 4A4AA 2EULA 1EAH2 4CS3A 2IJJA 3LPGA 5C3PA 1KITA 5A3NA 3THTA 3FN9A 2ZDIA 3DPRC 3AG4B 2VQFO 4PJYA 2R073 3VBRB 4O7XA 1KEXA 3OM3B 5BXXA 4FJCC 1WBLA 3FC0A 4LBMA 2QDOA 3H1MA 3RZKA 2AHYA 4AFDA 3N2KB 1AR93 4Q0PA 2OPWA 3JD0A 2ERFA 2P06A 2WS93 3ZR6A 4Y5Z0 2ID4A 2UWAA 4FPLA 2WABA 4PLMA 1JOYA 1NTKH 1ZRFA 5FY9A 4M4RA 1NTMH 2CGOA 3RMYA 3T4DA 2XQRA 3POWA 5IK4A 2F1MA 1ZX3A 2WBKA 1GP6A 3LB9A 4RR3C 4X1YB 3I2KA 5FLIA 4P9WA 4XDKA 3E6BA 1YFUA 4Y1UA 1JS9A 1NCRC 5FY4A 1ZTEA 4X1IA 2IU3A 4JI5O 1IQDC 1PM4A 1SDWA 4RQPC 2JE7A 4CCLA 3WDUA 4WM7C 5IAVA 3M70A 1N34B 1SLBA 2QFEA 4LIUA 4KGGA 3JQXA 4CE8A 3J7MA 2UYAA 5LBCA 3W58A 3D82A 2UUAO 1AX1A 1W90A 3IIAA 1LECA 1OH4A 4FOQA 2OQ6A 3B09A 1M56C 3HT1A 4K3AA 5M0TA 3JD72 4LC1A 1RUNA 4QU1A 3A0BZ 3ACHA 3U1XA 3W9AA 1DGWX 3NWKA 4RO2A 3T08A 3WEZA 2Q4SA 3MFCA 3CEIA 1UZWA 5CKNA 2ZCEA 1CAWB 4QU2A 4QE9A 3V56A 3MLKA 2JS5A 3M3OA 1MVQA 1WW5A 2NM1A 3JATB 3QH6A 1XNBA 4DRVA 4DRRA 2V73A 3CQOA 5A33B 2F4PA 3W7SA 1ZUQA 2QQPA 2W1SA 4MGIE 4JQTA 3OUSA 4LBEC 5J48A 1UMZA 3LEMA 2W2IA 2JDKA 3GGLA 2FTKA 3OCPA 4OZXA 2YV8A 1WLEA 3WSOA 3SPGA 1K5SA 1M57C 4JV5O 4MV2A 4PV1B 3ZKYA 3I3EA 1VBD1 1OT5A 2UUCO 1OH3A 1WD3A 3PVOA 3PVEA 4JI2B 5JXJA 5FZ8A 1OCZB 5CA0B 2GH2A 2JGDB 4CCOA 4DQAA 2XHNA 3A21A 5JZGB 1BEV1 2DQ3A 2X8KA 2ZD9A 1VAVA 4GKJO 2X5IC 1MS8A 4Y20B 1AXKA 4QPGB 4QM8A 1VF6C 1ORQC 5LA6B 2ZGUA 3PUIA 1DP0A 3ZFFC 2ZHKA 3O0VA 1I6XA 1TMF1 2JGUA 4D69A 1YFWA 4NR1A 2CDOA 4IGGA 2LM3A 3BRCA 2LQTA 3B3QE 4KNCA 3VZMA 1PZ8A 3VBRA 4LHKA 2BSKB 1YUDA 3NV3A 1WB8A 4AVSA 3K5LA 4LMFA 4PF1A 4LF9O 4YG3A 3ELNA 3LNMB 5CKQA 1US3A 5DZFA 2O14A 4D7SA 5GLVA 3WHTA 4JI6O 1HDKA 3OPTA 3CXCU 2DWDC 2YU2A 4AR2A 4R52A 1B35A 1W0JG 4FFBA 1LOEA 5FYTA 1UO9A 3SJQC 2HWE2 3KT1A 2ARAA 5IE9A 2DCYA 3IDAA 1XUQA 3AYAA 1UOGA 2ZGLA 1RUG1 3TETA 3B5LB 1NA1A 1QR8A 5SV8A 3GB7C 5D8AB 3SC7X 5A6XA 4JVAA 4U36A 1N3PA 4HPKA 3R0RA 4TV8A 2ZHLA 3UO2A 1PM9A 3LDDA 1F4NA 2PUSA 1UQXA 2ZEYA 1VMJA 2RS33 2JDPA 1OCRC 5FK7A 4XZPA 1XSRA 4XUTA 1DF4A 3ASOC 2XLFA 3K4DA 4H13B 4AI8A 4NB5A 4YJ3B 5DDJ2 4GWMA 3ZXAC 4PA9A 3QF7A 4H44B 4BW5A 4LH6A 4KGQA 1AR61 5GTIZ 2ARCA 2GNTA 1UKRA 4HK9A 4D0QA 1GH6A 2L9LA 5C4WC 1H2KA 4EWEA 1YYNA 4KP4A 2KXLA 5FDBA 2PI5A 2RM21 4BDVB 5BMVA 1S2EA 2ZGMA 4XVHA 3WG7B 3CCUV 4D8MA 4B3TB 4XHXA 1W04A 2BGPA 2HH9A 5J7MA 5JXGA 1O9GA 4BMBA 5CG8A 2A3WA 2IC1A 2LTNA 4BE3A 4LKDA 4JI6B 2C4XA 2YEVB 4ASKA 2XAGA 3N2KA 1DQ5A 1S2BA 2W3JA 3WT3A 3PJSK 3BCWA 4OUSA 1RUG3 4XYXA 1Q6IA 1JZ4A 2ZHNA 2Y4TA 3K79A 1TVGA 5A3WA 3GXUA 4GWIA 4IGOA 1BXHA 2YPJA 2CV6A 1XEQA 1QCEA 2BCCH 3ASNC 2J1UA 1VBE1 3SISA 4UB6Z 4Q29A 4DK0A 1LEDA 4JGYB 4NTYA 4A44A 3MICA 3OEAA 3TEYA 4ABMA 2PAKA 2X7RB 4PHZA 4COUA 4DY3A 5B1BC 3CD6V 5HXMA 4NE9A 4XBLA 5F2VO 1ZBA1 2WZEA 3CO2A 2VZRA 2C2AA 1RUD2 4P30A 2CTWA 3J80N 1Z2GA 4PI0A 1LEMA 1QQP1 2ZHMA 1M9NA 2WNUC 1WLTA 4NTXA 1HXS3 2JB8A 3NJYA 2NMOA 3IGAC 3NXSA 3I55V 1OHFA 4EROA 4Z1VA 3T2OA 1CAUB 1LTEA 4TZDA 1WCKA 5D1IA 5DQ0A 2WQ4A 5F7UA 1W0KG 1A32A 4GX2A 1V6MA 4EJRA 3I59A 1HB1A 5LMUB 3JB4C 1BQZA 4CH6A 4HSJA 1F4MA 1H9WA 4OHWA 1HRI2 5KA6A 4LQRA 3H7JA 4P9OA 1RHI3 4XXAA 3DPRA 4NAOA 3MW2A 1YQ6A 5F5IA 2YFUA 1QJEA 3ZHTA 2BVBA 4CDUC 3MFAA 2PA7A 2A9HA 4WVVA 3USUB 3NW4A 4LA3A 2TEPA 4NKGB 4PIXA 5L9VA 2IZWA 3BI3A 2QKSA 1SCRA 2YC2A 1K73W 3M7MX 1W8TA 3O1RA 1C57A 1ONAA 4HN1A 1XYNA 1N8RW 3RYFB 1CGPA 2ZMNA 5ITZB 2QR4A 1A3KA 1O59A 4I09A 3WG4A 4B7KA 4CTEA 1EYBA 4TWKA 4NYKA 1K3IA 1Q81W 2WO7A 1N1SA 4YXWG 4NPLA 1E5RA 1BVP1 1ZNPA 4DV2O 2JE9A 2RMKB 1AR4A 2FB5A 5J9PC 3AP7A 2Q69A 2DQ0A 4GKYA 1PM7A 4PA7A 1SACA 1JXNA 3N9LA 3POSA 2A70A 4AEDC 2V4AA 2WNOA 3WUCA 1Z78A 3AMMA 4XC9A 1DYOA 4NVPA 5B66Z 2X53S 1NA1B 2RR11 5FZMA 1WA6X 1VQ4V 5FYIA 5FMBA 1PO11 2DMXA 2ZCWA 3JUUA 3ZFGC 3UT5B 5A7PA 4P5YA 1MNGA 1OCOC 4JYBA 5FXZA 3LE0A 3KB5A 1V6LA 2A3QA 2P22C 1LAJA 3SCFA 3BALA 1VMGA 4B3RO 4AZZA 2BRTA 4MHUA 1S0GA 2VO5A 1XQ8A 3CNAA 2WNVA 3E6CC 3JCIA 1QJX3 1O5UA 2VQAA 2RS11 2Q0AA 2VVEA 1BHGA 1QJY1 2WO2A 2QQJA 3AKSA 1FI2A 1GOFA 2IJIA 3OY8B 1HW7A 2XWBB 1GM7A 4R4ZA 2UUBB 4MH0E 4O2BB 3VBFC 1AL21 3BTAA 2WT0A 4IE6A 1YHFA 2EIMB 1REDA 1H1IA 1LHWA 5CFDC 1XSQA 2PMWB 5JXIA 4C8DA 4Q8KA 1DYPA 1K9MW 5GM0A 1QNYA 5ERLA 4YIPA 3P5BA 1J84A 1JUHA 5E79Z 1GN2A 4O2AA 3E6DA 2Q1ZB 5LP6C 3JATA 4QT6A 3ZSJA 4JKKA 4D6RA 4H7LA 4NRMA 5LZ6A 3AC0A 3EFFK 3BKZA 3CC2V 1V9U1 2OTLV 3E89A 5FYHA 4AYUA 1R1A2 4GKJB 1W03A 2DFBA 1NBMG 2YBSA 3ZHRA 2XBO1 4UF0B 4ZOLB 1ULPA 1TEIA 3RYFA 2GDSA 3ACGA 2ET1A 3LFIA 3BTXA 3FHIB 1VBC2 1WW4A 2EICA 3HR9A 2QZ2A 5D2AA 3AG2B 4F6EA 4FAGA 1QJX1 4LTAA 3RDIA 1S5HC 3ZPYA 5IVEA 3EJKA 1MVEA 1XB9A 2UXNA 1I9RA 4OHVA 5FZ6A 1EUUA 2AHZA 2D7FA 3CCMV 3PVNA 4GJZA 5K0UA 3BIWE 4FM1A 1VE0A 4FPGA 3K08A 4FLWA 4R4XA 4YZ2A 3VZJA 5IJ9A 1WBFA 4OI1A 5C8CB 2NNUA 2D40A 5JVDB 1XMQB 3DKWA 1I5XA 4FFGA 2HJDA 3EBRA 1RVF1 3A0NA 4YVWA 1GV9A 3U10A 2H6BA 2ETNA 4IEWA 3B01A 4D6QA 4FPKA 4WVZA 3DGEA 2WLQA 1YQCA 4YSFA 4XOGA 2Q8VA 3UKVA 4Y26A 2PHDA 4W6XA 1UYZA 2OZ6A 2VOXA 4SBVA 1JYCA 1LNQA 2J1SA 2W47A 3WINE 3X2QB 2BWCA 1LR5A 3VDCA 5FPOA 1CAVA 4B29A 4AGGA 2G38A 1SEFA 4XJ9A 3FX3A 1V55C 3S7IA 2CHHA 3NJXA 4C91A 4W4ZA 4E4ZA 4Q2FA 1IBKO 3KLSA 3HEIA 2VW2A 2XAHA 4K8FA 1IXBA 1FXKB 1PIV3 4E2QA 1JN2P 1OLME 3S3XA 5JSPA 5EJZB 4R8CA 3OGIB 5F8PA 5FZ1A 2DVGA 3HQXA 3CZUA 5KXDA 4DR1B 1BK0A 2QQNA 5I0SA 2EX3A 5J2TB 1SLAA 3VD4A 5C3OA 3AK0A 4XFFA 4NWWA 5KR7A 4RHV2 4JGSA 3ZIWA 2RM23 2A7WA 4OHXA 4PDWA 1ULCA 5C8YB 1JBCA 3DC6A 1BMFG 2E26A 4X8AA 4R8HA 1H8VA 4MGYE 5LBFA 3HIFA 4GMP1 3BGAA 2J1RA 4HKWA 4YGDA 4BIOA 5EYPB 3H3ZA 1PGL1 1REFA 2BNOA 5JIAA 1Q3EA 4AF9A 3JCUZ 3DGTA 4UFIA 4E4SA 1KP3A 1OCZC 2XLAA 5BNOC 4W50A 3JAWA 3N7KA 3HKEA 4IDZA 4IT5A 3WP6A 3LZZA 1L8DA 1E5IA 2J1AA 1R64A 1V54B 1FMD3 3I3BA 4QB6A 2BYVE 1IVSA 4FM2A 3AJYA 3IC9A 4XEZA 5EC2C 3R6SA 1G86A 2UXDO 1RGSA 2XVLA 3TAYA 2RJKA 3V0AB 2VNVA 5LMUO 4Q1PA 2UY8A 2PHXA 3GBWA 4DV6O 3L73H 2VC9A 3UGGA 4AE2A 3TN91 2L6LA 1N36B 4H2AA 3KF3A 4CSWA 4M01A 3I2HA 1EZVH 5EZYA 4MTOA 4GH4C 1FYUA 1IBMB 1XL4A 2VOKA 1H2NA 4JF3A 3DEMA 3W5NA 4DXZA 1OQ1A 1VQLV 3P1IA 2X09A 2Q0OC 3BCCH 1B35C 1BKZA 3F2ZA 2AW9A 5K0UC 1ENQA 1CVNA 2OQ7A 4V2WA 3PUAA 1QQP2 3CU7A 1Z5VA 1W06A 4IUGA 2DUOA 5IVCA 4PF5A 1AX2A 1IS3A 3C7GA 2E7AA 3AYEA 2WS92 1YSCA 1G9FA 4CH4A 4LF5O 2ZJCA 4AEKA 1YQ8A 4L8QA 4FOVA 4QX0A 2QQVA 3AZWA 4N43B 1IDSA 2W08A 1W59A 2ITDC 5IWAO 1XU1A 4ONUA 4JZ2A 1F35A 4UYBA 1AR71 2ZE7A 3ATGA 1RUH2 1ZZ9A 3I3DA 2WSSG 5C4WB 5BNPC 5BXZA 4X89A 2KA3A 2XBO3 3TCUA 3CJIB 3AZXA 1TNFA 3W59A 4AW7A 2UURA 1XNQO 5CYYA 5B4NA 4Q4V1 1ZVFA 4IXLA 3RWKX 4LFCO 4BIZA 1W9TA 1ULOA 2RR13 2QQWA 5DAQA 4B3SO 4RR3A 3BIEA 1TAEA 4E9KA 3VQWA 2RG4A 1HW5A 1BJQA 4B3MB 1PO22 2XB6C 1W3VA 4BPZA 4ZHQB 1HN0A 5AVPA 3OR6C 1NTZH 2GMMA 3U14A 2K2SA 4K21A 3I49A 1D0HA 1F5JA 2YBPA 2ZNJA 5FPUA 1FAFA 2ZX1A 1N4CA 1UKGA 5EIYB 1YXBA 2R042 1Z5WA 1ZZBA 1LENA 1S0CA 1GN6A 5F5CA 4JZRA 4M3CB 2EXIA 1L0LH 2RDQA 1FNZA 3ZCCA 4XQ4A 3BAAA 1AI4A 3APOA 2IH1C 1V55B 1IG3A 1SPPB 2Q1MA 1ASJ2 4NHLA 1WP7A 1UJWB 2OYZA 1I94B 1POV3 4FBFA 1K34A 3VBUC 4UT5A 5LY2A 4YG0A 2B9ZA 2Y4UA 1G4YB 1OD5A 4PJ0Z 3O5SA 3QH7A 2WNVB 4PDWC 3B8NA 1GFF2 3R05A 3ZYBA 1S0VA 3AL6A 4FLVA 3FLRA 5A3TA 2FDKA 5T5LA 3POFA 1AZDA 5BR8B 1BHBA 4QGMA 3E22B 2R072 1S76D 4KU7A 4YW1A 2A7AA 1NLQA 1CD3G 4AFMA 4COWA 5CFDB 4CDWB 1UMHA 5GZEA 4AVTA 1UF2C 4NHKA 3AK3A 4C0BA 1AJOA 2A71A 2A06H 4FLXA 2ZXWB 5DPNA 4MVSA 3T2MA 1YLLA 1WP8A 5FLXN 1TG7A 4CCNA 5JJEB 4AHXA 1UN1A 5DEDA 3RYIA 1WLWA 3HMYA 1HIXA 2C1FA 3OYWB 3BPZA 3NR7A 1GNYA 1RYYA 1GLHA 1J83A 1RUF1 1VBA1 1Y43B 1FPN3 1L7LA 4A6SA 4X9QA 2P90A 3H50A 2VZUA 1N33O 4CEYB 4DINB 3C3SA 2WLLB 4EV0A 4DR5B 4LFAB 3INAA 4QWNA 3CC4V 1O8SA 4COYA 3RZLA 3MEPA 5I0TA 2YROA 4XETA 1VQ5V 3KVAA 3KHBA 5GZDA 4I0BA 5F6KA 1QR9A 3E5XA 1AI7A 2V5DA 4JI8O 1IKQA 4O9GA 5B5EZ 1PZ9A 4HNAB 1AXZA 1F8VA 1VBC1 5IJ9B 1BE3H 3T1HB 4KU8A 1KGYA 2QE3A 4BM8A 1VPHA 3K4ZA 2WKKA 2VUCA 4TV9A 1HKDA 4I55A 2J1VA 4IV1A 4FP2A 1VIWB 4CC5A 1VBB3 3VHOA 4DRXB 3T1YO 3MIFA 2ZA9A 1KQRA 2DCZA 1KUQA 3LNNA 3IAYA 5JAXA 4Y20A 2Q73A 3F5TA 5CA1B 4AI0A 1FAYA 3ZMNA 1FATA 3ZN6B 3X2QC 4IEXA 4MUVA 2PFWA 4BQ3A 3VBHB 3WDXA 1YFYA 3HNMA 3SJCC 2WWSA 3K2OA 2CUGA 5IVYA 4BXFA 1QLEC 2ES3A 2HWD2 1D2DA 4WVWA 4BQ4A 4P9YA 3J7AU 5DN6G 4WM7B 1OCCC 4BR6A 3GZEA 1EPZA 2YGLA 3CCJV 4WFFA 4CEWC 4GMP3 4YHHO 2VRZA 2E3CA 5LYJA 3BVOA 1ZZ6A 4YFZA 1L3JA 1KD1W 5F3CA 4QPYA 1PVC3 3GALA 2E7TA 2ZGOA 4CCJA 4K1YA 4BA6A 3JALB 3HB3B 3POJA 2XPJA 1SC5B 4IEZA 3LSDA 4HK8A 1K7DA 2D6KA 4Z8BA 2H94A 3RW0A 3RYIB 1W05A 1IZ3A 1R3JC 5A7SA 1HQLA 5FNVA 1W6PB 3JD2A 2HWF2 2PELA 4OX9B 2Y69C 2GU9A 3KQRA 2K1EA 1UD1A 1FNYA 2LROA 2P34A 3ZJZA 2AREA 3OB8A 1QQCA 1AHSA 4XQWA 4JPRA 2B9VA 2Y38A 3A8TA 2WLIB 4FLUA 3ZSKA 5JZGA 3GYDA 4GAZA 3AX4A 3AKPA 4W65A 3EO6A 2FDHA 5FYZA 3K46A 3MHZA 4DV4O 4OQ9A 2RS51 3K3WA 1DGRA 2R1BA 1OPMA 4AHYA 4DB5A 1JFFA 4GIQA 5F2SA 3I3MA 4AI3A 4DV0B 3SYQA 2DWEC 4ZOLA 4NO4A 1VAKA 4JI4B 2DF7A 2CL2A 4LOTA 1COWG 4J1WA 2UXDB 3LEIA 5DXDA 4MS2A 2IVJA 4D3WA 3JD1A 4JGYC 4P14A 5BNOA 4BQ2A 1TZOA 5JR2A 4CU8A 3C2UA 5FZHA 1TUEB 1F4AA 3SNMA 2VMDA 4WZCA 4KL1A 3SH3A 3HKBB 5A32B 4XDJA 3A0KA 1UWWA 3JSLA 4H55A 4IL6Z 3OTOB 2ZOEB 2FQPA 4Q5OA 3M3QA 2OXBA 3K5NA 1Y6XA 1PO13 4NUBA 3LEKA 1AYM3 4GKXA 4K20A 5L7OB 2O57A 4EFEA 4DK1A 1AR73 4MW3A 1M06G 1U97A 4Z92B 4TSFG 2HHHO 3CPWU 4FPYA 1Q8QA 1H2GA 1MR5A 5JLVA 4U7NA 5K7PA 2RMU2 3HPNA 1F15A 2VNOA 2D6LX 5FREA 3U11A 4UW6A 4JX0A 1R1A1 1OA2A 3ZN0A 1CAVB 4XFGA 2EIBA 4J10A 1JOBA 2VZ1A 4QX8A 4ZHNA 3CJIC 3OBZA 3WZ1A 2HWB3 4Y1XA 2EILB 1SZTA 3Q8EA 1J59A 4RAIA 1MEC2 3B77A 1MMMA 3DF0A 1VBA3 4DUZO 2C0ZA 1WUVA 4JTCB 1FXKC 4ARXA 1PL0A 3GWKC 4MO3M 1JYTA 1RUI3 3LOIA 2UXXA 1NZIA 1OVPA 3JD3A 3WXPA 3UETA 2EINB 4P9LA 3UNPA 4EQVA 4P08A 1B6QA 4I55B 4X66O 4FCAA 1VP7A 3CZJA 2QA4V 4HFSA 3X29B 3USUA 1LUWA 2D3SA 5LBEA 5CKMA 3KT7A 5J98B 3RT3C 4LP8A 3WCSA 3CRMA 4MG2A 5EWSA 4K8RB 4S2HA 3CRQA 2J1TA 3LD8A 3APQA 2AGAA 3CJHB 1CIYA 4NHXA 2LW1A 3VDDA 4CPBA 2ZDIC 4K35A 3PIJA 5IYCO 2YMZA 4J7JA 5FP7A 3OAAG 3NV4A 3S3WA 4JI2O 4A7YA 3OPZA 3NV2A 3ZXGA 4RYDA 2B5UA 3JAWB 3CCRV 1LB2A 4BCUA 2Q1FA 4JYAB 5BNOB 4DV5B 2AH2A 1GTOA 2NMNA 3ZIAG 2WZR1 2R043 4IEYA 3AZVA 2BFUL 3NNJA 3JD71 4AHWA 4GUNA 4LJHA 3AG7A 3POIA 3OBAA 3T0DA 3AG1B 4PQ9A 4NIIA 4Q0UA 3CSXA 4GMP0 2DYSB 3H1WA 4LBQB 4IV3A 1EV11 3OG2A 2PI4A 3IDEA 1M57B 4Y3OA 4V1PA 1C4RA 1E1QG 3CWBH 1KJLA 3KCXA 4FVMA 2B46X 2BERA 2LO1A 1G9BA 1JYWA 2R061 4QX7A 1THZA 3RYHB 5JSOA 2F93B 3AVRA 2WC2A 2BBAA 4BLIA 3CHXA 3F7VC 1BVVA 2OIEA 4GA9A 2ZR3A 1O3TA 2F4LA 3ZKUA 3Q9OA 3FFQA 5A3PA 3JZVA 1AR63 2OTJV 1B06A 2P2KA 1UIJA 1PNKA 4TQDA 1AL0G 1FOD1 1ZBE1 1HNZB 4J9ZB 2B39A 1WLCA 3A4UA 5KC6A 1XILA 3CCSV 1QIQA 4XTPA 1UMIA 4QXKA 3HBKA 2WO3A 5FO9B 1NZ6A 1R092 5LASA 4E4HA 4AFAA 4Q0SA 4C90A 4BQ5A 1DF5A 4Y24A 5IK7A 3FMGA 4R50A 3OFNG 4DR4B 4IW3A 4DUVA 5IATA 3E8BA 5I91A 4AEDB 5LYJB 2XJVA 1CONA 4YWAA 3WG7C 1GOGA 4DR4O 4ZIBA 5FCCA 5FZBA 2GN3A 5G05L 2VZ3A 3JALA 3PMEA 1RPRA 3HVDA 1XMOB 2Y0PA 1KJRA 1Y9GA 1ZSPA 1VBA2 1JMKC 5BMVB 2J22A 4RN5A 2W1QA 1UZZA 2PY5A 5IHRA 1AP6A 2EVXA 1UXXX 3O65A 1W6PA 5A80A 1DQ4A 4ISRA 3CIHA 3CB2A 3LSQA 5L3BA 2NLJC 3DPRB 4WFHA 4XJUA 2XKPA 4CXWA 2ZM6B 2XLGA 5C33A 4OYUA 2EAAA 1W9YA 3ZFEC 5FUIA 1M90W 1S0DA 2W68A 1A78A 4QDSA 5I0RA 4JZGA 3LGRA 4AL9A 3GHMA 4Q4X1 1KS5A 1NLRA 1OLMA 2VE1A 1RSOB 3DC5A 4HONA 1Q56A 1W8UA 4XCBA 4ES8A 2O8QA 2XJRA 3DN7A 2BGCA 1TUBA 1KU9A 4H14A 5L9RA 2Z69A 4Z2WA 1KFXL 5HCAA 2EJ7A 4N8MA 1FS0G 5FO8B 4JI5B 5FY5A 1TE1B 3H9VA 3S57A 2LS6A 1FX5A 2BUKA 1OUXA 4AGRA 5CB7A 1GP5A 3MBWA 1D5AA 2YB7A 2N05A 1XMOO 3CRAA 4QPJA 2J42A 2VTFA 4QX1A 3ZHUA 2D97A 5CN0A 5FZAA 4QQHA 4XZUG 5C9AA 2GC0A 5E1RA 3MPBA 3BN6A 5E88A 4EZHA 4GX1A 4RQEA 5CBGA 3JASB 3A23A 4FXGB 3VUOA 2D6PA 3K4AA 4RSUA 1SQGA 2UU9O 2RS32 2WYSA 2P6HA 2GV9A 2N7GA 5D21A 2AUYA 4B08A 3BFRA 1NCRA 4Z07A 3PL0A 1I5YA 5H6QA 5IK8A 4A3XA 5FZGA 3H1IH 1LCLA 3WB2A 4I5SA 4DR5O 4Z2AA 3EYPA 3AMPA 4AFCA 1X33A 4CH3A 1MSDA 4N53A 1W0PA 3VBHC 4GLXA 4IGQA 4DV5O 3WDYA 4JDOA 1ST8A 1WA4A 4HVQA 4OLLA 2HWB1 1DZRA 1AXYA 4AVCA 3QO8A 2QQLA 4LBNA 4FPFA 4P9XA 2ZEXA 2A73B 2OA2A 4Q0QA 3DV8A 5JCTA 4I9QA 4WM8C 5HBAA 4CBCA 2GN7A 4SLIA 1MABG 2WN3A 4QNHB 5JPNB 3S6PA 1W2BU 4HBNA 5EZWA 1QXJA 3B02A 2JDNA 4O4IA 1OQEA 1CXZB 4Q1RA 2GH8A 2AC1A 4UBGA 1K45A 3SGIA 2FDFA 1LOBA 1O3SA 2CE4A 1FPN1 3SYAA 3KMHA 5KHKA 3EB7A 1W2TA 1QEXA 1SERA 4RQPA 2WZPP 1QHTA 5HFMA 1LR1A 3RI9A 1TA8A 1SRYA 5B1NA 1FJGB 4NPMA 1XBLA 1H4GA 3E86A 2HBUA 3D0SA 4DV1O 1SZBA 3ST7A 2IXLA 1AYM1 4PI2A 1N3QA 4ISQA 4CEYC 1P84F 2VS0A 5B4XA 3TYJA 5LOVA 3PJQA 1DF0A 5FUPA 3I7DA 5FXWA 1JI6A 4NTWA 5IYZB 3OBTA 4MTFA 2PQQA 1CAXB 4UFZA 3WW2A 1YO8A 3NNFA 4MOAA 1B04A 2GTSA 2E51A 3AG4C 2ZINA 4XUPA 1V6IA 3CJXA 1XNKA 1AB3A 3UGHA 4A2UA 1I3HA 4QX3A 3Q4HB 4LORA 2Y0OA 3OEBA 5J2UB 4EE2A 5EZYB 5C9AB 4UVBA 1EN5A 4YW3A 1CX1A 3CRCA 3SR2C 1HRV1 1JX9A 4RA0A 4JTNA 4NAMA 4ZONA 1C8M1 3AM2A 5LWBA 3JAKA 1QNMA 2RE9A 2JDYA 1XC6A 2DBNA 4MVZA 5CBFA 4OUEA 3VN4A 2YDEA 5E89A 4GZRB 5KHGA 4LE4A 5JH7B 5I8TA 1UL9A 3K06A 1HRV3 2O8OA 5AC92 3AMHA 1C1LA 3OUHA 5FKCA 3E83A 1TME2 5DG2A 2BTQA 2V5YA 1Y76B 4CDQA 1JZ2A 1VQ8V 4KMQA 2JG9B 3RGBA 3W7TA 1URXA 3BTYA 1VF5B 1S77D 3PIGA 4JGZC 2A5ZA 2RS12 3HWJA 5DZGA 2DURA 5FZ7A 1ZLZA 3ZRWB 2IXJA 3J9SA 2VM9A 2RDNA 1IPKA 4BLJA 4H0LB 2WWUA 1V9U2 2W9XA 3TXSA 1JW6A 4CU9A 3WNMA 4R9BA 5CFCB 4EYUA 4P9PA 4QB2A 4DR7O 4QPIC 1C3HA 1RUJ1 5H2FZ 3VZKA 5LHIA 3CKHA 1A34A 1RUD1 2VULA 3QO7A 2YC0A 3BYWA 3ZFGB 3J4UH 3BPSA 2VBBA 5KXCA 2W1WA 1PMHX 1FV3A 3LFMA 3OEEG 5H9SA 5LOVB 1FKAO 3LUTB 3K0DA 4PIZA 1S4CA 1H0BA 4FPJA 2Y6HA 2O0OA 2FKXA 2Q68A 2OCCC 4PA6A 4DR2B 3H9AA 4NXMB 2HLDG 4AGVA 3LA3A 4FLYA 4OI0A 2HWC3 2L35A 1UY1A 1VJ2A 1SG3A 1EV12 1TMF3 2OW4A 1VB4A 3UKMA 3UGFA 4EN9B 3K58A 1GZ9A 1F31A 3ABTA 3ZEDA 4NXNO 4K0KB 4KWJA 1N1YA 1SLCA 3H3UA 5A3OA 3A2FA 2A6YA 2WT2A 1RC6A 3CJIA 4EB6A 2XOMA 4X1KA 5DAWA 4YZ1A 4DV3O 3B93A 3ZHVA 4A41A 1WA8A 3ZMZA 5L3GA 2Y8KA 4O4IB 3DYPA 3THCA 2P7TC 3NO8A 2DU0A 4V2VA 2VVFA 1S0BA 4J6GA 4C7UA 5J2TA 3DXRB 1RVF2 4Q4V2 1SDDB 1NXMA 4XAAA 2AGSA 2PHUA 3O9OA 4DR3O 2NN4A 1K4CC 3KKYA 1GZWB 3RYRA 1G7YA 1HV0A 1K12A 3M1HA 4FFIA 3S0MA 2PZSA 1X9TA 4QMAA 2CH7A 2GTAA 4PDWB 3SQOA 3WF2A 4E2GA 3D4KA 1M5IA 5BPXA 3WD5A 1BQ0A 1GZTA 4ICGA 2XDVA 2N04A 5LK7B 2QWPB 3ECQA 1H2SB 2FMYA 5FL7G 5A6QA 4YM3A 2BOBC 4N53B 4RFRB 1MEC3 3WNPA 2JEUA 1L0NH 3S30A 4OPAA 2Q8OA 3SPHA 3VL9A 2Y64A 4YM1A 4OXSA 3Q8CA 5AC93 3ZX7A 3HNBM 3LKJA 5A7WB 1SFPA 3VBOB 2VOWA 2VR4A 4LOSA 3Q8FA 1RPOA 4O4LB 4JQRA 2JIZG 3I97A 2R30A 2NZ9A 4LLFA 5DUXA 3OGCC 1ASJ1 3VDAA 5KMGA 1ZWIC 4BISA 1MS0A 2WA4A 4I4TB 2W92A 4DPNA 2VZVA 3V0AA 4QHBA 2BSKA 4GT1A 3G6BA 5EJ1B 1YDXA 5LL6Y 5E8AA 2AR6A 4MSWC 4B4QA 2YI8A 3FYIB 4D7YA 1SQPH 1OOPA 2PN5A 3AB0A 4YNIA 2JDIG 5EXOA 1NZCA 2DYCA 3RBZA 3KV4A 4CDWA 1LHNA 3VBUA 4EWAA 5T52A 1V6NA 2ZE5A 1RVF3 1WN7A 3SYOA 2VUJA 4I50A 1JZ7A 3SLIA 4QB1A 1ZM1A 3D3IA 5B1AC 2XUMA 1WGPA 3I3QA 4CH5A 2P3KA 1AI5A 1IQAA 3ILNA 1FFXA 5EYXA 1GQPA 3LCPA 4JI0O 1H38A 3HAGA 3GZTB 3OY8A 4J11A 1KP2A 4X62B 3FB8C 4FP3A 4XURA 4F83A 1KS4A 3EHKA 4C1WA 2JIJA 4LO4B 1EUTA 1Y74A 4B7EA 1PX4A 2WLLA 1D4M2 2R72A 2MEV1 1ZL8A 2GC2A 2R32A 3VD9A 4H33A 4A6OA 2NYYA 5ABJC 1IOAA 1AJNA 1YQ2A 2JG8C 3H01A 1IBLO 4M00A 3QLQA 4AOCA 1ULDA 5L19A 2XTAA 4JDMA 3O1PA 1ZZCA 3N9MA 4LEJA 1AILA 1IX9A 3H1LH 5GLWA 1EN6A 2Q7HA 2FDIA 1OJHA 5IFTA 4AK3A 2WN2A 4ZKTB 4E8CA 1W0OA 5FPLA 3H1KH 2HWB2 1D0GA 5LBQA 4HG6B 4YY3O 4JV4A 3MLLA 3S7EA 2D6MA 1RUH1 4CCEA 3K9SA 4KWLA 4BJ0A 3AZYA 4AHCA 1SBDA 1WCSA 5FZFA 1W9FA 1WLDA 3AZZA 5KHHA 4AI1A 2DCTA 2WUHA 5ACA3 4FQZA 4AVAA 1S72V 5EPAA 4UXAA 3GZUC 5CA1A 4F8AA 4U3JA 3PURA 1V0AA 4AWDA 2A3XA 3VD5A 3POYA 5IY5C 4CEWA 1EAH3 2QQUA 5LA0A 3OD4A 5CNAA 1XNTA 1HN1A 3RYCA 1VARA 4NPRA 1Q8SA 4FLTA 2F4VB 1AR72 3D5OA 2WWWA 3ABMC 1VBE2 1GMGA 1OA3A 2V4VA 3D0JA 3U0ZA 3MZHA 5BNPA 1FFTB 2XGXA 1PVC1 1Y67A 1GP4A 3IIIA 1N33B 2VCCA 2BOCC 4YM0A 2E9QA 4ZZ8A 4URTA 4IE5A 4UVAA 4DO0A 3WB1A 2KD7A 5J2UA 4OQ8A 4KXRA 3ZXLA 4N7IA 3CLPA 3WCRA 4IE4A 5IT6A 4LF6O 1DGRN 4AQ6A 5LBBA 1ULFA 3UT0A 2FCUA 5LATA 3P3NA 4TV9B 1DK1A 1X50A 1L7RA 1Y4MA 2RNBA 4A42A 1P7BA 3DKQA 4LNUB 1UPGA 4YW5A 1QBZA 4ARYA 1FXKA 2YGMA 1QXPA 3NNGA 1H8TB 2HWC1 1YVWA 3SCHA 2PHTA 1QH7A 2PYTA 1HRI1 3NQHA 2GP3A 2OCHA 3LEGA 4LE3A 3ZN6A 2E32A 2EILC 3HQRA 4P02B 1QU7A 4GH4A 5H9QA 4B4PA 3V64A 5L73A 1W8FA 2CSGA 4Y1ZA 1PGL2 5BYNA 4XUNA 1Q5OA 4XF9A 4TV8B 2GMEA 1O91A 3TK1A 4HKOA 4MX3A 3B00A 4FFHA 4DUYO 3HNYM 1NH2B 4DW0A 3OBRA 1R6TA 4Q4X2 1YIFA 2QVSB 2Z42A 3O1MA 2RVAA 4YW6A 4LUMA 4MVOA 3POGA 3MGUA 3CMEV 5JVVA 1O3QA 4U2AA 1GAXA 1HNXO 1I7FA 4YRDA 2HYXA 4LBKA 1RUE3 2R071 4AQSA 5GZFA 1GKBA 5C3SA 5JCOC 1LU2A 4XCAA 3T0AA 4QKFA 1Y3TA 3AG2C 5FY0A 4BQYA 1ND3A 3MW3A 4NXMO 4CRQA 1J1TA 4YGBA 5JUVA 4WVMB 2XL9A 4LF9B 1K97A 1AYN1 5CBHA 1X4TA 2XASA 2DV9A 5EP9A 4JYYA 4AFBA 1L1FA 3WQ7A 4UUJC 4FK5C 1W9WA 3CP1A 3CEWA 2IVIB 1GK9A 4LBQD 4GQ7A 5FZEA 2ZE8A 5B1OA 2EIJB 4I9WA 4EKWA 4DR1O 4Q4W2 1NA1C 3L2YA 5EBWC 1LOAA 4G3YC 1SQXH 4LF4B 1WMEA 3AEIA 2RS31 1RXFA 4P5HA 4KQ7A 2QKAA 1VBB2 4DR7B 4OZOA 2P1BA 1ASJ3 2F23A 3WLUA 1V00A 2IW5A 1YWKA 4TUYB 1DTOA 2WAMA 3CXHF 3DYMA 3MF9A 1QY4A 3GVMA 4CZSA 1AR62 2EBOA 1QMJA 2QTSA 2RJLA 5F9TA 1P4RA 2I07B 5LXTB 3N36A 4X20A 4KH9A 5JVDA 1O4ZA 2C9KA 1UIKA 4M3CF 5EIBC 2Q8EA 2XWJB 4XFAA 3RN4A 3RPQA 4G27B 2DYRC 2UU8A 3Q4HA 1DHKB 1CN1A 4UCVA 4QKNA 1UU4A 2EIMC 1V9U3 3R4DB 5LEJA 4LUKA 4UFKA 4HN0A 4BH9A 3RFRA 3C7EA 5FFOC 1Y9QA 1Z7S3 3B40A 4OI2A 4X64B 5FJHA 1XJAA 4LF7O 1BL8A 4U3JB 3ME2A 5IAXA 4LH7A 3GJBA 1ALYA 2D43A 4UV9A 3KV5A 1UU5A 3D8CA 4CEWB 3VD7A 2G9GA 4AEMA 5EC1C 2H6CA 3WG2A 2A6WA 2XL7A 1XYPA 1W2AX 2AZ0A 1NT2B 2K9PA 3QNEA 2B45X 2C5DA 3F95A 5I93A 1NUKA 2QE7G 4DXWA 3AK1A 1R1ZA 2QKCA 2XQXA 3T2TA 2HWF1 3SHRA 5B3SB 2QQMA 3SYPA 1TME3 4P9GA 4LHSA 3AK2A 1SQFA 4OGQB 4Q4Y3 4BMEA 2OYQA 4XDLA 1W8NA 1BZWA 4LF6B 5I0DA 3CCVV 5L3FA 1GMMA 4FTEA 3ZRWA 3IPVB 5CA3A 4TXWA 2KG7B 4Q6GA 1SQBH 5FBZA 4KG8A 1F7YA 4MGTA 2GSMB 4FTSA 3O7OA 5IWAB 3VDBA 3GWOA 2WYFA 1LOGA 3N7JA 3ZXFA 3WQ0A 1HRV2 1ACCA 3KM5A 1V6KA 4LO8A 4UWDA 2R0FA 3E8HA 1N32O 2YXYA 4ITCA 5FQ0B 5GTHZ 3CCLV 1CP9A 2F4VO 5TISZ 1AR1B 4FIPC 2HYKA 1PX3A 1QDCA 4MADA 1NQJA 1YQ5A 1XNDA 2X10A 5A7NA 3BOPA 1SHWB 2Q9LA 1J3QA 1E5SA 1PD3A 2JJ2G 3AKQA 4RL7A 5T5JA 2X5IA 2QM8A 2Q5ZA 4YJ2B 4Y1VA 4DY5A 2IFWA 1MZEA 2WIIB 3VHPA 1DQ2A 4GWNA 3H1HH 3RNSA 4AEDA 1R091 3FLPA 3E2EA 3KVBA 1PNMA 1B35B 5KX5A 2D5FA 1N36O 4WV8A 1VRH1 4JYAO 1GNZA 3N35A 3KF5A 4LK6A 5BY5A 2FZ1A 4AXOA 1W39A 2ET7A 2G9FA 4R6ZA 4QPKA 1RUJ3 1QH6A 1IXMA 3WP5A 3WNXA 1N47A 2ZKLA 5LHGA 4J41A 4JYCA 4LHNA 2ZZJA 2FYUH 1GRJA 1OF4A 2MW2B 1XNQB 3EVKA 4FPHA 3IFXA 4IEPA 2WLMA 1W99A 4D6TH 2QM7A 1C28A 5FZ3A 2QTWB 3MV01 4L99A 2EALA 3OUIA 3J7NA 5JOXA 4I01A 1WZXA 2UYBA 3TEZA 2AZ5A 1TVKB 3JU9A 4LK7A 5CAZA 4LWSA 1NYWA 4QE7A 3TNQA 4JKLA 1PGW1 2P5OA 1RIRA 4CA9A 1D2QA 1WMDA 2PYLA 4UOJA 3M8AA 4IETA 3SITA 3BHPA 2YI9A 2P3JA 3V65A 5EV7A 2RN9A 3E35A 2D5HA 1ND2B 1UOBA 4O4JA 5FYBA 4UFJA 4I7ZB 4B4RA 3K57A 3OMAB 4OPHA 1GWKA 4JAVA 5FYVA 5ANQA 3ZPOA 5BZBA 5L7OC 3ZVXA 1AR5A 5K8SA 1JZ8A 3GCWA 4AG4A 1NX9A 1HRI3 1UY4A 5L36A 1FPOA 1MS4A 1QGLA 2BZDA 1W8HA 3DXTA 5JIUA 4QPIB 4J9YB 4I4TA 5FBJA 2D6OX 4BZ4A 4EN7B 1HB2A 5IVVA 3NAPC 4IEUA 3ZRXA 4CP1A 4I30A 5B3SC 4Q4V3 4YG6A 1IBKB 3HT2A 3L9DA 1CQ9A 5ABJB 4K7JA 2ZEZA 2WZR2 4MZUA 4Y33A 5CA0A 5EQUA 1VQPV 4WFAV 3NNMA 1CR7A 5LEKA 4MXVA 4GB32 4B3MO 3W21A 3PNAA 3HOBA 1S3JA 4W8JA 5KBFA 4ZXEA 1KKCA 4X1YA 2LP7A 3DTUB 1UZ0A 2OUHA 3J7HA 1NE4A 4Q4X3 2UUBO 2HWD3 3IAQA 2ZGRA 3JXSA 2G1MA 2C6SA 3IB3A 4FZ0A 5AFBA 2NR5A 2XHKA 4BXSV 1YIJV 2AEYA 5C3RA 5KC5A 2A6VA 5DECA 5C4WA 2CU5A 3H7YA 1NVPB 1RJ8A 2YG0A 2HWC2 1Y74B 2FCTA 1WNSA 1XHXA 2EIGA 3QACA 1LU1A 2LFRA 2YZ4A 1MS3A 4PLNA 2ZXQA 5BR8O 3LSSA 3U4XA 3D3AA 4ZU7A 2DVAA 2VMFA 2D6NA 1FOD2 2R1DA 1NLSA 1RUI1 1S0JA 4DUZB 1Y7BA 4ZU4A 1SCSA 4GZ9A 5JSRA 1QHDA 1KBHA 1CPNA 1AR82 1JYXA 4LF5B 3HKCB 2BJSA 4CS2A 3NSTA 1UPSA 1SA0A 1DQ0A 3ZRSA 2BTQB 2GDFA 2DBIA 1YHQV 1S0EA 1YIPA 5EYPA 3B9CA 3WU2Z 1VQ6V 4J80A 1YC61 2Z0AA 3PU3A 4AVVA 4INDA 3FHAA 2IH3C 4N9HA 4XMAA 2VQEO 1W8OA 2A1XA 4FPOB 4XFIA 4CYDA 5I8SA 4FAHA 5BNNC 3ZO0B 2RS13 4XXPA 2PXJA 1SPPA 3AG3C 4YJ3A 1ZX5A 1LHVA 5BUVA 3R65A 2ZR2A 2VU9A 3FYEB 2ZBJA 1GUIA 3ZR5A 3RYPA 1N1TA 2LALA 5C6CA 1ZA4A 1C1FA 2EF6A 2CTPA 2MPFA 1RUH3 1X59A 1N0JA 1XI1A 1VF6A 4CDXB 1LRHA 3IDBB 2KB1A 3FAVB 5FP4A 3ZXJA 1JYNA 4BQ1A 1ENSA 5T3NA 2RMU3 4HETA 1KDMA 1RMU2 2E63A 5AVAA 5FZKA 1DDLA 1QWRA 3WQ1A 4BQWA 4DUXA 4NIDA 3ZSEA 4QHZA 5JPMB 3P3PA 4LCUC 1MZ6A 2ATFA 5FR3A 1MQTA 1ODMA 4X66B 4PDRA 1TQ5A 5IYYA 5H9PA 5CFCC 5H5NA 1GQHA 2GSYA 2DWRA 4NRQA 2XH6A 3ZMTA 2QTOA 1Y9MA 1KRIA 1ZAUA 5D8AA 1FD9A 1K33A 3MI8A 3W20A 5LHHA 2CAVA 3AYDA 4ZXKA 3ABZA 1LKNA 2LFSA 2CGNA 1U5XA 4Q4W3 2ARHA 3ZYFA 3N9NA 1MPXA 4ZZ5A 5F1RA 4MLOA 1LGNA 3SKVA 1F2NA 3H8XA 4UCRA 5C3QA 1NXD1 1WA8B 2RJZA 3G67A 4IEVA 3U07A 4OX9O 4E2SA 3KHCA 4Q26A 1RUF2 4CDUA 3WHUA 4DV3B 2Z2SB 2HVKC 4TT3G 4DR6O 2H0VA 3TBDA 5E1AC 4TYSA 4IE7A 3TN92 4A5UB 4M3CE 2C26A 2W95A 1D2SA 2MNGA 1QNWA 2DVDA 2D3PA 2I2SA 3CX5F 2YBKA 4DUYB 3I59B 5FMOS 4X65B 1VBC3 4AQ2A 3WQBA 1PGSA 4LNVA 4EN8B 4UW4A 2HBTA 4FLZA 3I2JA 4Q4Y2 1GQGA 2N74A 4RR3B 1BBT3 4YHHB 3SPCA 1CEZA 1VIBA 1PO23 4EEQA 3H0OA 1EBOA 2P67A 1VR3A 5C70A 1VMFA 4YVSC 3ITQA 2GNBA 5A33A 3KT4A 2W6JG 3GF6A 4XDPA 3NNLA 2GZWA 3VZNA 1YNAA 4JTDB 1Q90D 2ETEA 2UXCB 2ZTNA 2IXKA 3VBHA 1XE0A 3AFGA 1LHOA 2UUAB 2P3IA 1ZREA 3C7FA 4U7OA 4F6RA 4IYIA 4UCUA 4I0AA 2YS8A 4JRLA 4CCKA 4CUGA 5T50A 4ZPIA 2WDBA 2HEVF 5EBLC 2ILMA 1GKFA 1R1BA 1MS5A 3ENRA 1NS1A 1HB4A 4BHPA 4C0HA 5J37A 5FAXA 1SMVA 3S5QA 1PK6A 2BGOA 5JJJB 4Q27A 4CDXC 4NN0A 4DZGA 2TNFA 1DFQA 5FYCA 2WR9A 3VKNA 3L74H 1OI6A 3PTYA 3WDTA 2ZQMA 1X82A 2BWAA 5FOBB 4LFBO 3M99B 4PIYA 1F9KA 1R093 5FXVA 3G7DA 5EJ3A 2VW0A 2VL4A 2Q67A 1CAUA 4DYLA 4LLOA 4I50B 2HVJC 1YEWA 4X8PA 1WW6A 3FL7A 5L7OA 4OULA 2DTYA 2GUZA 3LOBA 1CPYA 2VMGA 4E2LA 2ATKC 2LJ2A 2VQFB 5FO7B 4IV1B 1CJDA 3SCGA 2YU1A 2ADPA 1QJFA 2VQTA 2YIDA 2WSUA 5FUNA 3M3CA 1AYM2 4PBOA 1H6YA 1HQNA 4CUBA 2B4KA 1CIWA 1JOJA 1VLNA 1XBFA 3KZ4C 4HKLA 1PPJH 4W4LA 5KUMA 1AYN2 5K1PA 3NJZA 5CIRA 4FPPA 3CCEV 3ABKB 4WFEA 3M8LA 1S55A 2HKXA 2VCAA 3FZ3A 1ND3C 4B3NA 4AAXA 3AFKA 5CG9A 4I3PA 2NN8A 1QJU1 1JFFB 1XYOA 1PNGA 4XDQA 2X05A 3I2IA 1PKXA 1R6KA 2G4IA 3MIDA 1SS3A 4RQFA 2W1UA 1FV2A 2ORZA 3GZAA 2RS52 2YC4A 2Z79A 5AC91 4BK4A 1SZXA 2WLPA 4DEVA 3RZMA 2HWE3 2E6VA 2BV4A 2ZMKA 2Q8DA 2YIBD 1XQNA 1ZA7A 1IS6A 1QVFU 2E33A 4R7CA 1T5EA 5A32A 2BTOA 1ROPA 4GWJA 4UVCA 4TQFA 1E1RG 2GP5A 4WBNB 3I2OA 3ORJA 3E5QA 3SJBC 1RMU3 1GICA 1LOCA 1VBD3 3ILFA 2RQ6A 1AL23 3LPFA 1G9DA 4D7TA 1DU3D 4LXLA 5FZOB 3OGSA 4CCDA 3WNNA 4XF3A 2ZS6B 5FWJA 3HQUA 5JI9A 4L2NA 1LUVA 2JIGA 4JGZB 4KBBA 5LB6A 1RUE2 2Z5UA 5IWFA 4QX2A 3ZYJB 1TME1 4EN0A 4LKFA 3CCQV 3UM7A 2Q7GA 2VZPA 4OHYA 2A3YA 4L9BA 4X64O 3THDA 2A0LA 5LGUA 4JHZA 4TWTA 4X8NA 1HWYA 4XF1A 1BLZA 1KMIZ 2YFZA 5EFUA 4J1XA 4MXWA 2IXHA 3W7WA 2ARXA 2W6IG 5IVFA 1XNRO 1ZRIA 2PTMA 3T1MA 1HJFA 4B8EA 4COZA 1NT0A 4DIQA 4D94A 3K59A 1WMFA 1AJKA 5FZIA 3N7LA 1SLLA 1ZRDA 4CP9B 4WM7A 4CDXA 3S5AA 4LO6B 3FKSG 3O14A 2YUAA 2R063 5GZGA 1PNLA 3ACIA 3E5UA 4QGNA 3ES4A 3VBUB 5LP6A 1G6NA 3OJBA 2HJIA 4KHPO 5F37A 4FFKA 4JAAA 3O1OA 4IV3C 3ZMUA 3N7MA 3VBFB 3PN1A 3VD3A 2XAQA 1MQTB 4EZ4A 4EFBA 2V72A 3POBA 5A6ZA 2WFF1 2P6JA 3DXUA 3JQWA 3ALQA 3WDWA 3E1F1 5D5PA 4CXYA 1GZWA 2PF4E 3HR0A 2P5BA 3ZYPA 3FD9A 1K5MA 5GALA 1SQ4A 4ATFA 2QKDA 5FY7A 5FNVB 3ON7A 1FPN2 3J7LA 4GCZA 3I4IA 1OURA 3SPIA 2ZIOA 1BEV2 2F6BA 4WBBA 4AQYB 4NHYA 1DLBA 2QQOA 2WFF3 2CDYA 1FT9A 4I0XA 1DZQA 1Q8IA 4KI5M 2XOKG 1V70A 3ABLC 2GMPA 3ZFFB 1R3KC 1AI6A 1E79G 1W6NA 4YW4A 3VBOA 2XAJA 5ACA1 4MGQA 1H2MA 2W39A 3APBA 5DDJ3 5FWEA 4LWSB 4ZHQA 2UWBA 4D6SA 3B69A 2K9ZA 4FTBA 1GOHA 4ZI7B 3EXUA 1J95A 3VL8A 3OGRA 3VBSA 1ND3B 1DGWA 1NR1A 4QPWA 4YIOA 4UW3A 2ZX3A 1I5ZA 4A7KA 3C7HA 2E7QA 3ABKC 3H3LA 1VMHA 3QCWA 4XUOA 3MIHA 5GONB 3MDPA 4QAWA 5E16A 2XONA 3LA7A 1OFSA 2IXIA 4CP2A 1H2LA 2F43G 3N2GA 4L8JA 1NVPD 3KV9A 1R6NA 3KS7A 3TEWA 3WW1A 5DABA 1QU0A 5IYZA 2PLV3 3HKBA 3ZXDA 3HN3A 1ZBA3 1H9PA 2VZOA 1RHI2 1DGLA 4MXWB 2Y6LA 4F4LA 4JKMA 5HI0A 2VW1A 2VY0A 1JHJA 5F39A 2AENA 1OSGA 4XF4A 5GZCA 3WF1A 1OF3A 2JXAA 4GH4B 3ZMOA 1HXS1 3VDDB 3LWCA 3Q8BA 1U12A 2W94A 1IBLB 1AR91 3QVNA 3WVJA 4O61A 1OBNA 4PT6A 4RUFA 5KXEA 1OOPC 1EAH1 4DXRA 2JECA 1ZBE2 1JPXA 4ASUG 1MG1A 2WPDG 2YICA 2ZGNA 1H8TC 3F5WC 3R66A 1JJOA 2JRIA 2BW8A 3MV11 4ZY9A 2ZZQA 5ISLA 5H9CA 1MS1A 4P9IA 1J5EB 2HP8A 3E8FA 5JOZA 2IU0A 4FXKB 1YFXA 3IJ4A 1FJGO 2YSUB 1RUC3 4AAPA 3HN1A 3DSQA 5JH7A 1PK6C 2WQ8A 2CAZC 4MTGA 3CYOA 2VTXJ 3TOJA 4RD7A 4HYOA 4O2BA 4YLZA 3H42B 5GJ6A 5BNNB 4IGPA 3JCZA 4UCSA 4WBNA 5CADA 2MEV2 1MACA 4CS4A 3PUQA 5BY1A 2PAMA 3RZJA 2EZPA 3IMMA 1JZ6A 1MOFA 3A0RA 4GD4A 1PL4A 1WCDJ 5LGTA 3RYKA 2ZPXA 5JQGA 4O2AB 1VBE3 4DUWA 1ULGA 3VQXA 2YPDA 1PHMA 2R16A 3ACFA 1UY0A 4KBZA 4ES9A 1OZ0A 4X1IB 1UNBA 3TRSB 3STLC 2R9IA 3ZFFA 3T4VA 3B2EE 3H8OA 4I3GA 3JARB 1H8EG 4TN7A 4ZI7A 1UU6A 1MS9A 4URAA 2WLJA 2GNDA 1ZBE3 1T6BX 1WWYA 1OHHG 4BWOA 2X29A 2VCBA 4UF0A 1TUBB 2YYOA 3K03A 2WLNA 2X6CA 4XW3A 4IEQA 3LIHA 3N9OA 2QWOB 4QD2A 5IDJA 2IBZH 1WW7A 2IFRA 1UFIA 3C3TA 2B5HA 1CAWA 4CCMA 3G71V 5C71A 3ASIA 4B3TO 4TTGA 1DIWA 1VBD2 1OV9A 3MHSC 2HEYF 3SEPA 4YFWA 4XACA 4UB8Z 3WDVA 3VV1A 2BBVA 3N27A 3FAVA 2DOSA 3MHHC 1IKPA 3AL5A 1LULA 1EFRG 1JCHA 2J1EA 4LULA 1H6XA 3MW4A 3R4UA 4S2FA 2LUWA 4AQYO 2JG8A 4NIGA 1OFNA 5I8YA 3O1VA 1TMF2 2B1IA 1UOFA 4QKBA 4Y22A 4N43C 1HNXB 3PU8A 2SBAA 2WINB 4LO5B 1SBFA 1N0NA 1KFUL 2OS2A 3RVYA 5IJRA 4KG0A 5LMNB 5TSWA 5FKBA 1W6QA 4LKSA 4M4PA 3G6JB 1LHUA 4CP9A 3CMAV 3VQVA 4KHPB 1DLLA 4E27A 5GKAC 3J81N 3RVHA 2HHHB 3M4FA 5CFDA 3I2DA 3L9JT 4XDOA 4KFMA 2V7QG 2KG7A 4RFT0 1DLCA 4L87A 4YZ4A 3N2GB 3LIGA 1XNAA 1R082 3EMRA 1G9AA 5JMCA 2EINC 4Z1MG 4CDWC 3D3QA 4AILC 3WV6A 2X6BA 4XJWA 3D36C 4G28B 2WNVC 4NWVA 3LQCA 2MK3A 1NJIW 1K92A 5IK5A 1Y66A 3KSCA 3SDLA 3WX5A 3QD6A 4Y5SA 5A2QN 4J7KA 3A7QA 2LW8A 3ZMVA 2XJPA 1GN3A 1CWPA 3MF6A 2AACA 4FT8A 2JGDA 3IMNA 3ZM8A 1J1LA 5FLHA 1B09A 1Q82W 4XAEA 1QQP3 3DECA 5F32A 1Q6UA 4RS5C 1CAXA 4DR3B 1DCSA 2G19A 1QOSA 5IVJA 1HNZO 1POV1 4QPGA 2ZXWC 5CISA 4UFMA 2OCCB 5DN2A 2M7WA 4UAPA 4DO2A 3W7XA 2QWQB 4PQQA 2CK3G 2D98A 2P3YA 4A45A 1YITV 3RI8A 3KGZA 4WM8A 5J09A 2HKOA 2IJKA 4RUEA 3UKTA 1I08A 1O8PA 3AJZA 2BNMA 3VBSC 1D5NA 3CE2A 5FZDA 2XVKA 2E5LO 1VBB1 3BY6A 1V6OA 2A75A 5K9YA 3WFVA 5AG2A 5JOYA 5FYMA 1J3RA 2JB4A 1HJGA 1JHNA 1EM1A 2G9ZA 1C8M2 3SH5A 3BA8A 1V9PA 4YW7A 4J42A 4NRPA 4RGGA 1UZVA 1M4UA 4QM9A 2AEZA 4OHZA 2HFEC 2A6XA 4Q4W1 5CB4B 4YY3B 2XHBA 2A79B 5D5QA 3WNOA 3K51A 1C8NA 2ZX2A 1QOTA 2CGPA 3MDSA 2R70A 1GO3F 4HPKB 2P4KA 1BMV1 1NCQA 2F95B 2MEV3 3AP6A 3I8TA 1E5HA 2GALA 1K5MC 4GX0A 4NIHA 4AI9A 4EB6B 3WG3A 2WRAA 4DEQA 2UY9A 4JDNA 2UXCO 3OTOO 4EWDA 3ZIXA 1UCXA 3T4HB 4COVA 1CPMA 2E75B 2DYRB 2XR4A 3MUY1 3PLQA 1QF3A 2WFF2 1R73A 4QGLA 3NL1A 4N53C 2R6QA 3J8F1 1BSMA 1KKDA 3PMSA 2VTXA 1PVXA 1IG0A 3IBMA 4XJ8A 4F3JA 1RINA 4JI0B 2I45A 4UFHA 1X8MA 3VBSB 3ZN4A 1H8HG 4FOWA 2W5FA 1JMUB 1OQDA 2VG9A 2CH7B 3KG2A 1SA0B 1AVMA 4XQDA 3WP4A 4XFHA 1XNCA 2JKXA 3WW4A 1SFYA 1FMD1 5JOWA 2C9AA 2YEVA 5ABJA 2JEXA 1YJNV 4QQOA 3ZMSA 1S0FA 1HDJA 4OUMA 1XRUA 4PELA 3CBNA 5LRRA 1JYVA 2EXJA 2PHRA 5JR7B 4PDMA 2PLV2 3K77A 3QBQA 2RCVA 5A1AA 2R7EB 4DOUA 5T54A 4MVQA 1NY72 2F17A 5FYYA 5LMNO 1RITA 4N23A 3V0BA 5APAA 1I1EA 2Q30A 4XILA 1SKVA 2JDZA 2OIGA 1LNSA 2P6CA 2VXJA 3K3OA 1TGOA 4MVTA 2VMCA 2WSVA 4J7ZA 2OPKA 5FLJA 2DUPA 5DAXA 4JTAB 1G8WA 1AROP 2OT7A 3T1CA 1E57A 1AX0A 4Y4RA 3ROUA 3UK9A 1WD4A 1H8TA 3K48A 5KX5B 3GCXA 2ZACA 3DXRA 2ZGPA 4QPIA 1PO12 1ODNA 1O6UA 2RJ2A 3B9IA 3USSA 1RL3A 4FVVA 1MZFA 1YTFD 4XBFA 2XNDG 3GNEA 3FBYA 3H8UA 4MVUA 2CTQA 1LGCA 3FHQA 1GM9A 2BOJA 4P2ZA 1W2OA 2W91A 1ZZ8A 1Z7S1 5J96B 3D6EA 2BTVC 4CZZA 1HR0B 1GBGA 2RDCA 4FZ1A 1QLNA 4Y22B 4YPJA 5GLZA 1YRZA 4JHTA 3RSJA 3TWIA 1BHAA 1S2KA 3CC7V 1EY2A 4YVSB 3T1LA 4IIJB 1KECA 1VQ7V 1G8MA 4LF7B 1A8DA 5HV0A 4MVMA 2B7YA 2VZQA 2BNNA 2CTRA 3B8MA 2E53A 1W6OA 2QUOA 4MT8A 2K0GA 1D4M3 1CX4A 4OI4A 5JI7A 2JG9A 3ETGA 2V09A 3HPLC 2VMHA 5KMGB 1H4HA 5K0UB 3HKDB 5K1XA 5HCFA 2VXRA 3CMGA 2P4VA 4ASMB 4OCTA 1X36A 2HWE1 1SLIA 5FP8A 3M3IA 3OMIB 5CBLA 4I0XB 1XL6A 4LR4A 1US2A 2QBXA 3VLBB 3ETQA 2WLKA 1MZ5A 3ZYHA 3NAPB 2QQKA 4BIUA 3EXAA 5EBMC 2QQIA 5L3EA 5A3MA 1M4WA 2XBO2 1F23A 5IT9N 1YJWV 2ZE6A 3G4SV 4BK5A 1KXGA 1VF7A 2UWCA 3ZDSA 1H1MA 5C5TA 4W4KA 1QXRA 3QG5A 3CJHA 4CC6A 2NPIA 5DG1A 4X65O 2Y33A 5DDJ1 5FPBA 3V0BB 4XPVA 1NKDA 5F3EA 4FO9A 1XDCA 4BW9A 3ETDA 5HCHA 3MIGA 5FP9A 1FYJA 1WPBA 1ZYBA 4IE0A 1PK6B 3HJRA 3ZS8C 1WPXA 4L92A 5DZEA 3VBBA 4JV5B 4HLTA 3FUOA 3BA9A 4FM0A 3FJSA 4ORFA 2H3OA 3FBMA 1CZVA 3GJAA 1Q8VA 4FFFA 4Z82A 4FPCA 2JENA 2YXHA 1UY3A 5C5UA 1NH2D 3K75B 1GR3A 2E74B 3PJYA 1C5IA 1BZKA 2VZTA 3EHBB 3WUDA 3L70H 4Y5TA 3EQEA 1K8AW 2RV9A 2B8MA 1VB2A 3A22A 3OTFA 1XE7A 3R4SA 1RUJ2 4ASLA 2Y34A 5FMOL 5H6RA 1PO21 1HP8A 1GSLA 3OGVA 2Q6AA 1OOPB 4YVWB 1K4DC 5EYYA 5AFEA 1NQTA 1R3LC 3JAMN 2Q5TA 3M2MA 2VZSA 3C90A 4LR3A 1GZCA 1W28A 2IWGB 1DQ1A 3VKLA 2JDUA 2YUEA 2VPVA 5L3DA 2Q4PA 4M0NA 4WZFA 2VUAA 1EPWA 2VWKA 3UKNA 2F66C 5T5OA 1FOD3 4YARA 2R041 2E31A 3FB6C 2KM2A 2ZAHA 4PLOA 3OF1A 1QKQA 2BVVA 1N1VA 5HCBA 4CU6A 3C7OA 2QWNB 5LRSA 3O1SA 1IBMO 2GC3A 1BBT1 1HX6A 4ZS2A 1LGBA 4CU7A 1VRH3 3U78A 4S2DA 5ANNA 4NROA 1ENRA 2JEMA 4K6BA 4XFCA 4QQ2A 2QSAA 4IESA 3VHNA 2WLIA 5JCOA 2EJRA 1KDKA 3ES1A 4RHV1 1UYPA 2XMLA 4KWKA 4PA4A 4DMIA 4Y4YA 3N9QA 2NLRA 4DV7B 4RS5A 5BNQA 5FZLA 2ZAAA 3J26N 5FRAA 4PCRA 3P6BA 4GYCB 3F7YC 2QZ3A 4Q0VA 1JQ0A 1W6MB 4WVMA 3AKTA 1SESA 1PVC2 1HB3A 1XOUA 4Y1YA 2ZGSA 4WM8B 2DW4A 3WY6A 2XAFA 4JCKA 5FIXA 3OUJA 3IM0A 4LA2A 4JGZA 2W0XA 4G4FA 1IGOA 1YI2V 4WCEV 1REEA 1VAMA 2GAUA 3STZC 2IUWA 4UW5A 2GNMA 3FLTA 4XBNA 3PUHA 1CZSA 1HV1A 2Z3YA 4XJZA 1QVGU 4NOTA 2LRPA 5LA6A 1J5EO 3LA2A 3SEEA 3SH4A 1AJPA 1MQTC 3JB8A 5GW7A 1NI8A 3RQ0A 5FOJB 2FHRA 2DYSC 5CU1A 5FPRA 3KV6A 4IL7A 1FFXB 4YZ5A 4JI8B 1SQQH 2EIKC 3OGGA 4A7ZA 1NCQB 2VECA 4GALA 5FPZA 3MYXA 2XT9A 1DGSA 3CRRA 2A6ZA 5IYDO 5FK8A 1N34O 1POQA 4GKKO 3TEXA 5G04L 2D3OW 5FPAA 3JAKB 1N32B 3ML0A 4BAYA 4HXCA 4CXXA 4S2GA 5FY8A 2YHJA 2Y60A 2JVDA 4XMIA 2ZKNA 2ZX0A 2VD7A 4H37A 5E6HA 2VQUA 1BMV2 4MGSA 3M3EA 2IJHA 3ZX6A 4ATEA 1R3IC 5F6LB 4C1XA 2GUZB 3QO5A 5JWPA 1KQSU 1C5HA 4HAMA 4UFLA 3LDEA 1U0AA 2ZGKA 3PTRB 5KAFZ 2Y69B 1JH5A 3T2PA 5FZ0A 2BP6A 4DW1A 2Z4FA 1ZZ7A 5C7GA 5FV3A 5JDBA 3L75H 1G6UA 3QOPA 3ZLIA 4CEYA 5L9BA 4JAUA 1IPSA 2OKXA 3H1JH 2DVFA 1P8JA 1O4YA 3AVSA 3E8GA 2RDRA 4B3RB 4YVSA 4O4JB 2JD4A 4YVWC 1XMQO 5FTTC 1P49A 3LDKA 1RUE1 3IZOA 4DXSA 3BEHA 1UZYA 2VNRA 2Y6KA 1H1AA 4QXBA 2BDRA 3PUSA 1D4M1 3JSNA 1KYOF 2CAUA 2VVDA 4UCTA 3ABUA 3SMHA 1G1XB 1FMD2 4HANA 2ZX4A 3OUFA 1W6MA 4ZBMA 2ZIMA 3K9AA 1A8MA 2VH9A 1L7QA 3NMBA 3TXQA 4YGCA 3OT7A 3UO3A 5GONA 2PAEA 4CPBD 2XKOA 1M56B 3ZN1A 1VQNV 3NVCA 1ENVA 5F3GA 5A6YA 3IN9A 3VDDC 4O4HA 2KR2A 5J3UA 5BNPB 1WJZA 4BU2A 2EIKB 4H7MA 3NAPA 1US6A 5A3UA 5FP3A 1YJ9V 1VQOV 4NMIA 1W0NA 4G9SB 4B1LA 1WMXA 2ENRA 2OWOA 3ZN5A 3FFZA 2XJUA 2WNUA 5CZKA 3RJRA 4HZ3A 3AMQA 4YZ3A 1GYKA 4ZS3A 2V1DA 4E4EA 2XG3A 3K04A 2H0BA 1QJX2 2NQYA 2I74A 5KLVH 1UPIA 1YCIA 1HNWO 1GN4A 3SPJA 4LNUA 4K8ZA 4CP0A 2CWMA 1BT8A 4JRAA 3H8RA 5A1FA 1X8EA 4YGEA 2ZGTA 4XIKA 2SLIA 1QJZA 2WAOA 3IT8A 4FI9A 5H9RA 2RS53 1EN4A 5KHIA 3WOGA 3O1UA 1YZBA 3K3NA 3G6EV 4E4DX 2GBOA 3GBGA 1MA1A 2ADDA 1FXVA 5T55A 5CB4A 4ET7A 3Q8AA 4WFGA 2OX0A 5FJKA 2FMLA 3SYCA 2X6AA 1NU1H 1O5LA 3RMXA 1GWLA 1COV2 5C8CC 5A9GA 4QDRA 5CEHA 4K3UA 5D8AC 4OMDA 2OT5A 1K42A 5KWRA 3MIEA 3M7AA 2WQZC 5K4LA 1R1A3 2JG9C 5CA6A 4HNAA 1NR7A 1D7PM 3IPVA 3WNLA 4O9EA 2JS3A 3PHMA 1Q43A 5HPOA 2V4DA 5A7QA 1PP9H 4OFGA 4HZFA 1PIV1 2ZKOA 1I94O 2D44A 2PHLA 3OPWA 4LBOA 2WZ8A 3WP3A 1W2UA 3KD4A 1QOOA 4DV2B 1BQPA 2XXZA 2JJ6A 3VBRC 1XPWA 2WZR3 5BV6A 2HG5C 2MHFA 2VOTA 4O4LA 1STMA 2RMU1 1RP3B 3JD4A 4JGYA 1RUC2 1WB7A 5IY5B 1JJ2U 5I0UA 2FZ2A 3ZRVA 4NIAA 3TGUH 2QCSB 2VWJA 4TLGA 4RHV3 3CL1A 2E76B 2ZM6O 1PNFA 1JZ5A 1COV3 2Q8CA 2CY6A 3HKEB 2RR12 3KCCA 1AR92 1W6NB 4FSJA 1QJY2 3L71H 3ETPA 4P00B 1UOJA 2EIDA 5C93A 1A6CA 2EXKA 2CTVA 1S0IA 4TUYA 1AL22 3MLJA 2FBEA 2WL1A 1OUSA 5HXVA 3JYCA 5FXXA 2KSDA 4FPEA 3HBZA 3IAPA 3H1YA 5DMYA 4IYHA 3WF3A 1B3QA 4A3ZA 2XVGA 4XF0A 2FDJA 4PDLA 5BNNA 4LBJA 3E22A 4L97A 4FMTA 3VZLA 3BOWA 3I54A 1DQ6A 4XTMA 3ZSMA 1ZRCA 2XJQA 3VKFC 1OLQA 4DRXA 4JI4O 4JASA 2FDGA 2Z5WA 4TLFA 3K5OA 3KGLA 5JQGB 3BB6A 3ZYIB 2QWRB 5KA5A 2B42B 1M1KW 2EIJC 2UXBO 1ZL8B 4MVRA 2HWD1 4U3FH 4MTXA 4DV0O 4X6RB 3OOXA 2CNAA 2VUDA 1F5FA 4EN6B 1WAZA 1JZ3A 1OKQA 1IS4A 5EK0A 5FY1A 4HT1T 3UJOA 3T1HO 1RUF3 4X1KB 2DCKA 1BYHA 2JX9A 3KZIZ 1G9CA 3J8F3 2VOVA 4LF4O 2BEOA 1W8ZA 1LJ7A 5ITZA 1NY71 1PGW2 1NKGA 3FB5C 4IIJA 4NHMA 1BGYH 4XUQA 3I56V 3U75A 4R9DA 3AMNA 3T30A 4RS5B 1W6OB 1S5LZ 4PA3A 5IJ0B 2WAAA 2HR3A 2C24A 1U5IA 2PGGA 3AXDA 2JE8A 1OMIA 5L3CA 4WFBV 2WS91 4JI1O 5SV5A 1RM1B 4LFAO 3RJ2X 3NV1A 4X6QB 3N9PA 1Z0HA 4XABA 2R062 2PQSA 5J36A 3A0HZ 4IV1C 4LT5A 1FXZA 3LDBA 3C3VA 3DCQA 4R9CA 1HNWB 5KAIZ 2P37A 4QGPA 2QDRA 1QJU3 5FZ9A 5FMCA 1W8WA 3HD8B 2D93A 3JBG1 1WCQA 5F3IA 3VZOA 3ZSLA 2OUJA 3ZFEB 1HLCA 1XREA 3AXEA 1BK1A 1JYIA 3N3HA 1UAIA 1TVKA 4LO7A 4K40A 1JU3A 2EIEA 1JU4A 3P32A 5FZCA 3ZHQA 2EA7A 4GB31 2WNEA 2QJ1A 3OR7C 4XHBA 2QGNA 1IURA 5ACA2 5LA9A 3FUQA 4M3CA 4LBLA 3WW3A 1JUIA 5IFPA 2KQXA 1GWMA 4IV3B 3AYCA 2KKWA 3BABA 3ASNB 2HWF3 3I2GA 1JR9A 4IEOA 2WO1A 1U5YA 1SLTA 2JICA 3KWVA 2ADEA 2VQEB 4PBPA 3DL3A 2AYHA 1HR0O 5IW0A 2BOIA 4XIOA 4PDVA 4JI3O 1J3PA 4XE9A 2TUNA 4NJ4A 4L11A 2WNUB 3U4SA 3OW2U 1XE8A 2VAUA 4KWUA 4QPGC 4IHJB 2LGWA 3VOUA 2Y6GA 3VQYA 4JI7B 1AP5A 3VGIA 2QNKA 3MAQA 4HMZA 3U37A 2RHPA 2DUQA 1KD7A 3UYJA 1M93A 2DN9A 4G2KA 3UT5A 1UY2A 2R9AA 2R49A 2JG8B 1HXS2 4J25A 4YYOA 3ILRA 4X62O 3PVBB 1KC8W 4W6YA 1MEC1 3CF6E 1O3RA 5A70A 1PZ7A 4DV4B 1ULEA 3ZOIA 1OXCA 3RZHA 4CCCA 3N4MA 1W2NA 3MUZ1 1OPOA 4CUCA 4DFSA 4AVBA 4HVOA 3LDCA 4Q8LA 5IVBA 1EV13 2OVUA 2CDPA 4UI9L 5GLUA 1UXZA 3O0XA 2YY1A 2UU9B 3T4ZA 1K3EA 1VRH2 1OA4A 4RWUA 1ND2A 4N21A 4JC1A 2OIIA 2E5LB 1GANA 3OEHG 2DE0X 2JDMA 2GC1A 3OE7G 3MIBA 4JI3B 1VQMV 3B94A 1RTVA 4XBQA 3LSEA 2UUCB 3FX7A 3NKGA 4BYYA 2FD8A 1APNA 2W46A 4QX5A 1IS5A 3URFA 2ZABA 1V6JA 1Y4WA 4RGKA 2JJ1G 1S1AA 2YXSA 3IDCB 3VKOA 1GM8A 2XJSA 4LKEA 1XHZA 2K46A 4RGAA 1T6GC 2AZ2A 3ASOB 4FOYA 3L2HA 1O4TA 1NAEA 2D2CB 4BWAA 4F6RB 3IC7A 1OLRA 4N9IA 5IYBO 3RYCB 1Q6HA 4LIVA 4K9SA 4BB3A 3SXWA 5LXTA 3O12A 3AKRA 4QQLA 1RUD3 4DV7O 2RM22 3GDBA 5JMOA 5FYSA 5FZ4A 2W87A 3SKJE 4BIFA 3KQ4B 2FL4A 1RJ7A 1UW8A 1YTFB 4QHOA 1NE6A 3OGJA 4QIWF 1J58A 1K5QA 1H30A 3TJTA 1BS3A 5DM6V 1SFNA 5F2WA 3O0WA 5A7OA 5IJ0A 3BODA 1Q8OA 4LBQA 3FE5A 3ZDVA 4GJYA 4CDQC 4DV6B 3BTZA 4GXLA 1MSWD 2HEPA 1JOPA 2FCVA 3LF7A 2CWSA 1LESA 2R9RB 3UQ8A 1LOFA 2P17A 5C8YA 3ABMB 5A1LA 2EAKA 4ZKIA 4MGZE 1F4HA 1UX6A 1XNRB 3ZBHA 3RZGA 4JI7O 1ENXA 4LFCB 4K1ZA 3LSUA 1AR83 1IHMA 1XXNA 3I5DA 4CUAA 1RFYA 2X0LA 2B9UA 1COV1 4UCOA 2DFCA 4Q4Y1 5A3LA 1UYXA 2PHWA 1VP6A 4HSLA 2Y0IA 1AF9A 2J7MA 4HVRA 2ADQB 1QLEB 5LGNA 1F51A 3ZFEA 3JD73 2BE3A 3E97A 5DUVA 3T09A 2VBPA 1RSOA 4UV8A 4DS0A 3ZXEA 4META 4UBHA 2QJVA 1PMIA 3IKWA 2DJVA 4E8DA 3W7UA 2PLV1 4BOWA 4Q20A 4KUMA 4DR2O 3AP5A 1HQWA 2W0FC 2B1GA 3B7MA 1OCOB 1URFA 1NCQC 2TBVA 3FWEA 4GULA 4CVUA 5T5PA 1VRBA 2Y6JA 1OD3A 5C9AC 3P30A 1UX7A 3NKTA 1C8M3 3MPPG 4K0KO 4NXNB 5LY1A 4GB33 1SQVH 3RS6A 1NOVA 1PV0A 1CZTA 3LDRA 3UL2A 2JKBA 1OCRB 1RUI2 5DAVA 5LW9A 4LF8B 1YJLA 3KCYA 5DAPA 3WNKA 3JASA 1AR81 5FQ0A 4O65A 5C8CA 2LGQA 3O1TA 4OMCA 4QJFB 4MYEA 4R9AA 1U5ZA 4N7UA 3D36A 4AI2A 4LPLA 5JJNB 1NCRB 3RYHA 5F5QA 3FB7C 1Q86W 2JWPA 2YIAA 5FMDA 3T2QA 3L72H 5GLTA 2NP0A 3GBFA 4JI1B 3RVZA 2P4EA 5IUQA 3AP4A 4N90A 4GKKB 4QQPA 2Y26A 4AQTA 2VJXA 1LODA 5LA2A 3CS5A 2DVBA 2R0HA 4FQ4A 5EIBD 3LAGA 4P9JA 1V54C 3UESA 4ZU5A 1YXWA 2ZT9B 4K8XA 2DTWA 4AEJA 3NJVA 2VNGA 1BCCH 3G80A 1RUG2 3CDZB 2JDAA 5F5AA 5KUKA 4QXCA 4DV1B 2LW7A 1FXHA 4MGKE 5EHDA 1QJU2 1XOYA 4CDUB 5LP6B 2XUEA 4M0HA 1OKOA 3TN93 3T1YB 2VBDA 2BU9A 3ACLA 3T0BA 3BUCA 2W52A 5CVRA 2ARBA 3TNPB 3JBG3 2PYJA 1JODA 2UXBB 5FYUA 1JA8A 1VALA 3WG1A 4LITA 1RMU1 5B1BB 4IHJA 2BQPA 3T3YA 3VBOC 2HLEA 1NQDA 4QDQA 5C8WA 3OSDA 1PMJX 3TB0A 3RRDA 3JARA 3OYWA 3W5MA 1Y76A 4CDQB 2VQ0A 1RB8G 1D4VB 1K5JA 2HEWF 3RWNA 4WF9V 1AYN3 2YIBA 3AG3B 2WFPA 5JXHA 1GU3A 3ZXKA 3MD0A 2VMEA 4IERA 4IQPA 2BPA2 2ORXA 4N43A 1U96A 1W3XA 3UJQA 3THOA 4H3WA 3ZHSA 1BCXA 2DCJA 1BEV3 2BFUS 1OC1A 5DUWA 1N3OA 4DXTA 1SETA 4YW2A 4GX5A 1YI7A 4W6WA 1RUOA 4MSVA 1I0HA 2Q7EA 5J1XA 3SJAC 4DNYA 3J8F2 4AHZA 1CJPA 3JBG2 4X20B 1AJQA 1IPJA 1OCCB 2WA3A 4B3SB 5CMUA 3IWZA 3VB9A 3I2FA 2VMIA 3RZZA 4TSVA
chains in the Genus database with same CATH topology
1LOFC 4OUMA 1XRUA 1ZZ6A 1QJY3 4YFZA 4RQPB 5LRRA 2B45X 2C5DA 1L3JA 2EXJA 1ZBA2 2PHRA 4I02A 5I93A 5JR7B 3UV9A 4QPYA 2IXCA 1PVC3 3GALA 2PLV2 2E7TA 3QBQA 1R1ZA 2ZGOA 4K1YA 4BA6A 3T2TA 2HWF1 4DOUA 5T54A 3SHRA 4C5WA 1NY72 2XPJA 1TME3 1RITA 1X7NA 3THPA 4IEZA 4P9GA 3LSDA 4HK8A 4BG1A 2D6KA 3V0BA 4Z8BA 3GHNA 4Q4Y3 4BMEA 1R081 1K5MB 1I1EA 2Q30A 1CESA 1IZ3A 1W6QB 1HQLA 4XILA 1BZWA 1W6PB 2JDZA 2HWF2 1PIV2 2EXHA 4FTEA 2PELA 3IPVB 2GU9A 4MVTA 1DBNA 3KQRA 4I0WB 1ZRRA 5FBZA 2WSVA 1UD1A 4KG8A 1FNYA 2OPKA 5FLJA 2P34A 2DUPA 2AREA 1AHSA 1O7FA 4XQWA 3O7OA 4FTSA 1G8WA 1LOGA 2Y38A 1E57A 5KHJA 1AX0A 1BBT2 3N7JA 3WQ0A 3ZXFA 1HRV2 3ROUA 3UK9A 1WD4A 1H8TA 3K48A 3ZSKA 3KM5A 5JZGA 1RUC1 1EP0A 3GYDA 4HL0A 1POV0 1R083 3AX4A 1V6KA 4LO8A 3AKPA 4W65A 2XJTA 3OD0A 3EO6A 2ZACA 2R0FA 2ZGPA 1DYKA 2FMDA 4QPIA 1PO12 5CFCA 2O1QA 2RS51 1DGRA 2R1BA 1Z7S2 1OPMA 4AHYA 4DB5A 3B9IA 4GIQA 3USSA 4ITCA 5FQ0B 1RL3A 4FVVA 4XJAA 1MZFA 4AI3A 3GNEA 3FBYA 5B2GB 1AUYA 2HYKA 4NO4A 1QDCA 3H8UA 1NQJA 1XNDA 1LGCA 1VAKA 2PHFA 3ZFGA 2DF7A 4M2FA 3BOPA 2CL2A 1Q8PA 2D3RA 4OVEA 3WR0A 1ZZ8A 2CYFA 4J1WA 1Z7S1 5J96B 3D6EA 2BTVC 5DXDA 1GNHA 1J3QA 1GBGA 4YM2A 4I2OA 4D3WA 4RL7A 3AKQA 5T5JA 2X5IA 4Y22B 3VBFA 4F7ZA 4JGYC 4P14A 5BNOA 4Y1VA 1ND2C 2IFWA 4DY5A 5GLZA 1YRZA 1MZEA 2WIIB 3VHPA 5JZGC 1DQ2A 3RSJA 4GWNA 3C2UA 3TWIA 1JTZX 3ZYRA 1S2KA 1DZTA 3AP9A 1EY2A 3SNMA 4YVSB 3RNSA 4AEDA 1R091 2WJSA 4WZCA 3T1LA 4KL1A 3FLPA 3SH3A 5A32B 1TNRA 3A0KA 1YJKA 4LHLA 1A8DA 1B35B 2VGDA 1QDOA 2D5FA 3VHRA 4H55A 2B7YA 1SBEA 2BNNA 2ZOEB 2E53A 2FQPA 2ZMLA 4WV8A 1W6OA 5FPXA 4JTOA 1VRH1 3M3QA 3R1JA 2QUOA 1PO13 1GNZA 2K0GA 1AYM3 1JR7A 1CX4A 1D4M3 4OI4A 4GKXA 4K20A 3N35A 2JG9A 5JI7A 5L7OB 1NG0A 2V09A 5LK5A 1AR73 2VMHA 3VKMA 5BY5A 2FZ1A 1M06G 1GVGA 2WBQA 1DG6A 1H4HA 1RHI1 3BU7A 4AXOA 1W39A 5K0UB 4Z92B 2ET7A 2G9FA 5HCFA 1RUJ3 2VXRA 4XFBA 4ASMB 1QH6A 1X36A 2OZJA 4FPYA 1Q8QA 2HWE1 1SLIA 1MR5A 5JLVA 1XU2A 3WP5A 3M3IA 3WNXA 5DUUA 2QDNA 5CBLA 1N47A 1YI9A 2ZKLA 3DUIA 5K7PA 4LR4A 2RMU2 2VNOA 3RG0A 4LHNA 2ZZJA 2WT1A 2X5IB 2D6LX 5FREA 3VLBB 2ZGQA 2DU1A 3U11A 1AVBA 3ETQA 4UW6A 4FPHA 5KXBA 1MZ5A 3ZYGA 1R1A1 1OA2A 3NAPB 4IEPA 1CAVB 4XFGA 1EAH2 1C28A 4L99A 2EALA 1KITA 5A3MA 3THTA 1M4WA 2XBO2 5JOXA 4I01A 4M27A 3CJIC 3WZ1A 2UYBA 2HWB3 1KXGA 4Y1XA 2AZ5A 3DPRC 3JU9A 2UWCA 5CAZA 1J59A 4PJYA 1MEC2 1NYWA 3ZDSA 3TNQA 1H1MA 2R073 3VBRB