1H2NA

Factor inhibiting hif-1 alpha
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
335
structure length
332
Chain Sequence
b'EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2nA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2nA01
4B7KA 4BIOA 4JAAA 4B7EA 2W0XA 1H2MA 1MZFA 4AI8A 2YC0A 3P3NA 4Z1VA 2Y0IA 2CGNA 2CGOA 2ILMA 3KCYA 1H2KA 2WA4A 3D8CA 1YCIA 3P3PA 1H2NA 1IZ3A 3OD4A 4QU2A 5JWPA 3KCXA 2YDEA 1MZEA 1H2LA 2WA3A 4NR1A 4Z2WA 2XUMA
chains in the Genus database with same CATH superfamily
1KS4A 3FMGA 4TN7A 5LBBA 3RYIA 2XTAA 3JUUA 5DUUA 5JSOA 3ZRSA 3MW3A 3PVOA 3E6CC 4KFMA 4NTXA 2W68A 3AMMA 1BHGA 3K3NA 2RJ2A 4N43B 4XDOA 1OA3A 3L9DA 1XE8A 1PNMA 4FPOB 4GX5A 2H0VA 2EIEA 2VNOA 4F6EA 1AX0A 3AXEA 3ZKUA 1Z7S3 3K03A 1VRH1 4ASMB 5C5TA 1IKPA 1Z78A 4PDWB 5T54A 3BA8A 2J42A 3UNPA 1KECA 3ZMVA 1OCZC 4FP3A 5LBCA 2OQ7A 4EE2A 2RMKB 2MPFA 1AR62 5EIBD 1XU2A 2VZPA 3L71H 2CAUA 3T1YO 1LTEA 4N9IA 4FAGA 1OD5A 1ST8A 1R73A 1BS3A 4Z92B 2WJSA 4TV9A 2XKOA 2ZGLA 5GONA 4XFCA 4NRQA 3E6DA 4DV5B 3AMQA 5LK7B 1IS6A 1XDCA 4JI3O 2MK3A 4JYBA 4M00A 3E8BA 2ETEA 4AHZA 3U37A 2RS11 1GP4A 4DFSA 1VAMA 4AR2A 3V65A 3POBA 4R8HA 1EV11 4AHYA 4BQ4A 1OLRA 1G6UA 2VQUA 4WFAV 1W2TA 2GDFA 1D4M1 3RVHA 1EPZA 3WEZA 3A4UA 2FTKA 1OCZB 1BQ0A 3EB7A 1TUBA 1VQMV 1SG3A 2JEXA 4E2LA 4UF0A 3DKWA 1QKQA 2OYZA 3MDSA 4RAIA 3A2FA 2HEVF 3VZJA 2XWJB 1JN2P 2IXLA 3N4MA 4BW5A 3LDEA 2JS3A 5ACA2 1PMIA 4XJUA 1OZ0A 4DRXB 5J2UB 1CAUB 2YV8A 3UGHA 1PVXA 4DINB 4KXRA 4LFCO 1UXXX 5I0TA 4PDLA 1VBB2 5KAIZ 5KC5A 1W28A 1G9CA 3IFXA 2YIAA 4PF1A 2R49A 4L97A 4DV3B 1EN6A 5DZFA 1RUC1 2BVVA 2FMDA 1FOD1 4BA6A 4OHWA 3J7LA 1HDKA 1GQHA 1BMFG 2LTNA 3IDCB 3OPWA 2P6CA 1NLRA 3OGRA 1RHI2 3AG7A 2XBO3 4GKXA 3EHBB 2XR4A 5DAPA 4K8FA 3DXUA 2GUZB 5J2TB 3VBUB 1ZTEA 5CB4A 2MEV2 2BPA2 1WLWA 5L3DA 1SA0A 2WT1A 2E51A 1MZEA 4IL7A 1KU9A 3N2GA 4NHYA 2W47A 1PHMA 2WO7A 5E16A 3QNEA 3K4AA 5J48A 1LHNA 4B3TB 4HYOA 1RPOA 4XPVA 2E32A 4PA9A 1AL21 1VQNV 1RUH2 2VE1A 2GMPA 1K92A 3MBWA 4AAPA 4DR5O 4CUBA 2OQ6A 1GTOA 1LEMA 4KUMA 3ACFA 2VOVA 1X4TA 4LQRA 2FDFA 1L7RA 1H4GA 1XSQA 1TME3 1S5LZ 3OBTA 5A6ZA 1QNWA 4DV5O 1HQWA 1UIJA 4QXHA 4FFHA 5IWFA 5FZ0A 2JWPA 5F37A 2HEPA 3DL3A 3CCJV 1M56B 3CYOA 4GJZA 5KWRA 4XUQA 4A42A 3DPRC 2VZRA 4LNUB 2PN5A 1SBDA 2J1AA 2BNOA 4COVA 4F6RA 1ZNPA 3CRAA 3GHMA 3AG3B 1ZBA2 5JQGA 2P4EA 3AP5A 4LC1A 1XQNA 3CD6V 4ARYA 4C0BA 2DOSA 4CDWA 4KL1A 3EMRA 4N8MA 4H7LA 3BPSA 3RQ0A 3FFQA 1Y43B 1SLBA 2Y6FA 1VBD3 2C24A 5LB6A 2RJLA 4NO4A 2V72A 4WVVA 1QJX1 2YIBA 4B29A 2WABA 3MUZ1 3TOJA 1O3SA 1OMIA 5CBHA 5KBFA 4E4HA 2A79B 2R042 3JD4A 3TN93 3OMIB 2DVDA 1JOYA 2FQPA 1IPSA 3RYHA 3H1WA 1OCOC 3H3UA 2UXBB 2Q69A 4AFMA 2BTQA 2YYOA 1UWWA 1MQTA 3DPRB 3BALA 5GLUA 4BMEA 4LF5B 3JARA 5FCCA 3B4SA 2LW1A 3QTCA 4FPGA 4DR3B 4CCDA 2O14A 4P30A 5AC92 4RQPB 3NMBA 4JI7B 3ACIA 5GZCA 3LAGA 1JCHA 4YZ1A 3P3NA 4X1KA 1XE7A 1JZ5A 3MEPA 1RUE3 1UJWB 3NAPC 1TAEA 3ZJZA 2R72A 1GZWA 1PV0A 2QQNA 5F5CA 3R6SA 2XJVA 4WVWA 3WQ1A 2D3PA 4DV3O 4GCZA 4EWDA 4BW9A 4H14A 2B5UA 3RJRA 3OW2U 4C90A 2MHFA 2A7WA 3VHPA 3ZEDA 1MR5A 4DR4O 5A1FA 1XL6A 2JDKA 4Y4RA 1OCOB 1W8NA 4M01A 3I3MA 5LP6A 1WMFA 2X6AA 1YXWA 2K0GA 4BIFA 1P8JA 4RSUA 4QKBA 3JALB 1AI5A 1PNKA 4KGQA 5FYSA 1UPGA 1K4CC 4YVWC 5FZIA 3R65A 4CTEA 5I0UA 1JW6A 4DRVA 2XBO1 1GMGA 4LXLA 5EJ1B 3RN4A 1UD1A 5IW0A 1CAXB 1PK6C 3NAPB 2Z4FA 3KCXA 2XH6A 3WHUA 1PM9A 1VMGA 2SBAA 3JD0A 2QQPA 1LHWA 1KYOF 2CGPA 2VUDA 2JDZA 2VWJA 1JXNA 1AYM2 3FKSG 4ZU4A 2XG3A 2FDHA 1I7FA 1S5JA 4WBNB 3ATGA 5H2FZ 2GH8A 5IYZB 1Y66A 1NYWA 2HR3A 4XF0A 4YVWB 1FI2A 3E1F1 1HQNA 2R9IA 3ES4A 2ZHLA 5L3EA 5KMGB 5A6XA 2A06H 4LPLA 3WCRA 2V4DA 1OQ1A 3KZIZ 1PK6B 3UKTA 4B3RB 1R6TA 2IFWA 4P9LA 3NRUA 1NR1A 3WG2A 3WF4A 4R4ZA 4HNAB 2ZXWC 3VBSC 4MLOA 3WP5A 2CYFA 3TGUH 3FB6C 3T0AA 5CA0B 4QGLA 3MIDA 3VN4A 3LIGA 4I50B 3JAKA 3P3PA 1VQ7V 2WFF2 2VBBA 1CGPA 2ZBJA 3OYWB 1IBKB 4UCTA 1KBHA 1SFYA 2BERA 4LF8O 4Q0PA 1PMHX 3WNNA 3MYXA 2UXBO 3V56A 1JFFB 2HLDG 4TSVA 1RUC2 3SYOA 5IDJA 4E8DA 1PGL1 4LF5O 2R061 4UVBA 4DR3O 4LH7A 5KC6A 4CS3A 4LBJA 3H8XA 3ETGA 1WLCA 1Q8PA 4LORA 4ARXA 2AC1A 1E79G 5G05L 2ZXWB 2BUKA 1HRV1 3VBSB 2W9XA 5F5IA 4NMIA 1GICA 1NUKA 3AKTA 3KV4A 3POGA 3V0AA 3KLSA 1E5RA 2P4VA 2IJIA 2A3XA 3TRSB 4XILA 3OEHG 3POSA 4GX1A 3CRMA 5AVPA 1RUE1 2E26A 1XNBA 3T1MA 2XUMA 3E22B 2GMMA 1ZAUA 4WVMB 4MGTA 2XXZA 3GM8A 2RJKA 2WNVA 3E97A 3FBMA 1QHTA 4ORFA 4HONA 4IERA 4Y24A 4UFZA 2QTSA 3JBG3 4EEQA 3C2UA 2QQKA 1Y7BA 4OHZA 4PDRA 3DC6A 5A3UA 3IPVB 3W7WA 1Z7S2 1MZ6A 4OMCA 3KT1A 3PDQA 3WW3A 1LEDA 3RWKX 2GV9A 3VHNA 2Q8EA 1XNQB 2ADEA 1CWPA 1U5XA 5CA1A 3NV3A 1J95A 1NVPB 4YW2A 1M4WA 1I5PA 4A7YA 2Q7EA 4KMQA 4X89A 3WB1A 2VR4A 5DDJ3 3WF0A 1RSOA 3OMAB 1E5IA 2NLRA 5J9PC 1SFPA 3S3WA 1NZIA 3VLBB 1GP5A 4RQFA 3SYPA 3B40A 3JCIA 4AGVA 4MT8A 3FFZA 5F3CA 2LUWA 1LJ7A 1QR9A 2CH7B 5FWJA 4KWJA 1GR3A 3VZMA 3FD9A 3M8LA 2VUCA 4Z2WA 1HRI3 4BIOA 3CJIC 1GSLA 4QPGA 4DV6B 4NROA 4B3RO 4MOAA 4JI1O 4GWNA 2ZDIA 1ZBE3 1V55C 2FMYA 1S2KA 4OHXA 4IT5A 5FBJA 5JCTA 1AJKA 3KS7A 4FOQA 1AJQA 4XXPA 3AB0A 2PYLA 4LF6B 4GMP1 4WM8A 1YNAA 2DN9A 1HXS2 4UOJA 3AYAA 3CC2V 1HN0A 1IX9A 2EIKC 2FMLA 2ZKLA 3VBHC 3KV5A 1QNMA 4YHHB 1VBA1 2W95A 4EJRA 1I5ZA 1BJQA 1XREA 1SPPA 1C8M3 3EJKA 2IW5A 1OH4A 1H2SB 4JI4B 5A6YA 1EM1A 4H2AA 3CJIB 3VD5A 3L74H 4CS4A 4BAYA 2G9FA 1XNDA 2W0XA 5JUVA 1V55B 1H6XA 3SR2C 1VQKV 4U3JB 1RUD3 2JGDA 4AE2A 3HOBA 2X6CA 3CE2A 4QNHB 5EBMC 2RDQA 3VBFA 2I45A 3AFGA 1QJU3 4XMIA 2Y69B 3ZN1A 1AYN3 3TBDA 2EJ7A 1I08A 2JG8A 1XU1A 3F95A 1HIXA 3ML0A 2XBO2 1W2NA 4G3YC 2VG9A 3VBHB 4MO3M 1PL0A 4SLIA 3MF9A 3MW2A 1AJOA 2QDOA 1IGOA 3H0OA 1RP3B 3ZS8C 4DR7B 3ZMTA 3KV9A 4QX3A 2C5DA 3R4DB 2Q1MA 4QB1A 4LHKA 2VZTA 3PUQA 4O2AB 1JYCA 3H8OA 2ET1A 1AR81 2K9ZA 2FZ1A 2X6BA 2JE8A 4QXCA 3VOUA 2AZ5A 1HDJA 5EYPA 3OY8B 3M1HA 2HYKA 2DQ3A 5EZYB 3AYDA 5FZ1A 3L73H 2E76B 1I6XA 4UI9L 1BT8A 1POQA 3I55V 4CEWA 1M90W 3H7JA 3GBFA 4EV0A 2DU1A 2EINC 2G9GA 1WA4A 4K3AA 3BA9A 3CDZB 1UMHA 2Z79A 2XPJA 3J26N 4XBFA 1O4TA 4DV1O 1DBNA 1TME2 2ARAA 2Q4SA 4AEJA 2AYHA 3L75H 3VD9A 1MPXA 5E79Z 1O9GA 2FKXA 3OTOB 4HBNA 1UXZA 5C8YB 4W8JA 3Q8AA 4NIDA 3AKPA 3TNQA 5A1LA 2OW4A 1QJY3 3HN1A 3FL7A 3CHXA 4O65A 5A80A 1SQPH 5H9RA 2LQTA 1XNKA 3M3CA 2N74A 3DF0A 4CXXA 3A0NA 1WB7A 5LHIA 4QX8A 3HR0A 4NAMA 1UY0A 3LEKA 3WOGA 3OD0A 4DV6O 2O1QA 3D3QA 1W0NA 1UZWA 4Q8LA 1U5YA 3VBOA 4L9BA 1VBD2 3JCUZ 2RDSA 2EINB 4YW7A 4H55A 1YJNV 1HRI1 3UESA 4XDQA 3WD5A 3J8F1 3NV1A 3AG1C 5JPNB 3WR0A 2DTWA 3TN92 3UKMA 5JWPA 1YJWV 5EXOA 3MF6A 4XJAA 1IPJA 4J25A 5FAXA 2WLQA 3DXRB 2FL4A 5DABA 3O9OA 4NTWA 1HNXB 5F6LB 2VTXJ 4CZZA 4E9KA 1KQRA 1ODMA 5FYTA 1GQGA 2ZS6B 3K9SA 1V6NA 2RQ6A 1W04A 1MZ5A 3ECQA 3CXCU 4JI4O 4PBPA 1JTZX 5JOXA 4OUMA 3WP3A 4DUXA 2RDCA 2X5IC 3EBRA 2ZX3A 3QG5A 1RUE2 3AG4C 1HB3A 1EPWA 1NCRA 3NXSA 3UKNA 3X29B 4BQ3A 3CO2A 1A3KA 2R1DA 4DRRA 1Q6IA 5T5OA 5LBFA 1RUF3 2ZPXA 5FUNA 3PUSA 2NN8A 5FNVB 3J7AU 1XMOB 3AG1B 4CVUA 2YXLA 5HXMA 4R9AA 3I49A 2YFZA 4RGKA 3VKOA 1EY2A 4NXMO 1W8WA 1WLDA 1VAKA 3O1PA 4Y20B 5EQUA 2FCVA 5ABJA 3DECA 3MHHC 1QLEB 1OFNA 4NWWA 2VCCA 4DR7O 1DZRA 3GBWA 4NPMA 1GRJA 2DTYA 4XACA 2P3JA 1SACA 4B4QA 5B66Z 2X5IB 4YGEA 4UFMA 1IG3A 4D6RA 3CF6E 4CDUA 1ZVFA 5LRSA 2XAFA 3OEBA 5EYXA 1QOOA 1N1TA 3GDBA 3RZJA 1T6GC 3KWVA 4DV4B 4MGQA 3MLLA 2JX9A 3VBRC 1AX1A 1WCDJ 2PAEA 4UAPA 1OURA 3MFCA 2W08A 2JIZG 1UF2C 3IM0A 3M3OA 3AVSA 3OTOO 3DXTA 4WM7C 4YZ5A 4N9HA 3UM7A 1AJPA 1LCLA 3SCFA 4CCEA 3PUHA 4LUKA 4RHV3 1FMD3 1XJAA 4MYEA 5L9BA 1JOPA 4AI0A 5FYYA 1ZREA 3KB5A 1HB4A 4B4RA 4I0XA 3E5UA 3VQWA 4UFLA 3W5MA 2DVBA 4HZFA 3ACHA 3Q8FA 1VBC3 1L1FA 3SJAC 4I0WB 1NCQB 1JUIA 2XVGA 3BKZA 2LW8A 3VBRB 4XUTA 2HJDA 1SLCA 4AVAA 4CDXC 3WG4A 4IETA 3APOA 1XXNA 4BQ2A 5LMUB 4XXAA 1OVPA 4XAAA 3N35A 4B3SB 4CH6A 4K21A 3WDYA 1HJFA 1UCXA 5FO9B 2B45X 4LBOA 2VNGA 4Y1VA 1RJ8A 1JZ2A 4JQRA 2XL7A 1Y76A 4JAAA 4ZKTB 1QY4A 5HI0A 4WBBA 1HNXO 4HSJA 4YZ2A 3B9CA 3VQVA 1PKXA 4Y1XA 1DHKB 3M4FA 5CFDA 1K7DA 3R66A 2Y64A 1RUJ1 2WDBA 1YEWA 3RYHB 2QE7G 1NH2D 5JH7B 3T2PA 4COUA 3KG2A 5AFBA 3ZSEA 1Y67A 4YM0A 4MGKE 2LRPA 1E1RG 3U0ZA 3RYCA 3GBGA 3JARB 4CDXB 1WBFA 2JIGA 4JI8O 2YEVB 3HBKA 1ZX5A 1SHWB 3OUFA 1XQ8A 1G4YB 3W7UA 1GZTA 2ZKOA 4AQ2A 1CZTA 1XMOO 4IUGA 5KUMA 1W59A 3SYQA 5T50A 1GNYA 5FJHA 1N4CA 1H1IA 2HLEA 4W50A 1DYOA 1FXZA 1LESA 4OZXA 4GLXA 1QJEA 4EKWA 1TMF1 3W7SA 2W94A 5AVAA 2BE3A 1WLTA 4A45A 4YGCA 3WNPA 3JBG2 1OPOA 4RGGA 3SPIA 3H1MA 4XHBA 5B5EZ 1X8EA 5LP6B 3UKVA 4JDNA 2ZNIA 2XL9A 2QWRB 4CH4A 5BNOC 5FTTC 3ZVXA 4MVRA 3D3AA 4LR3A 3Q9OA 3LB9A 3U1XA 4HETA 4M4RA 4KG0A 1WCUA 2XJUA 1IDSA 4JDOA 5DDJ2 3VZOA 2PLV3 4ISRA 3MIBA 5FP7A 1ZRCA 3J7MA 2ATFA 4LKDA 2UUCB 4AVSA 4DR2O 3BTYA 2YMZA 3ZRVA 3PU3A 2ZJCA 4JYAO 3OEAA 3T0BA 3C3VA 3A0HZ 5EJ3A 5IJ0A 2WPDG 4HXCA 2UUAO 4QPYA 1W03A 2Q9LA 2PAKA 5IYCO 1F2NA 5ANQA 5C93A 1JMUB 2LGQA 4QQHA 2EX3A 5BNOB 2VMEA 1ZBE2 1BK1A 3KQRA 3ZFFA 4PLOA 4COWA 1SETA 3K5OA 3FAVA 4ZKIA 3B94A 4I30A 3ZRWA 1QVGU 1VBE1 1J3RA 3JASA 4UFIA 4Y5Z0 4MW3A 2EIMC 5LMUO 5FMOS 1VBC1 3AL5A 5C3SA 4B3SO 4I3GA 2ZHNA 4QMAA 1DQ6A 3OBRA 1ODNA 4OMDA 4PIYA 5FR3A 4MTXA 5HFMA 3D3IA 4WCEV 5DUXA 2C26A 1CIWA 1ZRFA 2PHTA 4W6XA 3HT2A 1OF3A 3CMEV 1QXJA 5I0SA 2C4XA 1C8M2 3I59B 2F4VO 5IVYA 4HPKB 1FT9A 4NWVA 4J42A 4A6SA 2B9UA 3H9VA 1WCKA 3L2HA 3JAWB 2LS6A 1ZRIA 1RUD2 1NJIW 3PMSA 2QTOA 2E5LO 2Q8CA 1OJHA 5LXTA 1RUI1 4JQTA 3KKYA 1QJU2 1V0AA 5CA3A 3ZM8A 3NO8A 1D2DA 4K6BA 1FJGB 3K06A 1AYN2 1TZOA 5EBLC 2EIMB 1O3RA 3QF7A 3ZMZA 1I5YA 3SXWA 3KHCA 2XASA 2WA4A 4NHXA 2ZMKA 4NTYA 3NKGA 1D5AA 1B06A 2QM7A 4DS0A 4Q4X3 5LWBA 4PV1B 2VW1A 1PO11 1S0CA 3LSDA 2L6LA 4YARA 1F51A 3RWNA 3N2KB 2WLPA 5H6QA 1EAH1 2RR13 2E7QA 2FD8A 1O59A 5BV6A 3M99B 5FY7A 1DGRN 4FVMA 2BVBA 2RG4A 2VMHA 4TUYB 1N0NA 4DR1B 2AR6A 3CJHA 3C7GA 4F7ZA 2WNVB 4YW6A 3WY6A 2LFRA 4CU8A 3LNMB 5GTIZ 4D6TH 3HQRA 1JOJA 5LK5A 2PF4E 2PY5A 3PLQA 3I3DA 2WS93 2YGMA 5KX5B 2ILMA 1VQPV 4FFFA 5LGNA 3UO2A 2KB1A 1QQP3 3POJA 3MPPG 1PO21 1CP9A 2BV4A 2JG9A 2KM2A 4L2NA 1FFXB 2UUCO 4MX3A 3SJQC 1QJY2 1SQGA 4I7ZB 2ZAAA 2XT9A 1GLHA 3CCMV 1BK0A 1EN4A 4I9QA 3ABUA 2YUAA 4I4TB 4QJFB 4P9OA 1JYXA 2G4IA 2EIDA 4EN8B 3A23A 3TEZA 2VQFB 1V9U1 1FV2A 1ZZ9A 5BPXA 3BY6A 2ENRA 3AEIA 3GJAA 5KHKA 5FY0A 2IC1A 2YXYA 3CEWA 5C7GA 1CZSA 1UKGA 3L9JT 1V6LA 2NN4A 2Q5TA 3N9LA 5LYJA 1R1BA 4I5SA 1YQ8A 2ARCA 4D7TA 1PL4A 4NKGB 4IHJB 4JI2B 1H2NA 4B3NA 3J81N 1JYWA 5FKBA 1CAWB 2IU3A 2R073 2JEMA 1V00A 2WQZC 2BOIA 2WZEA 3UO3A 5GKAC 3BOPA 1VIWB 4K9SA 4FLWA 4GKJO 4AEDC 2R0FA 4LNVA 4K8XA 2RS33 3G71V 1M06G 3WZ1A 4FTBA 3GVMA 2IM9A 4FPCA 3WQ7A 3VDCA 3N9MA 2LW7A 1M57C 2D3RA 4META 2UURA 1XBLA 1VQ6V 3K04A 1MZFA 3T1LA 2WWUA 2YBSA 3ETEA 3SCHA 1W6PA 3N7JA 1WW6A 1RUF2 5FPXA 1MEC1 5HCAA 4QT6A 5E1RA 4FPJA 2B46X 5A6QA 2I74A 2EVXA 3VKNA 4JI6B 1K5MC 4JC1A 4WVZA 5JVDB 5DMYA 3TNPB 5GJ6A 1QBZA 1A78A 1C5IA 3I8TA 5C3QA 2RVAA 3OGSA 4AFCA 4L99A 1VAVA 3TJTA 3UV9A 3VBFB 4AL9A 2VPVA 5LRRA 3JCZA 2VOWA 1LHOA 3SMHA 3BEHA 2GHYA 4K8ZA 1K34A 1BLZA 5C8CC 1H8VA 3Q8BA 5IAVA 1BQZA 1WP7A 4E4SA 3EXAA 1M57B 1W8HA 5A7NA 1J83A 1RMU3 4W6YA 3MAQA 3QH6A 4YJ3A 3VZKA 5F39A 3B77A 3GXUA 1QQCA 3CCRV 4AI8A 3ETDA 4Z07A 4P2ZA 1ND2A 2Q8VA 2RR11 1K97A 3M3QA 1GWKA 3S6PA 1K5MB 4MVSA 4J10A 2ZX2A 5TSWA 5APAA 1LB2A 4P9XA 5JJNB 2E33A 5FZ4A 5ERLA 5IAXA 3SEPA 5JIUA 2JGUA 1OH3A 4YM3A 3BB6A 2FDKA 1X7NA 3BU7A 4CEWB 2H6CA 2NMNA 3H50A 3I56V 2QWPB 1Q81W 4GX0A 1Q8IA 5C8CB 1N8RW 1CAVA 4XBLA 4IEQA 4RHV2 1FMD2 3E5XA 2WLIB 1NU1H 2YGLA 5G04L 2NP0A 4DW0A 2UU9B 1GM7A 2A70A 4EZHA 5M0TA 1VBC2 2Q7GA 2C1FA 4CP0A 4GH4C 5C70A 3BFRA 2OIIA 2ZA9A 1I1EA 2VQFO 1WW4A 4D7YA 3ASOB 1LNQA 3NKTA 3BOWA 4WFEA 3I2KA 2EZOA 1POV1 2VU9A 3ZN6A 4OUEA 3TYJA 2OCHA 4F4LA 4JI2O 5E1AC 3HQUA 2BGOA 2HWC3 3LF7A 4IEWA 4P9JA 4MTOA 5IK5A 4FVVA 4R9BA 1Q6HA 2IZWA 1KP2A 5JVVA 1Y6XA 1QNYA 1ASJ1 1XHZA 2ZMNA 4GH4B 4U2AA 4X1IB 2ITCC 4YG0A 4X66B 2RMU1 3SKJE 1R081 3K3OA 4O7XA 3SYAA 4GWMA 3WVJA 1Q3EA 1NZCA 3IAQA 5KR7A 4RL7A 2Y0OA 1N32B 3ENRA 4PI2A 1MS1A 1E5SA 5BNNA 5L3BA 2HWD3 1WKYA 2E31A 1YITV 2XJSA 5L7OC 4Z1VA 4JI6O 1TUEB 4X20A 3CL1A 5A33A 3NV4A 3K59A 5BYNA 3ST7A 2A9HA 3OGJA 5FPRA 3SISA 2P34A 3HKCB 4Q4W3 4XUNA 1ND3C 5BNQA 1MS4A 4GIQA 3JATA 5DAXA 1GU3A 2O8OA 4CUCA 1BQPA 3WNMA 1C57A 5FYZA 4U36A 3OUHA 4JASA 5JR2A 4JRLA 5FZDA 2HJIA 4MSWC 4S2HA 4YVSA 3NQHA 5H9QA 2V73A 4X65B 4X8NA 5ABJB 1GUIA 3VHRA 4LBQB 4OPAA 2B42B 1FAFA 3HKBB 4COZA 4BM8A 4XFGA 1ULDA 1YTFD 5DUWA 2QWQB 5JSRA 3ZR5A 4TT3G 4QXKA 4CEYA 3D6EA 1W6NB 2VXRA 1FNYA 2BOCC 3VDDA 5LGUA 1PVC3 5L7OB 3AYEA 1RMU1 2PLV2 1W99A 2A73B 1AL0G 4LP8A 2W39A 4Y22B 2ZINA 4CDUB 2WLHA 5BNPC 5CYYA 5CKNA 3FLPA 4QX2A 3S0MA 3ILNA 2F95B 4XQDA 4LBMA 1DF5A 4PJYA 4X6QB 5FK8A 5ANNA 1S72V 1ND3B 1PM4A 5FFOC 1W2OA 2V1DA 1HW7A 2A6XA 1W8ZA 3WF1A 5T3NA 4RN5A 3BRCA 2WQ8A 3ZMOA 5F6KA 2E75B 5EK0A 4YSFA 2UU9O 1ZA4A 3DC5A 3U4SA 5IJ9B 2HWF1 3MDPA 2VZOA 4UXNA 3IGAC 1VPHA 4HVQA 2IXKA 3BTAA 3WXPA 2GNDA 3MV11 1G7YA 1HNWB 4O4JA 2PQSA 1AVBA 2YUEA 4FLTA 2H6BA 3FE5A 1EUUA 2JVDA 1ZWIC 4HOOA 5A7QA 5FZ8A 2GNTA 4LOTA 4DXWA 5BNPB 3APBA 2WAMA 4Z2AA 1G8MA 2UXNA 2F17A 4FP2A 2Q68A 1MS0A 1WA8A 5LY2A 5JZGA 2UXDB 4IV3B 3ACLA 1R091 5T55A 1DYPA 5BXXA 3USUA 2P4KA 4COYA 2D98A 4K1ZA 2YHJA 1JZ3A 4P08A 3SEEA 1NVPD 4YJ2B 4MV2A 4GMP0 1YWKA 1Z5WA 4NB5A 2UXCO 3FX3A 4XURA 1UOFA 3FB5C 2TEPA 5LMNB 3ZHQA 3SNMA 4L87A 1XNRB 2NNUA 3TEYA 2ZX0A 1ULPA 3RW0A 4DV0B 2Q1FA 3AP7A 4MVQA 1YO8A 4BQXA 4DOUA 3RYPA 2D6OX 2EAAA 2PHWA 4LK7A 2DWEC 5DUVA 4EQVA 4ZZ5A 1UYZA 1N32O 2VCMA 3AZYA 1AI7A 4GJYA 1BEV3 2DCYA 4ES9A 4J9YB 1HV1A 1G1XB 4LMFA 4BLJA 1W8FA 3AKRA 1RVF3 5K0UC 5LATA 4Q4X2 3O14A 3ZOIA 1SLTA 1RL3A 1CVNA 2XAHA 3N9NA 1W0JG 2QUOA 1H8HG 4E2QA 2F4LA 1GAXA 3O65A 3V0BA 2AW9A 1CIYA 1PZ9A 2HWB1 2WSUA 3OUIA 3UT5A 5CEHA 2RR12 1YJKA 2D97A 1OV9A 5IVFA 4XF3A 1NOVA 1KITA 2VZ3A 3ZSMA 4Y4YA 4FZ0A 2DMXA 5FYUA 4X65O 2D43A 2AENA 1S0GA 3BN6A 4Q0QA 1HX6A 1NE4A 3K0DA 1W3VA 2FZ2A 3ICXA 2WQ4A 1WW7A 3BPZA 2B9ZA 4IEZA 1YFYA 3IBMA 4LIVA 4UW3A 3NNFA 3N7KA 2UY9A 4J7ZA 5GZGA 1HWYA 4XFAA 3P6BA 2CTWA 2CAZC 2WS92 3PJQA 1PPJH 5LOVB 3SPCA 5FY5A 2A6ZA 4DR6B 2Y6KA 3Q4HB 4DO0A 5K0UB 2HWE1 1QQP2 2IBZH 4RYDA 1W9TA 4XZUG 1BXHA 2ZM6O 4M3CE 4FZ1A 3UETA 2WLMA 3JZVA 3PHMA 1S0EA 3WX5A 5FYVA 1VP7A 4XF9A 2PHUA 5IJRA 2XQRA 1CXZB 4XDKA 1PNGA 3VD4A 2HP8A 2W5FA 2J1UA 4LEJA 3EYPA 4JV5B 4L8QA 3K58A 1XYOA 3I2DA 4B8EA 5GLWA 2EIJB 4DZGA 3UT0A 3ZXGA 1BCXA 4QXBA 1N3OA 2WA3A 4QHBA 4FXGB 2GP3A 1HNWO 4ZI7B 2OUHA 2VULA 2KSDA 4AI9A 4O2BA 1Y9QA 1W9YA 2ZIOA 5FZEA 5JCOC 1M1KW 2R072 2XDVA 4IGPA 4D8MA 4CP9A 1RTVA 3ZFEB 5DECA 4C1XA 4UCOA 1N1YA 4YY3B 4LBNA 1O3TA 5KA6A 3S7EA 3JASB 4PQ9A 2RS32 4RUEA 2B1GA 3I3QA 3RZMA 3H3ZA 5FPBA 1SESA 3OR7C 1XE0A 5LMNO 2DYCA 3B8NA 3RWRD 5FPUA 5C4WA 1S0DA 1AI6A 2C9AA 2OPWA 3FB8C 3BCWA 4AHWA 4NHMA 5GLZA 4OPHA 5KA5A 3WNXA 3LGRA 3AZVA 4IGQA 4RR3C 4ZOLB 2A3QA 4GAZA 5ITZA 1OI6A 4EB6B 1VRH3 4R52A 5LA6B 3AJZA 5FO7B 2EA7A 4DUZB 2VH9A 4N7IA 4J1XA 1HNZB 5A3LA 4P00B 4B3MB 2YPDA 1R3JC 1COV1 2VTXA 4QU1A 4W65A 4DV2B 3HNMA 1UU5A 4ZPIA 2EBOA 2HHHO 2DCJA 1W8UA 4QPIC 4DQAA 2UY8A 5I0DA 1AR71 2GALA 2DCTA 2P7TC 4CCNA 4UCVA 3OCPA 3C7EA 3K2OA 3QBQA 1OLME 2RS13 1S4CA 2DYRB 4JAUA 1K12A 2BSKB 4DK0A 4RR3B 1UFIA 3KZ4C 3LDBA 4BQ5A 3H01A 4J1WA 4UVAA 3AL6A 3OUSA 1EV13 5BR8B 5IE9A 1NT2B 4LLFA 4D69A 4P9PA 4DR6O 1D4M3 3CMAV 4DK1A 4CUAA 3IMNA 4NIHA 1OF4A 3MW4A 5LA9A 3P1IA 5HCBA 1OCCC 4QPJA 1FPOA 1GOGA 1VF6A 4PCRA 3QO8A 3LPGA 1PX4A 1D7PM 4GA9A 1W9FA 2O0OA 1N3PA 2OIEA 3OG2A 1L7QA 5F7UA 1O5LA 2HH9A 4CUGA 4FPHA 4IEXA 3JQXA 1RUG1 1DG6A 3ZMSA 1MACA 1U96A 2AGAA 2ARBA 2A6YA 2JG9B 2IFRA 4HANA 3RRDA 2FCUA 3KGLA 4RS5A 4D7SA 4JV5O 4QGPA 2XAQA 4IE6A 2ADQB 4XFBA 4K35A 2ZAHA 4X1YA 3JSLA 4LBEC 4KGGA 2J1SA 5GZFA 2ZE8A 3VKMA 2D6PA 2W6IG 3JD71 3PJYA 5BMVA 1OCCB 2HKXA 1SDWA 2D5HA 1NY72 2HWC2 1CN1A 1J3QA 2OT7A 1DGWX 1FOD3 4OI4A 5KAFZ 4N43C 5FYBA 3VQXA 3AYCA 4R6ZA 5EWSA 1LECA 2FB5A 1K9MW 4NYKA 5LYJB 3HIFA 5CIRA 1WBLA 4YY3O 4PT6A 2QTWB 2ET7A 2VECA 5LL6Y 4QM9A 2Y6HA 4O4IA 3BUCA 5J36A 2GN7A 4FFBA 2ZGQA 1UU6A 4S2GA 3POYA 4HFSA 2ERFA 3MIHA 4NVPA 1XMQO 1YI2V 2RDNA 4IE7A 5FYIA 2D44A 1BCCH 2JENA 1VE0A 1XYNA 1DGRA 4CXWA 1W6QB 5D2AA 2QQIA 1ROPA 2CK3G 4PA3A 4XJ9A 1KRIA 5FWEA 2BGCA 2XAJA 2HWD2 2XAGA 1WMXA 5A32A 5C3RA 4I9WA 4MSVA 2VQEB 3WUCA 4BXFA 2RS51 4AEMA 3FYIB 1AL23 4E4ZA 1SFNA 1Q7YW 3AVRA 4R7CA 1W6MA 2FYUH 1H1MA 1QLNA 4O4HA 5B4NA 1Z0HA 1GN6A 1W6PB 3E35A 4CCCA 2ITDC 4D94A 1HNZO 2XJQA 2VS0A 1YQCA 4Q4W2 4B3MO 2FDGA 1F4HA 2QR4A 3ZIAG 2V09A 1OOPC 3O1UA 4DV2O 5H9PA 4A4AA 1S0FA 2JJ1G 1YFWA 3FZ3A 1R3KC 2F6BA 2IWGB 4Q4V3 3CQOA 3CX5F 1UYPA 4YGDA 4S2DA 1C4RA 1GANA 1PGW2 5FMDA 3CCQV 1ZZ8A 1WAZA 3ZFGA 2ID4A 1KEXA 3ZHUA 2VGDA 4BZ4A 1H8TA 1L0LH 4KBZA 4N7UA 4L92A 1PVC2 4XTPA 3CEIA 5BR8O 5FPLA 2Y26A 1REEA 4YJ3B 5A7PA 2HJFC 3J7NA 1E57A 3FHQA 4DEQA 4M4PA 2I2SA 3PIJA 1H30A 2QQJA 3ZYHA 2B1IA 1MG1A 3URFA 1YC61 2L35A 5FLXN 3E5QA 3ABKB 3PVEA 1U12A 1OOPB 3W58A 4A7KA 3NL1A 5FZ6A 1QJX3 3CNAA 2LO1A 2VZSA 1OKQA 3LPFA 3RZGA 2WINB 4I55B 2BWAA 4H33A 4ABMA 1T6BX 4TV8A 1LGCA 1CX1A 4MTGA 3R0RA 4A3XA 3WB0A 5JR7B 2BQPA 1RGSA 3KCYA 3UGGA 1FFTB 3DKQA 3DN7A 3OEEG 1TVKA 3VL9A 2B39A 2R0HA 2RJZA 1GZ9A 1GN2A 2Y8KA 4AF9A 2D5FA 2P90A 4ES8A 3ABTA 3VBUC 2WLLB 2YXSA 2DFBA 1UAIA 4IE0A 4UFKA 1FAYA 2GC1A 2QDRA 2Q8OA 5FK7A 2WFPA 4PDWA 2AUYA 3OGVA 2OTJV 2IJKA 2XOKG 1UPSA 1ZLZA 3T09A 4OX9B 3ILRA 5A3PA 5JXHA 5CISA 4DXRA 4K3UA 2ZR3A 3G80A 3AFKA 4JTOA 3LIHA 2NM1A 1CPNA 3RYFB 3VBBA 2EULA 2R6QA 3GWOA 1US6A 1OLQA 3HEIA 2OXBA 4FLUA 1G9AA 4P14A 2QEXV 4OUSA 1JH5A 2WLJA 1V54B 5E88A 1WNSA 2DVAA 1KS5A 2WNEA 3FWEA 3GNEA 2XWBB 1BEV2 3TEWA 3AXDA 5HXVA 2VQEO 4N23A 1RVF2 1S0VA 1LUWA 5FMBA 2ZMLA 3HB3B 1Q5OA 1F7YA 1SCRA 3PUIA 1M56C 3SYCA 1BBT1 1IG0A 4LF4B 3OE7G 1JHNA 2QJVA 4YXWG 1SEFA 4UYBA 4CH5A 1ONAA 3K46A 4K20A 1NA1C 3TCUA 1SQVH 2GTAA 2E7AA 1JYVA 2PHXA 2Y4UA 3THDA 2N05A 3AG3C 4TQFA 4LA2A 5SV8A 3HWJA 2DU0A 1WD3A 3WG7C 4IIJB 3RYRA 4ITCA 1RXGA 2XMLA 2QQMA 1KFUL 2P5BA 3VKFC 1XC6A 4DRXA 5J2UA 3RS6A 4YW5A 1DQ5A 1GM9A 1CAUA 2Q0OC 1NLSA 5JOYA 3P32A 1W9WA 3D36C 3KHBA 4Q4V1 4Q20A 1CQ9A 4JGZB 3HJRA 4ZHNA 1Q6UA 4M3CB 3I4IA 1U5ZA 2OKXA 2J1EA 5A7OA 1KQSU 3CPWU 2W0FC 1XOUA 4CEYB 1W2BU 1NA1B 3ACGA 1JZ7A 1N36B 1N33B 1QVFU 1JZ6A 3VDDB 1Z2GA 4RQPC 4DB5A 2JXAA 1IURA 4Q1PA 4Q0UA 4JGYB 4L0PA 3R4SA 3IC7A 1UY4A 4LULA 4BQ1A 4Q4Y1 3SQOA 1BL8A 4K7JA 3VUOA 5CVRA 2ZNJA 3WG7B 1QDOA 2QM8A 3G6BA 5D8AC 2G1MA 2LFSA 1ZX3A 1SZXA 4J80A 1EZVH 2GUZA 5J2TA 3CXHF 4P5HA 3FLTA 1U0AA 1Q8OA 3THPA 4CS2A 4QHZA 4LO5B 4TLFA 5KHHA 2X0LA 2CDOA 2R063 3NJVA 1B35B 5JIAA 3U78A 3G6EV 4M0HA 2WNUC 3VZNA 2JICA 1WCQA 3AKSA 1HRV3 3D8CA 2Q73A 5C5UA 2WT2A 3TETA 2EICA 3ZYGA 5EV7A 4YYOA 4JDMA 4Q2FA 4O4LB 4EN6B 1SCSA 2WIIB 2QKCA 5D8AB 4OX9O 3SH5A 3GCWA 4XF1A 5IY5C 5FZOB 4TSFG 3ABLC 2XVLA 1WA8B 2DW4A 3WDUA 3FLRA 4KWLA 4CC5A 5LA1A 4N53C 1KFXL 2VVFA 2CV6A 4KWUA 2ES3A 3PJSK 4DW1A 4LNUA 5D1IA 4I0AA 3LZZA 4P9WA 4XMAA 2WNUB 4X8AA 2EXIA 3OB8A 5BUVA 4KBBA 1VRH2 4MZUA 2A7AA 4H3WA 3OTFA 4AW7A 4Y5TA 2K2SA 2Q67A 2KKWA 2KQXA 4Q0VA 4LF4O 3NW4A 1GP6A 1WD4A 1GNZA 5L19A 4GALA 4ZXKA 4GKYA 5GZEA 3LUTB 3PVNA 5D5PA 1OA2A 4AFAA 4EN7B 1NLQA 4B3TO 3THOA 4RUFA 4BWAA 5IY5B 4QX5A 3ABLB 5A3TA 4C0HA 2ZZQA 1LOFC 1BMV1 3ES1A 4N53B 3OM3B 1R1A1 2CTPA 4XJZA 4H0LB 2RS12 1DZQA 5DN6G 5B2GB 1HB1A 4V2VA 3DPRA 3STZC 2XONA 2LROA 2WR9A 1YHFA 1EV12 3BTZA 4EN0A 2Z5UA 4DUYB 1D4M2 4HKOA 3WF2A 1FV3A 4E4DX 3QLQA 2WYFA 2VBPA 4AFBA 5T52A 2ZQMA 4CSWA 2B4KA 2V7QG 4QKNA 3AZWA 2KXLA 4J11A 1F5JA 1OC1A 1QOTA 2GZWA 1N36O 4GMP3 3MV01 2QQOA 3ZMUA 1KB9F 2C2AA 1IXMA 1S0JA 1AR91 1R1ZA 2A6WA 3PTRB 3ON7A 4HAMA 4NR1A 4WFBV 2PYJA 3ABMC 1URXA 1UZVA 1VBA3 2ZGNA 1F4NA 4P02B 1YQ6A 2QVSB 3JALA 4FPKA 2CL2A 5CFCC 4AI2A 4IESA 3MIEA 3D82A 2NPIA 4J41A 1XNAA 5F1RA 2IH3C 1COWG 3H1LH 1CAXA 4RWUA 4IV1C 3NAPA 1SKVA 1RPRA 3PUAA 3WINE 1FOD2 5FZGA 4GULA 2VBDA 2SLIA 4YIOA 2VUAA 1YZBA 1UOJA 2AEZA 2ZGOA 4JI7O 4I09A 4CPBD 3GB7C 1FKAO 1K3EA 1B3QA 4CDQC 1C3HA 1YXBA 3GYDA 3ABMB 4MGIE 3O1MA 3VDAA 4WBNA 2VXJA 1QMJA 2VMIA 5CMUA 1O4ZA 4IGOA 1CX4A 1FS0G 5F2VO 5IYZA 5CFCB 4YVWA 1CD3G 2TBVA 5FP4A 1AR83 2OCCC 3K5NA 5JJEB 1UPIA 1AL22 1PK6A 3NJXA 4IV1B 2UYAA 2YU2A 5C4WB 1LU2A 4IE4A 3OOXA 1IVSA 1OFSA 5B1NA 1AR61 1LOFA 2PMWB 4HNAA 2F93B 2DCKA 3W20A 3NWKA 2PI4A 5FRAA 4MGYE 5CA0A 1OBNA 3BHPA 2JDUA 4B7EA 3T4HB 5IFTA 4H7MA 5KUKA 5HBAA 4FXKB 4I50A 4CDQB 2C9KA 3B00A 5C9AC 3U07A 3OYWA 4Q4V2 1JZ8A 2O57A 1FXKC 4BWOA 1YQ2A 1JS9A 3JU9A 1LENA 5FV3A 1IBLB 5DPNA 2VWKA 1JFFA 1QEXA 2QKAA 3ZDSA 2OCCB 1GV9A 1XOYA 3NVCA 3WDTA 4LBKA 3M70A 1MMMA 3B02A 1H0BA 4DUYO 1AUYA 1DU3D 2P6JA 2OWOA 1VQLV 1UW8A 2G9ZA 4TLGA 4JKMA 2OUJA 4WFHA 2CTVA 4XIOA 5LA2A 4FPPA 2J7MA 1RUNA 3VBSA 1YVWA 4RFT0 3S3XA 1QJX2 3RZZA 3PN1A 3ME2A 4I0BA 1NQDA 1AR1B 4XETA 4EWAA 3WG3A 5B1AC 3W7TA 3J8F3 5AC93 5C9AB 5IK8A 5J37A 3T4DA 2GBOA 2H3OA 1S2EA 4GB33 1FXKB 1J5EB 2ZR2A 2P1BA 1LOEA 3ROUA 2ZGRA 5ACA1 1BZKA 1I0HA 5BXZA 3E22A 1NI8A 1J3PA 2WL1A 4WVMA 5J98B 1ZUQA 1WGPA 3IIAA 4XABA 4BU2A 4E8CA 5A3MA 2Y69C 1GWLA 1VBB1 5TISZ 1ENVA 5FMCA 3RMXA 4YW3A 3AZZA 1IBKO 1W3XA 3DYOA 2DBNA 4HN0A 3C3TA 4L8JA 2A1XA 3QD6A 2P6HA 2R70A 3RMYA 2JE9A 2DQ0A 5GALA 4LBQD 1ZL8B 2VQ0A 5KHIA 3X2QB 1D5NA 4LWSB 3HQXA 5B1AB 4LF9B 1GN4A 1LNSA 3Q8EA 4NN0A 1RHI1 3LSQA 3AMHA 3CMGA 4XC9A 2WAOA 4IYHA 3MIGA 3EO6A 4R9CA 4P9IA 1GBGA 1MVEA 3ASIA 4K1YA 4WFGA 1MS8A 3ZN4A 4I01A 5IK4A 2MEV1 4PLNA 3SLIA 3DUIA 4ZHQB 4PELA 1DGLA 4Y5SA 1SMVA 4AGGA 4O61A 4FM2A 4FQ4A 1APNA 4P9YA 4MTFA 2QDNA 4O4IB 2CH7A 1Y74B 3MFAA 4AYUA 3BIEA 3GGLA 4JZRA 3AK2A 3KT4A 1RUH1 3ZYFA 5FXXA 4C1WA 4DUWA 2KG7B 3VV1A 3WFVA 4JI3B 4K0KB 2BTVC 3SH3A 3RG0A 4GZ9A 4MXWB 1LOAA 3LFIA 2E6VA 3C8XA 1YIJV 1CZVA 2BU9A 2ZX1A 3FHIB 1GH6A 1IBMB 2ARXA 3H42B 2ZHKA 4HKWA 1XBFA 3TAYA 3CU7A 1ALYA 5I93A 4XTMA 3LOIA 5FXVA 1ACCA 4M3CF 1US2A 4UT5A 3RYIB 4U3FH 4RGAA 3J80N 4OI2A 3JYCA 4UBGA 5GM0A 1W6MB 2OPKA 1M4UA 1TGOA 2AEYA 2CHHA 5FPZA 4XUOA 1XNQO 1A34A 5A1AA 5KXCA 4JTNA 1DZTA 2DUOA 5IWAB 1IBLO 3HAGA 2P06A 1XNTA 5IVCA 5I8YA 2UYBA 3ZYIB 4LFAB 2LGWA 2YFUA 1ZBA1 3CJIA 3A0KA 2EF6A 1D0GA 3A8TA 5J3UA 4CP2A 1MA1A 3RGBA 2C0ZA 2BFUS 3ZPYA 2FBEA 2HFEC 3UL2A 3C7HA 1V6IA 2BCCH 4XFIA 4OCTA 3BODA 2BFUL 1JX9A 1H8TB 2LALA 4TV9B 4LFCB 5GONB 5LGTA 2XHNA 1XHXA 5K9YA 2R041 4BH9A 1NKGA 2JS5A 1UZYA 2D93A 1V9PA 2JEUA 3DGEA 1OHHG 5JMCA 5GZDA 3VBHA 1LU1A 1DCSA 2QFEA 2PFWA 4BLIA 3MHSC 3ZIWA 3ZYPA 5LBEA 2ZTNA 1GO3F 3SDLA 1HLCA 5JXGA 1Y9GA 1PGL2 2WZ8A 2R062 4QPWA 5AC91 4LF6O 4QX7A 5FL7G 1GWMA 4LO6B 3RZLA 4O2AA 4GB31 1RUJ3 3T2MA 4CU6A 2XJPA 4EN9B 2F23A 3CRQA 3RZKA 4Q8KA 3LEIA 3USSA 1U97A 1HRV2 3F2ZA 3OY8A 1TUBB 3MLJA 4YHHO 1QLEC 5EZYA 1FXHA 3K5MA 3L72H 3UGFA 4UF0B 2DV9A 1EUTA 3LDCA 1CEZA 3I2GA 1RFYA 5FYMA 3KQ4B 1CONA 1UYYA 1DLCA 1TVKB 2E9QA 4LF9O 2QE3A 5HV0A 3CLPA 4PHZA 2JD9A 3SH4A 5CN0A 4QWNA 4XBQA 5CG8A 3LA3A 1SQ4A 3RNSA 3IIIA 2M7WA 4XDJA 4DR5B 5C8YA 1IHMA 2ETNA 1TMF3 4B7KA 1MSWD 4AFDA 3MLKA 1N3QA 1XB9A 1KMIZ 1UX7A 2P17A 4EYUA 3WW1A 2P22C 2VQAA 1ENXA 3JQWA 2DWRA 2UWBA 3ZLIA 1REFA 3HVDA 2XJTA 1IPKA 2JDPA 4K0KO 2RN9A 1BKZA 1ORQC 3GJBA 4OZOA 4RA0A 1AB3A 2Z0AA 1IBMO 2ZGUA 4YM1A 3BAAA 4NPLA 4GXLA 1AYM1 1G86A 4EFEA 4TTGA 3NNJA 3AP4A 2AZ2A 1F31A 5DAQA 2W3JA 5FUPA 5CB4B 3MHZA 3GWKC 1SA0B 1NCQC 3EHKA 1UX6A 2JDHA 3K4DA 3T3YA 1GQPA 4JYYA 1N0JA 3N2GB 4NHKA 5FO8B 3DXRA 3RVZA 3SKVA 1AR5A 1LGNA 4G28B 2Y0IA 5IWAO 4CCKA 3RZHA 2OZJA 1W8TA 2ZGTA 2W52A 3VD3A 4LFAO 4CDWC 4KI5M 1TEIA 3NNMA 1QWRA 1HXS3 3KCCA 4NPRA 1S3JA 5B1BC 4Z8BA 1KKDA 1QOSA 2ORXA 3ALQA 2NZ9A 3IKWA 2NR5A 3JAMN 1VBE3 2CTQA 1R6KA 4FLYA 1JR9A 3ZMNA 2WFF1 4X64B 5FNVA 4A3ZA 1ZZCA 3LEGA 4OFGA 4UCSA 5JXJA 2QZ3A 1EZJA 5FXWA 2VCBA 3QOPA 3S7IA 3QVNA 2F43G 3T1CA 3FJSA 1MQTC 4Y20A 5J96B 1VBA2 1H9PA 2GNMA 3OMNB 4LH6A 4NHLA 2W6JG 5GTHZ 4F6RB 3E8FA 4JZ2A 5JQGB 5JLVA 5KHJA 4DR4B 2FHRA 4CDWB 1W8OA 3T4ZA 3ZN5A 4O9EA 3AKQA 2X5IA 5B1BB 1K5JA 1GN3A 2AH2A 3ZXFA 4MVUA 1AP6A 1NR7A 5DXDA 1K5SA 2DCZA 4FPEA 1PX3A 1DLLA 3HPLC 1RUI3 1R64A 1F9KA 3F7VC 4QGMA 1Q8SA 3POWA 4K40A 4UBHA 2WWWA 4JTAB 5I0RA 2N04A 5FZFA 1EBOA 1N34B 3CCVV 2XLGA 5FYCA 2M6YA 5LP6C 1VRBA 2BTQB 1REDA 1X9PA 1MQTB 4PDMA 1LR1A 3H8UA 1RC6A 1UMIA 5A70A 4UW5A 3HMYA 1PO13 4MS2A 3A22A 2XB6C 3A7QA 3JD2A 4AQSA 1EAH3 2QQVA 4X1KB 1AR82 4TXWA 5T5LA 4AI3A 2RV9A 4G4FA 1JPXA 4LO7A 1Z7S1 3GZUC 1GOFA 3CCSV 1GZWB 2DBIA 3ILFA 2V5YA 1M5IA 1A8MA 1LGBA 5FZ3A 3RJ2X 2GC0A 1G9BA 4DIQA 4DXZA 3BVOA 1NCQA 2DWDC 4FM0A 1ZZ6A 3I2HA 5EFUA 3VBRA 2ZT9B 4IE5A 4GUNA 1HP8A 4I3PA 2QCSB 2JJ2G 5H6RA 3I54A 3EVKA 4FOVA 3O12A 1PO23 2BZDA 1I9RA 2EXKA 3WUDA 3EFFK 2E53A 3WP4A 4WM7A 4YWAA 2V5DA 5IT6A 4DV4O 2CUGA 4RFRB 2OA2A 2PI5A 1Y9MA 4BR6A 1SLLA 1HR0B 2LP7A 3TK1A 4LF8B 1SQBH 4XJWA 3ZIXA 1V9U3 1Y4MA 2VVDA 5JH7A 4F3JA 1RYYA 1UZZA 1MS5A 2RHPA 2BBVA 1TA8A 5LZ6A 1HRI2 1CPMA 4CDXA 1HB2A 1Q90D 4PD4F 2YEVA 3QO7A 1Q8QA 3J8F2 4FPFA 3Q8CA 4X64O 5FZ7A 1HXS1 1C28A 4GB32 2VRZA 3TXQA 2IXIA 1SBEA 4FK5C 1X82A 1PGSA 2MNGA 4DY5A 2JDYA 1KJRA 2GC3A 1GOHA 2ZE6A 2NQYA 1NQTA 5T5JA 2D6NA 5CB7A 2HBUA 4K8RB 3HKEA 3CC7V 1QJFA 1H1AA 1WPXA 3AK3A 4F8AA 1IKQA 3VDBA 1N47A 2R7EB 5JI7A 2VTFA 1TQ5A 5CU1A 5IVVA 2KR2A 4HK8A 4Y1ZA 4LJHA 4WZFA 4JTDB 4FLXA 1KUQA 3JAKB 1MEC3 4PA4A 2B5HA 2J1RA 3IAPA 1DFQA 2NLJC 5DAVA 3N36A 4JHTA 1N34O 4BISA 4YG6A 1LHVA 4H44B 4J7JA 4MVTA 5FZMA 2R1BA 2WNVC 1SBFA 1UMZA 4X8PA 2VNRA 4XIKA 2PGGA 2B7YA 3OSDA 3D4KA 3BTXA 4AAXA 1F4MA 1NTZH 2Q6AA 3BCCH 4KQ7A 1Y4WA 3AZXA 1MS3A 3BU0A 1K33A 1OCRC 3LEMA 1VMHA 2ZZJA 1XI1A 1X36A 5BNOA 3V0AB 3I3EA 2ODMA 1YF2A 4NXNB 4JF3A 2BYVE 4NE9A 1X50A 4FO9A 2VOXA 3ZHVA 5C6CA 4LLOA 5CADA 1S2BA 1TME1 3BI3A 5JOZA 2ZE5A 5JAXA 2IUWA 4JI1B 2BDRA 2JK5C 1GKBA 4MW8A 1SZTA 3SGIA 4MHRA 2ZOEB 5JOWA 2WWJA 2UUBB 3D0JA 2HVJC 3I5DA 1N1SA 5L3GA 3H1KH 3I59A 5LHGA 4V1PA 4QPGC 3N3HA 2Y6JA 4HPKA 4LT5A 3WQ0A 2ZXQA 2ZDIC 1OCRB 4E2SA 4UCRA 2HBTA 4XCAA 5DM6V 1HR0O 2IJJA 1S55A 4FM1A 1H9WA 3JAWA 1BSMA 5IATA 5CA1B 3OGIB 1YTFB 5HFLA 1UNBA 1VBD1 1OT5A 2CSGA 1MABG 3SPGA 1RSOB 4WM8C 2GSMB 5FZLA 1S0IA 3U11A 4XFFA 4CA9A 4FOWA 4AG4A 1POV3 3TN91 5EP9A 5BZBA 3M7MX 1IS4A 2VQTA 3U4XA 3C3SA 2PAMA 1YYNA 2JB4A 5A7WA 2OZ6A 4BXSV 2RNBA 1VB2A 2DYSC 4XOGA 3WNKA 4G27B 3FBYA 5FZAA 3STLC 3F5WC 3C7FA 2QQLA 4E27A 4CH3A 5FZHA 4IXLA 3N2KA 4QPGB 2J1VA 4CCMA 3M8AA 2TNFA 1HQLA 1RUJ2 3VB9A 1ASJ3 5FLIA 1O5UA 4BIZA 2JKXA 1LHUA 4YGBA 4TUYA 2RMU3 2A71A 3VBFC 1R083 2A6VA 3WB2A 3APQA 1E5HA 3J7HA 5IUQA 1PMJX 4DXSA 2A3YA 2XKPA 4MHUA 4Q0SA 4WM8B 4PIXA 3S5AA 5CBLA 2W92A 1O91A 2JG8C 3ZCCA 5HCFA 2AXTZ 3IC9A 3DTUB 1NTKH 1B04A 1KXGA 1NX9A 5KX5A 3KGZA 5LCWL 4HL0A 4YFWA 3H1JH 4KG8A 3I2FA 2DYSB 3U10A 1W0OA 4J6GA 1SPPB 1TMF2 3RBZA 1FFXA 2VZUA 3I7DA 3W21A 2KD7A 4RQEA 4DY3A 2WO2A 1FJGO 4XDPA 2AGSA 1K4DC 3PTYA 1DTOA 4DV1B 5C33A 2JGDB 3LDDA 4I4TA 1IS3A 2DF7A 3H9AA 5CKMA 2YBKA 3S30A 1Q82W 3L70H 4CEWC 2VZ1A 2WN2A 1YIPA 1STMA 1C1FA 2W87A 4G2KA 3T0DA 2QSAA 1PM7A 5EC1C 2Y33A 2JG8B 3CCUV 4NXNO 2ZKNA 1C1LA 4LHNA 1CR7A 1JHJA 3JXSA 1NXD1 2GU9A 4J9ZB 4L11A 5FDBA 3MUY1 3HBZA 4ZS3A 3RDIA 4C7UA 4DR1O 4IHJA 2YC4A 2EZPA 2D6MA 1QXPA 2OX0A 1JI6A 1PZ7A 2GH2A 1CAWA 3AK1A 3F5TA 3HR9A 2UUBO 3ASOC 3O1RA 3NV2A 3ELNA 2NYYA 5EYPB 3H1HH 2XJRA 2GTSA 3WT3A 1YSCA 4PA6A 5KXDA 2ARHA 4WZCA 3K79A 1IQDC 3LA7A 3H3LA 4CBCA 1VQ8V 1W2AX 3PL0A 3CRRA 3VBOC 2HWF3 2Y34A 4Y33A 2XOMA 4QX0A 2JJ6A 3CJXA 4LA3A 1VBE2 4FJCC 2ZEZA 1O6UA 2R30A 2JDIG 2R9RB 2LJ2A 5JVDA 5CBFA 2MW2B 4QDQA 3T2QA 5F9TA 3LSEA 3O1OA 2GSYA 4KWKA 2VZQA 3UJQA 5B1OA 3L2YA 3FUOA 1G9FA 1R093 1AF9A 2QQWA 2XLFA 4CXYA 5BY5A 4LITA 4XZPA 4ZY9A 4AEDA 4LF7B 2DURA 3NJYA 4KU8A 4JAVA 2D6LX 2PELA 4B4PA 4DUVA 2IU0A 4UXAA 1XEQA 4NXMB 4LKEA 1NCRC 3VBOB 3W9AA 2EIKB 1NBMG 4XUPA 2ZX4A 2A0LA 4GT1A 4ONUA 5IYBO 5E89A 1PP9H 2Z5WA 3GF6A 1RUI2 5A3WA 1OPMA 1L8DA 1WW5A 4YLZA 2WT0A 4PDVA 4UB6Z 1V6KA 3ZSJA 3AM2A 1DDLA 1WP8A 1YFXA 2WAAA 1P7GA 4CPBA 1K5MA 3AP9A 3KF3A 4X88A 4YZ3A 1GNHA 3J4UH 3HKDA 5ABJC 4Q1RA 4ZXEA 4FT8A 1FYJA 4QKDA 4CCLA 1TVGA 3W59A 1PO12 1R3LC 4LK6A 2QBXA 4D0QA 1XILA 2HWB3 2Q7HA 3JBG1 2X7RB 1EAH2 3CC4V 2LM3A 2VMDA 2IXJA 4M0NA 5C8CA 2P3IA 3O0WA 3TWIA 5F2WA 5FUIA 5DEDA 1NCRB 1H38A 2WLIA 4KU7A 4CDUC 1K42A 3R05A 4DEVA 4ICGA 1RITA 2GMEA 5L3CA 2HEWF 2OS2A 2YB7A 4OQ8A 3MGUA 3LDKA 2QWNB 5DDJ1 1Q43A 3O1SA 1RB8G 4U7NA 4DMIA 1AILA 1J1LA 4NIIA 5F3EA 2VW0A 4AHXA 2YIDA 4OGQB 1F8VA 2HWE3 2IXCA 1W05A 2VY0A 3NNGA 1PO22 4GWIA 2CGNA 4XHXA 2WO1A 1US3A 1WA6X 3CWBH 2GC2A 1W9SA 4NOTA 3THTA 3B09A 3KVBA 1ULEA 3CP1A 4OULA 4CE8A 2CE4A 3AX4A 4W4KA 5D5QA 4C91A 2OVUA 2VD7A 2YY1A 2EAKA 1ZBE1 2QKSA 1AXZA 1V9U2 1D0HA 2K46A 1H2GA 4RD7A 1UL9A 4GH4A 4IV3C 3JB4C 4ZIBA 2QJ1A 2EIGA 4WFFA 4X1IA 4XVHA 5IFPA 1V6MA 3E6BA 1NKDA 2BEOA 2AHYA 1ULFA 4AVVA 3ORJA 2JDAA 4MH0E 1V70A 4JGSA 4FIPC 4QQ2A 4FPYA 2G38A 2P2KA 1MSDA 4LKFA 5DZGA 3T08A 1OD3A 3AMPA 1O9HA 5FY4A 1RJ7A 3OGGA 4HMZA 2R32A 2YSUB 4AEKA 4JI8B 3KM5A 2PYTA 1ZRDA 3OT7A 1C8M1 3V64A 4YFZA 5CFDC 2UWCA 3QH7A 3HKCA 4I0XB 4QB6A 1JQ0A 1B09A 1DK1A 1B6QA 3FB7C 1PIV3 2WZR3 5LHHA 4CZSA 1G9DA 4LF7O 5D21A 5T5PA 5FZKA 4LOSA 3I2JA 1RUD1 1VB4A 1FXVA 4QDRA 1WPBA 1KJLA 1KC8W 2VMFA 5FKCA 2ZEYA 4LBQA 5CA6A 3RPQA 2CAVA 5FPVA 3HKBA 1MEC2 1QJU1 4ZU5A 4X62B 3ZXLA 3SPJA 1AYN1 2ZE7A 3MO4A 2VUJA 3OPZA 1LODA 1W6NA 1FYUA 1W90A 4JPRA 5L7OA 2R16A 3AG4B 1Y76B 4ZU7A 4N21A 4QAWA 4AQYB 4Y22A 5EZWA 4X66O 1D2SA 2QGNA 1CPYA 1COV3 5CFDB 2JB8A 1X59A 1ND3A 5EIYB 2WSVA 3H8RA 2CY6A 5FPOA 3VD7A 2XLAA 1I3HA 3B5LB 1AXYA 3EQEA 3I3BA 5JXIA 3ZKYA 1S1AA 3RYCB 3UK9A 4DR2B 1AR73 4CCJA 2WBKA 4AILC 4JYAB 4HN1A 2F1MA 5IJ9A 5EIBC 3INAA 2X8KA 1QIQA 3C90A 3O1VA 2UUAB 3HNBM 1QF3A 1F15A 4ATEA 1SLIA 2BOBC 2ZCEA 1SRYA 1AROP 1R6NA 5F32A 1L3JA 1D4VB 3GZAA 4EWEA 2ZGMA 5BNPA 3JB8A 3ZXKA 1QJY1 3DGTA 1THZA 1WN7A 1OUSA 3KT7A 2K9PA 1I5XA 2CU5A 4IV3A 4OLLA 2EIJC 1VIBA 1O8PA 1K45A 2A75A 4YG3A 3FYEB 3CRCA 2WC2A 4HKLA 1VALA 1O8SA 5LW9A 4YJ2A 1RUG3 4QHOA 3J9SA 1KD1W 5FY9A 1C5HA 3E8HA 1QGLA 4QPKA 4ZBMA 5DAWA 3THCA 1JA8A 1BVVA 5BY1A 2PA7A 1GFF2 4WM7B 3ZFFC 3ZFEC 3OBAA 3PNAA 2Y0PA 3QCWA 2ORZA 4SBVA 2ZD9A 2F4VB 1UOBA 5F3IA 1LKNA 3DCQA 2D6KA 2XHKA 4BK5A 5KLVH 1FNZA 2DDUA 3WF3A 3NJZA 2HYXA 1V6JA 4FTSA 4DV7B 3GALA 2XNDG 4XCBA 5F2SA 1XYPA 2P37A 3JD73 1JODA 2E5LB 2P3KA 1RXFA 3DEMA 2J1TA 4Q29A 3MI8A 4JRAA 5IJ0B 4FFIA 4QIWF 2VMGA 3CS5A 4ASUG 2PHFA 3K3WA 1V6OA 2GP5A 5K7PA 2DVGA 2WNOA 1OVSA 2OIGA 1JMKC 4QQLA 1OA4A 1FX5A 5L9VA 3ZYRA 2B9VA 1K3IA 1J58A 1ASJ2 1W39A 4UW4A 2VMCA 5HPOA 3G67A 3ZFFB 5SV5A 3ZXJA 3B7MA 5FP9A 1Q86W 4GX2A 2RMU2 3FAVB 2UXDO 1R082 1W06A 5CG9A 2WLNA 4YZ4A 3WNLA 4NIGA 3ZRWB 1RUF1 4A5UB 4FI9A 1SQQH 4HLTA 3B01A 2WRAA 1PIV1 2WZR1 3WCSA 4X62O 3HKEB 4R9DA 2XGXA 2RS53 3AP6A 1UY2A 5CZKA 1UKRA 2BWCA 5LOVA 1XNRO 5A9GA 5L3FA 1O4YA 1JOBA 3Q4HA 4DV0O 5K0UA 4OXSA 2VO5A 3ZXEA 3HD8B 3I2OA 4UUJC 3WDWA 1WZXA 4AQYO 1LR5A 4EZ4A 2EILC 1GM8A 4LCUC 5KXBA 1JU4A 2QM4A 3AG2C 2DYRC 3VZLA 3NSTA 1XRUA 1L0NH 2PXJA 2HVKC 1K5QA 1MVQA 3E83A 2QA4V 1VARA 2YBPA 3WQBA 4QE9A 5LXTB 2YZ4A 2AZ0A 2ZGPA 4MXVA 4AVTA 3AJYA 4KP4A 3WDXA 4Q6GA 2UU8A 4QU2A 2JKBA 1RMU2 5E6HA 4NJ4A 5JPMB 3VL8A 4JKKA 4ZI7A 2D2CB 2JG9C 2VOKA 1Z5VA 1N1VA 2EILB 2EIBA 4X9QA 5L9RA 3AG2B 5J1XA 1KKCA 3QO5A 2CDYA 3ZFEA 4C8DA 2X09A 4WV8A 1LOCA 2ZCWA 4RHV1 1FMD1 5FREA 4A44A 3OR6C 4FLZA 2PUSA 5HCHA 3KD4A 1VR3A 4FPLA 1P4RA 3CJHB 3N27A 1PNLA 4QKFA 3LOBA 5IVBA 3O0XA 1W6OA 3UJOA 4LFBB 2HWF2 2BNNA 4XW3A 5FMOL 1QJZA 3T2TA 3RSJA 5FQ0A 3ZXDA 1DGSA 3WU2Z 1NXMA 1OSGA 1X8MA 4GKJB 1TE1B 1QXRA 1WMEA 5C8WA 1A6CA 4JV4A 2C6SA 1QDCA 3CB2A 4YIPA 3BYWA 5FBZA 4ZOLA 2YICA 4Y1UA 5JCOA 3IDBB 3P30A 2BTOA 4DV7O 4EB6A 5LA6A 5IK7A 2V4AA 1MNGA 3T1HB 4UFHA 1R092 4XDLA 3WDVA 2Z3YA 3FUQA 5B3SC 5I91A 4IL6Z 1H4HA 1HW5A 4R8CA 2BRTA 2KA3A 3TEXA 5A7WB 4A6OA 5FIXA 5KXEA 3I97A 3VGIA 3S57A 1CJPA 3ITQA 1SQFA 2EXJA 2Q1ZB 1BGYH 3FX7A 3B8MA 5EJZB 1BZWA 4GD4A 4MG2A 2BSKA 4RR3A 3MD0A 2WZPP 1JZ4A 5IT9N 5JSPA 1NE6A 2CWMA 1BBT3 1DQ0A 1JU3A 2VNVA 3ETPA 2ZIMA 3LWCA 5B3SB 2HWB2 5I8TA 1X33A 5LY1A 3HT1A 1JVMA 3T30A 4IDZA 5LASA 3K08A 5FOJB 4LR4A 2TUNA 4YRDA 4QPIA 3VQYA 4UV8A 1X9TA 4DUZO 1J1TA 3N9OA 3ZR6A 4CRQA 4HVOA 1ND2C 2DE0X 1EN5A 4IEYA 2Z69A 3ABKC 5F5QA 1YJLA 4A2UA 4D6SA 5ISLA 2Y38A 1SQXH 3RVYA 3AC0A 2PLV1 4LHSA 1CJDA 2H8PC 5JDBA 3K0GA 2HWE2 1Q56A 3DV8A 3K75B 3LD8A 3FN9A 1QCEA 1OKOA 1RM1C 2X53S 1DF0A 3LE0A 2QZ2A 2JECA 2YIBD 1EP0A 2ADPA 4QB2A 3WHTA 3RI9A 4GWJA 4Q4Y3 2WWSA 1VMFA 1SERA 1ND2B 3IT8A 5A3NA 2F4PA 3A21A 1ENRA 3C7OA 1BHAA 3CCLV 4LFBO 2Y6LA 1W6QA 1PZ8A 3KVAA 2UWAA 2RDRA 2VAUA 1Q8VA 4ZZ8A 2Y4TA 1VMJA 4DNYA 2Q30A 3D5OA 1ENSA 1KP3A 2XHBA 1SLAA 4ATFA 3JSNA 4CCOA 3LNNA 1ZA7A 4TZDA 4QM8A 4W4LA 3ETQA 3UCSC 1WB8A 3LSUA 1WJZA 1S76D 2W1WA 1IXBA 2XVKA 1RM1B 4XEZA 4FFGA 2IVJA 4R4XA 1YI7A 1CAVB 3T1HO 3WW4A 4N43A 3N7LA 2RM23 1V54C 4GKKB 4A7ZA 5FLHA 5B4XA 2GNBA 1AP5A 1PIV2 1VP6A 2WZR2 1UU4A 4JKLA 4AGRA 2WKKA 3RI8A 4F83A 2WUHA 4ASLA 5JI9A 3ZHRA 4IQPA 1UN1A 5FJKA 2JDMA 4NRPA 4UB8Z 3MIFA 3CZUA 4DYLA 4FAHA 2VVEA 5GW7A 3M2MA 5H9CA 1NS1A 1J84A 3OFNG 5BNNC 4QGNA 4AEDB 1EYBA 3HN3A 2FDJA 2IJHA 2L9LA 3ZN6B 1A8DA 4LE3A 1JBCA 2PZSA 4IW3A 4NRMA 1NG0A 5K1PA 1YI9A 4BIUA 4FMTA 4Q4X1 5J09A 2BW8A 3PU8A 2QWOB 5F3GA 4NIAA 3I2IA 4H13B 1UZ0A 1OQEA 1COV2 2YXHA 2W1UA 4Z1MG 1VQ5V 1F23A 1BHBA 2Q8DA 1ZRRA 4AQTA 1FATA 1FPN3 5C3OA 1OOPA 1KDMA 4PLMA 1AR4A 1NTMH 4KHPB 4YVSC 3GZEA 3SJBC 3HKDB 2W2IA 1QH6A 4JGZC 1H2KA 4IEPA 4XQ4A 4I55A 1AR72 2E3CA 4TWKA 1ULOA 1RINA 2HKOA 2YPJA 4UFJA 3SPHA 1R1A3 1T2XA 3FC0A 4FQZA 2Y60A 4CEYC 5BNNB 2H0BA 1IQAA 5CBGA 2JRIA 3VDDC 2WS91 4X20B 3UYJA 2BOJA 4JGYC 2WN3A 1UIKA 4CYDA 3B93A 3POEA 1QU0A 3N9QA 5A33B 2VM9A 3LFMA 4YNIA 1O3QA 3ZHTA 1QQP1 2GAUA 4DXTA 1KD7A 2YROA 1AXKA 1ZZ7A 3LQCA 3N7MA 4UVCA 1JYIA 4AK3A 3JATB 2WLLA 4MGZE 4XQWA 3WLUA 4YVSB 1M9NA 3VHOA 1B35C 3HNYM 4OQ9A 1RUG2 2ZABA 3MICA 1QH7A 1AR93 2JE7A 5FYHA 1BE3H 2Z42A 2WSSG 1ULGA 3LSSA 3OJBA 4R50A 5KHGA 3RYFA 5DQ0A 1UY3A 3PURA 3ZO0B 3AK0A 3K57A 5FLJA 4BMBA 1AJNA 2YI9A 2YC0A 1C8NA 2W1SA 3ZXAC 1TG7A 4PI0A 2AREA 2UXCB 3OD4A 2I07B 4HSLA 3IB3A 3A0RA 3O0VA 1H2LA 2RE9A 2H94A 5F5AA 2R071 4H37A 4ZONA 3JD72 4BCUA 3ZRXA 5JZGC 3VBUA 3T2OA 4LUMA 2IH1C 3TB0A 4BJ0A 4A41A 4ET7A 3OAAG 4OYUA 2VC9A 5DZEA 4AZZA 1QR8A 5L36A 2P3YA 1G8WA 2RS31 3OUJA 3G4SV 1UYXA 3ZN0A 4GKKO 5FY8A 4I02A 4GQ7A 4LBLA 2K1EA 2ZACA 3ZSKA 5IYDO 3KV6A 2YU1A 3DSQA 4MVOA 2VOTA 5EYYA 2YDEA 5L73A 4D3WA 3ASNC 3G6JB 4UCUA 4LHLA 3IZOA 4IIJA 4O4JB 2RM21 2ZGSA 1CESA 5HV4A 3CKHA 5FXZA 2ZEXA 4MVMA 2XUEA 5C71A 1TNFA 4Y3OA 5H5NA 4B1LA 3DYPA 4YM2A 2RS52 1SDDB 3B2EE 1H6YA 5JZGB 3AMNA 1YDXA 4JYCA 2P67A 1VQ4V 1HN1A 4JCKA 3USUB 4MADA 4JGZA 4S2FA 2J22A 4PQQA 1W2UA 2N7GA 3E89A 5IHRA 1AR63 5LEJA 4M3CA 2CNAA 4QQPA 2GN3A 1HKDA 1NA1A 4XF4A 1DQ2A 2D40A 4E4EA 2X29A 4JGYA 3K5LA 4KHPO 2P5OA 4E2GA 2ZM6B 2PHRA 3ASNB 4PA7A 3SCGA 3M7AA 5LEKA 4XE9A 1XSRA 2E63A 2PHDA 5CNAA 4Y26A 5CAZA 1FPN1 1MS9A 4YW1A 4O9GA 3H1YA 3M3IA 1AX2A 1R3IC 3IJ4A 1K73W 3U14A 2DJVA 1F4AA 3D36A 4XAEA 3VKLA 2DUPA 3ZX6A 4P5YA 1B35A 4BYYA 1YUDA 4EFBA 5JMOA 1VJ2A 4LTAA 1OQDA 4FFKA 4FBFA 1EFRG 1ENQA 3V0BB 2E7TA 3UT5B 4HK9A 1H8EG 2CGOA 1YFUA 1OUXA 2D3SA 1F5FA 4NAOA 1TNRA 4QQOA 4J7KA 1F35A 4G9SB 4AI1A 1MOFA 3TXSA 3ZBHA 5DG1A 2VW2A 4RQPA 1YLLA 3SITA 4O4LA 1S77D 2IVIB 5FP8A 3T4VA 4BE3A 4BHPA 3ABZA 3JD3A 5ACA3 1VQ9V 5D8AA 5DN2A 1QU7A 3K51A 5FZOA 4LO8A 4B1MA 4DPNA 4X6RB 1Y3TA 1NAEA 2VJXA 1D2QA 5FY1A 5A7SA 1N33O 3G7DA 1JJOA 1VBB3 1URFA 2EXHA 5FZCA 4DO2A 4LKSA 3ZYBA 5EHDA 1YRZA 1LOBA 3CBNA 2WNUA 5EC2C 2W91A 4XFHA 1XNCA 1OXCA 3PIGA 3H7YA 4HT1T 1NY71 1PNFA 2HWC1 4I2OA 4LIUA 4INDA 3U75A 4AHCA 2PQQA 4PF5A 2JD4A 3QACA 1RHI3 4BB3A 2O8QA 4JX0A 3LKJA 1QHDA 2W46A 1DQ4A 4NUBA 1VLNA 3E8GA 1UQXA 2IXHA 5C4WC 4B08A 3ZDVA 3N9PA 3WW2A 3P5BA 4LO4B 2MEV3 4XJ8A 3NR7A 4CC6A 3O5SA 2EJRA 3W7XA 2PHLA 1VEWA 4JZGA 1AVMA 4N53A 2BGPA 1OLMA 4JI0B 4HG6B 3IAYA 2HWD1 4U7OA 2HHHB 1DGWA 1POV0 5DG2A 4BQYA 4O2BB 4PBOA 1P49A 1WCSA 1J59A 1WWYA 4Q27A 4IEOA 1RUH3 3S5QA 4CP9B 2JDNA 1L7LA 1PD3A 4AQ6A 2DFCA 2CDPA 2VL4A 1UY1A 2BJSA 3R4UA 2V4VA 1BBT2 1DQ1A 4Q4W1 2CWSA 2EALA 4QD2A 3KMHA 1SZBA 3NNLA 5KMGA 1ZSPA 3O1TA 3JD1A 4MUVA 3IMMA 1YIFA 1LOGA 5AFEA 1P7BA 4HVRA 4W6WA 4QE7A 2DUQA 3IDEA 1KGYA 4BOWA 3WP6A 1PGW1 1YJ9V 1NT0A 2WYSA 2HEYF 4ZS2A 4KNCA 1BVP1 1I94B 4CP1A 3GCXA 3CIHA 4JVAA 4MGSA 1JYNA 5ITZB 1PVC1 2Q4PA 5CKQA 4ISQA 3PMEA 1ULCA 1ZBA3 5FZ9A 1AZDA 3RT3C 3ZX7A 2VCAA 3EXUA 4TOIA 4AOCA 1XUQA 2QKDA 4IYIA 1WLEA 1JYTA 1VF6C 5JJJB 2HG5C 3LDRA 2GDSA 1IZ3A 5AG2A 5GLTA 1U5IA 4FTEA 3IDAA 4FCAA 1AHSA 2R043 3HPNA 4BPZA 3MZHA 2QQUA 3ZYJB 4Q4Y2 3OPTA 1GK9A 4FOYA 5FPAA 1RUOA 3GZTB 4PIZA 2JIJA 4XYXA 3K4ZA 4RS5C 2FCTA 1BYHA 3B3QE 2B8MA 5A2QN 2A3WA 3X2QC 5IVEA 1LRHA 3OGCC 5CFCA 5K8SA 1H2MA 4AVBA 5EBWC 1T5EA 2D3OW 2BP6A 2D7FA 1M93A 3ZHSA 1FD9A 2PTMA 2QNKA 1GYKA 4EROA 3POIA 1XMQB 4JHZA 4MVZA 2X10A 4BK4A 4W4ZA 3IN9A 5K4LA 1W6OB 3WNOA 4JI5B 4WF9V 4IV1A 1WUVA 1JJ2U 1DYKA 5FQ0B 3WSOA 4XBNA 4UW6A 2DVFA 3IWZA 2RM22 1XL4A 3BABA 4PJ0Z 4OI1A 3SC7X 3K77A 2OYQA 4QDSA 5GLVA 5C3PA 3K48A 3RYKA 2A5ZA 3IPVA 2OTLV 2Q5ZA 4GYCB 2AACA 2F66C 1VF7A 4RS5B 4CDQA 4RO2A 1KDKA 2ATKC 2YS8A 3WG1A 2RCVA 3SHRA 2Z2SB 3ZSLA 4X1YB 4CU7A 4Y1YA 1E1QG 1OHFA 4AWDA 1DF4A 1A32A 2CTRA 1UOGA 4OI0A 1NZ6A 4CU9A 1DP0A 3W5NA 5F8PA 4JI0O 3DYMA 1BEV1 4N90A 1GMMA 3E2EA 4TYSA 2YG0A 5BMVB 1G6NA 1RVF1 3KF5A 1S5HC 5E8AA 1DLBA 3CCEV 1LULA 3FHAA 1UO9A 2R9AA 1IS5A 3F7YC 3CSXA 2ZEWA 1DIWA 3T1YB 2E74B 4FFBB 2VZVA 1FPN2 2G19A 5J7MA 1AYM3 1NH2B 3MPBA 4YW4A 1ZZBA 3BVCA 3LA2A 2Q0AA 4OVEA 4AVCA 4UWDA 5C9AA 4FSJA 5FOBB 1AI4A 1BMV2 1FXKA 2YC2A 3H1IH 3ZFGC 1R1A2 1O7FA 3LCPA 3M3EA 4URAA 1W0PA 4TQDA 1VF5B 5A32B 1H8TC 3GHNA 1I94O 1JUHA 3B9IA 1P84F 3CZJA 2XQXA 3OF1A 2Y48A 1K8AW 4JTCB 1SF9A 1IOAA 5IVJA 1SC5B 1SS3A 4O4HB 4QPIB 4UV9A 5H9SA 4HZ3A 4D6QA 3K9AA 4ASKA 4BDVB 1HV0A 1LAJA 3A0BZ 3PVBB 4V2WA 4Q5OA 1S0BA 2FDIA 4IEVA 2WLKA 1W0KG 4URTA 2ZGKA 1YQ5A 1ZL8A 2X05A 2Y6GA 2WFF3 4LWSA 1GKFA 2WO3A 2BNMA 3WV6A 4OHYA 1ZM1A 4AXOA 1AR92 4KH9A 4P9GA 4U3JA 3ZFGB 2YI8A 4IGGA 3UQ8A 4LE4A 1YCIA 4OHVA 3D0SA 1HJGA 1RUC3 4ZHQA 3B69A 5LBQA 5A3OA 1WMDA 3O7OA 3E86A 5I8SA 5K1XA 2ZHMA 1ZYBA 4Z82A 2NMOA 3ZPOA 2AHZA 1Y74A 4BQWA 5EPAA 2W1QA 1YHQV 4FLVA 5FP3A 3BGAA 1J5EO 4QX1A 4IEUA 1LUVA 4YPJA 4GZRB 3KSCA 5IYYA 1VQOV 2BBAA 2KG7A 4JI5O 1NQJA 4PDWC 2OT5A 3POFA 1XPWA 4MXWA 4Q26A 1GZCA 3BIWE 3SJCC 4TWTA 3RFRA 5LA0A 3OBZA 1RIRA 2UXXA 4TV8B 5FZBA 2ADDA
chains in the Genus database with same CATH topology
1KS4A 2BVBA 3FMGA 1V70A 2VMHA 4QQ2A 3JUUA 1D4M2 4FPYA 4HKOA 5DUUA 5JSOA 2P2KA 1FV3A 2AR6A 3QLQA 5DZGA 4AFBA 4E4DX 3MW3A 3PVOA 5T52A 3E6CC 4F7ZA 2WNVB 3AMPA 2W68A 1RJ7A 3OGGA 3WY6A 3AMMA 4HMZA 2R32A 4N43B 4AEKA 1JOJA 1OA3A 3KM5A 2PYTA 5LK5A 1ZRDA 1C8M1 1XE8A 3V64A 4YFZA 3PLQA 3AZWA 5CFDC 2UWCA 3QH7A 4FPOB 2KXLA 1F5JA 1QOTA 2H0VA 2GZWA 2WS93 4GMP3 1B09A 2YGMA 1DRTA 2VNOA 1PIV3 2WZR3 1AX0A 3AXEA 4CZSA 2ILMA 1G9DA 1S0JA 1Z7S3 5T5PA 1VRH1 1AR91 1R1ZA 4ASMB 2A6WA 1QQP3 1RUD1 3MPPG 1PO21 3SWTA 1VB4A 2JG9A 2KM2A 4L2NA 4NR1A 1IKPA 1KJLA 1Z78A 1URXA 1GY9A 4MX3A 4PDWB 5T54A 1VBA3 1QJY2 3PVJA 2ZGNA 4LBQA 5CA6A 1OIKA 3RPQA 4FP3A 2CAVA 2ZAAA 2MPFA 1AR62 2QVSB 1XU2A 1GLHA 1MEC2 1QJU1 4ZU5A 4FPKA 4CVYA 2CL2A 2CAUA 4FAGA 3ZXLA 1LTEA 4N9IA 5CFCC 1OD5A 1AYN1 4AI2A 4IESA 3MIEA 2VUJA 3D82A 3OPZA 2NPIA 4Z92B 1LODA 1W6NA 2WJSA 2ZGLA 1FYUA 2XKOA 5F1RA 4XFCA 5L7OA 2R16A 2G4IA 3E6DA 1CAXA 3AMQA 4EN8B 5LK7B 1IS6A 4ZU7A 1V9U1 4IV1C 3NAPA 4Y22A 1FV2A 5EZWA 1ZZ9A 5BPXA 4M00A 2ENRA 1D2SA 2ETEA 3WINE 4AHZA 5KHKA 1FOD2 2OG5A 2RS11 2IC1A 1COV3 4DFSA 3CEWA 5CFDB 1UKGA 4GULA 1VAMA 3L9JT 1V6LA 1ND3A 3V65A 2Q5TA 2SLIA 4R8HA 2VUAA 2WSVA 1EV11 2CY6A 4AHYA 2ZGOA 4I09A 4D7TA 1OLRA 2XLAA 1I3HA 3B5LB 1AXYA 3EQEA 2GDFA 1D4M1 1H2NA 4B3NA 1EPZA 1S1AA 4CDQC 1C3HA 3GYDA 1CAWB 2R073 4MGIE 3UK9A 2JEMA 1AR73 1V00A 1QMJA 2WQZC 3A4UA 2VMIA 4HN1A 1O4ZA 1CX4A 3INAA 5GKAC 2X8KA 5CFCB 3BOPA 1VIWB 4K9SA 4YVWA 1CD3G 4AEDC 2R0FA 4LNVA 3DKWA 2TBVA 1QKQA 1QF3A 1AR83 2RS33 2OYZA 4ATEA 1SLIA 1M06G 3WZ1A 2HEVF 4FTBA 3VZJA 4FPCA 1UPIA 2XWJB 1JN2P 3WQ7A 2IXLA 3N4MA 1AL22 1L3JA 1D4VB 3GZAA 1PK6A 4EWEA 2D3RA 4IV1B 2ZGMA 4META 2UYAA 2UURA 5C4WB 1LU2A 5BNPA 4M27A 1MZFA 3JB8A 5ACA2 1PMIA 3T1LA 4XJUA 3ZXKA 1QJY1 3DGTA 1OFSA 3SCHA 1W6PA 3N7JA 1CAUB 1WW6A 3KT7A 1AR61 1LOFA 1RUF2 2YV8A 2DCKA 5FPXA 1MEC1 4IV3A 5HCAA 1PVXA 4OLLA 4DINB 4QT6A 5E1RA 3NWKA 5FRAA 4FPJA 2A75A 4MGYE 4YG3A 2B46X 2I74A 5I0TA 2EVXA 1VBB2 3VKNA 4B7EA 1K5MC 2WC2A 4JC1A 4WVZA 5KC5A 4H7MA 4HKLA 1VALA 5HBAA 3TNPB 4FXKB 5GJ6A 1G9CA 4CDQB 1RUG3 3J9SA 3B00A 1C5HA 5C9AC 1A78A 1QGLA 3U07A 1C5IA 3OYWA 4Q4V2 3I8TA 2R49A 4L97A 1BVVA 2PA7A 1GFF2 4NE0A 4BWOA 4WM7B 4AFCA 4L99A 1VAVA 3ZFFC 5DZFA 3UV9A 3ZFEC 1RUC1 3VBFB 2BVVA 2FMDA 3JU9A 2VPVA 1FOD1 5LRRA 4BA6A 1LENA 3PNAA 4OHWA 2VOWA 1HDKA 1GQHA 1LHOA 2LTNA 3IDCB 3SMHA 3QCWA 4SBV