1H2NA

Factor inhibiting hif-1 alpha
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2nA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2nA01
3P3PA 2WA3A 4B7KA 1H2LA 1YCIA 1IZ3A 1H2NA 2ILMA 4B7EA 4NR1A 1H2MA 3OD4A 2Y0IA 5JWPA 2YDEA 4AI8A 1H2KA 3P3NA 3D8CA 2CGOA 3KCYA 2WA4A 4JAAA 2YC0A 1MZFA 4BIOA 2W0XA 2XUMA 4Z1VA 4Z2WA 4QU2A 1MZEA 3KCXA 2CGNA
chains in the Genus database with same CATH superfamily
1S55A 4IE7A 1OVPA 5BNPB 2WLLA 1US6A 2MHFA 1XNCA 2X7RB 4H0LB 4XXPA 2OCHA 4QKBA 1D7PM 4Y1VA 1DZRA 3WP3A 3ACIA 2QE7G 5J09A 3VL9A 3ABMB 1HR0B 1QMJA 5KAFZ 1ZBE1 1XNTA 1W6PB 3AK0A 4DW1A 1SQ4A 4MGQA 4BW9A 3ZR6A 4XAEA 3MIEA 1VAVA 1H1IA 2YG0A 1OMIA 5LW9A 3CEWA 1H30A 1W6QB 2DCTA 2AW9A 2GNTA 2XTAA 1L7QA 3CL1A 1N33O 2FL4A 1COV3 1FFXB 2IVIB 1AR91 3ZOIA 4OHYA 4CU7A 1HW7A 4AZZA 4FLZA 4IE5A 3O14A 1FXHA 4OI0A 2WZR2 3JBG2 1PM4A 2WLKA 2J22A 2D93A 4ZY9A 4CDXC 3DV8A 4NE9A 1WP7A 1G86A 1Y9MA 5JOWA 5FYCA 5A7SA 2FHRA 1ZA7A 3WINE 2ZCWA 3UKTA 2UXCB 4LA3A 5JAXA 1AROP 5HV4A 4NXNB 4Z1VA 3I59A 3SJQC 5AFBA 3UT0A 3L75H 5TSWA 4PI2A 3B3QE 2ARHA 2B39A 4XF4A 5DZGA 3LZZA 3CLPA 2DUPA 3S57A 3S5QA 3LSQA 2FYUH 2AENA 5FXWA 3PJQA 1KU9A 3IC7A 5JPNB 2D5FA 5I0SA 1GO3F 4O4LB 1Y43B 3FBMA 4XDOA 3ZFFC 5DAPA 3Q8BA 4NPMA 1TMF1 2UU8A 1GAXA 4JYCA 2DTWA 2B9UA 2BZDA 2E6VA 4FPYA 1LECA 3JU9A 1F4HA 2JJ1G 2WN3A 4LF4B 1DLCA 2CH7B 1BHAA 4NMIA 3VQYA 5LEKA 2QGNA 5KMGA 4BWOA 4UCUA 1XBFA 5F7UA 3SLIA 1RVF1 2X5IB 5M0TA 4G2KA 1QOTA 2VC9A 5C8CA 2O8OA 3K79A 3E6DA 5BV6A 3ZMSA 2ET7A 3EFFK 4UW5A 5LHIA 3AZWA 5FUIA 4WM7B 4QPGA 1K45A 4FP3A 3SPIA 1GKBA 3OGVA 3VBUA 5F6LB 2BTOA 2XAJA 3BTZA 2UU9B 3OF1A 1EPZA 1X50A 4QDSA 1QCEA 1UPIA 1YQ2A 3FB7C 1YJKA 2IXLA 4BISA 3ALQA 1HXS2 2OCCC 3ECQA 3FAVA 2J7MA 3JALA 3OM3B 4YIPA 4H44B 2RS11 4FTSA 2W92A 4MHUA 2H3OA 1JW6A 3NNLA 4EWEA 4TWTA 4JTCB 3ZXAC 4RQPB 5BUVA 5C9AA 4B4QA 3ZN0A 1ZNPA 3WNLA 5A6ZA 2GDFA 2PHUA 4DRXA 5CKMA 1WGPA 4ZU4A 4COUA 4HFSA 3DXTA 3GHMA 1XBLA 2ARBA 4PF5A 2C4XA 1GMMA 4Q27A 1R73A 2ZR2A 2ORZA 3RYKA 4AWDA 4X1IB 2DVDA 4AFDA 1N4CA 4K7JA 2G4IA 2R043 3WG7C 4YW5A 5FLHA 1X36A 2VMEA 4JASA 1V6MA 1AX1A 1R3IC 3CC7V 2CTVA 2A6YA 4E2GA 3KM5A 5FXXA 1QVFU 1N33B 3V64A 3B02A 4DS0A 4E8DA 3NAPA 3QD6A 2EICA 2D97A 4Q4X3 1LHUA 1PNMA 1SLLA 4PLOA 1SQBH 3CMGA 5FAXA 3BALA 1FPN1 3ZVXA 1AR71 2MEV2 3LE0A 4YJ2B 4U3JB 2ZX0A 1L7RA 4TV8B 3ST7A 4XIOA 1RUG3 3OUSA 4M0NA 1WD4A 2DCKA 2MW2B 3JASB 3SEEA 1FD9A 1QR9A 5L36A 2JEXA 1X33A 1REFA 4CEWA 4I9QA 2JE7A 1OV9A 3CCMV 5LZ6A 1SHWB 5IVVA 1VR3A 1D5NA 2ADDA 1L0LH 2WFF2 1HP8A 4OZOA 4TQFA 5JI7A 1OPOA 2YI8A 2IZWA 2WR9A 4CTEA 4ZXEA 1NU1H 1FMD1 4GB32 2R1BA 4H2AA 3K3WA 1UO9A 1U96A 4IT5A 4N21A 1BJQA 1VE0A 2DQ3A 3H3ZA 1Q90D 5IAVA 2JRIA 3CQOA 1GN2A 5FPRA 1VBE2 4HVQA 5B4XA 4MYEA 2BPA2 3ASOB 2FMYA 2HYKA 4R4XA 1HRV3 4XJWA 1NZCA 3HAGA 3QO7A 5AC93 1JQ0A 1YQ6A 3VBSB 3B8NA 1RPOA 4C8DA 4M4RA 4DK0A 4DV6O 4DV7O 3HBZA 4KUMA 3HQXA 1S77D 3MFAA 4HSLA 4CUAA 2VQUA 2PYLA 4JI4O 4LO8A 5FZMA 4INDA 4J80A 4G3YC 4MTFA 1IS4A 4GKXA 3KT4A 1MMMA 2BV4A 4NOTA 2IH3C 3VHNA 4AQTA 3AG1C 4XCAA 1C8M2 3V0BB 1COWG 1OOPC 2LFRA 5CBHA 4P00B 2Q0AA 4DZGA 3WF0A 4KL1A 3J9SA 4QIWF 2VCMA 1XHXA 1I9RA 4B3SO 1JTZX 4JPRA 5A7NA 1RUC3 2Q7GA 4QKFA 4FOVA 1MEC1 4BHPA 1URXA 4Y4YA 3P32A 1N36B 1OD5A 3ITQA 4YZ1A 4MVUA 1F5FA 2R062 1RUH1 2BDRA 1RP3B 5IUQA 4OHZA 3JARB 1LOBA 1I5ZA 1FX5A 3O1PA 2EINC 4FPKA 2BSKA 1AI7A 1DDLA 5FXZA 2VMHA 4JAAA 1PGW1 2PYJA 1YQ8A 4CDXB 4AXOA 3AK2A 3EJKA 2ITCC 1W8ZA 2NM1A 1C4RA 1RITA 2GH2A 4L8JA 2JDKA 3ZHQA 4PA3A 1Y74B 3X29B 3USSA 1O9HA 4PJ0Z 4I3PA 4HSJA 2VMGA 2HWF3 1FJGO 2LO1A 3AG7A 4FM1A 2PHFA 3JCZA 3T2OA 5EZYA 4NYKA 3OB8A 2BOIA 4NRMA 2GC0A 2IXJA 4IL7A 2ZXQA 3W58A 3WQ0A 4JQTA 3KCXA 1PM7A 4V1PA 3NQHA 3MIBA 2OT7A 2ZIMA 2VCAA 3MIFA 1C8NA 3ZFFB 2NZ9A 1LOCA 5L7OC 2DYRB 3J7NA 1W9SA 4GMP3 3FBYA 4CUCA 1VAKA 4AAPA 2HR3A 4CC5A 3RYHA 2VOVA 2E3CA 2ZNJA 5LGUA 2Y69B 4P08A 5GZCA 3N9OA 2WNUA 1JZ8A 5BNQA 3L2HA 5H9RA 4EQVA 5FOBB 4CEYA 2XJSA 2HWC2 1SQFA 3T1MA 2GUZA 4DUYO 5CFCC 4Q4V3 4GKKO 1UY3A 1A32A 3UM7A 1YUDA 2HJFC 2OQ7A 1TG7A 4IDZA 2Z79A 1SBFA 3D3QA 4DR3O 1GNHA 2P17A 3CF6E 3GB7C 2W5FA 2JEUA 4V2WA 2QE3A 1UOBA 3OBRA 2ZGTA 5JOXA 1W0OA 1VBA3 4MVZA 2R041 4DV6B 4DV7B 2KM2A 1VBD1 4JI4B 3FLPA 4PCRA 4FXGB 5FPUA 4E4EA 4LBKA 4C0HA 4Q4X1 5FKBA 1RTVA 4PA9A 4OHXA 4IV1A 2EIMB 5FUNA 3T4HB 1RC6A 4G27B 4ZI7A 4FCAA 4P9WA 4LNVA 3H42B 4F6RA 4IV3C 4CXXA 3DPRA 5T52A 3G6BA 3ABZA 2QJ1A 1RUG1 2J1UA 4WVMA 4QPIA 4B3SB 1DQ5A 5GONA 3AYCA 4FPOB 2HWE3 3LPFA 5FPXA 1IX9A 3IB3A 1FXKC 3LNNA 1J58A 1IXBA 4CDWA 2X05A 4XDLA 3B5LB 1KKCA 1J83A 3OE7G 4YJ3B 4TV9B 2Q8DA 4ZKTB 2Z0AA 1X9PA 4LUMA 5J98B 3LFIA 2R9RB 1EBOA 3WX5A 3E83A 1NE4A 4X88A 2JIJA 4HLTA 4H37A 1MS9A 1UL9A 5DN2A 4PIYA 2IJHA 3THOA 4E4SA 1K97A 4DUVA 1ZL8A 1DGWA 1MZEA 1LOFC 4AHYA 3G67A 3AM2A 5IVYA 3N3HA 4L11A 5FP3A 2R072 2EAKA 1ENSA 4MW3A 4JV5O 1H4GA 2OZJA 4XBNA 1HRV1 1G6UA 1FJGB 1IS6A 1K5MA 1XL6A 1V6IA 3RNSA 5AC91 5LA6B 1VQ4V 5G04L 1J3PA 3GVMA 3E8HA 1BVVA 3KLSA 4ZZ8A 4E4HA 2QDRA 4N9HA 4N43B 3H1HH 5FNVB 4ZOLB 3K3NA 4X66O 4LBNA 1J59A 1PO21 4H3WA 1NA1C 2PHLA 1BSMA 3PJYA 1CEZA 1U5IA 2QVSB 3WP4A 4YY3O 5I8TA 4QDQA 4UBGA 3MF6A 3KB5A 5BYNA 3C7EA 3POWA 5A9GA 1EM1A 4Q8LA 3SISA 2VNRA 1XUQA 2ARCA 2YROA 1XNRO 2VVDA 4A44A 3K57A 2ZOEB 1CZTA 3ZRWA 1W59A 1Q8VA 4MO3M 3VL8A 3ZXEA 1FOD3 4DUYB 4GKKB 1R083 2E76B 1YJ9V 1UNBA 3OG2A 4UVCA 1Q8SA 2GSYA 3L70H 2F6BA 1W9TA 1NH2B 2A6WA 4DR3B 4FP2A 3PUSA 5C3PA 4A7YA 4J42A 1X8MA 2OS2A 3RWRD 5F32A 2XVKA 3ZFEC 1H2SB 5FPLA 3O0WA 3ZYGA 3CRAA 3DC6A 3U11A 1AYM2 4META 1CX1A 3FHIB 2OWOA 4HOOA 4QM8A 5FCCA 3VDAA 2XVGA 3A0NA 1QQP3 2WS93 4RHV2 1XRUA 4LH7A 1V55C 2VNOA 3ZSJA 3ASNB 3A4UA 4HXCA 3UQ8A 5EZWA 2Y26A 1V9U2 1ZX3A 2XL9A 1PIV1 5JOYA 3T4ZA 5APAA 4WCEV 1LAJA 5CIRA 1BGYH 1OHHG 3GBFA 1LOAA 1K5QA 2RM22 2JG9C 3AP4A 1NR1A 2HHHO 4P9IA 5KX5B 5FR3A 3W7XA 3T2TA 3N2KB 3KS7A 3ZHUA 5LP6C 1FATA 1NT0A 4X65O 4EWAA 1GQGA 1BEV3 1PZ7A 1MS8A 3FLRA 1WLEA 4YRDA 1GQHA 4YW1A 1WWYA 2JDHA 4LIUA 1RUD2 4IEUA 3JD2A 3E6BA 4FPPA 4J9YB 1AL21 2HG5C 5HXMA 1H38A 5FZFA 2HKXA 2PAKA 1QOOA 3ZN6A 4P30A 5BMVB 4LTAA 3VBOA 2I07B 3BGAA 5D8AA 1CQ9A 4CCLA 4JV5B 5A7PA 3KVBA 3AFKA 3B2EE 2L9LA 3PVBB 3EBRA 2VZRA 1VBA1 1AX0A 1PGL1 3NXSA 4FAHA 1WJZA 1LESA 4KWLA 3AYEA 1M93A 4X66B 4Y4RA 1H9PA 5I0UA 3MLKA 5ABJC 2CH7A 1U5YA 4YM1A 2G38A 1GZTA 1IKPA 2Q4SA 4YY3B 5C4WC 2Q5ZA 2XB6C 2VCBA 3H3UA 5BPXA 4WZFA 4CU6A 5F3IA 1AR81 1XMQO 2R9AA 5FP7A 1XNRB 3STLC 5LOVA 4A6SA 1GN6A 4BYYA 5CFCB 4E2LA 1V00A 1N0NA 1N3PA 2HWE1 4I9WA 3BN6A 2QKSA 5IYZA 3CHXA 4XF1A 3ZYBA 4FJCC 3D4KA 5TISZ 2WT0A 4BQWA 3PTRB 1AYN3 1W06A 4QPJA 1DF5A 4YM2A 1GWMA 3MO4A 4O4JB 1FPOA 4M3CB 3AKQA 4K1YA 3POSA 1W8OA 3WW2A 2BGCA 2BOJA 3H1MA 5CADA 2BFUS 4LLOA 1NOVA 4KHPO 4RN5A 1ZZ6A 2WO1A 2O1QA 4Y5TA 4MLOA 2WLQA 4IIJB 3AKRA 3TAYA 2ATFA 3E2EA 5CA0B 3IC9A 2XAHA 1NTMH 1LTEA 1LNSA 2HYXA 1OPMA 2ZEZA 4FTBA 1V6OA 3ZHSA 4DXWA 1WMDA 2BW8A 2P6CA 3THDA 1HNWO 3JD72 5F5CA 5LBBA 2F4LA 5DG1A 3HKCA 4UWDA 4YZ5A 3WOGA 1OLMA 4BQ2A 5LYJA 1Y7BA 2HHHB 2VBPA 1AJNA 1JN2P 1CX4A 5JLVA 1I94O 5FBJA 4X65B 1QBZA 4U3JA 3QF7A 1B04A 3ZXFA 1H0BA 1WLCA 3VOUA 4LHNA 1CESA 1C5HA 1HQNA 3VBFC 2V4DA 1TNFA 5FYHA 3M3QA 4HMZA 3ME2A 1H8HG 1DZTA 3KV9A 4XFFA 2HWB1 2PYTA 4MOAA 4IE4A 5DUWA 1R081 5J2UB 3D3IA 4CH6A 2Z69A 4FFHA 4XC9A 4E9KA 2JIZG 3K0GA 4ASKA 2CE4A 4J7KA 2WNVA 5FLJA 3J7MA 5FQ0B 3M3IA 4R8HA 3BABA 4BMEA 1BLZA 3RZGA 2XWJB 5IK4A 2D6PA 4EN0A 2JJ6A 1NA1B 4B7EA 5E16A 3PUHA 2FMLA 3I2FA 2JWPA 1TZOA 5FFOC 1OLME 1RHI3 1JXNA 4JGYC 3IDEA 1OD3A 3IJ4A 4CCMA 3AG4C 4YM3A 5K7PA 1B35A 4KNCA 2ODMA 4UOJA 1VP7A 4DXSA 1XMQB 3ZJZA 2YU1A 1H8VA 4E8CA 2EILC 3CRMA 2LALA 4QQHA 4YGEA 4QB6A 2RR13 3WNPA 3QTCA 1PZ9A 1ZRRA 1W2AX 3AK3A 5IK5A 1JMUB 1E5IA 1F35A 3GYDA 3MYXA 2HEVF 4Y1UA 2EXIA 4BQYA 1BMV1 3PJSK 2RMU2 1VQ5V 3VDDB 1QHTA 3HR0A 2QKAA 2GP3A 2I45A 2B5HA 1ZZ9A 3USUA 4COZA 3CCJV 1S4CA 4DEQA 1ALYA 1RUI2 4TLGA 4Z2AA 1WMFA 3HEIA 4FZ0A 3ZMVA 4JCKA 1AILA 4IE0A 3T09A 2VU9A 3TN93 2DVAA 4I30A 4Q0UA 3TYJA 5LL6Y 4KHPB 4NIGA 5B1AC 2DV9A 4TSFG 2WNOA 4B4PA 1R6TA 1WW5A 2P7TC 5A7WB 4KGQA 3SH5A 4CU9A 5D2AA 3DYPA 4AYUA 2W1QA 2RJKA 1MZFA 3WFVA 3NW4A 1TUBB 4GJYA 1HNWB 4HZ3A 2PHRA 4QKNA 4P9XA 2Z5WA 1SETA 2D44A 4CDXA 1RMU2 2NR5A 4CA9A 3W7UA 1LENA 4H33A 1BBT3 5JMCA 4BMBA 4PQ9A 3JAKA 1ASJ2 2GC2A 1I94B 4WBNB 1PHMA 5ACA3 4XUTA 4MTXA 2K9PA 1W0KG 4QWNA 3W9AA 5FZEA 3E8GA 2PY5A 1IKQA 1QNMA 4XUOA 3FUQA 1HLCA 2VW1A 4CE8A 5JI9A 4FT8A 4R9CA 5ITZB 2YIDA 2BP6A 3I2OA 2ZXWB 1M4WA 3PTYA 1HB1A 5LRRA 1RM1C 4FFBB 1PPJH 3E6CC 1RPRA 3D82A 4Y20A 1KXGA 5D5PA 3AFGA 1B09A 1UOJA 2QTOA 2D40A 4GULA 4KU8A 1N1YA 4ORFA 1CAUA 3JD0A 4YVWA 3ZLIA 2VBDA 1SC5B 1AYN1 1Q7YW 3K5NA 5KXDA 1CN1A 1Z7S2 3RZHA 4OLLA 3AEIA 2BBAA 2HP8A 4Q1RA 4AL9A 1BMFG 2ZKOA 3T30A 5JPMB 4UYBA 4R7CA 4DEVA 3WP6A 3JXSA 2QUOA 3RG0A 2X53S 2XLGA 1KBHA 3CZJA 1O4YA 3A0KA 1FXVA 2J1VA 1UYPA 1CR7A 5F3GA 5E79Z 1OCZC 3ZXJA 2XR4A 1TUEB 4KXRA 3OMAB 1OSGA 4IHJA 3C2UA 4LBMA 4GALA 4HN1A 2DURA 2X09A 3Q4HB 1MVQA 1H2NA 4D3WA 4MSVA 4XTPA 4WF9V 3RFRA 3R4UA 1D4M3 1A8MA 1ND3B 1HQLA 3NV1A 1O9GA 2QNKA 3PVEA 1KEXA 1JS9A 4Z2WA 1QDOA 2GN7A 2JDNA 4RFT0 5EYPB 4IEOA 3IMNA 2E53A 5E88A 2A0LA 3KMHA 1SPPB 5I93A 4K40A 1GZCA 3TCUA 5LCWL 3JCIA 1ND2C 3GWOA 1RVF2 3M3EA 4JX0A 1MACA 1ZM1A 1WB7A 2Y64A 4CCDA 4YJ3A 4TV9A 3RJ2X 4X89A 5IVEA 2JIGA 3BU7A 1SRYA 2Q8OA 4WFFA 3G6EV 3GALA 2UURA 3AG2B 1AR61 5L73A 3MZHA 1EV13 2YBPA 3SJAC 1UKGA 4QB1A 1Y4MA 5E89A 4JTOA 4JF3A 3U1XA 3CCLV 1WW6A 3B00A 3E5XA 3E1F1 3PVNA 1JYNA 1GU3A 2E33A 3DYMA 2DE0X 2UWCA 5B1NA 4RL7A 5FWEA 5CN0A 3DTUB 3HWJA 3A0BZ 1HQWA 3V0AA 5CBFA 3N7LA 3UGGA 4PDWB 2QWPB 1PNGA 4Q8KA 4E27A 3VBFB 5IYYA 3S7EA 4NO4A 3AMMA 5IK7A 3VQWA 2CDPA 3SCHA 2Q8EA 4H7MA 1KB9F 3HT1A 2FDKA 2CY6A 4ZS2A 2EAAA 4TOIA 3POBA 3POIA 4YVSB 4LBQD 3S0MA 3OD4A 2W46A 3PIJA 1REEA 1VRH3 4LHSA 4NHYA 4N8MA 1PM9A 3UETA 2FCVA 1GZ9A 1W6MB 2JDYA 2ZPXA 4HN0A 5EIBD 3LB9A 3IMMA 4LHLA 4BB3A 4NWVA 4PHZA 3VZJA 4YG3A 5JVDA 1PO13 1POV0 3M1HA 1JPXA 3RS6A 2A06H 1H9WA 3DF0A 1S0IA 1RUE2 4QKDA 1DYPA 1YZBA 1TVKB 3JD3A 2JJ2G 3U07A 2WBKA 1NCQB 4ASMB 3K5OA 1N1VA 2CWMA 1Y3TA 4D6QA 3OEBA 2OUJA 3TEXA 3VZMA 4J9ZB 2K46A 2VH9A 4X1YA 4S2FA 2DWRA 1G9DA 3I56V 1FFTB 1OLRA 1C57A 4Q5OA 4XQWA 2Y0OA 1UXXX 1W2UA 1F9KA 1OOPA 3RWKX 4LIVA 3ZFGB 4MXWA 3LEKA 2YBSA 3IWZA 4AEDC 1BBT1 2R49A 2XHKA 3PUIA 2Y38A 1FMD2 3RVHA 3UGFA 2PELA 1ZUQA 4J25A 4DRVA 2BERA 2VGDA 4X6RB 4O2AB 4NWWA 2RJZA 4LO5B 1HRI2 3B94A 4YGBA 2UYBA 3EHKA 4CZSA 1EY2A 1QJX1 3ILNA 1Q8PA 3J7LA 5KXBA 2E74B 3E8BA 2HWD2 4UV8A 1UX7A 1UW8A 1TE1B 3N2KA 1JYXA 4FOYA 2FZ2A 1G8WA 2WYSA 4HK8A 5CA1A 1IGOA 4GT1A 1XI1A 5KBFA 2KQXA 1NUKA 3C3VA 4EN9B 2QM7A 3CE2A 3FN9A 2DUQA 4DR4O 2BTQA 3LNMB 1LKNA 4Y22B 5BMVA 3FL7A 1WPBA 4HVOA 2EZPA 1XNKA 3K4ZA 4YIOA 1M56C 2KXLA 1Q6UA 1WCSA 3X2QB 4EROA 1YIFA 2ID4A 4HETA 1XC6A 1O8PA 1VQPV 1QJU3 1YC61 5FYIA 3HNMA 1YTFB 5JSRA 2CAUA 1UN1A 5FY9A 3BTYA 2WAOA 5HI0A 1UIKA 5LATA 1YJLA 1ZWIC 1RUH2 5L7OA 1SERA 5H9PA 2Q1MA 4KH9A 1CAVB 3AVSA 1V0AA 4XJAA 3HKDB 3K9SA 5LHHA 3NO8A 3ATGA 2YU2A 1OCRC 4ATEA 3K77A 3LIHA 2WLLB 4DR2O 1W90A 2L6LA 3MDPA 1BK1A 5CFCA 4UB8Z 3D3AA 3PMEA 4BQ3A 5IWAO 1EPWA 3TOJA 4R50A 4FVMA 1GM8A 1Q81W 4W6YA 1SBEA 4XOGA 4RR3C 4CVUA 1YF2A 1K92A 4BK4A 4XE9A 3H9VA 4WFHA 5FL7G 1GWLA 4D7SA 1VF5B 2ZE8A 5L9VA 4ZS3A 4K8XA 2EXKA 4BIOA 4PIZA 2XAQA 4XEZA 2B45X 1LRHA 1G1XB 4EEQA 1QJY3 3BRCA 2QFEA 2RVAA 1ZSPA 3PURA 4Q4Y3 3MV01 3ZX6A 1DK1A 4FIPC 3PNAA 4IV3A 3F5WC 1XSRA 2TNFA 4A6OA 3ABKC 4R4ZA 4XUPA 1NG0A 1QU7A 1BQZA 2QQKA 1LEMA 3GZEA 2GTAA 1JZ6A 3I59B 4BIFA 3TN92 2HKOA 1FXKA 5FY4A 4K3UA 5J9PC 1S0CA 3N9NA 1ULFA 3S3XA 4RSUA 4QX1A 1RUJ1 3GHNA 3BIWE 3ZIAG 5DDJ3 2FDGA 3ILRA 4F83A 2F93B 3HVDA 1QQCA 2YC2A 4IEPA 2D7FA 3EYPA 2Y6GA 3QNEA 5HFMA 2QQUA 4H13B 1HN0A 4FLYA 2UXBO 1VBD2 4WM8C 1IS3A 3FB5C 1GBGA 2VVFA 1W6NA 1LOFA 3ZR5A 3FHAA 1O3TA 2FD8A 1XMOO 2VQ0A 1OA2A 4LMFA 1RB8G 4DR4B 2ZX3A 1HN1A 3W7WA 3RN4A 3CYOA 5KMGB 2RNBA 5IVBA 3RZJA 4AEMA 4MADA 1EUUA 2M6YA 2XLFA 3WNNA 2CK3G 5FO8B 5C8CB 1AR4A 4MT8A 3UCSC 1RINA 4NKGB 4Q4W3 2VRZA 1CIYA 4P9OA 2VZ3A 5H2FZ 5T50A 4ABMA 5L9BA 2YXSA 5F2SA 4ES9A 1H2LA 4QPGB 4XMIA 3VBUB 2YC4A 1VQ8V 4GKJO 5JCTA 1MSDA 1GP6A 1SZBA 3E89A 1A78A 1NA1A 5C71A 1BQPA 1S5JA 4HONA 1A8DA 2XUMA 4XTMA 1H6YA 5LK7B 3RT3C 4GWIA 2RDNA 1OHFA 3FAVB 2UY8A 4U7OA 3FWEA 4MS2A 1YDXA 5EJ1B 2DCZA 2IW5A 2BNNA 3JCUZ 5FMOL 1VBB1 4DR2B 5A3NA 2DFCA 2A75A 3OMIB 1US3A 2CGNA 3SH3A 5IWAB 2VD7A 4DRXB 2YZ4A 2VMIA 1BHGA 4RQEA 3VD3A 5LA1A 2WZR3 5CMUA 4HKOA 2A7AA 4LE4A 3THTA 4BOWA 3MAQA 3ZFEA 2VCCA 3FYEB 3VV1A 2XJQA 3BPSA 4Z07A 1IPSA 4BK5A 1LUWA 5A32A 2VE1A 3NAPB 2A6ZA 4X64O 2RV9A 4FPFA 2IU0A 2P67A 1PO22 3AVRA 1LOGA 4BQ5A 5IATA 5BNNC 2ZE7A 4NHLA 2QBXA 4QPKA 4MSWC 5HCBA 2E31A 4UVAA 2V73A 4JKKA 2ET1A 4FLXA 1KRIA 2XOMA 2EXHA 4J11A 2N05A 1RYYA 3OGIB 1YEWA 2Y33A 3S30A 1SFYA 4IEXA 1K5MC 2XMLA 1CWPA 1IBLO 1KQSU 4CCKA 3H8UA 1PX3A 1V9PA 1RGSA 5CKQA 2HEPA 2JG9A 1H2GA 4CEWB 2WWUA 3JZVA 4K20A 3K08A 1X59A 5A3LA 4XF3A 5LP6A 3OEHG 3RYFA 4OHVA 1SQVH 1QY4A 1SZTA 1W9YA 2B42B 1M1KW 2IFRA 4X9QA 3ON7A 1JI6A 2UXBB 1R1A2 3IM0A 1LU1A 1UPSA 5C8WA 1Y9GA 2IXCA 4LT5A 4W6XA 3RVZA 2WWWA 1SLBA 1XMOB 4CH3A 3AKPA 1RUF3 1OA3A 3JQWA 4LR4A 1CXZB 1PD3A 3AKSA 2B1IA 1E1RG 2N7GA 4UCVA 4GQ7A 5C70A 4WFBV 4AHZA 3A8TA 5L9RA 4MVMA 2E7TA 5B5EZ 3QLQA 2AGSA 1HXS3 3VD7A 1W2BU 5DAWA 1PIV2 3ZN1A 1W0NA 1TA8A 4BLJA 1H1AA 5A7QA 5ABJA 4GKJB 1D2DA 2GC3A 1OBNA 4ASUG 1CD3G 1RFYA 2ADEA 4PELA 3ETPA 4LQRA 1BVP1 5C4WA 3OTFA 2GNBA 4LR3A 2BVBA 3ZPOA 1QOSA 4F6EA 3KGLA 3H1WA 5KUMA 2EIKC 4JDOA 5F3CA 2UXXA 3N2GA 5FXVA 1I7FA 1XNAA 3WVJA 3BOPA 5AG2A 4B3RO 5GZDA 3U4XA 5C3OA 1AL22 5FUPA 4EJRA 5BR8O 3E8FA 4B3NA 3LA7A 1IZ3A 3LDDA 5CYYA 1ULOA 1WMEA 1WBFA 3Q4HA 2DW4A 2QKDA 3M4FA 1ZRDA 4LULA 1ZZCA 3BY6A 5EBMC 5T5OA 1N32O 3ZIWA 4FTEA 4BU2A 2DVGA 1SA0A 2MEV3 3UV9A 5JDBA 1KJLA 2BSKB 3DL3A 4DR7O 1NVPB 4TTGA 3ZMUA 3H1KH 4X64B 5EYPA 1Q56A 3U14A 1A34A 4LHKA 4FK5C 1XSQA 2ZEXA 3WNKA 5T5JA 1IURA 3TB0A 5AVAA 2BFUL 3F95A 1SQXH 3NL1A 3ABUA 2V7QG 1AR82 2CTQA 4QHZA 1P84F 2WFF3 3HR9A 1KD7A 2JS5A 3JYCA 2B4KA 5EZYB 4BAYA 2FZ1A 4Q4W1 4AVVA 2YIAA 4Q6GA 1IBLB 4ZKIA 4GB33 2ILMA 2XG3A 3AXEA 3RYIA 5KC6A 1GYKA 4JGZC 2R72A 3HD8B 4ZPIA 3T1CA 4XQDA 1CAWB 4BZ4A 1I0HA 5I0DA 1NR7A 1VBE3 4FLVA 3ROUA 2D3SA 1UIJA 3AG3C 1JZ3A 3WDUA 4XFIA 2JS3A 3RYHB 2VNGA 2P2KA 1BZWA 1OVSA 4A4AA 5I0TA 5FPBA 3OPZA 3MW2A 4AVAA 4NHXA 3PVOA 2C5DA 2VOXA 2VNVA 2Y0PA 2JDZA 2Y0IA 2GUZB 2YS8A 3OR7C 5JCOC 4CXWA 4N7IA 4XABA 2W6JG 4XJZA 2WZR1 1DGRA 3OW2U 4DB5A 3JBG1 1C8M3 1WZXA 3WSOA 5C5TA 4ARXA 2WLIA 2E51A 1MS3A 5FJKA 5H6RA 3ZYRA 1V6NA 1G8MA 2MNGA 3K2OA 4XW3A 5ANNA 4XZUG 2OPWA 4WV8A 5AVPA 4JGYA 2DVFA 4IV1B 3PL0A 4G9SB 4B1MA 4E4ZA 2YXLA 2PMWB 3MEPA 2C6SA 1L1FA 5GM0A 1OH4A 2R063 2AUYA 4F6RB 4B3RB 1O6UA 5LEJA 3DPRB 1O4TA 2AGAA 5K1PA 3L9JT 4WVMB 3THPA 2YPDA 4LOTA 1DP0A 4HVRA 5GONB 4Q0SA 3K4DA 4DV3O 5BR8B 4AHXA 2HWB2 3CCRV 5L3EA 4QX0A 3E22A 4CDWB 3FB8C 3IIIA 4ATFA 1JODA 2YV8A 4XQ4A 2GTSA 1AUYA 1T6BX 4U2AA 3O1TA 1N32B 4KG0A 1O3QA 1IDSA 1ZLZA 4DR7B 1E5SA 1JYIA 2WZPP 1OKQA 1Y4WA 5LA9A 4O2AA 3M2MA 3FFQA 4PT6A 3Q9OA 5H9SA 5CB4A 1YLLA 3ZO0B 1ENVA 1OQDA 5A3TA 4KWUA 4F7ZA 5IVFA 2Y8KA 1JYTA 1K4DC 4RGGA 2CDYA 5A3MA 1EZJA 3AB0A 5IJRA 5FK8A 1K5MB 4RO2A 1YI2V 3DEMA 3MDSA 3I3QA 4K0KO 4LNUB 3NNFA 1SQQH 4QX8A 4PDLA 2FCUA 1W6OB 5FO7B 2YGLA 3QBQA 1UY2A 2HWC3 2VQTA 4Y22A 3FFZA 2RG4A 1H8TC 3CJIC 3MBWA 4AEKA 1JJ2U 1BYHA 4RS5C 1Z5VA 4TQDA 1OKOA 2WC2A 2PAMA 1VBC2 4DY3A 3HQUA 3ZRWB 1QH7A 3CU7A 5FZDA 3MI8A 3W5MA 3UK9A 4TYSA 1W3XA 2Y6KA 2BWCA 4XAAA 2ETEA 3ELNA 3LOBA 3ZRXA 1AX2A 4LKFA 1DTOA 2ZDIC 1CAVA 5CFDC 2KD7A 3H8RA 3ZSEA 4AVCA 3HKDA 4AGRA 4I5SA 5FY1A 1B3QA 4YW3A 2VQAA 4N9IA 1FV3A 4XBLA 4GX5A 2XL7A 2O57A 3T1HO 1OC1A 1YNAA 4P02B 1GN3A 1UY4A 3A7QA 1WLWA 4R6ZA 2DBNA 2VZQA 2BVVA 3J26N 4NVPA 4WFEA 4JC1A 3H8OA 1P49A 2BNMA 3PIGA 4CP1A 1EAH1 5KR7A 1N0JA 5EP9A 1O3RA 2YHJA 4Q29A 1ZBA3 3I2JA 4W4LA 5FPZA 3JSLA 4DV3B 1N8RW 3POFA 1BCXA 4GB31 3J8F3 3P5BA 4O2BA 2VZOA 3EMRA 3VD4A 1JOJA 1DIWA 1V54B 1QIQA 4XDKA 4IE6A 1LU2A 2UWAA 4O65A 2R073 4UW4A 3VBRC 3P1IA 3Q8AA 1HDKA 5FWJA 5FREA 2PGGA 3APQA 5B1BB 3PUAA 4LBEC 1Z78A 3IDCB 5IJ0A 3BU0A 5IAXA 2ZHKA 4X20A 1JHNA 3KF5A 4FFFA 1ND2A 4K9SA 4MZUA 2EIJC 2XGXA 1XOYA 3B40A 3LCPA 3ZN6B 1NKGA 3TNQA 3VBOB 1GANA 3TJTA 5D8AB 5A3WA 5IT6A 5I91A 3LDKA 5CBLA 1YIPA 3C3SA 4CC6A 2V5YA 3C8XA 3ENRA 2LGQA 4K0KB 4QDRA 4XILA 4FM2A 2OIEA 1YXBA 1GOFA 2W08A 3VHOA 5J3UA 4YVWC 3M7AA 3WY6A 5ISLA 3N27A 3LSUA 3IIAA 3AG3B 4PDRA 1DQ2A 2GALA 3S7IA 3CRQA 2Q67A 2WN2A 3ETDA 3LDBA 1SEFA 2QQOA 2Q5TA 3IPVB 2QQPA 5IY5C 1GWKA 2R061 2P3YA 5LOVB 1DGRN 3OR6C 4HANA 3FB6C 3SYOA 3O5SA 2CL2A 5FY7A 3WCSA 1D0HA 2QWQB 3MUY1 2X6BA 1RUF2 5FOJB 4M3CF 1YQ5A 4K8RB 2HFEC 4QQ2A 3PU8A 3CRCA 4Z8BA 2WO7A 4CXYA 5IYZB 1HKDA 1AYM3 3MPBA 5FZAA 4CPBA 2EX3A 5JR7B 4COWA 2Q1FA 1W0PA 5A33A 2RDRA 4RHV3 3L72H 5F5QA 1AR62 4FPCA 1JFFA 2D2CB 3W7SA 2QTWB 5JZGC 1MQTC 3M8LA 2P37A 4CS3A 2F4VO 3T1HB 3WW1A 2Z42A 4JGSA 4JHTA 1V9U3 5LRSA 3AK1A 2VJXA 5K0UC 3K48A 3NJZA 3LEMA 3GZAA 1VMGA 2OKXA 1N36O 3AMQA 5C3SA 1BQ0A 3SNMA 1RJ7A 2RM23 5IHRA 4B7KA 4I2OA 1C28A 2ZGSA 4S2DA 3OGGA 1O5LA 3VKOA 2ZHMA 4LF9O 3MW3A 3OGSA 4ET7A 1FV2A 2WSUA 3WQ1A 4QGLA 1CIWA 1IS5A 4N7UA 2RE9A 2VO5A 1RUD3 2ZT9B 1FKAO 5FP9A 3CJHA 3HKCB 4AEDA 4FOWA 2RS52 1IBMO 1JZ5A 1DGLA 3T0AA 5LYJB 1KGYA 4NIAA 2DTYA 4QQPA 2HWC1 3VD5A 2W0FC 2BEOA 2D98A 5FV3A 1H6XA 1E5HA 1YFUA 3CMEV 2OPKA 4BWAA 1AL0G 2AZ2A 4TUYB 5FZ7A 2GMMA 4X6QB 3A0RA 4UT5A 3STZC 5A6QA 4A7ZA 2ZMKA 3MIDA 3T4DA 2YGMA 4WBBA 1AZDA 2WPDG 1BZKA 4B4RA 4Q1PA 1GSLA 2CTRA 1OURA 2LS6A 4AI0A 2Y6JA 4B8EA 1NJIW 1AR1B 3ZDVA 3TK1A 1O7FA 2WNVB 2WQ4A 4LA2A 3M3CA 3VLBB 5J7MA 4OQ8A 3CEIA 3CXHF 2PHXA 4TN7A 1JUHA 2F43G 3CCEV 5FYUA 4R9BA 3W59A 5JH7B 1H8TB 4QXBA 2ZGUA 1D4VB 2YIBA 2OW4A 4EKWA 2BJSA 4LOSA 3WD5A 4FMTA 1B35B 2XKOA 5LXTA 4MUVA 5KHJA 3OYWA 1OQ1A 2ZE6A 3F7VC 2AYHA 4L87A 4MGZE 5EC1C 4K8ZA 3RYCA 3KT1A 1YFXA 3KQ4B 3IGAC 1COV1 1SACA 1I3HA 2DCJA 2VECA 3E5UA 5T3NA 4BXSV 5H9QA 4YSFA 4EN7B 5GZEA 2K1EA 4JRAA 3DN7A 2VOKA 3K06A 4LWSA 3USUB 3T0DA 2WL1A 1KC8W 2PLV2 2KA3A 2R071 1UQXA 1W0JG 4L92A 3N9LA 3C7FA 5DMYA 3N4MA 2F4VB 3JAWA 5CVRA 2RS33 3UO2A 1BKZA 1F7YA 5CZKA 1WB8A 5JJJB 2WSVA 1P4RA 2BGOA 3SJBC 3ABLC 1VRBA 3E86A 1K3IA 3JD73 1FAFA 4DYLA 4RR3A 3KF3A 3RPQA 3VBHC 1AF9A 5BY1A 4COVA 2Q7EA 5KUKA 3URFA 4OVEA 5FZ0A 2XONA 1K42A 5J1XA 3ZPYA 3H8XA 5F2VO 3IBMA 1M4UA 2ZZQA 4LF9B 1VIBA 3OUHA 2WLMA 4DXTA 1JOPA 3RMXA 1GZWA 4MTGA 1VLNA 5J2TA 4PIXA 4BH9A 4M00A 4KI5M 2GMPA 3POEA 4Y1YA 3OBAA 3BA8A 1WLTA 1PK6C 3MICA 4MX3A 1IBMB 3MLJA 3UJQA 4C90A 1GK9A 3AZVA 4QPWA 1MABG 4GWMA 2BNOA 2Z2SB 1LJ7A 3JAKB 2W3JA 2LROA 3EQEA 4LO4B 3UO3A 5A3UA 2AZ5A 1U97A 4O4HA 4PI0A 1TME2 1UXZA 4KWKA 4OUMA 5BZBA 1DQ0A 2EZOA 4XDJA 3JB8A 4IYIA 5I8SA 1ZRCA 1Q3EA 1MSWD 1OT5A 4EE2A 1JA8A 4D7YA 1DGSA 2JG8C 2BUKA 2W47A 4QD2A 1JBCA 1S72V 4D6RA 4DUZO 4N53C 3RZZA 3CC2V 4Q0QA 3JSNA 5L3BA 4GIQA 2HH9A 1JOYA 1CAWA 4Y20B 2V09A 3D36C 4MG2A 2XH6A 3GBWA 4WM8A 2VVEA 3IAPA 1PNFA 4Q0PA 4P5YA 4RHV1 2X10A 3I2GA 5BNOC 1CAUB 4YVWB 5FBZA 4IESA 2ZQMA 1QJEA 5FZ1A 4QXHA 3ZRSA 3FMGA 2NN8A 1Y6XA 4YW7A 1QNYA 1KYOF 1V6KA 4UCSA 3OGJA 3KZ4C 1PGSA 2RMU3 1Z5WA 5KHKA 2RM21 2PUSA 3HQRA 4Q26A 4R52A 4QAWA 3BB6A 4QHBA 3RW0A 1XNQO 2GC1A 2EF6A 2CWSA 4NHMA 4QQOA 5FYTA 1RUI3 2VZVA 3NV4A 3P3PA 2Q9LA 5GZGA 1RUJ2 1U5ZA 4YWAA 3SGIA 1VQ9V 5LY1A 1JVMA 5BNPC 4IHJB 3AP6A 1RUD1 4UBHA 2OCCB 1Q82W 3AMNA 1KDKA 1NAEA 2ZAHA 3CWBH 2Q73A 1IHMA 2Q68A 3F2ZA 3ZMTA 4X1KA 4IERA 2HVJC 3LEIA 2WLHA 3ABMC 2QTSA 2IUWA 3PU3A 2X29A 2OYZA 3RYPA 5FKCA 3SH4A 4OFGA 3MW4A 2DWEC 1G9CA 1NLRA 1POQA 2ZNIA 4ARYA 1E5RA 2W39A 5HCFA 3OBZA 5LWBA 3ZDSA 1RMU3 2D3OW 4P9JA 2VPVA 3WG7B 3WG2A 2XNDG 3ETQA 3WUDA 3OD0A 1N34O 1ASJ3 2Q30A 1ZBA2 3AL5A 3I5DA 3PDQA 4K21A 5IJ9A 2RQ6A 4B29A 3O0VA 3HB3B 1K73W 3J8F2 4CS2A 2RDCA 1WCDJ 5BNNA 4JI1O 1KECA 3INAA 5K4LA 2W2IA 4CZZA 5L3CA 3U78A 3V0AB 4UFZA 5DQ0A 3BTAA 2EIDA 3WF3A 5EQUA 1VBB2 4PF1A 4B3TO 1UOFA 4IQPA 3APBA 1NZIA 4QU2A 5C33A 2UUAO 5DXDA 5SV5A 4LNUA 4LO6B 1KS4A 3UT5B 1SF9A 5B4NA 5GLWA 1H1MA 4DUZB 2YUEA 3WHUA 4XBFA 1W6OA 3WHTA 4NXMO 3TETA 4XJ8A 2H6CA 4LCUC 1Z7S3 3C7HA 3KSCA 4JQRA 4UCOA 3EO6A 4DV0O 1SQGA 1X4TA 3NR7A 4ONUA 2QWOB 1H4HA 3I2DA 2FKXA 5FPAA 4L97A 5FMOS 2PTMA 4I0WB 2VTXA 2JGDB 3RYRA 2E63A 3I97A 3KZIZ 5GTHZ 2CYFA 2X5IC 5JVDB 3HKBB 4BCUA 4BIUA 3ACFA 4GWJA 1RUC1 1AP6A 3BVCA 3DECA 3LSSA 3H0OA 3JD71 4AW7A 4O4IA 4OPAA 3OUJA 5F8PA 5FZKA 1KFXL 2YICA 1UMHA 3MF9A 2F66C 2YY1A 1QU0A 4R9DA 3VUOA 1QJZA 4AFMA 3KCCA 1ZZ8A 1VMFA 4FFKA 3ZXKA 2ZKLA 3J81N 3WR0A 1XNQB 1UYXA 4QB2A 4Y3OA 4ES8A 4X1YB 1SDDB 1CZSA 3KCYA 4NAOA 5I0RA 3WNOA 3ORJA 4IUGA 3HOBA 4GYCB 3AG1B 4DPNA 5DECA 2NNUA 3ZHRA 1OOPB 5CISA 3O1SA 5DEDA 2P6JA 1DGWX 4MXWB 4LK6A 4Y1XA 2NN4A 3H1IH 2QZ2A 1RVF3 5JUVA 5CBGA 2XASA 1Y76A 1W8FA 4QGPA 4GAZA 2IJKA 4IEWA 1YYNA 5A1LA 2HWF1 4MGIE 3NNMA 3BUCA 4E2SA 3SPCA 4LPLA 2VG9A 1XEQA 1NTZH 2DYCA 2Y4UA 4JVAA 2J1EA 4AILC 1WA6X 4XUQA 2IU3A 1FI2A 2AR6A 3GDBA 3BEHA 2VXJA 1UX6A 4JHZA 1R092 4UCTA 3LDCA 4RGKA 4YW2A 5FYYA 4XF9A 2EINB 2V4VA 3VKFC 1N34B 2IFWA 4YGCA 1BL8A 4UUJC 5CB7A 4ITCA 4P14A 4R9AA 2KG7A 1JU3A 5CA1B 4GMP1 4N90A 1WW4A 1F4AA 1GFF2 3R6SA 1UF2C 4LF5O 1AVMA 1URFA 1QF3A 1CJDA 4JI1B 1RSOA 2P4VA 2A3XA 2VZ1A 2NLRA 5C5UA 2J1TA 4UFKA 2BTQB 3Q8CA 1KJRA 4JDNA 4Q4V1 5FZ8A 3ZYPA 2QQNA 1GV9A 4B3TB 3VBBA 1WBLA 1OF4A 1M06G 2VTFA 2ZBJA 2HBUA 3D8CA 4C0BA 2UUAB 3B93A 4OQ9A 1G4YB 4JGZA 1W04A 5G05L 2LGWA 1RUI1 3P30A 1KP3A 3OSDA 1YHFA 4NXMB 2AREA 1L7LA 4HPKA 1KKDA 2E9QA 2A3WA 3VKMA 4UFJA 2ZMNA 2Q0OC 1Q43A 1GR3A 1RUE3 5L7OB 3LDEA 3HN1A 4DV0B 5BNOB 3OCPA 4LKEA 2RMKB 1UZWA 2QCSB 3NV3A 3IPVA 4PV1B 1IG3A 4DR1O 2NLJC 3DGTA 4MXVA 5KA6A 5LY2A 4GUNA 2XPJA 1TQ5A 1W2TA 2OVUA 2NP0A 2QQLA 3ES1A 1UMIA 4EFBA 4O9GA 2ERFA 3NJYA 1F8VA 5JCOA 3VBSC 2AHYA 2FTKA 4FPEA 3WEZA 5F5AA 4DW0A 1EZVH 3OFNG 1LHOA 1OZ0A 1GP4A 4ISRA 3MIGA 4UW3A 5FYMA 4HAMA 4FO9A 1IQDC 4RA0A 5FLIA 1K12A 1FMD3 2QM4A 4OX9O 1S76D 3Q8FA 2VMDA 3GCWA 2JICA 2LRPA 2XJTA 5F2WA 5E6HA 4LORA 3LAGA 5E1RA 2XQRA 1HV1A 1HRI3 3U75A 3EXAA 1EUTA 4KGGA 5FYBA 1K5JA 4ZZ5A 2VWJA 3SCFA 4NR1A 2W95A 2PHTA 2YUAA 2C9KA 4IV3B 4KWJA 3IFXA 4L8QA 2XJRA 5IW0A 3E97A 4YFWA 4DMIA 1KFUL 1R1ZA 1VQLV 2HWD3 1DFQA 2RS32 3K46A 3POJA 3T08A 5HFLA 1FXKB 3VQVA 1QEXA 3F5TA 2EA7A 2AC1A 2TEPA 5EIBC 2P4KA 5FZ4A 4MVSA 2R70A 3M8AA 1SCRA 2LUWA 4FLTA 3EXUA 1S2BA 2E5LO 4I4TA 2R30A 3SEPA 3B9CA 2ZGQA 3NV2A 1VF6C 2WQZC 3TWIA 1Z7S1 1M57C 2OT5A 2OZ6A 3APOA 4HBNA 3KD4A 1E79G 1PVC2 4YZ4A 4TUYA 4B3MO 4LF5B 4YARA 1VQOV 1W6NB 4NTWA 3WXPA 3GXUA 2XLAA 1MEC3 1ZRFA 1GH6A 4L9BA 4S2GA 1YFWA 5EYXA 4ZHQA 2PI4A 1K4CC 4FQ4A 1FOD1 2WDBA 2WLJA 1RUH3 4LKDA 4CDQA 2PAEA 3SJCC 4XXAA 3HT2A 1ENRA 2G9GA 3TRSB 1HNZO 2QQJA 4KQ7A 4GMP0 3OT7A 3TXSA 5CG8A 4H7LA 2I74A 2DYRC 1QH6A 5LMUO 4UCRA 1D2QA 2VMCA 2Y6LA 2BE3A 4CP2A 1E57A 1OFSA 5H6QA 3O65A 5JH7A 1H8TA 2Y69C 1NY72 3CJIA 1L0NH 1QR8A 4L2NA 3OGCC 1ULEA 1QQP1 2WS91 4RS5A 3AKTA 4DR1B 1L8DA 2P4EA 2GU9A 1WCQA 4MGKE 3FKSG 1DLBA 3FD9A 3SHRA 1B6QA 3WV6A 1Y66A 2VZTA 1LR1A 4EN6B 2VUJA 2ZJCA 2CGPA 5DUUA 3ZMOA 5JXJA 4IEQA 3HMYA 2XBO2 1GM7A 2ZDIA 5CFDA 4CCEA 4UFHA 3PLQA 3A21A 3J4UH 2AXTZ 4LEJA 1OXCA 1C5IA 4B08A 4HG6B 3WQ7A 1PV0A 2DDUA 2CGOA 1A6CA 3ZFEB 2C0ZA 2EIMC 4OX9B 4PDVA 3CO2A 3BA9A 1W28A 1BEV1 5A32B 4AI2A 2W91A 1HB3A 1GMGA 2Z3YA 4A41A 2RHPA 2HEYF 1LCLA 4XURA 3OEAA 3CC4V 2V1DA 1MPXA 4A45A 2QEXV 1GOHA 1GKFA 1V55B 1QDCA 4MGSA 2VQFO 2CAVA 4YLZA 3DXRA 4A2UA 2ZACA 3R05A 4NAMA 3TEYA 2KR2A 3G7DA 3R0RA 4YG6A 2IJJA 3DKQA 2BGPA 3AYAA 1DQ4A 3OTOO 2YPJA 1VBD3 1KS5A 4HZFA 4QXKA 2X6CA 4K35A 4NTXA 4BDVB 2E5LB 2JG9B 3W7TA 3WG4A 4UXAA 3HJRA 3VBRA 5T55A 2UUCO 4G28B 4I0BA 5LP6B 1UMZA 3RYFB 1OF3A 1RUE1 1GICA 4LP8A 2OA2A 1VQ7V 5C8YA 1O91A 4UVBA 4GWNA 4W50A 2X0LA 4EN8B 5LA2A 4AFBA 4B3MB 2WWSA 3O1UA 4JV4A 3ILFA 2R9IA 3B7MA 2VAUA 5FZOB 2BU9A 4YG0A 3TEZA 4PA7A 1S1AA 4YPJA 1S5LZ 3HPLC 4QT6A 2PHDA 1ZBE2 4N43C 1P8JA 1EAH2 3OPWA 4QX7A 3L9DA 5B66Z 1D0GA 1DZQA 3BIEA 2YXYA 5FMCA 4F3JA 3WUCA 1HNZB 3SKVA 1MVEA 4C1XA 4AOCA 2FB5A 4KMQA 1AR92 4OUEA 5LMUB 1AVBA 5FZGA 5ABJB 3B9IA 4W4ZA 4FSJA 3BFRA 3N9QA 2JX9A 3UKMA 4XJUA 3DYOA 3WB2A 5C4WB 4AGGA 3O7OA 4RD7A 5FIXA 2H6BA 2ADQB 1HRI1 4IGQA 2R0HA 2E7AA 2A7WA 1H2MA 1MZ5A 4DUWA 4XBQA 3N2GB 4DR5O 4X8AA 5A70A 2VL4A 1S5HC 2XXZA 3T1LA 2HWD1 3M99B 1J5EO 3CXCU 5KC5A 3J7AU 4JYBA 1MS1A 2GNDA 3CKHA 3ZEDA 2CUGA 3AYDA 1UYZA 5FP8A 2ZABA 4HNAB 3OAAG 1BK0A 1W8NA 1O4ZA 3WDXA 1PO23 4OZXA 5EWSA 5JZGA 3BPZA 1VAMA 1MQTA 2WT2A 3HKEA 4NPLA 1SA0B 3IDBB 1H2KA 4P9LA 3BODA 3A0HZ 3OBTA 1O5UA 4P9YA 1TMF2 2R1DA 5K0UA 2D3PA 3I49A 1X8EA 3JATB 2WUHA 3ASNC 3GF6A 3AP9A 1UKRA 3UL2A 1OJHA 4SLIA 3WU2Z 5JSPA 1MG1A 4UAPA 4LBQB 1GNYA 2VQFB 2WINB 1JU4A 4GJZA 1AJOA 1XYPA 3JB4C 3D5OA 3RMYA 4CDUA 3FX7A 1IQAA 1JMKC 2OXBA 1XILA 3OTOB 1TGOA 1ZYBA 5FZ9A 1R1A3 4DIQA 3R66A 1SKVA 4DV4O 4D6SA 1CONA 5JXGA 2H0BA 1WN7A 4EB6A 3RYIB 1M57B 1NE6A 3ACGA 5AFEA 2D6LX 3CMAV 2W1WA 2UUCB 4J1WA 4FPHA 5FYSA 5LGNA 2WLPA 4XF0A 5FP4A 4XJ9A 5EJZB 1RUNA 1QLEC 5LBFA 4V2VA 1RHI1 3ETGA 4BW5A 4CP9A 1N1TA 3CCQV 2RS12 1QWRA 2EALA 2P5OA 3OY8A 3IAYA 3W21A 4C7UA 5EV7A 4LK7A 2LW1A 4HK9A 4NN0A 1F31A 1PIV3 4ZXKA 1C1LA 4XMAA 4LUKA 3UT5A 2A70A 2RR11 2JDUA 1JYVA 3GZUC 3I2HA 2JVDA 3WQBA 4FAGA 5IWFA 1J84A 5IYCO 3DGEA 3H01A 5ERLA 4WZCA 1IPJA 3NJVA 2WLIB 4CUGA 1UWWA 4JAUA 2JGDA 3B8MA 4LFCO 4A42A 1HNXO 1AJPA 4ICGA 3ZHVA 1NS1A 3HKBA 3MHSC 4GX0A 1AL23 3TN91 1V6LA 1BS3A 3SPGA 4JGYB 5KA5A 2ZIOA 3DCQA 4TSVA 3AG4B 4MVRA 1FPN2 1AR72 4DQAA 1R3LC 3B69A 4QGMA 4DR5B 2P5BA 4QPYA 2IXHA 1WA8A 2GBOA 2EIGA 3VZKA 3OUIA 2EILB 2RCVA 1QVGU 4L0PA 1LHWA 1J1LA 3SYAA 2FMDA 1J5EB 3WLUA 2B8MA 3WT3A 2XHBA 2VUAA 3MD0A 2XDVA 5FZLA 4AHCA 3E22B 1FYUA 5LB6A 5A6XA 1YFYA 2HLEA 2M7WA 4J1XA 4MGYE 5FRAA 2JD9A 5K9YA 4DV2O 1WLDA 1JH5A 1AJQA 2E7QA 3MUZ1 1MZ6A 4UF0B 1W03A 2O0OA 1AR83 3RRDA 5ACA1 2B5UA 4K8FA 2WT1A 1ZZBA 3ZYJB 4QE7A 4IEVA 2R32A 3LIGA 3FYIB 3GM8A 3ZYHA 1DBNA 5EYYA 4NUBA 1ODMA 2A9HA 5CG9A 5B1AB 5F3EA 1D2SA 5CB4B 3VBHA 2WYFA 2JKBA 1UZVA 2EXJA 3RQ0A 4BXFA 4A3ZA 2WFPA 3LQCA 4D8MA 4I55B 1US2A 4NIIA 1SBDA 3KT7A 2EJRA 2LP7A 5J96B 1VPHA 2WO2A 1PZ8A 4QX5A 5FMDA 4P2ZA 4JI6O 2HJDA 5EC2C 1TAEA 2HBTA 1E1QG 3P6BA 2ZKNA 4DV5O 4DO0A 4UB6Z 4OYUA 2WO3A 3O1VA 4DV4B 5LBEA 3KHBA 3AZYA 4I09A 1PK6A 2CHHA 2GH8A 1Q5OA 3HNYM 4BLIA 1COV2 2W9XA 4PJYA 3LKJA 4Z92B 5LMNO 3KV4A 5IFTA 3H50A 4LFBO 2BTVC 3JQXA 1UZZA 2Y6FA 4AVSA 4JI0O 4YXWG 2DU0A 3IDAA 3KG2A 3LF7A 3CP1A 1ULPA 1OH3A 4XFCA 5DPNA 5GTIZ 1YITV 1YI9A 4I50A 1CJPA 1LEDA 2JG8A 4XCBA 1XE0A 1S0BA 4AI1A 2ZD9A 4N53A 1MEC2 1J3QA 3QG5A 5FDBA 4AG4A 4IYHA 2J42A 1RM1B 4ZHNA 3ZYFA 2F23A 4CUBA 4OHWA 3D36A 2LQTA 4SBVA 5F1RA 2VZSA 3ES4A 4FBFA 1GLHA 3W20A 4TT3G 1W8TA 4JYYA 3LSEA 3K5LA 5BNOA 1LNQA 4KFMA 1X7NA 4AQ6A 3RWNA 1D4M1 4GH4C 1W3VA 4LFCB 3B77A 1PGW2 2VM9A 1HNXB 3H9AA 3R4SA 4E2QA 1GNZA 3R4DB 4HKWA 1YXWA 3CIHA 4EZ4A 2HWB3 5GLVA 3WDYA 1M5IA 2A73B 4QU1A 2R6QA 3VKNA 3M3OA 1IBKO 5CA6A 1NI8A 1SG3A 5F37A 5FYVA 1CPYA 2WRAA 1XJAA 1AXKA 1OCZB 4QQLA 3IKWA 3VDDC 5K1XA 2XJUA 1NLQA 2QDNA 1R64A 1B06A 1R1A1 5BNPA 1AJKA 1EV11 5GW7A 3KQRA 3T1YO 1WD3A 4O2BB 4O7XA 1GUIA 4J41A 2QQMA 4XDQA 2DVBA 5DM6V 1AHSA 1XNDA 4AGVA 4FPGA 2B9ZA 4DV2B 2YFUA 4MVOA 5JXIA 2RN9A 1K33A 3FJSA 1D5AA 2XT9A 1K5SA 2QA4V 1W6PA 4AVBA 1W6QA 5IJ0B 5DUVA 3RI9A 2QKCA 4X20B 1ND2B 4XPVA 1FFXA 4XHXA 5FMBA 2OUHA 1DLLA 2D6OX 3C90A 3AP7A 4D7TA 1V6JA 5A6YA 4JDMA 2JDAA 4J10A 1SESA 1JX9A 4JI6B 5GKAC 2IC1A 3ZHTA 1NH2D 4JTDB 3H1YA 2YI9A 5JJEB 1VRH1 4DV5B 2R042 1NZ6A 2YEVB 2ZTNA 4RUFA 2A5ZA 2P06A 1C1FA 4PBPA 4AQ2A 2A1XA 3QCWA 4RGAA 2V5DA 4AI9A 2DFBA 2ZEYA 2P90A 4Q4X2 1EN4A 1VBC3 1PO11 5LMNB 1C3HA 3FLTA 4LFBB 1QLEB 2BCCH 1UZYA 4W8JA 3UKNA 1I6XA 3ZRVA 2GZWA 3ZMNA 4JI0B 3W5NA 3AXDA 2F1MA 3LA2A 2XAFA 2ZXWC 1UU5A 1S2EA 4LF6O 4EZHA 4YZ3A 3S6PA 1JHJA 1RUG2 5C3RA 3UNPA 2Q69A 1HB4A 1K3EA 4O4LA 2RJLA 1LODA 2V72A 2FDHA 1XYNA 3AJZA 1DU3D 5DABA 1KD1W 4AHWA 4M0HA 1EYBA 2VW2A 3E5QA 3D6EA 4LBOA 1S0FA 4J6GA 1QLNA 2TBVA 2CU5A 1LB2A 2CSGA 5A33B 3OPTA 1LGNA 1JFFB 2X5IA 3I54A 5BY5A 4YW6A 5KWRA 5J48A 2GHYA 5A3OA 1POV3 3BVOA 2G9ZA 1OFNA 1ZRIA 3O1OA 1I5PA 4WM7A 3HIFA 2H8PC 3I3BA 3IT8A 2XKPA 3VDBA 3RDIA 1VQKV 1IBKB 4AE2A 1HRV2 2QR4A 1HIXA 5EXOA 3NMBA 5AC92 2IM9A 4HT1T 2RJ2A 3ZS8C 4Y5SA 4JI8O 4C1WA 2EJ7A 4O61A 3DUIA 2XQXA 3QH6A 4I3GA 4AAXA 3T1YB 4WFAV 1ND3C 1Q6IA 1VIWB 5DZEA 1YIJV 3CCSV 2F17A 3RVYA 4RQPA 3CJHB 4G4FA 1HDJA 4AEDB 3K4AA 4DV1O 4ASLA 4DFSA 1DF0A 3CB2A 1G9AA 4RQFA 3I2IA 1NXD1 2UY9A 2CTWA 3WF4A 4X1IA 1N47A 5FZHA 3VKLA 1ZAUA 5H9CA 3WW3A 1RUC2 3G71V 2NMOA 1QJU1 5L19A 2JK5C 2NQYA 2ZGMA 3AG2C 1STMA 4I0XB 5LBQA 1OCOC 4JZGA 3N35A 2GSMB 1S2KA 4MGTA 4PBOA 2IH1C 3NWKA 5FY5A 4EYUA 2N74A 1CAXB 1W2OA 3GBGA 4FZ1A 1KUQA 3KVAA 3P3NA 5H5NA 1ULCA 4GKYA 2VMFA 4YJ2A 1GP5A 3T4VA 4TV8A 1EN6A 4PDWC 3JASA 4U36A 5JSOA 4URAA 1XHZA 3SDLA 3ZMZA 5FZOA 5JIAA 1M56B 2UWBA 3O9OA 1IG0A 1SLTA 3O1RA 4UFLA 4LF6B 2CNAA 4YVSC 3WNMA 5LXTB 2HWF2 3JAMN 1AR63 3OYWB 2XOKG 5EJ3A 2ZHLA 2ZGNA 4YNIA 3E35A 5J36A 1IXMA 5FZBA 2ZX2A 2I2SA 2ZEWA 5DZFA 4ZBMA 3HNBM 3N36A 2W0XA 1WUVA 3I8TA 1XE7A 5JOZA 2QM8A 3RYCB 1I5XA 1R1BA 2G9FA 3JUUA 5B3SC 4Y1ZA 1NTKH 2YMZA 5L3DA 5GLZA 1GRJA 4COYA 4UI9L 1QJY1 3BHPA 2VY0A 4LC1A 3AMHA 3ZBHA 1OCRB 1MOFA 4Z82A 1NLSA 1CZVA 4GH4B 1YSCA 2ARXA 2XWBB 4Q4Y1 2JEMA 4LWSB 1XQNA 3WG3A 3MGUA 1HV0A 3N7MA 3AP5A 3LGRA 3C3TA 1QKQA 3JAWB 3K5MA 1NCQC 3VBSA 3U4SA 3GJAA 2GAUA 3NKTA 4E4DX 1SLCA 4X8NA 5GLUA 1FXZA 3N7KA 3POGA 3SPHA 4RR3B 5C93A 3BI3A 4Q4V2 4HNAA 1S3JA 3RBZA 2QWRB 2RS53 4QGNA 4PLNA 5DDJ1 3L73H 3V0BA 3SMHA 4AQSA 3ACLA 3ZFGC 1Q8OA 1QNWA 4JI8B 2QWNB 1OI6A 1APNA 1UAIA 3VZNA 3TXQA 1VQ6V 1VBA2 4K6BA 5F5IA 4LF7O 1PGL2 3H1JH 1GZWB 1Q8IA 1DCSA 2DJVA 2ORXA 5J2TB 3WDVA 2HEWF 3JATA 2ADPA 2R7EB 4YM0A 1W8UA 3BCWA 2PFWA 4LFAO 3V65A 4FPJA 1S0EA 1VBC1 1RUOA 5L3FA 4DV1B 4YHHO 1W9WA 2VOTA 3ABKB 5KAIZ 4LBQA 4O9EA 1NCRC 2KKWA 1W05A 2VULA 4O4HB 3SXWA 4AFAA 5DAQA 3CRRA 2GDSA 3JARA 2WZ8A 4IL6Z 1YRZA 4FI9A 4YGDA 1A3KA 2P22C 2HWE2 3DKWA 1UFIA 3DSQA 1WMXA 1VF6A 4IGOA 1WPXA 4NRPA 1OA4A 1FS0G 1ZZ7A 2WABA 4I01A 2P6HA 3DC5A 3Q8EA 2Q8VA 5FO9B 4Y24A 4XFGA 1QXRA 1SLAA 4WM8B 3GZTB 1Y74A 3PMSA 1RXGA 4IEYA 2UYAA 4DY5A 1XPWA 2ZINA 3ML0A 2AH2A 3MIHA 2D43A 4PLMA 4MW8A 4NPRA 2VXRA 1IVSA 2Q8CA 1POV1 1JZ7A 4OI2A 3X2QC 4PQQA 4YFZA 1ORQC 5GJ6A 4LF8O 1S0GA 5GALA 4LXLA 3KGZA 1QJX3 3FUOA 2TUNA 2PN5A 3T2MA 1K7DA 2Y4TA 2F95B 1ENQA 1PNKA 3VDCA 1KDMA 3TBDA 3R65A 4RWUA 1JYCA 3ZFFA 1REDA 2QDOA 4PDMA 1U5XA 2PLV3 5BXZA 2A3YA 5LA0A 1BE3H 3K03A 4JTAB 2QZ3A 2ES3A 4XIKA 1XQ8A 2VWKA 3WDWA 2JE8A 4NTYA 3I3EA 4C91A 4WFGA 1TVGA 4TZDA 1LHNA 2VTXJ 4GZ9A 4JKMA 4Y33A 1UJWB 4MV2A 1J95A 1WNSA 4X1KB 2EIBA 2WAAA 4OPHA 2LW7A 1AI5A 1TEIA 4PA6A 3BCCH 2CDOA 1CP9A 4PA4A 4S2HA 3RGBA 4BM8A 3MHHC 4R8CA 5LGTA 5JQGB 1G9BA 4DOUA 3K51A 4A7KA 3TEWA 3LPGA 3THCA 5F9TA 2YXHA 1FOD2 1W8HA 3GNEA 1R082 4AI3A 3MFCA 4BA6A 4D69A 2H0VA 1Y9QA 2RDSA 4FLWA 5T54A 2W1SA 2N04A 4JKLA 2WJSA 5ANQA 1AXZA 4W65A 5KXEA 1W99A 5T5PA 4UFIA 1ZVFA 3WW4A 3O1MA 4BJ0A 4UF0A 1KMIZ 5IJ9B 4LF7B 3UYJA 1TME3 3PN1A 5DAXA 1NQTA 2O14A 3GGLA 2LW8A 1SCSA 3NNJA 2B46X 3NNGA 3NVCA 4LFAB 5BNNB 1W39A 2OTJV 1XYOA 2QSAA 4YHHB 1DYKA 1RUF1 2XHNA 5HCAA 4I7ZB 1ZA4A 2XJPA 3RI8A 1T6GC 3OUFA 1QQP2 2WS92 1SLIA 2CV6A 4I55A 1PMJX 1JJOA 3K0DA 4JI7O 1DQ6A 4KBZA 5GLTA 2W1UA 4DO2A 4XFBA 3U10A 5EBWC 3KV6A 2GMEA 3KKYA 3IAQA 5FY0A 1PX4A 1W8WA 5F6KA 1T2XA 5A2QN 3S5AA 4FXKB 2ZGRA 1LHVA 4CDQC 4PD4F 1HXS1 2DUOA 1OCOB 4A5UB 3H7JA 2OTLV 2BRTA 3H7YA 3SQOA 3BKZA 1BMV2 4JTNA 3QO5A 4JYAO 1G7YA 3ZXLA 3MV11 3SC7X 1WAZA 3CNAA 4CCOA 1LUVA 4AEJA 4I02A 2UXDO 3M7MX 1X82A 1MS5A 4QX3A 4IW3A 1BEV2 1SDWA 4FOQA 5EIYB 2GV9A 4EV0A 5F39A 4Q20A 3FZ3A 5LA6A 1JZ4A 3GJBA 2PA7A 5C8CC 5FTTC 2CAZC 4N43A 2ZCEA 1XE8A 5JMOA 4LF8B 5HBAA 2A71A 5FNVA 4JI3O 3T3YA 3N7JA 1RUJ3 4ZOLA 4O4IB 3WNXA 1EN5A 4QPGC 3LSDA 5FZIA 4AK3A 3VBUC 1CVNA 1O8SA 2RS51 5JJNB 5KHGA 4QE9A 3ZCCA 4AQYO 1GM9A 2RDQA 1FNYA 2A3QA 5JVVA 2MEV1 2E26A 5B3SB 2ARAA 1I1EA 2WWJA 1YQCA 2LJ2A 2EIKB 1XL4A 2SLIA 1W9FA 4NB5A 2GNMA 5C9AC 4CCCA 3F7YC 3EB7A 4FFGA 1YWKA 1S0JA 4DR6O 1AI4A 2O8QA 3I3MA 1Y76B 1WCUA 1QGLA 3IZOA 4XYXA 2C26A 4LLFA 2WFF1 2QQWA 1KITA 1AI6A 1K8AW 3K9AA 2B9VA 3CX5F 3CCUV 2YB7A 3CZUA 4NJ4A 2C1FA 1HJFA 1PP9H 4CYDA 4F8AA 1QXJA 3ASIA 2P1BA 5EHDA 4FQZA 2WA4A 2BYVE 3NAPC 4QX2A 3ZYIB 4QNHB 1ACCA 1IOAA 1VBE1 3WF1A 3SYPA 1P7GA 1LULA 1PMHX 1VBB3 1AYN2 2KG7B 3CSXA 2W52A 1DHKB 3QACA 5CAZA 5JR2A 4BR6A 1RSOB 4P9PA 3I4IA 1NCRB 5CNAA 1J1TA 4OUSA 3B01A 1MNGA 2Q7HA 3JD1A 1GQPA 5HXVA 4GX1A 2ZA9A 3SKJE 4JI7B 3LOIA 2JDPA 2ZE5A 2DYSC 1KQRA 4LBLA 4CEWC 5I8YA 4L99A 1XB9A 3LFMA 3IN9A 1O3SA 1YJWV 4RYDA 2IVJA 4N23A 5KX5A 1NX9A 2D6MA 4J7ZA 4GD4A 1C8M1 4GCZA 3VN4A 1JCHA 3NJXA 5D1IA 4D94A 2YEVA 5KHHA 2PLV1 3N9PA 4JGZB 3KHCA 5IYDO 2XVLA 4HL0A 5IVCA 4HPKB 2VQEO 4GX2A 1XREA 1YHQV 4A3XA 1H8EG 5DAVA 4JYAB 1UU6A 3VD9A 2IXKA 1K9MW 2YDEA 5LHGA 4JZRA 2UXDB 2G19A 1VEWA 2FCTA 1MR5A 2WZEA 1EFRG 1OCCC 1Z0HA 1U0AA 1VMJA 3LEGA 3A22A 2ENRA 1HX6A 1RL3A 4Q0VA 5CU1A 4KG8A 5LASA 3WZ1A 1CPNA 5B1OA 5FLXN 3QH7A 4JI3B 5C7GA 3QO8A 4B1LA 4ZU5A 1ZREA 4NIHA 3WDTA 4OXSA 1GOGA 1Z2GA 2ZS6B 4QHOA 3B09A 2DF7A 4TLFA 4AQYB 1N1SA 2D6NA 2OQ6A 3OGRA 3B4SA 1J3RA 4ISQA 2DN9A 3ZSKA 3ACHA 1TME1 5JXHA 4LE3A 2HVKC 2Q1ZB 5E8AA 2WA3A 2WAMA 1ROPA 3POYA 3ZIXA 5EBLC 1UPGA 2P3KA 3N9MA 1NBMG 3ICXA 4Y5Z0 2VS0A 2JB4A 4OCTA 3T2PA 1RHI2 3WP5A 4MVTA 1R093 4DR6B 2EULA 3A2FA 2OIGA 1WKYA 2JB8A 1N3QA 5C3QA 4FM0A 4CDUC 3ABTA 3SITA 2RR12 4FFIA 4O4JA 4D6TH 1VARA 4M3CA 4FLUA 3ZSLA 1VJ2A 1YTFD 3UKVA 4I4TB 5C6CA 1AR5A 2GN3A 1RJ8A 3VHPA 4X62O 5IDJA 1OUXA 2ZGKA 4CCNA 2AEZA 4IGPA 4TXWA 2Z4FA 5FY8A 3OMNB 1S0VA 2J1RA 4IIJA 4UW6A 5CA0A 1VF7A 3HN3A 5FZ3A 3ZXGA 1NKDA 1G6NA 4XVHA 3SCGA 2W87A 2DCYA 3V56A 2HLDG 1THZA 2GP5A 1PNLA 2C9AA 4ZHQB 4I0XA 2PF4E 5FPVA 3S3WA 2EBOA 2P3IA 4KU7A 1YCIA 4LJHA 4JZ2A 2ZAAA 4YW4A 3RZMA 1YI7A 4JI5O 3T0BA 4CDQB 1CAXA 3L71H 3K3OA 1MS0A 3L2YA 3WCRA 4ZIBA 1WA4A 4RFRB 1M9NA 4P5HA 2BWAA 3BAAA 4MH0E 3EVKA 2DOSA 1F23A 4JI2O 2Y60A 1VP6A 3ZXDA 2J1AA 5SV8A 2VQEB 1LGBA 1Q8QA 1CPMA 4M3CE 4QMAA 4NHKA 3CJIB 1MS4A 2WNUC 4WVZA 2PZSA 1BBT2 3J7HA 3LA3A 1X9TA 3HPNA 1VB2A 4CEYC 4XACA 1MA1A 1R3KC 1RXFA 5J2UA 4RS5B 3T2QA 5EK0A 1NQJA 5ACA2 4DNYA 3HBKA 5HCHA 3PUQA 4Q2FA 1HW5A 1ZBA1 1UD1A 3H3LA 5FQ0A 3TGUH 5D5QA 2LFSA 3VGIA 1UYYA 3OEEG 1QJX2 3NRUA 3AZXA 3J8F1 5KXCA 4IGGA 2YFZA 5CFDB 3BOWA 1HJGA 5FPOA 3AJYA 5IE9A 1UY0A 4GH4A 1JYWA 2W6IG 4IV1C 3JALB 2PQQA 5EPAA 4H14A 3JD4A 1LGCA 2DWDC 5FZ6A 2C24A 2K2SA 2OX0A 2ZR3A 4YYOA 1F2NA 3L74H 5C9AB 3DPRC 3UJOA 1LOEA 4CRQA 4DXRA 4QPIC 2PHWA 2ZX4A 1FT9A 2XJVA 3U0ZA 4XHBA 4KP4A 3I7DA 4FVVA 2EVXA 4CP0A 3DXRB 3I3DA 3UGHA 3QOPA 3JBG3 3VDDA 4CDWC 1JR9A 1OUSA 2BOCC 2ZM6O 1M90W 2Y6HA 4XFHA 1Y67A 4EFEA 4AF9A 1PVC3 1VQMV 1QHDA 1ST8A 4CBCA 2IXIA 1YO8A 4OI1A 1V70A 2AEYA 2XUEA 4X62B 2BQPA 2E32A 3OOXA 2WSSG 3VBRB 1TNRA 1SQPH 1XDCA 2XAGA 2D5HA 4CPBD 1R6NA 4DINB 3ETEA 5C8YB 5A7WA 1D4M2 1F51A 3KWVA 1JOBA 4BQ4A 5IK8A 4W6WA 4H55A 2FDJA 1F4MA 1YVWA 2X6AA 1DG6A 1N3OA 5DUXA 2EIJB 4DUXA 2B1GA 4MTOA 1TUBA 2W68A 4GA9A 3I55V 5IYBO 3LD8A 2D3RA 5B2GB 4XETA 2DYSB 1W2NA 1AP5A 5D21A 3ZSMA 2K9ZA 2SBAA 2PXJA 5IFPA 2BBVA 3U37A 4JI5B 5J37A 1AYM1 1HWYA 1WW7A 5JIUA 2KSDA 3ZKYA 3A23A 3WF2A 4U3FH 5IT9N 4XDPA 4WBNA 4UFMA 1QJFA 4ZU7A 2Z5UA 2B7YA 1EV12 3K04A 3WG1A 2UUBO 1ZTEA 4JI2B 4OULA 3K75B 4J7JA 3DXUA 1VB4A 2G1MA 5E1AC 1BT8A 5ITZA 1V9U1 5HPOA 3AX4A 1WP8A 2DBIA 4CH4A 3NKGA 3G4SV 5IY5B 4Z1MG 4XFAA 2XBO3 5L3GA 4IXLA 4FFBA 1OCCB 2Y48A 1R091 4CSWA 2NMNA 4K3AA 2YYOA 2DU1A 2JKXA 1K34A 2AZ0A 1G9FA 4AVTA 4YZ2A 2BOBC 1F4NA 3AL6A 2JDMA 2WLNA 2JENA 2J1SA 5T5LA 4DXZA 2ZGOA 1PKXA 1UCXA 3ZX7A 5A1FA 5GZFA 1BHBA 1VRH2 5JZGB 1MQTB 2DMXA 2WQ8A 3HKEB 2MPFA 4GLXA 2ZGLA 3AMPA 4WVWA 2OYQA 4CCJA 3I2KA 1JUIA 4BE3A 1SMVA 2ETNA 5K0UB 1XXNA 4LITA 2E75B 2P3JA 1PO12 5JQGA 2JD4A 3GWKC 3CD6V 2IWGB 1BCCH 1AB3A 4FPLA 1VMHA 4DK1A 2EIEA 1F15A 4BIZA 1XOUA 1SFNA 2R0FA 4XUNA 5CEHA 4AFCA 4EWDA 3CJXA 1UOGA 2YIBD 4CDUB 1VALA 2ZM6B 2ITDC 4QXCA 4LO7A 1V54C 3O12A 2VUCA 2A79B 4M4PA 1ND3A 3MHZA 3ZN5A 2JXAA 4D0QA 3UESA 2FDIA 4EB6B 2IJIA 2AACA 1FYJA 2ZMLA 2VW0A 5B1BC 4OMCA 4OMDA 3D0SA 5IVJA 3FHQA 1SPPA 2QQIA 1CGPA 2W94A 2Y34A 4IETA 1AXYA 1ZBE3 2LTNA 3D0JA 4CP9B 2QJVA 1U12A 1EAH3 2A6VA 2WNEA 4HKLA 5CKNA 3OY8B 3VBOC 3AZZA 4CH5A 5D8AC 2D6KA 3SPJA 1Q6HA 3RZKA 4CS4A 1AR93 4TWKA 1NT2B 5LK5A 2WKKA 4IEZA 1L3JA 2QQVA 1FNZA 3CS5A 3G80A 3ZKUA 1YJNV 3M70A 5A1AA 4WVVA 1ENXA 1F5JA 2V4AA 2ZHNA 2FBEA 4X8PA 4PDWA 3VBFA 4K1ZA 2OIIA 1DQ1A 2UUBB 1VQNV 2ZX1A 1NVPD 2RS31 3MPPG 4JAVA 4LKSA 3CCVV 2WNUB 2A6XA 2YSUB 1XU2A 2PI5A 2FQPA 2ZGPA 4CEYB 3MLLA 5KLVH 4BQ1A 3LDRA 3EHBB 5FYZA 1GTOA 4WM7C 3TNPB 4YVSA 5BXXA 3LUTB 1NYWA 3G6JB 2VOWA 1SZXA 2ATKC 1WA8B 3RJRA 5K8SA 4NRQA 1UZ0A 2VUDA 4I0AA 4KBBA 4ZONA 1XU1A 3AC0A 3FX3A 5DG2A 3KV5A 5LBCA 1W6MA 1QJU2 1ULDA 2ZZJA 1TMF3 1PVC1 3CDZB 1HB2A 3GCXA 2AHZA 4UV9A 3K58A 2JDIG 1O59A 4M01A 4RQPC 1TVKA 4CU8A 3SR2C 2FDFA 4ZI7B 1HR0O 4QM9A 1NCQA 3VZLA 2KB1A 3VB9A 3CBNA 2MK3A 1T5EA 3QVNA 2VR4A 3ABLB 1UU4A 3LWCA 5DN6G 2VZUA 1QXPA 4QPIB 1NXMA 5JWPA 4DRRA 3VBHB 2C2AA 3O0XA 2Q6AA 3J80N 2X8KA 2R16A 2H94A 1RIRA 2IBZH 5FJHA 4JRLA 2DQ0A 3BTXA 4URTA 4LH6A 1SFPA 3C7OA 5A80A 3ZFGA 4P9GA 3NSTA 3C7GA 1EP0A 2VZPA 5CA3A 1Q86W 1NY71 2WIIB 5HV0A 1I08A 1DYOA 4QJFB 4UXNA 2PQSA 2RS13 3VHRA 3ZN4A 1I5YA 1GN4A 2UXCO 1PK6B 1PVXA 3SYQA 4NXNO 1KP2A 1JZ2A 3BYWA 1FAYA 1IPKA 2F4PA 3WB1A 1SS3A 1QJY2 4AI8A 1NCRA 3VQXA 1ZL8B 3RZLA 1BXHA 1LR5A 3H1LH 4Q4Y2 5A3PA 4LBJA 2YBKA 2XBO1 5A7OA 3ZM8A 4W4KA 2RMU1 2UXNA 4HYOA 4MVQA 4I50B 4OGQB 1WCKA 2JG8B 1ONAA 2VBBA 1OLQA 2JGUA 5FK7A 1NQDA 2YC0A 1R6KA 4GXLA 4N53B 2CTPA 4BQXA 2JE9A 4RAIA 5KHIA 2Q4PA 2WNVC 1UY1A 4BPZA 3WB0A 1PMIA 4NIDA 1DF4A 2NYYA 4XZPA 5DDJ2 2JECA 4LF4O 1PL0A 2HJIA 1OQEA 4GZRB 1FPN3 1AR73 3K59A 1R3JC 1XNBA 1P7BA 3FE5A 4NROA 2LM3A 4RUEA 3ASOC 3SYCA 1S0DA 1B35C 4Y26A 2K0GA 5EFUA 3CPWU 3FC0A 3PHMA 2P34A 4AR2A 1PL4A 3OJBA 4U7NA 4MHRA 2UU9O 1RMU1 5FZCA 4OI4A 3VZOA 4F4LA 1ULGA 1ZX5A 3RSJA 4Q4W2 2L35A 2NPIA 1ODNA 1ASJ1
chains in the Genus database with same CATH topology
1S55A 4YVSB 3JB8A 4ASLA 4DFSA 5I8SA 1DF0A 4LBQD 3S0MA 1ZRCA 1G9AA 5BNPB 3OD4A 1Q3EA 4D7YA 2MHFA 1XNCA 1REEA 1NXD1 4XXPA 1VRH3 2JG8C 2BUKA 4QD2A 4Y1VA 1JBCA 1DZRA 3WP3A 2UY9A 4N53C 1GZ9A 3RZZA 1W6MB 1N47A 2ZPXA 4HN0A 3LB9A 4Q0QA 4GIQA 5J09A 3VL9A 4LHLA 3VKLA 1CAWA 4NWVA 3WW3A 1RUC2 4Y20B 2V09A 2NMOA 1QMJA 1QJU1 3VZJA 1ZBE1 1PO13 1POV0 2XH6A 3GBWA 3M1HA 1W6PB 3AK0A 4YG3A 5L19A 4WM8A 3RS6A 1SQ4A 2VVEA 2NQYA 1PNFA 2ZGMA 1H9WA 4Q0PA 4RHV1 3DF0A 4C5WA 3MIEA 1S0IA 5BNOC 1VAVA 1H1IA 1RUE2 1CAUB 1DYPA 1OMIA 3CEWA 3N35A 1H30A 1W6QB 4YVWB 5FBZA 4IESA 1S2KA 2DCTA 4PBOA 3NWKA 2GNTA 3U07A 1CAXB 3FMGA 1NCQB 2NN8A 3CL1A 3GBGA 4ASMB 1N1VA 2R6SA 1COV3 1QNYA 4OHYA 1AR91 2CWMA 1V6KA 3P3NA 1ULCA 4GKYA 1Y3TA 2OUJA 3O14A 3VZMA 4OI0A 1OIHA 3OGJA 2WZR2 2VH9A 3KZ4C 4PDWC 3JBG2 2D93A 4S2FA 4CDXC 1PGSA 2DWRA 3DV8A 1G9DA 1OLRA 4U36A 1C57A 2RMU3 1G86A 5KHKA 2RM21 5JSOA 4XQWA 2Y0OA 4Q26A 5JOWA 4R52A 3BB6A 1W2UA 2FHRA 4QHBA 1F9KA 3WINE 5JIAA 1OOPA 2GC1A 2EF6A 2CWSA 3ZFGB 2ZCWA 4MXWA 3UKTA 4LA3A 4NHMA 4QQOA 5JAXA 2UWBA 1RUI3 4Z1VA 3I59A 5AFBA 3IWZA 3NV4A 4AEDC 1BBT1 5TSWA 3P3PA 1SLTA 2R49A 2XHKA 3B3QE 5GZGA 2CNAA 1RUJ2 4YVSC 2HWF2 2Y38A 1U5ZA 1FMD2 2B39A 2PELA 5BNPC 1AR63 3OYWB 4XF4A 5EJ3A 3AP6A 1RUD1 5DZGA 3LZZA 2ZHLA 2ZGNA 2DUPA 3CLPA 4YNIA 4UBHA 4DRVA 5J36A 3AMNA 1KDKA 2VGDA 2ZX2A 2ZAHA 2I2SA 5DZFA 4X6RB 2AENA 3N36A 2W0XA 3PJQA 1IHMA 1WUVA 3I8TA 1XE7A 4NWWA 5JOZA 1GQWA 4LO5B 4IERA 2G9FA 1HRI2 3JUUA 2D5FA 4Y1ZA 3B94A 2YMZA 5JPNB 4YGBA 2UYBA 2X29A 3EHKA 2OYZA 4CZSA 5I0SA 5GLZA 3RYPA 3SH4A 4COYA 4OFGA 1EY2A 1QJY1 1Y43B 2VY0A 1QJX1 3FBMA 3MW4A 3AMHA 3ZFFC 3V15A 3ILNA 1G9CA 1Q8PA 5KXBA 1NLSA 4Z82A 4GH4B 1TMF1 2UU8A 2ARXA 2XWBB 1NLRA 4Q4Y1 2JEMA 1XQNA 2DTWA 2B9UA 2E6VA 2HWD2 3WG3A 3MGUA 1UW8A 4FPYA 1LECA 3JU9A 1TE1B 4FOYA 1HV0A 3N7MA 2FZ2A 3AP5A 2W39A 3LGRA 5HCFA 1G8WA 1QKQA 3ZDSA 1NCQC 3VBSA 1RMU3 5LEKA 4HK8A 4P9JA 1IGOA 2GAUA 4BWOA 2VPVA 3NKTA 4E4DX 1SLCA 4X8NA 5GLUA 1FXZA 3WG2A 3N7KA 3ETQA 3SLIA 1RVF1 3WUDA 5KBFA 2X5IB 1ASJ3 3OD0A 2Q30A 1ZBA2 3C3VA 4EN9B 4RR3B 4EWDA 1QOTA 5C8CA 2DUQA 4K21A 4Q4V2 4B29A 2O8OA 3O0VA 3E6DA 1LKNA 5BV6A 4Y22B 2RS53 4QGNA 2ET7A 4HVOA 4UW5A 3AZWA 3J8F2 4PLNA 1XNKA 4WM7B 5DDJ1 4QPGA 4FP3A 1GKBA 3V0BA 3SMHA 3VBUA 4AQSA 3ACLA 1WCDJ 2KXLA 3ZFGC 3N6WA 5BNNA 1Q8OA 1QNWA 1WCSA 5F6LB 3INAA 1OI6A 3VZNA 1APNA 1UAIA 4EROA 1YIFA