1H2NA

Factor inhibiting hif-1 alpha
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2nA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2nA01
3OD4A 1IZ3A 2WA3A 4Z1VA 4Z2WA 3P3NA 2CGNA 4QU2A 2CGOA 1MZFA 4B7KA 2YC0A 4JAAA 1H2NA 2YDEA 1H2KA 4B7EA 5JWPA 1H2MA 3KCXA 2XUMA 4BIOA 4AI8A 2ILMA 1H2LA 3P3PA 4NR1A 1MZEA 3KCYA 1YCIA 2Y0IA 2WA4A 2W0XA 3D8CA
chains in the Genus database with same CATH superfamily
4XJWA 1EP0A 2D6PA 1N32B 2Y6GA 4MSWC 2J22A 5A6YA 4MYEA 4WBBA 3KF5A 2OQ7A 1IBKO 4AGGA 2CWMA 1ZA7A 2FYUH 1LU1A 2ZMKA 4GAZA 3R66A 3B9CA 1L0NH 1EN6A 4G2KA 4DR2O 3JBG3 2FZ2A 2JB8A 4OHWA 3LNNA 1CP9A 3JARA 1N1TA 2VOXA 4ZS3A 3B00A 5LHHA 3AZYA 3ILFA 3OEBA 5A3PA 1XQNA 1PIV2 2OUJA 4P5YA 4XE9A 5J48A 1RUE3 3LEMA 1QVGU 4JV5O 3DGEA 3STZC 4RS5B 4QDQA 1LAJA 1JR9A 2J42A 1GNYA 2Q6AA 4Q0PA 1A78A 2XTAA 2DWEC 5FPXA 4FPCA 5LY1A 3POYA 4KBBA 1ZRRA 4LOTA 2BPA2 3LDDA 4HNAA 4BQ5A 5LBBA 2BZDA 1SZTA 3ZYRA 1ULGA 1OVSA 4IEQA 3O9OA 3BTXA 1RUD1 1OMIA 1OQ1A 1ULPA 4MT8A 1JFFA 2JDHA 3DECA 5EC1C 3GGLA 4P9IA 3NNJA 1BLZA 4CP0A 2PUSA 2ZZJA 3BPSA 2DYSB 4GXLA 2WWSA 5FL7G 4BIOA 3WDVA 1YSCA 3K3WA 2Y38A 2BDRA 2RCVA 3BVCA 2ZE8A 2UUAO 1N3PA 4WVMB 5FMDA 3WUDA 1SBDA 4DK1A 3NMBA 1FS0G 4GWNA 2VQ0A 2YZ4A 4DV6B 5LA2A 3GZUC 4B3NA 2QEXV 2JG8B 2YC2A 2VVDA 3MPBA 3DPRA 3I55V 1QR8A 5C5UA 5FYTA 4LKFA 2D40A 2VMDA 3UJQA 1NU1H 1JN2P 1WLEA 4ZU4A 2YIBD 5JVVA 2ETNA 5K1XA 5J2TB 3K5OA 1FXVA 4O4HB 3K48A 2HLDG 1HB2A 1XE8A 2O57A 3HKCB 4LIUA 4Z92B 1GWLA 3CD6V 2ZHNA 1AR92 1NQTA 2QWNB 1OUSA 4AHZA 3LDCA 1MS5A 2E3CA 1ORQC 4DV4O 4AEDA 2QFEA 4DV0O 1M4WA 3I2GA 1VF5B 4E8CA 3NAPA 2W94A 5HXVA 4H14A 4TV9B 1MQTC 1QH6A 4Y5TA 2QQPA 1HQNA 4LITA 3RZHA 3AKQA 1WW7A 2ZE7A 1PX4A 3H1KH 2NQYA 3ZXAC 1FJGO 4LH6A 4XAAA 3ASIA 3IN9A 2UWAA 1AXYA 4LF7B 2UXBB 3AZVA 1RUJ1 3WR0A 2ZQMA 3T0AA 5IK4A 1QHTA 5EZWA 5FZOA 4N43A 4Q4Y1 3BCWA 4MVRA 1JYTA 2Q4SA 2LQTA 4LJHA 4IIJB 3G7DA 2WR9A 2CGPA 2R0FA 1XBLA 3C7EA 2ATKC 2JKXA 4FFFA 1VBB1 2DCKA 2YXLA 3JSLA 3WG1A 3DN7A 4QPWA 1SLIA 4PI0A 1GN3A 1KBHA 4IV3B 2X29A 1SZBA 2P6HA 3VB9A 2X5IB 3BTYA 3WNXA 5EZYB 5LA6B 2FMDA 2QCSB 1WLTA 1OFSA 5AC91 3CC7V 4Y5Z0 2ZE5A 1Y9GA 5HFLA 5B66Z 1W39A 2ZAAA 4EZ4A 1W0KG 1COWG 3OD0A 1OZ0A 4Q0UA 5JQGA 4X1KB 5BXXA 5F39A 2C0ZA 5HV4A 2WLQA 2WNUC 2D6LX 3CSXA 2W1SA 3HKEB 3JAMN 4E4EA 4X20B 3AYEA 4NHKA 4GYCB 2D3SA 2NR5A 4Q4W2 5IYCO 3ZN6A 4QPGB 2BFUL 3BRCA 1UPSA 4DK0A 3GDBA 1NI8A 3AL5A 3SMHA 3O12A 4X6RB 1CN1A 4IETA 1Q6HA 1HIXA 4BR6A 3TXQA 3PUSA 3D5OA 1HNZB 1UOGA 4OQ9A 1R3JC 5FLIA 3J7NA 3MV11 3OR6C 5LZ6A 3SDLA 3ASNC 3OTOB 4FFIA 4EFEA 3DYMA 3ILRA 3ACGA 5HCBA 3NJXA 2YEVB 4FLVA 1BHAA 2O14A 3K77A 3FYEB 5IW0A 4CH5A 1PVC1 1IURA 2ZE6A 1AYM1 5A3LA 4MS2A 3LDEA 1DQ2A 3V0BB 5FUIA 1D4M1 5DZFA 4LWSB 1VR3A 2ARBA 3TCUA 2ZGMA 3ZJZA 1A8DA 3VBHC 3W21A 4A7YA 2DDUA 1TE1B 5IK5A 4XIKA 4XOGA 3QO7A 3SPCA 5J98B 1I1EA 5FY4A 2ZM6O 1SQPH 4DUYO 2B4KA 3M7MX 2YUAA 3AK2A 3SITA 3T1YB 3J80N 2GNDA 4JI5B 1NCQA 3WNMA 4M4PA 4PI2A 1OD5A 2OIEA 3WP3A 3IAQA 3NV1A 3HKDB 3SYCA 3RVHA 1WLCA 1FXKA 2RDRA 1XU2A 3D0JA 4PDLA 1RHI1 1RFYA 1FNYA 3MICA 2DV9A 1GNZA 3G6BA 4LA3A 2C2AA 3CYOA 1CX4A 2R9RB 5ACA1 1UU6A 5APAA 1P84F 2HWE3 3LAGA 5F3EA 1GO3F 1K97A 5H9SA 4N23A 2X09A 3WHUA 5DN6G 3HKBB 1YQ8A 1BQZA 3ZMZA 4XABA 4N90A 4D6TH 4LIVA 2NZ9A 3L2YA 5D5PA 2PHRA 4BA6A 3WB2A 4DINB 3ZRWA 2PI4A 1R1A2 1QKQA 1FAYA 5CFCB 1XE7A 1OJHA 4PDMA 3K3OA 4KH9A 4J25A 4JKMA 3CIHA 1PV0A 2GC1A 1W0PA 5CZKA 5KHKA 4WFFA 3LEIA 5BNOA 3BB6A 3H1IH 2Q7HA 2ZIOA 4J42A 3N2GB 1M06G 3VKOA 4YJ2A 4G4FA 1VAVA 3A22A 4MX3A 2YV8A 4LBOA 4U36A 2CU5A 4K3AA 3KV9A 4YW6A 4JRAA 4M01A 3DC5A 4UCOA 5GLTA 1RUG3 3DXUA 1SACA 1XYOA 2R49A 5C8CB 3SQOA 3LPGA 4M0NA 1IS4A 3CEWA 2ODMA 4AI0A 4BXFA 3B8NA 4YVSA 3MIEA 5D8AC 3ZX6A 3IDCB 3POGA 4XIOA 5C8YA 1VQOV 3PURA 2TNFA 1K4CC 1XHZA 2JG9A 2EILB 4AGRA 2HH9A 1F4HA 2V4AA 1UKRA 2ZEYA 1UO9A 1W6MA 1OPMA 4BQXA 2OZ6A 1VQLV 4YLZA 4UFHA 1F15A 1YFXA 2OT7A 5B1AB 2RS32 4RA0A 2BOCC 4Z07A 5E16A 1KQSU 5G05L 2DF7A 3ZMNA 3E83A 4YY3O 5JCTA 2WN3A 2XB6C 4ZS2A 3O7OA 4D3WA 4GKYA 4PDRA 4GH4A 4E4DX 2ETEA 4IEWA 3A23A 1KFUL 4BPZA 1GM9A 2QM7A 4GX1A 1YJKA 1JHNA 1UYPA 1G9AA 3B01A 4XUNA 1Y3TA 1HNWB 1YDXA 3MHHC 3DGTA 4NIAA 1BBT2 1HRI1 4B29A 2DVBA 2Y8KA 2C26A 2WO7A 2JDYA 4GUNA 4L0PA 4ZHQA 1QU7A 1DYKA 3M3OA 4HANA 1U12A 2V4DA 3IBMA 2ZJCA 4DR7O 2VTXA 4JCKA 3CRMA 1BT8A 1N3QA 4O7XA 1RUD3 2E5LO 4J9ZB 1MZEA 5JVDB 5L3CA 4OULA 4RQEA 5C93A 4FLYA 5J36A 3I59B 4B7KA 2OTJV 1KD1W 4M3CB 5CA1B 1GFF2 1RUH2 3VBFA 2Q4PA 5BNNB 1FMD2 2E6VA 3SEEA 1Q5OA 1A8MA 2WWUA 3ZMOA 5IFTA 4KGQA 3SH4A 2IJHA 5F5AA 4S2FA 1XJAA 4AEDC 1VIBA 1S0CA 2VOVA 4PCRA 5GZCA 2Y0PA 4LR3A 3NAPC 3BIWE 1PIV1 1HXS1 4XCBA 5IYDO 1KXGA 5FLHA 5FP8A 2XVLA 1B35C 3ZR6A 3N7KA 5CA0B 1V6JA 4GX5A 2AR6A 1IPKA 2Z5WA 2WLIA 2A3WA 3C7HA 5LBQA 4MXWA 1NS1A 2ARHA 4DRRA 5CBFA 5A33A 1P8JA 2QTWB 3WNLA 4CEWB 3CZUA 2R70A 4CDUA 1O4ZA 4JC1A 1SEFA 5FY0A 4NRPA 2Z3YA 4BW5A 1PM7A 5FZ7A 3T08A 4R52A 1Y66A 5L7OC 4Q8LA 3JQXA 2GNBA 1RUJ3 2VQEO 2RMU1 2Q30A 2YG0A 3BOPA 1SPPA 1H6YA 1VBC1 4RL7A 5J09A 1Q8VA 5HCHA 4DS0A 4Q4Y3 3OBZA 1PD3A 5JR7B 4JI7O 3E8FA 2VQFO 1DGWX 1G86A 4EROA 2QBXA 4N53B 2JWPA 2WSUA 2JDMA 3IAYA 1VBB3 2X6CA 5H9QA 5DAVA 4JAUA 3K4DA 4AF9A 3O1TA 1PO11 1XNRO 1PX3A 4LK7A 3ZMUA 4XMIA 4EN0A 1JZ5A 4AYUA 3KZIZ 5AC93 2QQIA 1DGRN 2RMKB 5A7QA 4O65A 1PZ7A 5CEHA 1JUHA 1LTEA 1JMKC 1AR91 1QWRA 2VBBA 5HCAA 3BN6A 4UCSA 4URTA 1QDOA 4RS5C 1Y76A 3OAAG 1W04A 2FKXA 4LF6O 4QWNA 1Q90D 3GYDA 2ZT9B 5B1OA 2IJJA 3P5BA 2VZ1A 3OBRA 1G8WA 3QD6A 2VMCA 2WFF2 3VBOB 4UFMA 4V2VA 4DV2O 1KITA 1NJIW 4L8QA 2BGPA 1LECA 1XXNA 1NQDA 1W9FA 4OGQB 1ZZ6A 3VBRB 3R65A 3AXDA 5K7PA 3OEHG 4D6SA 4HSJA 3QH7A 4W6YA 1D2DA 1ULFA 4QNHB 3EJKA 3HIFA 2P67A 3L9JT 1GMGA 2F95B 3FE5A 3MZHA 4JASA 4YZ4A 4XF0A 1EV12 3WQ1A 3ZSMA 1JZ7A 5L9RA 4DFSA 4AQTA 1PPJH 3JAWA 2LS6A 2FHRA 1SDWA 2XKPA 2IXIA 4UW5A 4RR3A 4JI0O 1O3RA 3KMHA 2W3JA 4S2GA 1PVC3 4PIZA 2JG8C 4K35A 3OPWA 4HOOA 1AYM3 3TEWA 2LGWA 3KLSA 5A9GA 4PA7A 3R4SA 3WHTA 1D4M3 1YJ9V 3I5DA 2SBAA 3D3IA 3SJBC 1IOAA 5FYVA 2UY8A 4CZZA 1OT5A 2Q67A 1YNAA 3AJYA 4FMTA 4AEMA 5FPBA 3AVSA 4HK8A 1SQXH 1R081 1C8M2 2Q8DA 2IVJA 2ZABA 1LR5A 5FZ4A 2UWCA 5EJ3A 3ZFFA 2ZZQA 4CDXA 4Q4W1 3VDBA 2WLHA 2VQAA 4DXZA 2GTSA 2NYYA 5FZ0A 4LO4B 1O6UA 3UL2A 4JZ2A 4K21A 1V6MA 4IV1A 5EK0A 2OW4A 2MHFA 3OGRA 4AI1A 2WINB 3MIBA 2Z4FA 4Z1VA 3UKVA 4HMZA 4HZ3A 3J7HA 2Q68A 3JUUA 2R9AA 4J10A 5DN2A 1NYWA 3J7MA 2BV4A 1XRUA 1VP7A 5BUVA 4QDSA 5ACA3 5GZDA 1CEZA 2XMLA 2NP0A 3CJIB 4XJ9A 5I91A 2A3QA 4D6RA 4CDQB 2NMOA 4KHPO 5BNPA 2XJVA 1DLCA 3AK0A 5FBJA 4NVPA 5M0TA 4FK5C 3NNFA 1NA1A 2D5HA 2VMFA 3CO2A 3O14A 1B6QA 4IV3C 2GDSA 1V55B 4O4LB 4KFMA 2X5IC 1QIQA 1MS1A 3SCHA 2ZX1A 4XZPA 2ET1A 3ES1A 1G9BA 2PN5A 3KKYA 1G9FA 4DR3O 1O5LA 2JB4A 1WB7A 2CHHA 3JCIA 3TGUH 3U07A 5A6ZA 3ITQA 4YG3A 3RYIA 2IH3C 1UNBA 1E1QG 1JOPA 1UCXA 4YRDA 2WO1A 2P4KA 4Y33A 4JAAA 2JKBA 4XTPA 4EZHA 3HQRA 3BTAA 4GX2A 2WLNA 2VVEA 5FQ0B 1SCRA 1ULDA 4KWLA 1S0IA 1AYN2 5JLVA 2AHZA 3H7YA 5L3FA 3VV1A 4FTEA 3ZFGB 4P14A 3SR2C 4QPGC 2FD8A 4YJ3A 1W2OA 5ITZA 1NR1A 2ZKLA 2A6WA 4B3TB 1K45A 3ACIA 1F5FA 4XZUG 4UFLA 3MPPG 1H8VA 5JJEB 5A7SA 5IYZA 4G9SB 1GKFA 1OKQA 1W2UA 1ASJ3 2G9GA 3NNGA 4S2DA 4YG6A 4DV5B 3SNMA 2F93B 5FBZA 4UFZA 1Q3EA 1ZX3A 2R72A 3WG7B 1OUXA 1YZBA 1W6PB 4XDLA 1XNQO 5FZ1A 1ND2A 5A3TA 4XURA 2EIDA 1PK6B 4UF0B 1S5HC 2QKCA 4FLXA 4GH4C 1C5IA 4I30A 1RMU2 5F6LB 1E5SA 2ZMLA 2D98A 3WF3A 3PVEA 4YSFA 1D4VB 3OM3B 3Q8FA 2XXZA 4LF8O 1DQ5A 2P34A 1DU3D 4XFAA 3I54A 4K8XA 4IESA 2VE1A 5FMOL 1HDJA 3E22A 4XFHA 3E6BA 4HKOA 4LHLA 1KFXL 4BYYA 4U3FH 2RE9A 5FZKA 5T5OA 4A3ZA 2EIMB 5JSRA 4LBQA 1U97A 3V64A 3NRUA 5FO9B 3ZSEA 3VZNA 5LY2A 3AEIA 1DGLA 3I3MA 2VNGA 4Q27A 2R071 1W6OA 4XCAA 3SPHA 1RVF2 2QM8A 1PM9A 3P3PA 3PJQA 2P6JA 4X66B 1COV1 2GN3A 1HRI3 4AHYA 1G9DA 2VNVA 3VD3A 2W47A 1QJX1 1RUI3 5FO7B 5BZBA 2MEV1 4I9QA 1EZVH 4YW3A 4QMAA 5F8PA 3IJ4A 3NSTA 1IKPA 4X1IA 1UZ0A 2NLRA 1VRH2 5F32A 5KXBA 2A71A 1SLAA 4GB31 4BQWA 1UN1A 4K7JA 2Q73A 4W4ZA 2JD4A 3KCXA 1Y74A 3OGGA 2WAMA 4MO3M 1W9WA 3KCYA 4ISRA 2BTQA 2WYFA 4I55B 4HPKA 4XF4A 3TK1A 2RS31 3WQ7A 2EJRA 4OUEA 1WA6X 3C2UA 4LF9O 1ND3A 3OB8A 1W0NA 4K40A 1IKQA 1YCIA 1Y7BA 3H42B 3JAKB 3MUY1 1W8WA 4LBNA 2R042 4Z8BA 1QJEA 5GLVA 1PIV3 3KS7A 4OZOA 1HXS3 3NNLA 5E89A 1QBZA 4PA3A 5JSOA 2ID4A 2D2CB 3AXEA 1C3HA 4NXMB 2VU9A 2IXCA 3Q8CA 4NO4A 1XEQA 3ILNA 3NJYA 4BMBA 2F1MA 4LP8A 3ZDVA 1AL22 1V0AA 4QXCA 1IHMA 3PUHA 1G4YB 1SRYA 3QG5A 3C3VA 3THTA 3VUOA 4CUBA 1NY72 1AZDA 1MACA 2CH7B 5BNQA 2VMHA 2GUZB 5C8CC 1H1AA 4H3WA 3B8MA 1RUC2 4J6GA 2B1GA 1DF4A 4QQLA 5KAIZ 4AI2A 4CEYB 3M1HA 3HEIA 2XAFA 2WO2A 5FUNA 2RMU3 4XDQA 1VBC3 1UX6A 3E5XA 1K5SA 2EILC 3T4HB 1IBMB 5K9YA 3FAVB 3K58A 2HWB2 5IWAB 5B1BB 5AVAA 1SBEA 1FYUA 2A6ZA 3Q4HB 3GBGA 5IJ9B 3FD9A 4CS4A 3QH6A 3CCVV 3TRSB 4UYBA 5IY5B 4H2AA 4CCKA 5B1AC 2WJSA 3AP4A 5LASA 3JQWA 4FLZA 1PO13 2C5DA 4RQPA 4OUSA 4QX5A 1J5EO 4LUMA 4G28B 4P9XA 2AW9A 1ZM1A 5A7PA 5DAWA 4WBNB 1QNMA 4FLUA 1ZBE2 3FUOA 2XOMA 5IVVA 4Q5OA 1K12A 3QBQA 2HHHB 2UXCO 4OZXA 2QDNA 2W5FA 3ZEDA 3NV3A 1C4RA 3VKFC 3UNPA 2TEPA 2DWRA 1SQFA 3CRAA 1GBGA 3CCSV 4LEJA 4BK4A 4FQZA 3POEA 4QDRA 1JZ4A 4R50A 1F23A 2JGDB 5JXJA 1JYWA 2PXJA 1S0BA 3S6PA 1BHGA 4AG4A 3VHRA 1X82A 2LFSA 1RB8G 2V4VA 2WS92 3AZXA 5I0RA 3JASA 3INAA 1IXMA 2DN9A 2HVJC 3W7UA 2CWSA 1WMXA 2B45X 4B3RO 1OI6A 3ZN1A 4E4HA 2E26A 1K7DA 3RMXA 4MVMA 1VBD2 1DQ1A 1JODA 4EEQA 3KV4A 5FOJB 2ZAHA 4GULA 2GSMB 3OJBA 1OH4A 1BZKA 5BNNC 4KUMA 5EFUA 5F3CA 1SG3A 3OFNG 4FJCC 5BPXA 1RGSA 2AZ2A 5IVEA 5DPNA 3VOUA 4DUZB 1OLQA 3ZLIA 1VF7A 4F7ZA 3M3IA 5IVFA 4CCCA 3PTYA 1CJDA 1BQ0A 2AXTZ 3E2EA 4GX0A 3N9QA 1R083 4GMP1 2W46A 2JEXA 3KB5A 1QJY2 5LEKA 2WFF1 4P08A 4XUQA 5FZFA 1DFQA 4Q4W3 2BERA 3GHNA 2EA7A 4N8MA 5B1NA 3EXUA 4TV8B 3DV8A 1N32O 4QX7A 1OKOA 4CXYA 2YBKA 1C5HA 4J7JA 3ORJA 4EN8B 2R32A 5FUPA 3S5AA 2PLV2 3PVBB 4EKWA 4JI3B 3VBSA 1I6XA 1SQBH 4RGGA 3I2JA 4XHBA 4OVEA 3CDZB 4AK3A 1K5MB 1PKXA 1AUYA 2X0LA 3U37A 1JCHA 4J80A 3MUZ1 3M3EA 1ENQA 2D97A 4N53C 2YB7A 1W90A 4CC6A 4IEOA 1E5IA 4N7IA 3O5SA 1TMF2 1E1RG 3CXCU 3K5MA 5BY1A 5DUUA 1S55A 5DUXA 3T09A 1LNSA 4M00A 1NKDA 4A7ZA 2Q7EA 3ETPA 4BWAA 2WAAA 2AREA 3PIGA 1UPGA 4PIXA 1ZTEA 3AVRA 1US2A 3IPVA 2W6IG 1UAIA 1MS9A 1IGOA 2TBVA 3CKHA 1J1TA 3NO8A 1OQEA 1C8M1 4L2NA 2HJIA 2PHUA 1HKDA 3WP6A 3LDRA 5C5TA 1YO8A 2GNTA 2DVFA 2QVSB 3DYPA 1AX0A 4QB6A 1POV0 3JD2A 2ADEA 1AJOA 2JS3A 1UY2A 5FYHA 4DRXB 1T2XA 4Q8KA 5LP6A 4ISQA 2VQUA 5I93A 4AI8A 5EV7A 1FFXB 1BVVA 4HVRA 5C9AB 4DR1O 2ZGQA 1XREA 5FPLA 2Q0OC 4DV7B 3VBRC 1A3KA 5T3NA 3KD4A 4DXRA 2XAGA 1QU0A 5F7UA 4PDWA 4DV6O 1WKYA 2GTAA 4JDOA 2UUBB 4RO2A 2JD9A 2FB5A 4C0HA 4X62B 1T5EA 2G9FA 3R0RA 2VNOA 3JATB 1LOFA 1XOUA 3WCSA 1UW8A 2UU9B 4F83A 1K73W 1X33A 3TNQA 4K20A 2RM22 4GZRB 3CC2V 1BMV2 4LLOA 1GLHA 2X7RB 5JPMB 3T2PA 3CCRV 4INDA 4OI1A 4AHWA 1ENXA 4O9GA 1YXWA 1WNSA 3ASOB 1CAUB 5A7WA 4QPJA 1UXZA 1GANA 4A42A 3W58A 3Q8BA 1P7BA 2VVFA 4AFBA 4LF7O 4LNUB 3QO8A 2UXBO 4B7EA 1TUEB 4NIIA 3LF7A 1AR61 3ZHRA 4XJZA 3RJ2X 5A7NA 3UK9A 2YBSA 4MVSA 5CKQA 1LHOA 2D43A 2R073 4FPPA 1X8MA 1COV3 2FL4A 4PA9A 1LOAA 5K1PA 1U5YA 1W6NA 3ZYGA 1NZIA 4YM0A 1W06A 3GNEA 1QJX3 3I97A 2MEV3 1LEMA 2A06H 3ZHSA 2QUOA 3AM2A 4MHRA 1STMA 3UESA 3CCQV 2UYBA 4NPLA 3HJRA 3KHBA 4WCEV 4AQSA 3CC4V 3CJIC 3LSSA 5HI0A 1KP2A 3LCPA 3KHCA 1U5XA 3C7FA 4GB33 1FXZA 1HNXB 5EYPB 5FREA 3IDBB 2HJDA 2ARAA 3H1WA 3ZKUA 1F5JA 4I4TB 1RUF2 3W7WA 3AG4B 3FUQA 4COYA 4Y26A 4HVQA 1V55C 2EAAA 3WF2A 3EQEA 4BIZA 4AL9A 2RS33 2GC0A 4FTSA 1JBCA 2D93A 3E97A 2PHXA 5EYXA 3ROUA 2ZGNA 1OOPA 1PNGA 4FIPC 2PYLA 1MABG 5FKCA 4X6QB 4IYIA 1TVKA 1SKVA 2FDIA 1OF3A 2CV6A 1YXBA 2X6BA 2A0LA 2ZHMA 4YPJA 1WA8B 2WNEA 5CKNA 1I3HA 1ULEA 4HBNA 3SKJE 1H0BA 5EIBC 1TEIA 2PHTA 1V70A 4CVUA 4JGZB 3M2MA 1CGPA 2HWC1 2DVDA 1HNZO 5F37A 4KG0A 1NOVA 2ZPXA 3SYPA 3ZFGC 5DAQA 3J9SA 5EXOA 3TN92 1G9CA 3BOWA 3BU0A 1DQ4A 3OTOO 3POJA 5D1IA 3ZFEB 4LO8A 5GZEA 2RDCA 2LALA 3VZJA 1PP9H 1WMEA 3K4ZA 2QGNA 4JDNA 2VUAA 4I3GA 5C3PA 3OY8B 1W6QB 1M1KW 5L9BA 4ICGA 2VY0A 3L9DA 5JDBA 1OH3A 4KI5M 3IM0A 2A5ZA 4NN0A 1OSGA 3H8UA 3H8XA 3LNMB 2F23A 5CA6A 3WG7C 2BCCH 2A7AA 1REEA 3U11A 1JYCA 5DZEA 5F6KA 1QQCA 1PK6C 1V6LA 3A0BZ 1BJQA 2LGQA 1CQ9A 3VZOA 1M93A 3P6BA 5JCOC 1ZL8B 2BWAA 3U78A 4P9LA 3BUCA 1D5NA 3LFIA 4LLFA 3NWKA 1OA2A 2NM1A 1UYZA 1GOGA 4B4PA 3I2KA 3GZTB 5LBFA 4CPBD 1POQA 4U3JB 3T1YO 3VD9A 4JI5O 4QXKA 2R041 5GLZA 1TQ5A 4F6EA 1BCXA 4LKSA 1V00A 1QXJA 1P49A 4PBPA 4YW5A 3AC0A 2EIMC 4MUVA 5CAZA 2YYOA 2MK3A 5JH7B 4Y1UA 2NN4A 3MV01 3CRCA 4UCTA 3S3WA 2UXNA 2AZ5A 4O4IB 1AL21 3Q9OA 5JXGA 1LUVA 2GHYA 4FFBB 4WFGA 1IPJA 4NWWA 5FLJA 1ZBA2 4O4JB 5JZGB 2PHDA 5T52A 2VTFA 2ZDIA 3IKWA 2B7YA 3H8OA 5C33A 3THDA 5FYBA 4JGYB 2Q8CA 5C4WB 2HKXA 1NQJA 3H3LA 2LW8A 2KG7A 2MW2B 3OEAA 2WQ4A 4AAPA 3CRQA 5A32A 4ZKIA 3AMNA 2JICA 3K5LA 3WG2A 1NTKH 1LHNA 1WP8A 3NW4A 4WM8B 2ZXWC 4NTWA 2YFUA 2VAUA 2QQUA 5ABJB 3RVZA 4Q4X1 5JOWA 4MVQA 3WSOA 1BS3A 4K8RB 3FYIB 3ZRVA 2ZX2A 5F5CA 2QM4A 3TAYA 4I50A 2P06A 2VPVA 4FP3A 1AX1A 1JYVA 4QB2A 2R061 2FMLA 4IYHA 1FPN2 3GALA 2V73A 1DYOA 4CCMA 3PL0A 4D0QA 5CYYA 4NB5A 4M4RA 3W20A 4BM8A 3O1OA 4OYUA 2RVAA 3UYJA 3WNKA 1ZBE1 5LK5A 5LYJB 2GAUA 5JIUA 2WNUB 3AK1A 4LFCB 4J1WA 5E8AA 2BEOA 2B8MA 1DQ0A 2IFWA 1W05A 1HLCA 4RD7A 3VQWA 4D8MA 2I07B 3RZGA 3RZLA 3CNAA 2PFWA 4AW7A 2VXRA 2XHNA 4JI6B 5GTIZ 4IEPA 3AKTA 4TN7A 4MTFA 5DMYA 2WFF3 5KXDA 3PN1A 1EN5A 5FJHA 4F6RB 1XI1A 2GP5A 4FBFA 4G27B 1JXNA 3VZMA 4CCEA 2E9QA 1Q8PA 5SV5A 1S5JA 3N7LA 3PJSK 1I7FA 3BA8A 3WVJA 4CEYC 1U5IA 5KWRA 1GM8A 1VQ4V 4QXBA 4AVTA 1WCUA 5K4LA 2DWDC 4B4RA 3ASNB 1OC1A 4E27A 3M99B 3OYWA 3ABTA 1H38A 1MPXA 5L19A 4QKNA 1B09A 2RR11 4AOCA 5FNVB 5IFPA 3OUIA 1MR5A 4L11A 2CYFA 5B1BC 2RS51 4JYCA 2B5UA 2H6BA 4GD4A 4HETA 4CRQA 2WNVB 1GNHA 5A1AA 1Z7S1 2QQJA 1EAH2 3B93A 1KS5A 1SFYA 4CA9A 3RI9A 3LOBA 3JALB 5KA6A 3OD4A 2VC9A 1LUWA 3VDAA 4ITCA 1RC6A 4JX0A 1HNWO 3ETGA 3WB0A 2Q1FA 2CAUA 5C6CA 3E1F1 5KXCA 4Z1MG 1CPNA 3RPQA 3GWKC 1OCRB 1XNAA 2XJTA 3ZHTA 5DABA 5LRSA 2H94A 5FXZA 2D6MA 2E7TA 1MNGA 4DR6B 1QJY1 2EINB 5C71A 4FQ4A 1SA0A 5BR8B 1RINA 4Y1XA 3T4DA 2RS11 3P30A 4B3SB 2BGCA 1IS6A 2YPJA 3UO3A 2CDYA 5FXXA 4H7LA 5CB4B 4CU9A 1XMQB 3O1RA 3W7TA 1H8TA 3AZWA 3G80A 4GMP0 4ARXA 4QHOA 1YQ2A 4CE8A 4DRVA 3K0DA 5FYSA 5DQ0A 4EWAA 1E57A 1HW5A 4NPRA 1H2NA 1J83A 4FPEA 2YIAA 3IGAC 1QJU1 1W3VA 1TMF1 2A6YA 4LE4A 1UXXX 1BMFG 2D6KA 1Y4MA 4K6BA 1TME2 4BAYA 4K0KB 3HQXA 1GTOA 1A34A 4KXRA 2RG4A 2K9PA 2UUCB 2ZGPA 4AQYB 4Q4V1 3LZZA 4KU8A 1UIJA 1WAZA 2IJKA 4PDVA 3ZM8A 4GWIA 5K0UA 3CJHA 2F4LA 1K3EA 1AI4A 2EAKA 2XDVA 4JQRA 3WNOA 4MADA 2VZVA 1HQWA 1NT2B 2XAQA 4FPYA 5LOVB 1W8OA 5GLWA 4Y1VA 1Y9MA 3UJOA 4FOWA 4FPJA 4AILC 4NXNB 2G38A 3H1MA 3BPZA 2QQLA 4BQ2A 1BZWA 1AR63 2KM2A 4IEZA 3WY6A 4DR5B 3VLBB 1EFRG 2EZOA 3E5UA 4FPLA 4ET7A 5LGTA 5BXZA 4R4ZA 1KECA 3B02A 5EPAA 4XUTA 2ZX0A 1FOD2 4YIOA 3USUA 5LGUA 5E6HA 1OF4A 1EY2A 2BGOA 1SQVH 4COWA 4QQHA 4Y1YA 1K5MC 3SC7X 4RQFA 4W4LA 2XVKA 1VQKV 5FP9A 5A6QA 3BALA 2ZKNA 4QAWA 1VB4A 1OOPC 2VNRA 4I0XA 1JJ2U 5JJNB 2CUGA 3VBUA 5CFDA 1V6OA 1PL4A 2ZCEA 4D7SA 4BK5A 3VKLA 3I49A 4I9WA 4DNYA 4YGBA 1QLNA 2EVXA 3MLJA 1BMV1 3JBG2 4B08A 5KC6A 1UPIA 3ZN4A 1G6NA 2ADDA 4AHXA 4LKEA 4LCUC 2DU1A 4XJ8A 4HNAB 1RUE2 1ENRA 4NPMA 2IXHA 1VBA1 3AFGA 3RDIA 4XFGA 5E1RA 3D0SA 1MEC1 1RUNA 5AFEA 5J9PC 5IT6A 4HLTA 4NRMA 4HXCA 1YQ5A 4ASLA 1ZSPA 1PGW1 3UT0A 4MW8A 2Y6KA 1JFFB 4CUAA 2RDNA 3WW4A 1UZVA 1ZRIA 3WOGA 3DYOA 1WB8A 3K75B 3RYKA 2HWC3 4JI8B 1BEV2 5G04L 1VEWA 5E79Z 3PUAA 2BVVA 5C9AC 1I5PA 3NJVA 4OHVA 2PTMA 3ZXLA 3KVAA 3NXSA 4ZKTB 2ES3A 3HT2A 4UV9A 3S7EA 1ODNA 5FZ8A 1KKDA 5SV8A 1LCLA 5FPVA 1ZWIC 3DPRB 3RGBA 3DKWA 1CXZB 2GMPA 5DG2A 1WWYA 5BMVA 5EYYA 2QZ2A 3LDBA 2ET7A 2XH6A 2RDQA 3I3DA 1JI6A 2P37A 2YDEA 1QR9A 3WNPA 4BIFA 4AEDB 1EN4A 4W6WA 4AEJA 1AHSA 2O0OA 3NAPB 1K4DC 2FDGA 3IFXA 5TISZ 5F5QA 5T50A 1FNZA 1AXZA 1GYKA 2JDIG 2EXKA 3ASOC 5AFBA 1MZ6A 2FTKA 3OT7A 2V1DA 4QIWF 1RXFA 3K4AA 2WC2A 2DCZA 1Z5VA 2O8QA 3S3XA 1Q56A 4NJ4A 1QNYA 3IMMA 5FZOB 4N43B 1GZ9A 1AP5A 2VZTA 1AL23 4HN0A 4LC1A 3IIAA 4TLFA 4PF1A 3OMAB 2QKDA 4EYUA 1Q8IA 4RSUA 5CB7A 5T5PA 2WYSA 4CU8A 1X9PA 4UVAA 4MH0E 4O2BA 1YFUA 1RUOA 4I5SA 5FZMA 2HWF1 4ASKA 1BE3H 1PGL2 3BU7A 3V0AA 2JVDA 2Y48A 4R9DA 2F43G 5DDJ1 1M4UA 2ARCA 4NTXA 5I8SA 1Z0HA 1XYNA 5JQGB 3NKTA 1KDKA 3AG4C 4Q4X3 2RJKA 2P2KA 3ETEA 3Q8AA 3I2IA 4PIYA 2E33A 1IX9A 4EB6A 3I3BA 4ZHNA 1JJOA 2R063 4FZ0A 1XNDA 3X29B 3ZN6B 4LO6B 4MGSA 1J84A 2E7AA 1ZBE3 1WMDA 1YHFA 1WCKA 5C3QA 4B3TO 4AXOA 1VQ5V 5J2UA 1O4TA 4Q1PA 4YY3B 4JGZC 1VF6C 3MO4A 4D69A 4DV5O 3E5QA 2N05A 4LBMA 1V54B 4TSFG 2ZA9A 3LD8A 2VW2A 3MD0A 3WEZA 3MBWA 1W3XA 1KU9A 1N33B 3ZFEC 2UU8A 3O65A 2NN8A 2L9LA 2BE3A 3PU3A 4JI1B 3WDUA 2Y6JA 1XL6A 4EQVA 1APNA 2PA7A 4FLWA 2EIEA 3ZSKA 1HJGA 3PVOA 2ZCWA 1R091 4Q6GA 3J7AU 5A3WA 3KQRA 5CISA 5EBWC 3M7AA 3UM7A 5T55A 1PNLA 5FLXN 1M5IA 1UKGA 4DR7B 1MVEA 3L71H 2FDFA 3B77A 2RR13 1ZRCA 3WDWA 2B1IA 4HN1A 4GT1A 1KRIA 2RS53 1O9HA 3UV9A 3S57A 1EPZA 1GZWA 3KQ4B 2Q9LA 3RMYA 1AR82 1W99A 1Z7S3 4TUYA 3U75A 2WUHA 3ST7A 5DXDA 1FPN1 1QQP1 1NCQB 3AYCA 2CAVA 3RYHA 3JD3A 4B8EA 3AP9A 3V65A 4RYDA 1FXKB 1ZUQA 4X66O 4NHMA 4AVVA 1W9TA 5LBCA 4QM8A 4CU6A 3GBFA 2W1UA 2PAKA 3N4MA 5IHRA 2E63A 4AWDA 4LF4B 4WM7A 1H8TC 3PMSA 1H30A 1OBNA 2PQQA 1ODMA 2G19A 1QJY3 2H8PC 2XJUA 3CMGA 1K92A 3HR9A 5JZGC 2GZWA 4UBHA 2XAJA 2WZR1 2K0GA 1RITA 1RSOA 4TQDA 2RS13 1O3QA 5CU1A 2Y69B 4JGYC 5C4WC 2EF6A 1JVMA 3CXHF 3UETA 1FI2A 1QXRA 2GH8A 1S0JA 2VZUA 2HWE2 2YU1A 4QX8A 5IWFA 1LOEA 4PJYA 2P5OA 2EBOA 1DYPA 1ALYA 3DF0A 3L70H 2VZQA 5F2WA 4QPYA 1G6UA 3M8AA 1ENSA 4J41A 4BDVB 1JZ2A 2WO3A 2NMNA 4QKBA 4WM8C 4DXWA 1QHDA 5HCFA 5FZHA 1TG7A 2WNOA 5ABJC 5L3EA 4UB8Z 4MLOA 3MHSC 1QJU3 1BGYH 5BNOB 3PUIA 1LESA 1Z2GA 3W7SA 1TMF3 4WV8A 1JQ0A 3ENRA 4X64B 3QLQA 3RYFA 3R6SA 2EALA 3GJAA 1NXMA 4YJ2B 3ECQA 1IQDC 1NG0A 4UFJA 4NXMO 1WW4A 5FPRA 4Q4V3 4OPAA 1WW6A 3H9VA 1SETA 1JOYA 1F4AA 4XHXA 5JWPA 4H37A 2PAMA 3VBBA 1CR7A 1DGWA 2XJSA 3KV5A 4YVWA 1US6A 3OR7C 1JZ8A 4PQ9A 1ZX5A 2WLJA 4YVSB 2QR4A 1GICA 5C8YB 2BVBA 2JG9B 3CZJA 1DIWA 2Y6FA 1RUG2 1AJQA 5FZEA 3GCWA 2HWD1 1ZRFA 1IBMO 1T6GC 2QWOB 2P1BA 3ZXFA 5IWAO 2ORZA 2QQKA 2R0HA 2ZD9A 5DAXA 2CTPA 4PBOA 1ULCA 2P6CA 3SLIA 2E51A 3CMAV 4Z2WA 2W52A 5A2QN 4JDMA 3RVYA 4BCUA 5EP9A 2GMMA 3BFRA 4IHJA 2ZHLA 1HN0A 1H2MA 1N36B 3RYPA 4GH4B 5FTTC 4CUGA 3AMPA 5F2VO 3NR7A 3MIDA 1R1BA 3MFCA 2WNVC 2VMEA 2VS0A 1KDMA 2YC0A 2ZEWA 1VQ9V 1W2TA 3VHPA 2XKOA 2PI5A 2ZACA 1ZZ7A 2HHHO 2ORXA 3LPFA 3SJCC 5LWBA 3HWJA 3N36A 5FMCA 1PZ9A 2DJVA 4IGQA 4ZHQB 2QE3A 3JD71 3D36A 5J96B 1AR71 2HJFC 1OCRC 2YS8A 1VBA3 1R6TA 4NHYA 2DCJA 1YQ6A 1L7QA 1VQPV 3MGUA 1MEC3 2VCCA 3ZN0A 4ZONA 2I2SA 3OF1A 1XB9A 2QTSA 1MS8A 2EINC 3GCXA 4MGYE 5B2GB 5J1XA 3WLUA 3E89A 5LMNB 1YF2A 2FZ1A 2HKOA 2QDRA 4QPIA 3WF0A 4DIQA 4ZZ8A 5JSPA 1IDSA 1DTOA 1UMZA 2E53A 1M57C 1JW6A 1QCEA 4ZZ5A 1ZAUA 3RJRA 4ATFA 1DF0A 1LNQA 3VBFB 4CCDA 3VQXA 3LA2A 3LIHA 2IM9A 2BYVE 1SLLA 5I0TA 3JZVA 2NPIA 1V9PA 1SLTA 3N9NA 1UF2C 3ZPOA 3DTUB 4DPNA 4KBZA 1NT0A 4DEQA 1NZ6A 4PA6A 3WP5A 1NLQA 3S7IA 4F8AA 3W5NA 4DUZO 4ZY9A 4HZFA 3FWEA 3DXRA 1A6CA 1YJLA 4NR1A 2OA2A 4XDKA 2WLIB 1S2BA 4MXWB 4CCLA 2PAEA 4NKGB 2H6CA 3F2ZA 5FIXA 5A33B 2DUOA 3K2OA 1Q86W 2YIBA 3AZZA 4Y4YA 4E2GA 4CDUB 2HEYF 1HRV1 5FDBA 2Z2SB 2N04A 3D82A 3AYDA 4CP9A 1ZYBA 2HR3A 2VUJA 3KT7A 4PJ0Z 1XHXA 1YFYA 3SJQC 2D6OX 1TAEA 1MZ5A 1TUBA 2B42B 1FV2A 1QDCA 3ZHQA 1AI6A 5HBAA 1NTMH 1OCOC 3NL1A 4JI3O 4JZRA 4CP2A 1SPPB 4MXVA 4EFBA 4R8HA 4IERA 4B1LA 2LM3A 5IJRA 4QD2A 4OFGA 1HW7A 1Q6IA 1HR0O 1BEV1 1XMOB 5JXIA 4XXPA 5L3BA 4XBNA 1WA8A 4BMEA 1WPXA 3BCCH 2L6LA 1D0GA 1RUJ2 2JE7A 3JD4A 1VMJA 4Q0SA 3VZKA 2HYXA 3WU2Z 4FVVA 1ZZ8A 4DO2A 2VQTA 3K9AA 2HWF3 5L3DA 4U7NA 2G4IA 3H1HH 4YZ3A 3FFZA 4RGKA 2MPFA 1O3SA 3FZ3A 2Q8VA 5KMGA 2DCYA 2F4VB 1VBB2 5DDJ3 5BV6A 4U2AA 3CQOA 2HEWF 3C3TA 3OY8A 1W6QA 3ABZA 3X2QB 1A32A 1Y76B 4HVOA 2J1RA 1QNWA 1N8RW 5ANQA 5AC92 3U14A 4ATEA 3W5MA 4UUJC 4CCJA 2A3XA 4ZPIA 3TB0A 3GB7C 3N2KA 2GU9A 4XC9A 1NUKA 5FZBA 3ACLA 2X8KA 3CPWU 4MGZE 2P4VA 1J1LA 2BWCA 3ABUA 4P9JA 3BI3A 3RYCA 3JD0A 4JTDB 4A41A 1PO22 4N9IA 4K1YA 1DZRA 1GZTA 4ZI7A 2FBEA 4X88A 4DV7O 4D6QA 3SGIA 3NQHA 2ZGRA 1OPOA 1JPXA 1XOYA 4HFSA 2UUBO 2IWGB 2ADPA 2ZXQA 3ZYFA 4X62O 2OPKA 2PGGA 4FPHA 5FZDA 2XNDG 1LOGA 3JAWB 2UU9O 4AVCA 4Y4RA 2IC1A 1V6KA 1MQTA 4RR3B 3H9AA 2F4PA 2XWJB 3CHXA 4HKWA 4LPLA 4WF9V 3DPRC 1R3IC 3FKSG 1CZSA 4OQ8A 1R093 5KR7A 3E86A 2CSGA 2AH2A 2ATFA 2JDPA 1GU3A 4MVTA 4X1YA 4O61A 1XL4A 1E5HA 2RN9A 4MV2A 5FY9A 2WKKA 4I7ZB 1NR7A 5EWSA 1PVC2 4BWOA 1W2AX 1AYM2 3SH5A 3ZFFB 4CDXB 4WM7C 4XQWA 4EN9B 1D4M2 3EHBB 4MTOA 1K9MW 1S72V 1QQP3 3JB4C 1Y6XA 1HP8A 3OW2U 2OYZA 4IV1B 5IYBO 5KA5A 4B3MB 5FK8A 4PLOA 4AQ2A 1JX9A 1MVQA 5JUVA 1QOOA 1V9U2 4DV1B 3VDCA 4LXLA 3J4UH 1FATA 2J7MA 3ABLB 2J1TA 4IEYA 3BAAA 5D21A 3NVCA 5J37A 3HB3B 4H13B 2ARXA 4IEXA 4N43C 4QPKA 2IH1C 1DBNA 3N7MA 3P3NA 3DSQA 2XBO2 2Y33A 3I8TA 3APQA 5BNPB 4R7CA 5KX5A 2DUPA 4KWKA 2WZR3 4XDOA 1HNXO 2EICA 1YHQV 1NA1B 5FKBA 4Y24A 3L72H 4JGSA 4IL6Z 3AG2B 3WQ0A 5ACA2 3ME2A 4NIDA 3BABA 3BKZA 3PTRB 1XU1A 1FAFA 1FYJA 1NCRA 1PVXA 2EJ7A 2DQ0A 3FB6C 2M7WA 3DXTA 5FPAA 1DCSA 1Y67A 3FX7A 4RN5A 2R9IA 4COZA 1F7YA 3W59A 5IK7A 4FO9A 4KQ7A 4C91A 3RYIB 1PMJX 4A44A 2Z5UA 4GALA 1W8UA 1AR81 1JH5A 3PDQA 1Q7YW 4YIPA 1VQMV 2CK3G 1VAMA 3HN3A 1AR1B 5GONA 4UXAA 5FP4A 2P7TC 4AVSA 1IQAA 5B5EZ 5A3MA 4JYAB 1DHKB 3CU7A 3ZBHA 3VQYA 3BGAA 1S77D 1XNTA 5I8TA 3B7MA 1CAWA 4YJ3B 5ITZB 1UQXA 3PJYA 1SLBA 1Q82W 5CG8A 2P22C 5LA0A 4XQDA 4XDJA 3H3UA 2W95A 1WPBA 4XVHA 2L35A 4I02A 1WMFA 5IYZB 1JZ3A 1KJRA 1Y9QA 1YTFB 1CAXA 4V1PA 4JTAB 1N3OA 4QHBA 2AYHA 2P3IA 4XYXA 3VBHA 4DUXA 2ZX3A 5IYYA 2EULA 1HJFA 5B3SB 1NZCA 2VD7A 1V54C 2EXJA 4YYOA 4FXKB 2B9VA 1ND2B 1CIWA 3VQVA 5H6QA 2E32A 4L92A 2LJ2A 2VW1A 1I5ZA 1LKNA 1K42A 2HWD3 2DUQA 3WDYA 2WWJA 2XUEA 4TXWA 2OIIA 1ASJ2 4DY5A 4MW3A 4HKLA 4YM1A 5FJKA 1SDDB 4LHSA 1YUDA 2WZEA 4QKDA 3SH3A 4AEKA 3IT8A 3C8XA 4TSVA 3SPJA 3E22B 2WL1A 4OUMA 4QHZA 3ZOIA 3K0GA 2Y4UA 1I5XA 2H0BA 2P5BA 1NAEA 2EIJB 4R9CA 1LGCA 1OA3A 4LBQB 1UZZA 5T54A 1POV1 4QT6A 2I74A 3MYXA 1OCZB 3ICXA 1NCQC 1DZTA 1W6OB 4XMAA 2JE9A 3WB1A 2PYTA 1FXKC 1UJWB 1VQNV 3N9PA 4QPIC 4OCTA 1UX7A 3RWKX 2F66C 4DXTA 2YROA 3JD73 1YIPA 2RNBA 3LGRA 4E2QA 2ZR2A 1AR73 1GUIA 2WSVA 3TETA 3ZCCA 5FZAA 4X1IB 2LW1A 3CRRA 4QQOA 2OZJA 3RN4A 4UVCA 3GVMA 1HRI2 3EFFK 1R6KA 4L97A 2GC2A 2CL2A 3ZXGA 1RUI2 1Y74B 3AKPA 3JU9A 3ABMB 2BBAA 4JRLA 1RHI3 3RWNA 1U96A 1RPOA 2BTQB 3O1SA 4D7YA 5I0DA 2WRAA 1SQQH 1UWWA 2Y69C 1IBLB 4HPKB 4O2AA 3R4DB 4Y22A 4I3PA 3LUTB 3OUFA 4BB3A 4OMDA 3VL9A 5DEDA 2LW7A 1YWKA 2GSYA 3SXWA 3HBZA 2ZGTA 4DR4B 1ND3B 4YARA 3TEXA 1OXCA 5JXHA 1VJ2A 4QU2A 1O4YA 5LXTA 3VDDA 5FY1A 1IXBA 4JTNA 2IJIA 2BNOA 4X9QA 4H44B 1WZXA 4HL0A 1OD3A 2VGDA 2DURA 4GWJA 2ZS6B 5D8AA 5BNOC 2W1QA 2CAZC 3PIJA 1BKZA 4ES9A 4LFCO 2KB1A 2JRIA 5GW7A 5FCCA 1SESA 5D2AA 3WT3A 2EZPA 2OTLV 5FZCA 4DZGA 2VCBA 4JHZA 1VMGA 4EJRA 2Q5TA 2WLKA 4JI6O 2BW8A 1HXS2 4KGGA 1HRV3 3T3YA 4AFCA 5AVPA 3C7GA 1C8NA 2CTRA 5L73A 4CDWA 2W68A 1YIFA 2C4XA 2PQSA 3U0ZA 4NAOA 2JJ6A 3H1JH 4YVSC 1KGYA 2ZEXA 2QKSA 2JG9C 3EB7A 2BOBC 3UT5A 3LSDA 3EYPA 3I2FA 1CPMA 3IDEA 1BEV3 2GALA 4NYKA 2NNUA 4IXLA 3MF6A 1ONAA 2WN2A 4X8PA 4CH4A 3SYAA 5IAXA 2DFBA 2RMU2 1AJKA 2XJRA 4X65B 4XQ4A 4ZXKA 1VBC2 2X05A 2XUMA 1N34B 1CAVA 4RQPB 1SQGA 2A9HA 3OTFA 2WSSG 3O1MA 1LJ7A 4DR1B 4Y20A 1YFWA 4GJZA 1UY1A 2OIGA 4GIQA 5KUMA 2BP6A 2P3JA 1J58A 1R1A1 1S0GA 1CJPA 4ZIBA 2ZGLA 4E2LA 2G9ZA 2LP7A 3D3QA 2WLLA 2Z79A 4YG0A 1PO12 1RIRA 3MIFA 2PMWB 5GALA 5FZ3A 3WQBA 3NKGA 4BU2A 1SF9A 1RXGA 4DR6O 3KT4A 2C24A 3JYCA 4K8ZA 2D6NA 4F4LA 2XLFA 5F1RA 3UQ8A 5BR8O 5GKAC 2VULA 1GV9A 4B3SO 1XYPA 2ADQB 5KHHA 1GOHA 3CCEV 1YI7A 4ZOLA 4DW0A 3T2MA 1VQ6V 1XMQO 1VQ7V 3F5WC 2ZGSA 4FFGA 2C9AA 3A0KA 3JASB 4YGDA 2KQXA 3ZYIB 3EO6A 5A3OA 3CF6E 4LH7A 1B35A 3M3QA 1ROPA 4A7KA 2YSUB 4LK6A 4AHCA 4IE0A 2QWPB 1WCQA 3P1IA 2QA4V 1QLEB 1TGOA 1OV9A 1EPWA 2VM9A 1PZ8A 4QXHA 1MMMA 4MGIE 1NXD1 3VBFC 1HB4A 3FLTA 5EQUA 4O9EA 2W08A 2ENRA 5KHGA 1AILA 3HR0A 1GZCA 4EWDA 3GM8A 5B4XA 2JIZG 3ZRXA 3AG1B 4K0KO 2HBUA 3ZKYA 2ZXWB 2M6YA 1OCCB 2EIKB 2UUCO 4AQYO 1H1MA 2O1QA 3LFMA 4LQRA 5IJ0A 5L7OA 4E9KA 1UL9A 5CNAA 3U4XA 4BLIA 5I8YA 5A80A 2VTXJ 4LHKA 1PL0A 3UO2A 1LENA 1E79G 4EV0A 2A6VA 3DCQA 3FLRA 5IVYA 1UZWA 4XF1A 4QE9A 3OOXA 4XDPA 4LFAB 1QJFA 4NXNO 2LRPA 1F4NA 2GV9A 5DUWA 3T1HB 1XE0A 4CDUC 2RJZA 2AENA 3K06A 5FZ9A 2QTOA 3ZHUA 1IS5A 4DR5O 4H7MA 4UW6A 3ZO0B 1MS0A 2V09A 5FY8A 1PO21 2Y0IA 1TNRA 3VBSB 3WUCA 1R082 1K34A 4YHHB 1F9KA 5LHIA 4XBLA 3T0DA 1BBT1 3BEHA 5JOXA 3POBA 3USSA 1OA4A 3UGFA 1XUQA 3FMGA 4Y1ZA 4UV8A 4AQ6A 3NJZA 3FB7C 2HG5C 4QGPA 1KUQA 2D44A 4NMIA 2HLEA 3FL7A 5LW9A 3RW0A 4QGLA 1UY4A 1NCRC 4WZFA 2WABA 4RS5A 3O0VA 5C8WA 2P3YA 4D7TA 2WFPA 5LMUB 3T30A 1Q8SA 2Y0OA 4QB1A 1X9TA 5CBHA 1ZREA 3OSDA 2KD7A 2QDOA 2AGAA 3FFQA 2BTVC 2VH9A 1KD7A 3IPVB 1RUH1 1FMD1 1GQHA 2Q5ZA 3KCCA 5EBLC 3B40A 5FZIA 2JS5A 3X2QC 1BXHA 1AJPA 2FDJA 1LGNA 2Y4TA 1AR83 1YI2V 3J81N 5BY5A 5KHJA 5CKMA 1B06A 1TA8A 3TOJA 3G6JB 3L73H 4BISA 4WVMA 4CS2A 4C8DA 3RS6A 5LP6B 1GSLA 4LBJA 4BIUA 1OFNA 4QQ2A 1W8FA 3CB2A 4MVUA 1V9U1 1AR93 4JI8O 3KWVA 4IGPA 2WIIB 4RHV2 3KSCA 1QXPA 1BK0A 4RUEA 4C1XA 4COUA 4FPGA 2JG8A 1NKGA 3C3SA 5FY7A 3MF9A 4PDWB 4RFT0 4RWUA 1ZVFA 1HV0A 3V56A 2Q1ZB 1YQCA 1C1FA 2XBO1 5J2TA 4O4HA 3HKCA 3ZSJA 3PMEA 4OHZA 2VCMA 3G4SV 4KG8A 3FHIB 2UWBA 2JEUA 4IGOA 2VMIA 2XG3A 1X59A 3T1CA 1JU4A 4TV9A 3K51A 4RR3C 3T4ZA 5A1FA 1GP4A 4LBKA 4JPRA 3I2DA 2DOSA 4TOIA 2DBNA 4OHXA 5FV3A 1MS4A 5FO8B 2Y34A 1S4CA 4XXAA 4FOQA 3W7XA 4E4ZA 1M9NA 5A7WB 1AI7A 5LBEA 3ZYBA 3BY6A 3C90A 1DDLA 3IC7A 5A3NA 4Q0QA 1SC5B 1UIKA 3RZZA 4MVOA 4QQPA 4IIJA 5FPOA 3MIGA 3JD1A 1FX5A 3Q8EA 2IXJA 3M70A 5JOYA 3ZFFC 4CDXC 5C7GA 1YC61 1POV3 1LEDA 2JDZA 3MI8A 1RJ8A 2C6SA 1LULA 3RSJA 4UBGA 1FT9A 2XL7A 1UU4A 2D7FA 4IV1C 4TWTA 4R6ZA 2HVKC 1NLRA 4IV3A 4KWUA 3LB9A 1GN6A 3DKQA 2X5IA 1W6NB 5EZYA 5LA6A 1SS3A 1J59A 4A45A 5AG2A 1GOFA 1XBFA 3BODA 1WGPA 3ABLC 5IUQA 4NWVA 2BOJA 1KKCA 3CCJV 2JXAA 4B4QA 1BSMA 1WCDJ 2JIJA 2VBDA 1RM1B 2R072 3MHZA 4ORFA 3OGJA 4IEUA 4MHUA 1COV2 4X1KA 2A1XA 3S0MA 5BNPC 3A0NA 3NV4A 3VDDC 3OUHA 1QJX2 1F8VA 3HKEA 2MEV2 2WZ8A 1ASJ1 1K33A 1NA1C 3WW1A 4J7ZA 5FXWA 4X20A 2QKAA 1AI5A 3AG2C 2W39A 1OHFA 3CEIA 4U7OA 4QPGA 1H8EG 1OOPB 3H1LH 4GB32 4TQFA 4PLNA 1EV11 1WD4A 1O9GA 5CVRA 3PU8A 2IW5A 3WG3A 4AFDA 1TVKB 4FFHA 1DQ6A 4IDZA 3U1XA 2ZBJA 3P32A 5FFOC 4UAPA 5IVCA 1QGLA 2PZSA 1GWKA 4LHNA 2QZ3A 2A6XA 4FOVA 3A0HZ 4BOWA 2EIGA 3TYJA 3T2OA 2XHBA 3G6EV 1DK1A 4FOYA 1BL8A 1NVPB 1GRJA 1XSQA 2WPDG 3ABKB 4CDWC 5JR2A 4DOUA 1VMFA 5KAFZ 1S0FA 1UYYA 1NE6A 4MG2A 2VWKA 2AUYA 2YEVA 4YXWG 4XETA 2YI9A 2JX9A 3EVKA 3K46A 4Q26A 1GMMA 1YVWA 1W8ZA 4UCVA 3WW2A 1BCCH 2ZTNA 2DW4A 3CMEV 1N33O 1QVFU 3V0BA 2CNAA 1O5UA 2GNMA 4L99A 4LWSA 1HX6A 2OYQA 2RQ6A 4OXSA 4JI1O 1S2KA 4HSLA 4FI9A 5B3SC 3SCFA 3HT1A 1RUI1 4IEVA 4IGGA 1ND2C 4GKJB 2BU9A 3CLPA 1JS9A 1CZTA 2YC4A 3OBAA 5KUKA 4URAA 4JI2B 2D3RA 3K79A 1Q6UA 2BFUS 4UWDA 1GM7A 3LSQA 1DGSA 4R9BA 4B1MA 5ANNA 3GWOA 1VPHA 4FZ1A 3UGGA 1RL3A 1H6XA 3HKDA 2UXDB 1X50A 3E8HA 5JMCA 3K5NA 4YZ5A 2OPWA 4CCOA 5DG1A 3VN4A 4MTXA 1GQGA 2BJSA 3WX5A 2PHFA 5E88A 1WP7A 1ZZBA 2EIJC 3AYAA 4JVAA 1GN2A 3I2OA 2QWRB 3J8F2 3KF3A 5CG9A 4LFBB 4CXWA 1R1A3 1URFA 1WBLA 4AFMA 4LF4O 1OCZC 1VQ8V 3HKBA 1IVSA 4A5UB 5KC5A 5CA3A 3CS5A 3F7VC 3KT1A 3SJAC 2A7WA 3LE0A 3B69A 4E4SA 5FYCA 1IPSA 2VOTA 4PA4A 5CFCA 4IT5A 1H2GA 1AYN1 3SHRA 3BYWA 3F7YC 1KS4A 2VZSA 2VR4A 2KG7B 3I56V 4COVA 3FN9A 4QGMA 5A32B 1JTZX 4K1ZA 3ZMTA 3MDSA 3ES4A 2XQRA 3ALQA 4A4AA 4PQQA 1LODA 3ABMC 3N2GA 4YW4A 2BOIA 2RV9A 1YTFD 3IMNA 3STLC 1XNBA 1BHBA 4I50B 5H9PA 4CP1A 4R8CA 4X64O 4J1XA 3DUIA 4CS3A 1ND3C 3C7OA 1D2SA 3I7DA 4X8NA 3WF4A 4P9GA 5C8CA 2DYRB 1J3PA 1S2EA 2VMGA 5GZFA 1RMU1 3RYRA 3R05A 1CX1A 3D6EA 1TNFA 1SFPA 3CWBH 4OX9B 4CC5A 2AEYA 4YGCA 1LHWA 3S30A 1G7YA 1JYXA 1VE0A 3JXSA 3HMYA 4XEZA 5A70A 4CUCA 1US3A 2LTNA 1LGBA 5FZGA 5LEJA 3F95A 4TYSA 4FXGB 4GQ7A 3AMQA 4WVVA 4CZSA 1L0LH 4LBQD 1PO23 3FLPA 1RVF1 2ZGKA 4NE9A 1BBT3 1LOCA 4BQYA 1H4HA 4KP4A 4XFCA 3OYWB 3F5TA 4CXXA 4NHLA 3PVNA 2K1EA 2QE7G 2XGXA 4LF5B 2A3YA 3MFAA 4QE7A 1O8PA 3LWCA 1U0AA 3UGHA 4UCRA 4JYYA 1N36O 2YBPA 3W9AA 2B39A 1VRH1 2IUWA 4EE2A 4W4KA 1GP5A 3O0XA 3URFA 2YUEA 3T0BA 2DYSC 1XNCA 4RQPC 1LHVA 2OCHA 4IE4A 1X7NA 1V6IA 3RG0A 4GKKB 4JKLA 4NROA 4YFZA 3H7JA 2YHJA 4YZ1A 2JK5C 1RUH3 2YICA 1K8AW 1FMD3 4LNVA 4QKFA 5ISLA 5JMOA 3UKTA 1MZFA 4C0BA 3TWIA 4GCZA 5ERLA 2AGSA 4XUOA 1UFIA 5JVDA 2FCTA 4Q2FA 5D5QA 4GZ9A 4AVAA 3U4SA 3ZXEA 2DQ3A 4WFAV 4JI4B 3I59A 1SA0B 1G1XB 1XQ8A 4M3CA 4BZ4A 5LMNO 2E74B 5CA1A 2IZWA 1SZXA 5BNNA 4OPHA 3TEYA 2J1EA 2ZHKA 2GP3A 4UW4A 2R1DA 4DV3B 5J7MA 3GHMA 1V9U3 1H8TB 4BQ3A 5C3SA 3RZKA 2ITCC 1J3RA 4Y5SA 5K8SA 3E35A 2AEZA 2WQZC 1NY71 1YYNA 4NAMA 2OQ6A 1BYHA 4PHZA 1TZOA 1I94B 2XBO3 5CA0A 1RUC1 2IU3A 2R7EB 1QLEC 1URXA 2ZOEB 2KA3A 5EIBD 2J1VA 4LBEC 2W0FC 3N27A 3A0RA 1GQPA 4CEWA 2XT9A 2DU0A 3MEPA 2HWB1 3A7QA 1Z5WA 1RP3B 3AG1C 3ACHA 4R4XA 2J1AA 1HB1A 3JSNA 1OCCC 5EHDA 2EIKC 3FHQA 2Z42A 4HT1T 5K0UB 3CJHB 1QY4A 2VOWA 5FP7A 1UMHA 3R4UA 5CN0A 4XILA 2X10A 1I08A 2BRTA 2W1WA 4AGVA 4ZU7A 3VL8A 2OCCB 4DQAA 1DGRA 2YGMA 1LHUA 1FFTB 1R64A 5LRRA 4AI3A 4P9WA 3E6DA 4UT5A 2B9UA 1IBKB 1SQ4A 4N53A 3CCMV 1N0NA 3E6CC 5GLUA 4ONUA 4LMFA 4P5HA 4NOTA 5EC2C 1HWYA 4RHV1 4CTEA 1XMOO 3IWZA 4DR2B 2D5FA 1JHJA 3WNNA 2WAOA 1F2NA 1VAKA 2B5HA 3O1UA 3VBSC 3USUB 3B94A 1PNKA 4GMP3 4RGAA 1DLLA 1AR62 4R9AA 2C9KA 5JIAA 5HXMA 2CGOA 4JV5B 3ZIXA 4FVMA 2YFZA 3UCSC 4I0XB 4ASUG 3ZYPA 3VBUB 4FCAA 4FT8A 5CFDB 3K9SA 2F4VO 2WS91 4XACA 3HNYM 3N9OA 1AP6A 1ST8A 5DECA 3MW3A 3O1VA 2WLMA 4UOJA 1S0EA 4CSWA 3VBOA 2BSKB 3ON7A 4IQPA 4YZ2A 1VBD1 1KJLA 2P90A 3I2HA 3POSA 3VKNA 3WFVA 1ZZ9A 4FTBA 3JB8A 1UOBA 2IFRA 1PHMA 1EV13 3ZMSA 3VBRA 2ZEZA 4DXSA 1LB2A 1CESA 4E2SA 4LO7A 5JPNB 1YEWA 1IZ3A 4V2WA 3TNPB 4FAGA 2UUAB 4IUGA 4ZU5A 3OPZA 3KM5A 1ZA4A 3U10A 2VZPA 2UXXA 2LROA 4SBVA 5LP6C 1VBE2 2YY1A 4OI2A 1AL0G 3ZMVA 1CD3G 5IVBA 2YMZA 3AG3B 4DYLA 2WA3A 1NH2B 4NIGA 1C8M3 3QCWA 3OEEG 5C3RA 4WVZA 4LUKA 2F17A 4G3YC 3CE2A 1LRHA 4N9HA 2VG9A 4PDWC 1MSDA 4PLMA 1S1AA 2HWC2 1WD3A 1NLSA 4LTAA 1M57B 1O3TA 4DV4B 1OLRA 2PLV1 1L8DA 3AKSA 4GLXA 4DV0B 2HP8A 2VOKA 3QTCA 5BMVB 1FPOA 1LOFC 4IE7A 5T5JA 5FK7A 3EHKA 2XOKG 1UY0A 2DBIA 3AFKA 1VRBA 3KV6A 1WBFA 4M3CE 1H2SB 3G71V 2UYAA 1FJGB 3MLLA 4TLGA 3HPNA 3HNBM 2XQXA 2WDBA 4I0BA 2XHKA 3GJBA 3BIEA 3D3AA 1AB3A 1C1LA 1F35A 4B3MO 2VZOA 4MTGA 2VUCA 2XPJA 4DV1O 3ZR5A 3CJIA 3N3HA 4CPBA 5CFCC 4LOSA 4CDQA 3VD7A 2KKWA 3BVOA 2WLPA 3IB3A 5JI9A 4XBFA 2HEPA 4GWMA 1QH7A 5DM6V 3ZPYA 4UFKA 2P17A 4F3JA 4O4LA 2BUKA 1FKAO 1WN7A 3J7LA 1OCOB 5A7OA 2W0XA 4O2BB 1XILA 3I4IA 3WP4A 2EX3A 4IW3A 3B2EE 4JHTA 1AYN3 2ZR3A 2ZKOA 2YXYA 3TBDA 3QVNA 5C3OA 4NIHA 1UOFA 3HQUA 3V0AB 1RM1C 4BQ4A 1CONA 5LL6Y 1NTZH 1LU2A 4Q20A 1LR1A 3ETQA 3I3QA 3VHOA 5IATA 4BLJA 3NV2A 5FQ0A 1H8HG 5H5NA 3BTZA 3WDXA 4RAIA 3FBMA 1IG3A 5H9CA 3D4KA 4L87A 3FX3A 3JARB 2XJPA 4XPVA 3ZFGA 4EB6B 3IIIA 2RJ2A 4W65A 2Y6LA 2LFRA 4YW2A 4JYAO 4MVZA 2GH2A 5I0SA 4Q4X2 1W9SA 4XF9A 3SPGA 2RM21 3OUJA 1RMU3 3J8F1 1ENVA 4P9OA 3VD5A 5J2UB 2LO1A 1W6PA 4BW9A 1VB2A 3ABKC 4JAVA 4UXNA 4LBLA 4NHXA 4FLTA 4Q29A 2R062 3ZIWA 1VALA 1PK6A 3PUQA 1EM1A 2ZX4A 1MG1A 5GM0A 4UF0A 2KSDA 3A2FA 3CCUV 2FCUA 1WJZA 1JOBA 2RHPA 3QO5A 2CDPA 3OBTA 1BVP1 1KEXA 5JCOA 4DUWA 2UY9A 4OHYA 1MOFA 2ZGUA 3H8RA 3VHNA 2XWBB 1W2BU 3KZ4C 2E7QA 1YI9A 1VIWB 1KC8W 5HPOA 4FM2A 1RVF3 5JOZA 1HN1A 3SYOA 1J3QA 2ZM6B 5FPZA 4BXSV 4DUYB 2QNKA 2A75A 5A1LA 1YJWV 5FYZA 1DLBA 3OCPA 1I5YA 3THPA 1Q43A 2W92A 2E31A 2Z69A 3LQCA 3NNMA 1GZWB 4FM0A 3ZRSA 4OI4A 4TUYB 1VRH3 3ZXJA 4UVBA 1GN4A 1WW5A 5I0UA 5LA9A 3GZEA 4L9BA 3UKNA 2DCTA 3AJZA 4OI0A 3RYHB 2QQVA 1RUF1 4W50A 2N7GA 2RR12 4XJUA 1Q8QA 5A3UA 4PF5A 4BHPA 3OMNB 2RS52 2XAHA 2XLGA 4AFAA 2QQNA 4LORA 1WA4A 2J1SA 3FB8C 1Z7S2 1Q8OA 3T2QA 4WM7B 4XF3A 2RDSA 5TSWA 1OLMA 3K08A 2WT0A 3ZN5A 1RTVA 2PYJA 2SLIA 5F5IA 2R043 3ATGA 2Q7GA 1L3JA 3ZXKA 3AK3A 4I55A 2ZDIC 2FCVA 2IBZH 2B9ZA 2PY5A 3HD8B 1RSOB 2DMXA 5FMOS 4AAXA 2PF4E 2HYKA 2A73B 4Z82A 1PMHX 3POWA 1W2NA 4JQTA 5IDJA 2CTQA 1NVPD 1AXKA 1IBLO 4A6SA 3JAKA 4M0HA 4NUBA 3IDAA 3M8LA 1GAXA 4CEWC 3WW3A 3FC0A 3WXPA 3TN91 4DR4O 3CP1A 4X89A 2V7QG 2RS12 3A21A 1G8MA 3TJTA 1MSWD 3A8TA 1RUC3 2A70A 2VWJA 2AHYA 2XL9A 4UW3A 3RYFB 1QOSA 3OMIB 3GBWA 4AR2A 1HR0B 5F3GA 2NLJC 1L1FA 3DL3A 4W6XA 1DZQA 3THCA 2KXLA 2HWB3 4I0WB 2CH7A 2Q8OA 2GUZA 5DAPA 2ILMA 1ACCA 2DYRC 1QJU2 3LKJA 2ZINA 4SLIA 4KL1A 2QQOA 5JI7A 4CEYA 3KVBA 2R16A 3K59A 4YVWB 2VUDA 4EN6B 1WLDA 3TEZA 3HAGA 5HFMA 2VZ3A 1P4RA 4BJ0A 4PELA 3HNMA 5KLVH 3ACFA 3S5QA 3VKMA 3FAVA 4Q4V2 2ZNIA 1YJNV 4BH9A 3Q4HA 3MW2A 4QU1A 5IJ9A 1H9WA 1U5ZA 4H55A 1R3LC 2PELA 3AX4A 4RHV3 5KXEA 5GJ6A 1ZBA1 3SISA 1EBOA 4X65O 4WBNA 1OQDA 2BTOA 1W8HA 3VBOC 3MDPA 1N34O 1GH6A 2XONA 4IHJB 1S5LZ 1YIJV 3WCRA 4CYDA 5E1AC 2A79B 4FSJA 2VBPA 3L74H 4QJFB 1HQLA 2HEVF 3THOA 4M3CF 4Z2AA 2ITDC 1SLCA 2WS93 4P00B 1H2LA 3VD4A 1AR5A 2W9XA 3FHAA 4NRQA 3LEKA 2JGDA 1VBD3 5KBFA 4X8AA 1H4GA 3RRDA 1W03A 2E5LB 1RYYA 4TTGA 3HOBA 3POFA 4AI9A 5GZGA 2IXKA 5FWJA 3OG2A 3WF1A 2JIGA 1XSRA 4AZZA 1P7GA 2O8OA 1L7RA 1TVGA 1REDA 2WBKA 2I45A 4QPIB 2FDKA 3HN1A 2EXHA 5FPUA 1ZZCA 1GWMA 1JYNA 1SCSA 1VBA2 2ERFA 1VARA 1M56B 4XJAA 2WZPP 2WT2A 4UFIA 2YIDA 3GZAA 1MEC2 2JDKA 4ZBMA 2VZRA 3SKVA 4JV4A 4D94A 5B4NA 1PGW2 5LCWL 3M4FA 2V72A 3EXAA 4P02B 1BQPA 2Q0AA 2BNNA 2DTWA 2H3OA 1SERA 3HBKA 3CCLV 1JUIA 2GDFA 2LUWA 2QJVA 1W8TA 3H3ZA 3B3QE 4ZXEA 4WZCA 3H1YA 2PLV3 1OLME 4RFRB 4QX1A 5LGNA 3ZRWB 1SHWB 3J26N 2KR2A 5IE9A 3DXRB 3IZOA 4H33A 1NBMG 1FXHA 3M3CA 5CIRA 3DEMA 4ABMA 1KQRA 3PLQA 4CCNA 5CBLA 5FAXA 1UU5A 4TV8A 4K3UA 5EIYB 3CJXA 2UURA 3OPTA 1O59A 4CDQC 3T1MA 4LFAO 5K0UC 2VQEB 4Q0VA 2YXSA 3WDTA 1B04A 3N9LA 4LA2A 4CP9B 3T1HO 1EAH1 4TWKA 1MA1A 1S0VA 1VMHA 4MGKE 1UYXA 2JENA 1TUBB 2V5DA 1K5MA 4MZUA 3T1LA 3L75H 4FM1A 4JI7B 2VQFB 3H01A 2OCCC 3TXSA 3HPLC 4YHHO 2JJ2G 2JDAA 3QACA 1ZLZA 3K04A 5T5LA 1VBE1 5DUVA 4LKDA 3AB0A 1XNRB 1W28A 1O8SA 4UB6Z 2WA4A 1R1ZA 4HONA 5CADA 2JECA 3MAQA 1XC6A 1OVPA 1CWPA 4QGNA 1C28A 5LMUO 3VGIA 1PM4A 1YRZA 2EXIA 1AR4A 5CMUA 3QOPA 4MGQA 5LB6A 1GK9A 1CZVA 3BHPA 1W6MB 4WFEA 1UZYA 4Y3OA 5KMGB 4WFHA 4LF6B 2QQWA 1DP0A 1N1SA 3VBUC 5FMBA 5CFDC 3RT3C 1SBFA 3AG7A 3T4VA 2BNMA 3B4SA 5FY5A 2CTVA 2VECA 1XNKA 1W0JG 2OT5A 4DRXA 4DV2B 1Y43B 2HWF2 4ES8A 2G1MA 2GBOA 3N35A 4OMCA 1AX2A 4XFIA 1JOJA 5LK7B 4FPOB 1FFXA 4EN7B 5C9AA 3ZYHA 3ZHVA 2IXLA 1H1IA 3N2KB 5DDJ2 3ZS8C 4EWEA 2X6AA 2P4EA 5L36A 3B09A 2JDNA 3T2TA 2JGUA 1TME1 2N74A 2TUNA 3RYCB 2K46A 5FYUA 3ZVXA 2RM23 1N1YA 2RJLA 1OHHG 3J8F3 5H9RA 4YW1A 4ZI7B 3A4UA 2AACA 3ZSLA 3RFRA 3ETDA 2JJ1G 3JATA 5C70A 2CGNA 5FP3A 1EZJA 1D2QA 5IVJA 4XFBA 1FD9A 4C7UA 4JI0B 1IG0A 4Q1RA 3OE7G 5F9TA 3AG3C 2X53S 3H0OA 5J3UA 4P9YA 1Q81W 1NE4A 1MQTB 4CH6A 1UD1A 1THZA 1CAUA 3KGZA 5FR3A 4HK9A 3LIGA 4XBQA 4YGEA 4WVWA 1FOD1 4X1YB 4LR4A 1JU3A 4LNUA 3MW4A 2VCAA 4DO0A 2ZMNA 4GKXA 1RUD2 3KG2A 3FBYA 3EMRA 4YWAA 1HV1A 1H9PA 2CY6A 3OGVA 1R6NA 4P2ZA 1R092 4XUPA 2VW0A 1AROP 4C90A 1V6NA 2D3OW 5JAXA 4DUVA 1RUF3 2K2SA 3JBG1 5F2SA 3GXUA 4YM2A 4AVBA 2AZ0A 4KHPB 4P9PA 2Q8EA 3JCZA 1OURA 1W59A 1QQP2 1Y4WA 5EYPA 1RUE1 1CVNA 2HBTA 2R6QA 1E5RA 3RQ0A 2Z0AA 2Y6HA 4AE2A 4W8JA 4I4TA 3WG4A 2DVAA 3D8CA 1KB9F 2K9ZA 3G67A 3SPIA 5KX5B 2QQMA 4K8FA 1QOTA 1J95A 2E76B 2DYCA 4XTMA 4XAEA 2OS2A 2YXHA 1WCSA 3RZMA 1D5AA 3FB5C 1F31A 4DR3B 3LOIA 4KNCA 3N7JA 4NTYA 4YW7A 4YNIA 1KYOF 1RPRA 5FWEA 4KWJA 3K3NA 1RJ7A 2VO5A 2YI8A 1NCRB 4MGTA 3TN93 4A6OA 3E8GA 1X4TA 2QSAA 2WZR2 4FPKA 1SMVA 3ML0A 1NH2D 2PHLA 1F4MA 3RI8A 4JTCB 4YM3A 1SFNA 1PMIA 4JKKA 4JGZA 1VF6A 4ASMB 1EUTA 4Q4Y2 1QMJA 5KHIA 2Y64A 4I0AA 5GONB 3RBZA 2F6BA 3APBA 3ZX7A 5L9VA 3K57A 2FMYA 1XPWA 4N21A 1NX9A 3ZFEA 4J11A 2W2IA 4I09A 1CAWB 4J9YB 2DTYA 4FP2A 2PHWA 1X36A 3PNAA 1PNFA 3AMHA 5IY5C 1XNQB 4A3XA 1CAXB 1F51A 1AVMA 3E8BA 3AMMA 3AKRA 4KU7A 2H0VA 3FJSA 3VBHB 1K3IA 3SEPA 3KGLA 1WLWA 3CL1A 2ZNJA 3LSEA 4QX0A 4E8DA 5FZLA 3BA9A 1ZL8A 4GKJO 2E75B 3IAPA 4I2OA 4LF8B 1W8NA 1N1VA 4U3JA 1N4CA 4JI2O 4DEVA 5EBMC 4DY3A 2VRZA 1ZBA3 3ZYJB 5FRAA 3OUSA 4JF3A 4A2UA 1W0OA 2DFCA 2WQ8A 3VZLA 4LO5B 2UXDO 2IVIB 2HWD2 1VLNA 5JH7A 1K5JA 3QF7A 4O4IA 2XLAA 4H0LB 4HYOA 4FFBA 4GJYA 1PGL1 4META 3DC6A 4O4JA 5JZGA 2FQPA 4LFBO 2Y26A 1N0JA 4MSVA 5EJ1B 5IT9N 1S0DA 1JZ6A 4DW1A 4JGYA 5C4WA 2YGLA 1JMUB 3WD5A 4PD4F 4PV1B 1LOBA 1HDKA 4DMIA 1ULOA 4LE3A 1S3JA 4UCUA 1K5QA 4BE3A 2R1BA 2XASA 4YFWA 5FZ6A 1DF5A 1N47A 1ZNPA 4WFBV 1XDCA 1W9YA 3WV6A 2Q69A 4KMQA 1FPN3 2BQPA 2J1UA 4LULA 4WM8A 5LATA 5ABJA 3APOA 3ELNA 3N9MA 5FOBB 3LDKA 1BK1A 1EUUA 4FAHA 5F3IA 2WWWA 4LF9B 3JD72 3O1PA 5HV0A 1AR72 4IE6A 4O2AB 5BYNA 3K03A 4Y22B 2AC1A 2ZIMA 1FV3A 3O0WA 1KP3A 4HG6B 1UOJA 2OVUA 2GN7A 1CIYA 5LXTB 2W6JG 5LYJA 3VDDB 5LA1A 2WNUA 1B3QA 1RHI2 3GF6A 3RWRD 4JYBA 2GC3A 5D8AB 1CPYA 2OUHA 2YPDA 1GR3A 2BBVA 4OX9O 2XJQA 2JEMA 4ARYA 4FFKA 3CX5F 2WT1A 5H2FZ 1D7PM 3ZIAG 1KMIZ 3PHMA 4F6RA 3AP7A 5L3GA 4LT5A 3WZ1A 2FDHA 2DVGA 3AP5A 3LA7A 2MNGA 2IU0A 4CBCA 4OLLA 1T6BX 2W91A 5H6RA 1EAH3 4YVWC 4CDWB 3LEGA 3AL6A 4MOAA 1Z78A 2BSKA 2CDOA 3POIA 1R73A 3B9IA 2JDUA 1R3KC 1H2KA 1C57A 5FNVA 3UKMA 1AJNA 4C1WA 3I3EA 1D0HA 3UT5B 1O91A 1HRV2 1M90W 2V5YA 3LA3A 1VBE3 4QX3A 2WNVA 5GTHZ 4TT3G 1HB3A 1JYIA 4LF5O 5FYIA 1J5EB 5A6XA 3JALA 4IL7A 5IAVA 5CBGA 2W87A 1YLLA 3JCUZ 4GA9A 2CE4A 1JA8A 1DG6A 2YU2A 1CAVB 1WUVA 4BQ1A 2JE8A 1AF9A 3SCGA 4Y20B 1YITV 3ZDSA 4IE5A 4HAMA 2UXCB 4GKKO 4FPFA 4XFFA 2HWE1 1REFA 2OWOA 1QF3A 5FYYA 4JZGA 1O7FA 1VP6A 2P3KA 5EJZB 3L2HA 2WLLB 4N7UA 5IK8A 2C1FA 3CBNA 3RNSA 3OGIB 2EIBA 4J7KA 4P30A 3SYQA 1UMIA 3WINE 2OXBA 1ZRDA 4JI4O 5CB4A 2VJXA 3AP6A 5JJJB 1EYBA 1S76D 4K9SA 3LSUA 3D36C 2R30A 4ZOLB 1TME3 4B3RB 2D3PA 2VL4A 1QJZA 3RZJA 1GKBA 2QWQB 4DV3O 2Y60A 1I9RA 1I0HA 2DE0X 4CH3A 4QM9A 1B35B 4QX2A 4I01A 2Q1MA 5FXVA 3ZXDA 3HVDA 4XW3A 1UY3A 2OKXA 5LHGA 1PGSA 3QNEA 1I94O 2B46X 1M56C 2QJ1A 1QEXA 4PT6A 3MLKA 1AVBA 1MS3A 3OGCC 4S2HA 2XR4A 2ZGOA 3B5LB 2CTWA 3EBRA 2GMEA 1RUG1 5DZGA 4DB5A 1L7LA 3OGSA 2OX0A 4JTOA 2HFEC 3IC9A 4L8JA 1GP6A 1IS3A 4RUFA 5IJ0B 5L7OB 5LOVA 4CU7A 5FYMA 1FOD3 2XVGA 2VXJA 3MIHA 1X8EA 3H50A 1PNMA 4TZDA 4UI9L
chains in the Genus database with same CATH topology
4XJWA 1EP0A 1ZYBA 2D6PA 3EXUA 2VUJA 4AGVA 3DV8A 3KT7A 4ZU7A 3VL8A 1YFYA 2D6OX 4DQAA 1C5HA 1MZ5A 1DGRA 2B42B 1DRYA 2YGMA 1FV2A 1QDCA 4MYEA 4WBBA 4EN8B 2R32A 2PLV2 1LHUA 5HBAA 5LRRA 4AI3A 3NL1A 3PVBB 4P9WA 3E6DA 3VBSA 2B9UA 4CP2A 1SQ4A 4N53A 4MXVA 4R8HA 4IERA 4AGGA 1I6XA 4RGGA 2CWMA 4XHBA 2LM3A 4OVEA 1LU1A 4QD2A 4OFGA 2ZMKA 4AK3A 1K5MB 3E6CC 5GLUA 3B9CA 1BEV1 4ONUA 4P5HA 4NOTA 4CTEA 4RHV1 1AUYA 3IWZA 4XXPA 2D5FA 4XBNA 3JBG3 1F2NA 1VAKA 4BMEA 2FZ2A 4OHWA 2B5HA 3M3EA 3VBSC 1ENQA 3USUB 2D97A 3B94A 1D0GA 1N1TA 4N53C 2VOXA 1RUJ2 2JE7A 4IEOA 3B00A 3AZYA 3ILFA 1XQNA 4GMP3 4N7IA 1PIV2 2OUJA 3O5SA 4RGAA 1TMF2 1DLLA 4XE9A 4Q0SA 3VZKA 1AR62 4R9AA 5J48A 1RUE3 4FVVA 1ZZ8A 5JIAA 2CGOA 3ZIXA 5DUUA 1S55A 5DUXA 2HWF3 4RS5B 2G4IA 4M00A 4YZ3A 4A7ZA 3FFZA 2AREA 2MPFA 4Q0PA 3ZYPA 3VBUB 1O3SA 4FCAA 3FZ3A 4PIXA 5HSXA 4FT8A 5CFDB 1A78A 3IPVA 2DCYA 1UAIA 1VBB2 5DDJ3 5BV6A 4U2AA 2WS91 5FPXA 4FPCA 1MS9A 3POYA 1IGOA 2HEWF 2TBVA 1J1TA 1ZRRA 3NO8A 4KBBA 3OY8A 1W6QA 3MW3A 2BPA2 1OQEA 1S0EA 3VBOA 4IQPA 1C8M1 4HVOA 1QNWA 4L2NA 4YZ2A 2HJIA 2PHUA 3ZYRA 1HKDA 1VBD1 5AC92 1KJLA 3WP6A 3POSA 4ATEA 1ULGA 1YO8A 2GNTA 3VKNA 4IEQA 1ZZ9A 4FTBA 3JB8A 2DVFA 2IFRA 1RUD1 2QVSB 2A3XA 1PHMA 1AX0A 1EV13 1OMIA 1OQ1A 3TB0A 1POV0 1AJOA 3VBRA 2GU9A 4C5WA 4P9IA 4Q8KA 3ACLA 4CP0A 1LB2A 1CESA 2X8KA 4ISQA 2ZZJA 4MGZE 4GXLA 2WWSA 4BIOA 5I93A 4AI8A 1J1LA 2BWCA 5EV7A 3WDVA 4P9JA 4E2SA 1BVVA 4HVRA 5C9AB 4LO7A 5JPNB 2Y38A 1PO22 2ZGQA 1IZ3A 4N9IA 4K1YA 1DZRA 3TNPB 2FBEA 4FAGA 4WVMB 1N3PA 4ZU5A 3OPZA 3VBRC 3KM5A 1A3KA 5T3NA 3WUDA 1SBDA 1ZA4A 3KD4A 3U10A 4SBVA 1QU0A 4GWNA 1VBE2 2YY1A 2VQ0A 4PDWA 2YZ4A 2ZGRA 4JDOA 1AL0G 1OPOA 3GZUC 4OI2A 4B3NA 1CD3G 4HFSA 2IWGB 2YMZA 2JG8B 2WA3A 2VVDA 3MPBA 1C8M3 4C0HA 3DPRA 3QCWA 2G9FA 2OPKA 3R0RA 2VNOA 4FPHA 2D40A 4WVZA 4LUKA 3UJQA 1JN2P 4ZU4A 1LOFA 4G3YC 1LRHA 5JVVA 3WCSA 1LOGA 1UW8A 4N9HA 4F83A 4AVCA 2VG9A 1X33A 4PDWC 3K48A 2IC1A 1V6KA 1XE8A 1MQTA 4PLMA 4RR3B 3TNQA 4Z92B 3H9AA 1S1AA 2F4PA 2HWC2 1WD3A 2ZHNA 1AR92 2XWJB 4HKWA 4K20A 1NLSA 4LTAA 2RM22 4AHZA 1GQWA 1MS5A 1O3TA 3DPRC 1OLRA 2PLV1 2WBPA 2QFEA 3AKSA 4AEDA 1BMV2 4LLOA 1R093 2VOKA 1GLHA 1M4WA 5JPMB 2AH2A 2ATFA 1LOFC 4INDA 4OI1A 4AHWA 3NAPA 4MVTA 5T5JA 5HXVA 1ENXA 4H14A 3EHKA 4O9GA 1YXWA 1MQTC 1QH6A 1CAUB 4MV2A 3AFKA 2QQPA 2WKKA 1HQNA 1GANA 3AKQA 1WBFA 4M3CE 1WW7A 2NQYA 3ZXAC 2UYAA 3MLLA