1H2OA

Solution structure of the major cherry allergen pru av 1 mutant e45w
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
159
structure length
159
Chain Sequence
GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILWGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSHYHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR ALLERGEN PRU AV 1
publication title Mutational Epitope Analysis of Pru Av 1 and Api G 1, the Major Allergens of Cherry (Prunus Avium) and Celery (Apium Graveolens): Correlating Ige Reactivity with Three-Dimensional Structure
pubmed doi rcsb
source organism Prunus avium
molecule tags Allergen
total genus 30
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2002-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 1h2oA00
2LUZA 2E3SA 2K5GA 3ZVUA 1EM2A 2QIMA 2M47A 2LE1A 1XN5A 4MNSA 1Z94A 4JHHA 3Q63A 4IH2A 4Y31A 3W9RA 4C9CA 1LN3A 4LGBA 4IGVA 3TVRA 5JO1A 1T17A 4A85A 5C9YA 1X53A 4Q0KA 1B6FA 1LLTA 1LN1A 4MAPA 3UQHA 2E3NA 3KLXA 2LPXA 4M9BA 2EJXA 3NR4A 3NJ1A 1ICXA 2L8OA 4A86A 4MA6A 1ZXFA 3QSZA 3KB3A 2FLHA 3Q6AA 4REIA 4GY9A 1XDFA 5I8FA 2E3QA 2E3PA 3KDJA 4PSBA 5E4MA 4BK7A 4A8UA 3H3TA 3NS2A 4N0GC 5BRLA 3JRQB 3KAZA 4FPWA 4IGXA 3F08A 1H2OA 2KTEA 2K7HA 2LDKA 4XRWA 4BK6A 3H3QA 4REHA 1TXCA 4C94A 2L9PA 2M89A 3OTLA 4JHGA 3H3SA 2LF2A 4DSBA 4R7KA 3H3RA 3CNWA 3P51A 1TW0A 1QMRA 4A80A 3IE5A 5I9JA 3RT2A 3E85A 3OH8A 3KB0A 4IH0A 3NMHA 2RERA 5JO2A 2I9YA 4QIPA 3P9VA 4A83A 1XFSA 3NMVA 1BTVA 2NS9A 1JSSA 5E46A 2KEWA 3OJIA 2VQ5A 3TFZA 4BTZA 3Q64A 4A84A 1KCMA 3KDHA 5E4DA 4B9RA 2A1LA 4C9IA 4XRTA 2KF2A 2KCZA 4LA7A 2WQLA 2E3OA 3PUTA 2MOUA 3NMNA 4IGWA 3P0LA 2LGHA 3ELIA 3RT0C 3QN1A 2E3MA 2N4BA 3NEGA 3KL1A 3R6PA 2LCGA 4A87A 3C0VA 3KAYA 3KDIA 2RESA 4JHIA 2REZA 2Z9ZA 4LGAA 3W9KA 2LEQA 4Z3LA 5E4BA 3NMPA 4A8VA 3NEFA 2QPVA 1T27A 3WG8A 2NN5A 4BKDA 2L65A 4IGYA 4LG5A 3OQUA 2N4AA 2PCSA 2GKDA 4DS8A 4DSCA 3JRSA 1E09A 4JDAA 4N3EA 3NJOA 3UIDA 3NMTA 2LAKA 2R55A 4OICA 3UJLA 4BKCA 1VJHA 1LN2A 2Q3QA 4IHRA 1FM4A 2BK0A 1XUVA 2PSOA 3FO5A 4A8GA 3K90A 3IJTA 3K3KA 3PU2A 3GGNA 4WVOA 1XN6A 3NJ0A 4REJA 4A88A 3RD6A 4M9WA 4JDLA 2FFSA 2Z9YA 2D4RA 2VNEA 4A81A 4RYVA 1IFVA 3NI8A 2LIOA 1UW5A 5JNNA 5AMWA 1FSKA 2E3RA 2IL5A 3TL1A 3TVQA 1BV1A
chains in the Genus database with same CATH superfamily
2LUZA 2E3SA 2K5GA 3ZVUA 1EM2A 3HXMA 2QIMA 2M47A 2LE1A 1XN5A 4MNSA 1Z94A 4JHHA 4QDDA 3Q63A 2YH6A 4IH2A 4Y31A 3W9RA 4C9CA 1LN3A 4LGBA 4IGVA 3TVRA 3GKEA 5JO1A 1T17A 4A85A 5C9YA 1X53A 4Q0KA 1B6FA 1LLTA 1LN1A 4MAPA 3UQHA 2E3NA 3KLXA 2LPXA 4M9BA 2EJXA 3NR4A 3NJ1A 1ICXA 2L8OA 4A86A 4MA6A 4E6FA 1ZXFA 3QSZA 3KB3A 2FLHA 3Q6AA 2LAFA 4REIA 3HM9A 4GY9A 1XDFA 5I8FA 2E3QA 2E3PA 3KDJA 4PSBA 5E4MA 4BK7A 4A8UA 3H3TA 3NS2A 4N0GC 5BRLA 3JRQB 3KAZA 4FPWA 4IGXA 3F08A 1H2OA 4N76A 2KTEA 2K7HA 2LDKA 3NQNA 4XRWA 4BK6A 3TGOC 3H3QA 4REHA 1TXCA 4C94A 2L9PA 2M89A 3OTLA 3GTSA 4NCBA 4JHGA 3H3SA 2LF2A 4DSBA 4R7KA 3H3RA 3CNWA 3P51A 1TW0A 1QMRA 4A80A 3IE5A 5I9JA 3RT2A 3E85A 3OH8A 3KB0A 4NCAA 4IH0A 4N41A 3GOBA 3NMHA 2RERA 5JO2A 2I9YA 4QIPA 3P9VA 4QCKA 4A83A 1XFSA 3NMVA 1BTVA 2NS9A 2ZYLA 1JSSA 5E46A 2KEWA 3OJIA 2VQ5A 3DLHA 3TFZA 4BTZA 3Q64A 4A84A 1KCMA 3KDHA 5E4DA 4B9RA 2A1LA 4C9IA 4XRTA 2KF2A 2KCZA 3HVRA 4LA7A 2WQLA 2E3OA 3PUTA 2MOUA 3NMNA 4IGWA 3P0LA 2LGHA 3ELIA 3RT0C 3QN1A 2E3MA 2N4BA 3HK2A 3NEGA 3KL1A 3R6PA 2LCGA 4A87A 3DLBA 3C0VA 3KAYA 3KDIA 2RESA 4JHIA 4QDFB 2REZA 2Z9ZA 3GL2A 4LGAA 3W9KA 2LEQA 4Z3LA 5E4BA 3NMPA 4A8VA 3NEFA 2QPVA 1T27A 3WG8A 2NN5A 4BKDA 2L65A 4IGYA 4LG5A 3OQUA 2N4AA 2PCSA 2GKDA 4DS8A 4DSCA 3JRSA 1E09A 4JDAA 4N3EA 3NJOA 3GTEA 3UIDA 3NMTA 2LAKA 2R55A 4OICA 3UJLA 4BKCA 4KPYA 1VJHA 1LN2A 2Q3QA 4IHRA 4QDFA 3HO1A 1FM4A 2BK0A 1XUVA 2PSOA 3FO5A 4N47A 3K90A 3IJTA 3K3KA 3PU2A 3GGNA 4WVOA 4A8GA 1XN6A 3NJ0A 4REJA 4A88A 3GL0A 3RD6A 4JHYA 4M9WA 5EKQC 4QDCA 3F73A 4JDLA 2FFSA 2Z9YA 2D4RA 2VNEA 3GB4A 4RYVA 4A81A 3HJFA 1IFVA 3NI8A 2LIOA 1UW5A 5JNNA 5AMWA 1FSKA 2E3RA 2IL5A 3TL1A 3TVQA 1BV1A
chains in the Genus database with same CATH topology
2LUZA 2E3SA 2K5GA 3ZVUA 1EM2A 3HXMA 2QIMA 2M47A 2LE1A 1XN5A 4MNSA 1Z94A 4JHHA 4QDDA 3Q63A 2YH6A 4IH2A 4Y31A 3W9RA 4C9CA 1LN3A 4LGBA 4IGVA 3TVRA 3GKEA 5JO1A 1T17A 4A85A 5C9YA 1X53A 4Q0KA 1B6FA 1LLTA 1LN1A 4MAPA 3UQHA 2E3NA 3KLXA 2LPXA 4M9BA 2EJXA 3NR4A 3NJ1A 1ICXA 2L8OA 4A86A 4MA6A 4E6FA 1ZXFA 3QSZA 3KB3A 2FLHA 3Q6AA 2LAFA 4REIA 3HM9A 4GY9A 1XDFA 5I8FA 2E3QA 2E3PA 3KDJA 4PSBA 5E4MA 4BK7A 4A8UA 3H3TA 3NS2A 4N0GC 5BRLA 3JRQB 3KAZA 4FPWA 4IGXA 3F08A 1H2OA 4N76A 2KTEA 2K7HA 2LDKA 3NQNA 4XRWA 4BK6A 3TGOC 3H3QA 4REHA 1TXCA 4C94A 2L9PA 2M89A 3OTLA 3GTSA 4NCBA 4JHGA 3H3SA 2LF2A 4DSBA 4R7KA 3H3RA 3CNWA 3P51A 1TW0A 1QMRA 4A80A 3IE5A 5I9JA 3RT2A 3E85A 3OH8A 3KB0A 4NCAA 4IH0A 4N41A 3GOBA 3NMHA 2RERA 5JO2A 2I9YA 4QIPA 3P9VA 4QCKA 4A83A 1XFSA 3NMVA 1BTVA 2NS9A 2ZYLA 1JSSA 5E46A 2KEWA 3OJIA 2VQ5A 3DLHA 3TFZA 4BTZA 3Q64A 4A84A 1KCMA 3KDHA 5E4DA 4B9RA 2A1LA 4C9IA 4XRTA 2KF2A 2KCZA 3HVRA 4LA7A 2WQLA 2E3OA 3PUTA 2MOUA 3NMNA 4IGWA 3P0LA 2LGHA 3ELIA 3RT0C 3QN1A 2E3MA 2N4BA 3HK2A 3NEGA 3KL1A 3R6PA 2LCGA 4A87A 3DLBA 3C0VA 3KAYA 3KDIA 2RESA 4JHIA 4QDFB 2REZA 2Z9ZA 3GL2A 4LGAA 3W9KA 2LEQA 4Z3LA 5E4BA 3NMPA 4A8VA 3NEFA 2QPVA 1T27A 3WG8A 2NN5A 4BKDA 2L65A 4IGYA 4LG5A 3OQUA 2N4AA 2PCSA 2GKDA 4DS8A 4DSCA 3JRSA 1E09A 4JDAA 4N3EA 3NJOA 3GTEA 3UIDA 3NMTA 2LAKA 2R55A 4OICA 3UJLA 4BKCA 4KPYA 1VJHA 1LN2A 2Q3QA 4IHRA 4QDFA 3HO1A 1FM4A 2BK0A 1XUVA 2PSOA 3FO5A 4N47A 3K90A 3IJTA 3K3KA 3PU2A 3GGNA 4WVOA 4A8GA 1XN6A 3NJ0A 4REJA 4A88A 3GL0A 3RD6A 4JHYA 4M9WA 5EKQC 4QDCA 3F73A 4JDLA 2FFSA 2Z9YA 2D4RA 2VNEA 3GB4A 4RYVA 4A81A 3HJFA 1IFVA 3NI8A 2LIOA 1UW5A 5JNNA 5AMWA 1FSKA 2E3RA 2IL5A 3TL1A 3TVQA 1BV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUZ A;  2E3S A;  2K5G A;  3ZVU A;  1EM2 A;  2QIM A;  2M47 A;  2LE1 A;  1XN5 A;  4MNS A;  1Z94 A;  4JHH A;  3Q63 A;  4IH2 A;  4Y31 A;  3W9R A;  4C9C A;  1LN3 A;  4LGB A;  4IGV A;  3TVR A;  5JO1 A;  1T17 A;  4A85 A;  5C9Y A;  1X53 A;  4Q0K A;  1B6F A;  1LLT A;  1LN1 A;  4MAP A;  3UQH A;  2E3N A;  3KLX A;  2LPX A;  4M9B A;  2EJX A;  3NR4 A;  3NJ1 A;  1ICX A;  2L8O A;  4A86 A;  4MA6 A;  1ZXF A;  3QSZ A;  3KB3 A;  2FLH A;  3Q6A A;  4REI A;  4GY9 A;  1XDF A;  5I8F A;  2E3Q A;  2E3P A;  3KDJ A;  4PSB A;  5E4M A;  4BK7 A;  4A8U A;  3H3T A;  3NS2 A;  4N0G C;  5BRL A;  3JRQ B;  3KAZ A;  4FPW A;  4IGX A;  3F08 A;  1H2O A;  2KTE A;  2K7H A;  2LDK A;  4XRW A;  4BK6 A;  3H3Q A;  4REH A;  1TXC A;  4C94 A;  2L9P A;  2M89 A;  3OTL A;  4JHG A;  3H3S A;  2LF2 A;  4DSB A;  4R7K A;  3H3R A;  3CNW A;  3P51 A;  1TW0 A;  1QMR A;  4A80 A;  3IE5 A;  5I9J A;  3RT2 A;  3E85 A;  3OH8 A;  3KB0 A;  4IH0 A;  3NMH A;  2RER A;  5JO2 A;  2I9Y A;  4QIP A;  3P9V A;  4A83 A;  1XFS A;  3NMV A;  1BTV A;  2NS9 A;  1JSS A;  5E46 A;  2KEW A;  3OJI A;  2VQ5 A;  3TFZ A;  4BTZ A;  3Q64 A;  4A84 A;  1KCM A;  3KDH A;  5E4D A;  4B9R A;  2A1L A;  4C9I A;  4XRT A;  2KF2 A;  2KCZ A;  4LA7 A;  2WQL A;  2E3O A;  3PUT A;  2MOU A;  3NMN A;  4IGW A;  3P0L A;  2LGH A;  3ELI A;  3RT0 C;  3QN1 A;  2E3M A;  2N4B A;  3NEG A;  3KL1 A;  3R6P A;  2LCG A;  4A87 A;  3C0V A;  3KAY A;  3KDI A;  2RES A;  4JHI A;  2REZ A;  2Z9Z A;  4LGA A;  3W9K A;  2LEQ A;  4Z3L A;  5E4B A;  3NMP A;  4A8V A;  3NEF A;  2QPV A;  1T27 A;  3WG8 A;  2NN5 A;  4BKD A;  2L65 A;  4IGY A;  4LG5 A;  3OQU A;  2N4A A;  2PCS A;  2GKD A;  4DS8 A;  4DSC A;  3JRS A;  1E09 A;  4JDA A;  4N3E A;  3NJO A;  3UID A;  3NMT A;  2LAK A;  2R55 A;  4OIC A;  3UJL A;  4BKC A;  1VJH A;  1LN2 A;  2Q3Q A;  4IHR A;  1FM4 A;  2BK0 A;  1XUV A;  2PSO A;  3FO5 A;  4A8G A;  3K90 A;  3IJT A;  3K3K A;  3PU2 A;  3GGN A;  4WVO A;  1XN6 A;  3NJ0 A;  4REJ A;  4A88 A;  3RD6 A;  4M9W A;  4JDL A;  2FFS A;  2Z9Y A;  2D4R A;  2VNE A;  4A81 A;  4RYV A;  1IFV A;  3NI8 A;  2LIO A;  1UW5 A;  5JNN A;  5AMW A;  1FSK A;  2E3R A;  2IL5 A;  3TL1 A;  3TVQ A;  1BV1 A; 
#chains in the Genus database with same CATH topology
 2LUZ A;  2E3S A;  2K5G A;  3ZVU A;  1EM2 A;  3HXM A;  2QIM A;  2M47 A;  2LE1 A;  1XN5 A;  4MNS A;  1Z94 A;  4JHH A;  4QDD A;  3Q63 A;  2YH6 A;  4IH2 A;  4Y31 A;  3W9R A;  4C9C A;  1LN3 A;  4LGB A;  4IGV A;  3TVR A;  3GKE A;  5JO1 A;  1T17 A;  4A85 A;  5C9Y A;  1X53 A;  4Q0K A;  1B6F A;  1LLT A;  1LN1 A;  4MAP A;  3UQH A;  2E3N A;  3KLX A;  2LPX A;  4M9B A;  2EJX A;  3NR4 A;  3NJ1 A;  1ICX A;  2L8O A;  4A86 A;  4MA6 A;  4E6F A;  1ZXF A;  3QSZ A;  3KB3 A;  2FLH A;  3Q6A A;  2LAF A;  4REI A;  3HM9 A;  4GY9 A;  1XDF A;  5I8F A;  2E3Q A;  2E3P A;  3KDJ A;  4PSB A;  5E4M A;  4BK7 A;  4A8U A;  3H3T A;  3NS2 A;  4N0G C;  5BRL A;  3JRQ B;  3KAZ A;  4FPW A;  4IGX A;  3F08 A;  1H2O A;  4N76 A;  2KTE A;  2K7H A;  2LDK A;  3NQN A;  4XRW A;  4BK6 A;  3TGO C;  3H3Q A;  4REH A;  1TXC A;  4C94 A;  2L9P A;  2M89 A;  3OTL A;  3GTS A;  4NCB A;  4JHG A;  3H3S A;  2LF2 A;  4DSB A;  4R7K A;  3H3R A;  3CNW A;  3P51 A;  1TW0 A;  1QMR A;  4A80 A;  3IE5 A;  5I9J A;  3RT2 A;  3E85 A;  3OH8 A;  3KB0 A;  4NCA A;  4IH0 A;  4N41 A;  3GOB A;  3NMH A;  2RER A;  5JO2 A;  2I9Y A;  4QIP A;  3P9V A;  4QCK A;  4A83 A;  1XFS A;  3NMV A;  1BTV A;  2NS9 A;  2ZYL A;  1JSS A;  5E46 A;  2KEW A;  3OJI A;  2VQ5 A;  3DLH A;  3TFZ A;  4BTZ A;  3Q64 A;  4A84 A;  1KCM A;  3KDH A;  5E4D A;  4B9R A;  2A1L A;  4C9I A;  4XRT A;  2KF2 A;  2KCZ A;  3HVR A;  4LA7 A;  2WQL A;  2E3O A;  3PUT A;  2MOU A;  3NMN A;  4IGW A;  3P0L A;  2LGH A;  3ELI A;  3RT0 C;  3QN1 A;  2E3M A;  2N4B A;  3HK2 A;  3NEG A;  3KL1 A;  3R6P A;  2LCG A;  4A87 A;  3DLB A;  3C0V A;  3KAY A;  3KDI A;  2RES A;  4JHI A;  4QDF B;  2REZ A;  2Z9Z A;  3GL2 A;  4LGA A;  3W9K A;  2LEQ A;  4Z3L A;  5E4B A;  3NMP A;  4A8V A;  3NEF A;  2QPV A;  1T27 A;  3WG8 A;  2NN5 A;  4BKD A;  2L65 A;  4IGY A;  4LG5 A;  3OQU A;  2N4A A;  2PCS A;  2GKD A;  4DS8 A;  4DSC A;  3JRS A;  1E09 A;  4JDA A;  4N3E A;  3NJO A;  3GTE A;  3UID A;  3NMT A;  2LAK A;  2R55 A;  4OIC A;  3UJL A;  4BKC A;  4KPY A;  1VJH A;  1LN2 A;  2Q3Q A;  4IHR A;  4QDF A;  3HO1 A;  1FM4 A;  2BK0 A;  1XUV A;  2PSO A;  3FO5 A;  4N47 A;  3K90 A;  3IJT A;  3K3K A;  3PU2 A;  3GGN A;  4WVO A;  4A8G A;  1XN6 A;  3NJ0 A;  4REJ A;  4A88 A;  3GL0 A;  3RD6 A;  4JHY A;  4M9W A;  5EKQ C;  4QDC A;  3F73 A;  4JDL A;  2FFS A;  2Z9Y A;  2D4R A;  2VNE A;  3GB4 A;  4RYV A;  4A81 A;  3HJF A;  1IFV A;  3NI8 A;  2LIO A;  1UW5 A;  5JNN A;  5AMW A;  1FSK A;  2E3R A;  2IL5 A;  3TL1 A;  3TVQ A;  1BV1 A; 
#chains in the Genus database with same CATH homology
 2LUZ A;  2E3S A;  2K5G A;  3ZVU A;  1EM2 A;  3HXM A;  2QIM A;  2M47 A;  2LE1 A;  1XN5 A;  4MNS A;  1Z94 A;  4JHH A;  4QDD A;  3Q63 A;  2YH6 A;  4IH2 A;  4Y31 A;  3W9R A;  4C9C A;  1LN3 A;  4LGB A;  4IGV A;  3TVR A;  3GKE A;  5JO1 A;  1T17 A;  4A85 A;  5C9Y A;  1X53 A;  4Q0K A;  1B6F A;  1LLT A;  1LN1 A;  4MAP A;  3UQH A;  2E3N A;  3KLX A;  2LPX A;  4M9B A;  2EJX A;  3NR4 A;  3NJ1 A;  1ICX A;  2L8O A;  4A86 A;  4MA6 A;  4E6F A;  1ZXF A;  3QSZ A;  3KB3 A;  2FLH A;  3Q6A A;  2LAF A;  4REI A;  3HM9 A;  4GY9 A;  1XDF A;  5I8F A;  2E3Q A;  2E3P A;  3KDJ A;  4PSB A;  5E4M A;  4BK7 A;  4A8U A;  3H3T A;  3NS2 A;  4N0G C;  5BRL A;  3JRQ B;  3KAZ A;  4FPW A;  4IGX A;  3F08 A;  1H2O A;  4N76 A;  2KTE A;  2K7H A;  2LDK A;  3NQN A;  4XRW A;  4BK6 A;  3TGO C;  3H3Q A;  4REH A;  1TXC A;  4C94 A;  2L9P A;  2M89 A;  3OTL A;  3GTS A;  4NCB A;  4JHG A;  3H3S A;  2LF2 A;  4DSB A;  4R7K A;  3H3R A;  3CNW A;  3P51 A;  1TW0 A;  1QMR A;  4A80 A;  3IE5 A;  5I9J A;  3RT2 A;  3E85 A;  3OH8 A;  3KB0 A;  4NCA A;  4IH0 A;  4N41 A;  3GOB A;  3NMH A;  2RER A;  5JO2 A;  2I9Y A;  4QIP A;  3P9V A;  4QCK A;  4A83 A;  1XFS A;  3NMV A;  1BTV A;  2NS9 A;  2ZYL A;  1JSS A;  5E46 A;  2KEW A;  3OJI A;  2VQ5 A;  3DLH A;  3TFZ A;  4BTZ A;  3Q64 A;  4A84 A;  1KCM A;  3KDH A;  5E4D A;  4B9R A;  2A1L A;  4C9I A;  4XRT A;  2KF2 A;  2KCZ A;  3HVR A;  4LA7 A;  2WQL A;  2E3O A;  3PUT A;  2MOU A;  3NMN A;  4IGW A;  3P0L A;  2LGH A;  3ELI A;  3RT0 C;  3QN1 A;  2E3M A;  2N4B A;  3HK2 A;  3NEG A;  3KL1 A;  3R6P A;  2LCG A;  4A87 A;  3DLB A;  3C0V A;  3KAY A;  3KDI A;  2RES A;  4JHI A;  4QDF B;  2REZ A;  2Z9Z A;  3GL2 A;  4LGA A;  3W9K A;  2LEQ A;  4Z3L A;  5E4B A;  3NMP A;  4A8V A;  3NEF A;  2QPV A;  1T27 A;  3WG8 A;  2NN5 A;  4BKD A;  2L65 A;  4IGY A;  4LG5 A;  3OQU A;  2N4A A;  2PCS A;  2GKD A;  4DS8 A;  4DSC A;  3JRS A;  1E09 A;  4JDA A;  4N3E A;  3NJO A;  3GTE A;  3UID A;  3NMT A;  2LAK A;  2R55 A;  4OIC A;  3UJL A;  4BKC A;  4KPY A;  1VJH A;  1LN2 A;  2Q3Q A;  4IHR A;  4QDF A;  3HO1 A;  1FM4 A;  2BK0 A;  1XUV A;  2PSO A;  3FO5 A;  4N47 A;  3K90 A;  3IJT A;  3K3K A;  3PU2 A;  3GGN A;  4WVO A;  4A8G A;  1XN6 A;  3NJ0 A;  4REJ A;  4A88 A;  3GL0 A;  3RD6 A;  4JHY A;  4M9W A;  5EKQ C;  4QDC A;  3F73 A;  4JDL A;  2FFS A;  2Z9Y A;  2D4R A;  2VNE A;  3GB4 A;  4RYV A;  4A81 A;  3HJF A;  1IFV A;  3NI8 A;  2LIO A;  1UW5 A;  5JNN A;  5AMW A;  1FSK A;  2E3R A;  2IL5 A;  3TL1 A;  3TVQ A;  1BV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...