1H2TZ

Structure of the human nuclear cap-binding-complex (cbc) in complex with a cap analogue m7gpppg
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
146
structure length
146
Chain Sequence
LLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Induced Fit Recognition of an M(7)Gpppg CAP Analogue by the Human Nuclear CAP-Binding Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords 80 KDA NUCLEAR CAP BINDING PROTEIN
total genus 42
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2002-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h2tZ00
2NLWA 1QM9A 3VAIA 2RVJA 5LSLA 2MY8A 5CA5A 4IOCQ 2CQ0A 2RQCA 2MXYA 2OSQA 2CPYA 1X5PA 2RRBA 5GMKa 3IRWP 3CCJS 1OIAA 4YOEA 1N88A 2CPIA 2LMIA 3G4SS 4WF9Q 4OZ1A 5LXRA 2DHGA 2K3KA 1WI6A 3UD3P 1RKJA 3VAMA 1P27B 2KT5A 5EN1A 1QVGR 1WEYA 1VQKS 3RW7A 1DBDA 1Q86T 5CYJA 2F9JA 2MQOA 1H6KX 2CJKA 2MSSA 2AD9A 1F9FA 3H2UB 1SJFA 4ZKAA 3NNAA 2MQNA 1DHMA 2ERRA 1KC8T 4UY8T 3EGZA 1WEXA 1U1KA 2N82B 1U1RA 1FJCA 4QPTA 3G71S 2XNQA 2MYFA 2X1AA 3HI9A 2MZSA 1P1TA 4WFBQ 4WKRA 3MD1A 2E5GA 5IM0A 2HGLA 5CXTA 1WG4A 1UW4A 2DNQA 3J7ZT 2HYIB 3CC4S 4TU8A 1VQMS 2WBRA 2DNHA 2KN4A 2M70A 2UP1A 2DGSA 2O3DA 1X4BA 3N9UC 3MUVP 4FXVA 5DM7Q 2GHPA 2LCWA 2B0GA 1UP1A 3THTA 1WTBA 2HZCA 1U1LA 1PGZA 3SXLA 4IOAQ 4UQTA 4WFNQ 3TP2A 1VQ7S 1JJ2R 3P49B 2YTCA 2ADCA 3U1MA 2ZJQQ 1JMTA 5DDRC 1M5VC 1YHQS 2I2YA 1VQOS 1PO6A 2M8DB 3BO2A 4PRFA 1R8HA 3OW2R 3G6ES 2XS5A 3EGNA 2RNEA 1U2FA 3PIOQ 2G0CA 2KI2A 1XN9A 1D9AA 3UWTA 2LA4A 1YITS 1M5OC 3FEXB 2HGMA 2KHCA 2M0GB 2DGTA 2DGWA 4TLQA 3CUNA 2D3OR 2E5IA 3NNHA 3VAGA 1VQLS 1YJWS 1WEZA 1URNA 3CCLS 3US5A 1YJ9S 3B4DA 3Q2SC 4ED5A 2MJNA 3MD3A 2X1BA 3CC2S 2DO0A 2DH9A 4WIIA 2MGZA 3B4MA 2DISA 4A8XA 2G4BA 2MSTA 1UAWA 2JVRA 2M4MA 2E5HA 3H2VE 3P5TL 4RU2A 5LXYA 2X1GA 4WFAQ 1NJIT 2QEXS 1H2TZ 3RW6A 2CQGA 2DGXA 3CF5Q 1VQ6S 2MB0B 1HA1A 2DNYA 2BOPA 1X4HA 2RS2A 1SJ4P 1KD1T 3SDEA 1JJHA 1S72S 1JJ4A 1SJQA 2MZJA 3CCQS 3UCUP 2DHAA 2M2BA 3MXHP 1VQNS 2Q79A 2FPHX 1ZH5A 5GADU 1D8ZA 4C4WA 2KXNB 2CPEA 2JX2A 2JVOA 2RT3A 1Q82T 3CTRA 1RK8A 3VAFA 3NNCA 1AUDA 2MZTA 2V94A 2DH8A 2MQLA 2M8HA 1VQ4S 2OIHA 2KYXA 1WHWA 2DNMA 2G1DA 3S01A 3VAKA 5FJ4A 2J76E 1IQTA 1SXLA 4YUDA 1Q7YT 4Y0FA 4V19X 2MZQA 2DGOA 2CPXA 2L9WA 1X5TA 2OSRA 2MQQA 4M5DB 3CCMS 2OJ3A 2J0QD 3NS6A 1KOHA 1WF2A 1YIJS 2DIUA 2F3JA 4TU7A 2ZJPQ 3UE2A 3VAJA 4ERDA 1X5SA 2DGUA 1VC5A 1FJ7A 4QU7A 5H1SV 2FC9A 2MZRA 3P3DA 2AYBA 1HD0A 2DNOA 5D78A 1N52B 4CIOA 2DNPA 2DB1A 2N3OA 2LEBA 3MI7X 2KH9A 2KG0A 2U2FA 3VF0B 1VBZA 2KRBA 5ITHA 2MHNA 2E5JA 2MKKA 2CQDA 1DZ5A 1VQPS 4C0OC 3P6YC 4OZ0A 3S8SA 2X1FA 1OWXA 1A7GE 3LQVA 1VQ5S 2CQCA 3CCVS 2L08A 1FT8A 2AYGA 3DXBA 2F9DA 2MY7A 2RUGA 2N3LA 2YKAA 4PR6A 1WELA 1FO1A 1YTYA 2ADBA 1U1PA 4EGLA 1B7FA 2VOOA 2CPFA 2CQ3A 4Y00A 3ULHA 1FXLA 3EX7B 1K8AT 2EK6A 5LJ5Y 2DNZA 2LEAA 4Z2XA 5BJRA 1SJ3P 4CQ1A 1R8PA 3HHNB 4F02A 1DRZA 2KU7A 2CPJA 4YB1P 5JVHQ 4W90B 1VC6A 1A9NB 3G8SA 1U1QA 2KM8C 2CPHA 2DIVA 2CQPA 1WHYA 3PIPQ 3BO4A 3BEGB 2LECA 1QVFR 3CC7S 1X4DA 2HGNA 3G9CA 1U1MA 5MLCV 1FHTA 3G8TA 2MKHA 1VC0A 1X4GA 5IFMA 2MKCA 2FC8A 2VOPA 3I55S 1OPIA 5GVQA 4WCEQ 1U1NA 2YWKA 2KM8B 1ZZNA 5IM0B 2VODA 4F25A 1U6FA 2RS8A 2FY1A 1W2BR 1X5OA 1YI2S 1O0PA 2ZJRQ 2DITA 2KFYA 2NZ4A 4IO9Q 2K8GA 2XNRA 2MMYA 2VONA 2OTLS 3MUTP 3SMZA 2DK2A 5IQQA 3VALA 1X4CA 2BZ2A 4P6QA 2A3JA 2DGQA 3MURP 3K0JA 5GAEU 2M7SA 5GAGU 2DNGA 2OTJS 1M1KT 2EVZA 1M5PC 1U6BA 2KRRA 3CCRS 5DDQC 1CVJA 1WG1A 1G2EA 2CQIA 2MKIA 5JVGQ 1X4FA 2DHSA 1FNXH 4FXWA 2DHXA 2DO4A 2LXUA 2DGVA 2KXHA 2PE8A 3ZZYA 4QU6A 3U1LA 3NS5A 4CH0S 1H2UX 2N7CA 2LYVA 2J8AA 2L41A 3CCES 1Q81T 4W92B 3S6EA 2LQ5A 1X4AA 2QA4S 2RRAA 2MPUA 5DDOC 2D9PA 2J0SD 3UCZP 1NU4A 3L3CA 2RU3A 3R1HA 2KG1A 2CQ1A 2MZ1A 4PKDB 3CMES 1WHVA 2I38A 3ZZZA 1U1OA 1WF1A 1KQSR 2DNNA 1KOOA 2DNKA 3CCSS 3TO8A 3CXCR 2SXLA 2CPDA 1VQ8S 2JRSA 3D2WA 1VBYA 2MQMA 1WF0A 2XB2D 1S79A 3BS9A 2XSFA 2DNLA 4BS2A 1M5KC 2GO9A 3TYTA 3THPA 5DETA 2FHOB 4C7QA 2M88A 2LA6A 3S7RA 1N8RT 2QFJA 1H2VZ 3G96A 4CH1A 1WHXA 3Q2TC 2YH0A 1FJEB 2HVZA 2MQPA 1ZZFA 1X4EA 2PEHA 3BO3A 5LJ3Y 3LPYA 3MOJB 2LKZA 1M90T 3CPWR 1OO0B 3NMRA 1BY9A 4LIRA 3CD6S 4U67Q 2XS7A 3CCUS 2AYEA 2CPZA 3MDFA 1NO8A 2U1AA 2DNRA 1HL6A 1K73T 2YH1A 4IUFA 2E44A 2LXIA 1N54B 3MUMP 2M52A 2DH7A 3FEYB 4LMZA 3UD4P 4F26A 3JB9k 1L3KA 5HO4A 1YWXA 5GAHU 1WI8A 3R1LA 5DM6Q 5HL7Q 1UFWA 1X0FA 1WG5A 2CQBA 3R27A 2KXFA 1WWHA 2D9OA 4LJMA 2XS2A 1HD1A 1VBXA 5DDPC 4TU9A 1K9MT 3DLLQ 2MGZB 2AYMA 2CQ4A 3UCGA 2M9KA 2MKSA 1VQ9S 3SDEB 2MKJA 5LSOA 2JWNA 2KVIA 3CULA 3J7YU 2CQHA 3CMAS 2MJUA 5D77A 4J5OA 2CQ2A 1YJNS 3IWNC 2RQ4A 3I56S 3V4MA 1SJRA 3VAHA 4QQBA 2EK1A
chains in the Genus database with same CATH superfamily
1HQEA 1M1HA 1QE1B 3TUIC 1JLBB 3CJ2A 1RBLA 1U26A 5HMYA 1KVIA 1QM9A 1HNWJ 3V6KA 2GAHC 2Y9HA 4N41A 4WE1A 1TL3B 4ICLB 1VOMA 2HFNA 2MY8A 3FBBA 1NJXA 2UVWA 4EUVA 1RT3A 5KFQA 4IOCQ 2V9WA 2RQCA 4CTAA 2CDRB 3JAMY 1HWIA 2ZUAA 2PA3A 4RW8A 4L75A 4TQRA 3K5MA 2GIRA 3LGNA 4BC9A 4KGKA 5HP1B 3AQOA 3EDQB 4DV7F 1SV5A 5F8GA 3IRWP 4KKOB 5KFCA 4LRAA 2RDJA 4I1TA 5K14A 2C2ZB 2RB7A 2VIHA 2JHEA 3H5SA 4NYOA 1YBTA 2A1BA 4OZ1A 5LXRA 2DHGA 4RNNA 1O6XA 2K3KA 3U7JA 3TWZA 3NMAA 3UD3P 1HHSA 3MM8A 5JXSA 1RKJA 4O44B 1TL4A 1JLBA 5EN1A 5K5MA 4USHA 4WK3A 4DJBA 5KFKA 1NKEA 1VQKS 3B78A 5KFDA 1Q86T 4M5IA 4G1PA 1HMVA 1H6KX 2B43A 3POTB 1F9FA 2DXFA 3DRSB 2C3UA 2GZOA 3H2UB 4X65F 3BYRA 2FLOA 2UUCF 4JI0J 3CJKB 2BM1A 1RWOB 3L7UA 4R8UB 1U49A 1IKXB 4K7QA 1TMMA 2APOA 2HNDA 2JLEA 3CO9A 4KE5A 2ALYB 4PG7A 3R5DA 2YNGA 5KFTA 3EGZA 2R7VA 2GJ2A 2HBQB 1Y4ZB 1LNQA 3QZ7A 3BQ2A 2N82B 1U1KA 2VQEF 3RBXA 3SCJE 5F0WA 3KG4A 3SCKE 1S9EB 2MZSA 2UV8G 2NZCA 4WFBQ 1S6OA 2BKPA 2RF2B 3C15A 5L38A 3BGUA 5IM0A 3TARA 2JLGA 2HGLA 2C2OB 2DRAA 5CXTA 3MPDA 3Q8VA 3M8QB 2AJ0A 1LXJA 1WG4A 4I0WA 3QSYB 1LWCB 2DNQA 3PX6A 4B3MJ 1J5OA 1JLGB 3NBPA 2HYIB 3ZTSA 1G3OA 4OZ5A 4UOFA 1D9DA 3C19A 4QIEA 2KN4A 4ZS6A 2F1FA 4FDFA 3M9OB 4P73A 4ED8A 2YBVA 4Q44A 3Q23A 2YQ0A 4AXJA 2OP5A 1FFSB 1JX4A 1ZPVA 2HIYA 4OQJA 3S1TA 4YS2A 1RCOB 1Y5NB 2BW7A 2YX7A 1FTCA 3CCZA 4JBCA 4MFBA 4N7TA 4ZJLA 3GZ7A 4DLEA 4ED7A 1U1LA 4U7CA 2F4VJ 4JYAJ 5C24A 2BJ8A 1U09A 3LO3A 3NCPA 3F41A 1UPMB 4J91A 4DL0C 5CCMA 3CDEA 1SKRA 4PWDB 3TP2A 4RKUC 2KJWA 2V68A 3M30B 4XIUA 2G2OA 4R5PA 4ATNA 4DV7J 5T7LA 4C8YA 1JJ2R 1CLFA 4LRDA 2NXJA 2ADCA 3U1MA 1JMTA 1IWAA 4QW9A 2FJXA 3MCNA 3D6TB 4DSFA 1SKSA 1CJUA 2C3PA 2V4JB 3MMAB 4MAKA 3OSNA 4DSLA 4WFZA 2OFHX 1S1TB 4ZVHA 3VR1A 3JAMU 4PUOA 1GMUA 4CM0A 3DGVA 1ZM3A 2XS5A 4X84A 2WZ1A 1TQLA 2KI2A 2HK3A 1XN9A 2W8KA 2DHHA 3HVTA 2OPPB 3QBCA 1NK0A 2LA4A 1LV5A 2B5JA 2BJ7A 1TKDA 5F41A 2FVRA 2UXDJ 2I9SA 2X7IA 1C0UB 4DPWA 1BWEA 4TY9A 3MEDA 2P9GA 3BGOP 3DRYA 4WFXA 5KFGA 2KHCA 4YY3F 2C1EB 1R43A 2AIRB 2D1CA 4NASA 3UQSA 3Q24A 4ER8A 3PO4A 1QE1A 2HS4A 3C8YA 3DOLB 1SH0A 5HVFA 1R0BG 2RHSB 4ZPBA 1X9SA 5CCLA 4B3RJ 4KJIA 3PYFA 1RLCL 1Q78A 3MEGB 1HNVB 3UN3A 3KOAA 1TL7A 4OJGA 3US5A 3B4DA 2O66A 4PWWA 5J1PA 5CYMA 2QLBB 1TVRB 3HSDA 3KLIB 4Q2LA 1WACA 3K5PA 3M05A 5HLFA 4WIIA 3DMJA 2MGZA 3B4MA 1RE1B 2CVIA 3FKBA 3ISZA 3E01B 2AEFA 2IRUA 2MSTA 3QFHA 4PPDA 4DHVA 1UAWA 5GAGI 3D9BA 2VC1A 1WSVA 4USUA 3QLHA 4U7UD 1C1BB 1DY3A 5C7PA 3EUNA 3KDNA 4LSZB 1TKTA 2E66A 2OHDA 1NJIT 1RTZA 3AH6A 4OHWA 3C2PA 2QEXS 4B3OA 2ZDPA 1RCXB 4L3KA 4P71A 1P9QC 2GMHA 2KFNA 4P2SA 4WK1A 4RW8B 1Q8BA 4LBHA 3K8VA 3LGMA 3N4WA 3A3PB 3DLHA 1FESA 1X60A 1ZOTA 2VFVA 4JI2J 4KHMA 1NZAA 3AT1B 1XC9A 4FF4A 5H9FJ 3HZGA 3BSOA 2F4VF 4JYAF 1JJ4A 2JC1A 2MZJA 1NPPA 1MMLA 6FD1A 4RW7B 3PR4A 2HWIA 4KQZA 3GQCA 1BGXT 3G6XA 4F4WA 5KG4A 2FDNA 1XTZA 1MWZA 2W1BA 5LOQA 2GVDA 2XSJA 2EI5A 4ZPDA 3OSPA 2FPHX 2ZDOA 3OBIA 1R6YA 2V4RA 1FK9A 2UUBJ 4C4WA 1ZAWA 3OT9A 3VGVA 4X66J 2W9BA 2BE7D 2VJUA 3RB4A 1TK5A 2A6MA 2G1HA 1REVB 2JVOA 4J9LA 2ASDA 5HLFB 2GGPA 3GFZA 3KG1A 5CABA 1M5HA 2HZAA 3RRKA 1U25A 2C3YA 3JSYA 3M1VA 4BLGA 5JUMA 2C2DA 3KUEA 2MZTA 2V94A 1RHQB 1RTIA 1RT1A 2YKPA 2YNIB 4PCQA 4DEZA 2HKEA 3QO9A 4A8OA 4U8VA 1TUGB 2IYIA 4O4GB 2BJ1A 1EJ7L 1FDAA 3KJNB 4LUBA 3VGUA 2NXUA 2JH3A 4OHZA 3NGRA 2V2QA 1EIYB 4E0DA 4FNHA 1A6LA 4ELTA 3NCRA 2WONA 3IGVA 2YX1A 2RH3A 3BH7B 3QATA 1I5OB 3UDVA 1FKOA 1GK8A 2J76E 3TNVA 3OLBA 1IQTA 1S99A 3BR9A 4ZP8A 4LR9A 4XK8C 1YZ7A 4Y0FA 4V19X 2RRNA 2Y3YA 3CD7A 3CCMS 3BGRA 3WIUA 3M8QA 3CJ5A 1SPBP 3NS6A 1X31C 1VFJA 1S9GA 1MU2B 1HBOA 3OQ2A 3P8BB 2DIUA 3TAQA 2Y1RI 2ZJPQ 4ERDA 3UE2A 3VAJA 2EG1A 4IFVA 2DGUA 4OMFG 4OX9F 4J9VA 5HQLA 3OL9A 4QU7A 1FA0A 1OSDA 2FC9A 1YRUA 4M5GA 5ETKA 2BQUA 3LTOA 4M8LA 2RU9A 3PV8A 4DSIA 4C3LA 1JXLA 2AYBA 2Z2MA 3AFGA 5KG7A 1HD0A 1OSCA 1VRUB 4FKXA 4Q2MA 4ES2A 1J5OB 1S10A 2XLKA 4Q45A 2KYZA 3FRZA 3NOCA 2DNPA 1S57A 4J90A 4GO5X 2KH9A 1IKYB 4MIBA 4RBTA 2XYGB 1XIQA 3L95X 4AXIA 4ZN1A 3OLAA 2KG0A 2BJ3A 1SB6A 2D41A 3W5ZA 2H9ZA 1IM6A 1CEZA 3GLJA 3AA8A 2CQDA 4Y3CA 1RTHB 3W2WB 2OMOA 3OFEA 2GC8A 2KO1A 5I3PA 1ITPA 2WVEA 2J0XA 4PXDA 4QIVA 3W5YA 1L5UA 2J7UA 3P6YC 4NLXA 4W98A 3OFHA 3OR1A 2NSCA 4HH1A 3LOUA 2XMKA 3D28A 3TAMB 2CQCA 2E7WA 2AYGA 1CJUB 1N56A 1JLEA 1L3TA 4OZJA 2JEJA 4NLSA 1SH2A 4N56A 2RUGA 2M3DA 1PSDA 4HT7A 2N3LA 4PR6A 1IKVB 1WELA 3HVTB 4QR0A 4RL1A 3E2EA 8ATCB 2YNFB 1B7FA 1U0HB 2CPFA 4DUYJ 1WC1A 1IKYA 4NXMF 2LP4A 4F4YA 4QPXA 4ZVOB 2YKQA 2V8PA 1CS4B 5ETSA 4ECZA 2YPYA 5LJ5Y 1K8AT 1UVNA 2WVFA 2DNZA 1N32J 3DRPB 4F4KA 3D7SB 5THWA 4CT9A 4FPIA 2H5IB 3H25A 2HFUA 3GCWP 2OPRA 4CI0B 3CD5A 3HHNB 1EZZB 3M8PB 4H4OA 4IQMA 5C25A 2CPJA 2QX0A 1B7YB 3LGHA 1FRMA 4EO6A 1HHQA 3MEEB 3A4TA 2H3EB 1SBRA 3UDCA 4TYAA 4F4XA 2DCUB 4M5MA 1DLOB 4ZOSA 1KRPA 1ULRA 4IR9A 3M6VA 1IWGA 2NCKL 3OTEA 3DRXA 4DPXA 2CQPA 4GMKA 1S4FA 2CRLA 3BJYA 2QA2A 2ZC3A 3P4UB 3D0GE 3QSIA 4M5JA 4OYMA 2VA3A 3I5AA 1S49A 1IN0A 2HGNA 2PMZD 1FFGB 3T9NA 5MLCV 4ALZA 1CJKA 1JLQB 3QNWB 3JXOA 2H51B 5H9EJ 2E9ZA 2B8QA 4MK9A 2YX4A 1C1BA 3ENAA 1RACB 5B0BA 3O8WA 2PN6A 4DXLA 3HCXA 2XULA 3VZHA 4DLGA 1CJVB 1SJ1A 1C0TB 2FC8A 1NPKA 4HACB 4HT5A 4A8WA 4DL2A 2HMIB 3I55S 4N8NA 5F3ZA 5HBMB 3CJ8A 3DHWC 3AOCA 3M4XA 3LP0A 4X62F 3KLEA 3RJMB 5HMZA 1REVA 2DRDA 2G0IA 2FJDB 4OI4A 5IT4A 2KM8B 3H4BA 3QJPA 2MTLA 3M2RA 4F25A 1CULB 3W63A 1BLUA 1JKHB 2Q6BA 2VFUA 4OI1A 5RUBA 4K4VA 5AJ3F 4DX7A 1RP5A 3G6VA 2ZJRQ 2HHHF 1AFIA 1LW2B 4BC7A 2NYHA 2B8PA 1N5TA 3EVWA 3PJ9A 3KLFA 3M8RA 4AL5A 3RAQA 4QWEA 5J2MA 2HWTA 2V2ZA 4ZPVR 1BD6A 4MK8A 5B7WA 2AJ4A 2DGQA 4ECXA 4ELVA 2BXJA 1S0OA 3K0JA 3ZO7A 1CG2A 2IAJA 2FGOA 3DOMA 3L7PA 1F0XA 5GAGU 5F9LA 2W8LA 2GGPB 3C16B 1TZ0A 2YQ3A 3E8OA 2Y1IA 3CCRS 3QGGA 2R9LA 4B9UA 4L73A 1JB0C 3RRGA 2AU0A 1KQKA 1VJWA 2K2PA 2E7VA 1Y7PA 3D0IE 1G2EA 1OYEA 1YG0A 2HNYB 3QYYA 2FVSA 3G6YA 1H0HB 2B51A 2GQCA 4MH8A 4GC7A 1UEKA 1KQFB 4Q43A 3KK3A 4OI0A 4QWDA 5A2QY 2DHXA 2DO4A 2QL5B 3N28A 2C2NA 3C3LA 2QMWA 3ZZYA 2XTJP 3IS9A 4KFBB 1CSJA 3U1LA 3OR2A 1F5CA 3W2VB 1H7XA 4CH0S 5J1EB 2C28A 1RT6A 4F8RA 1XNQF 5T14A 4NXMJ 1S76D 3IR7B 2LYVA 4MYTA 1NHKL 4DR4J 4X4QA 2R4FA 3DOKA 5IXUA 3EM1A 1VQYA 2WSEC 4K4WA 1NK5A 1VS3A 2VPXB 2L41A 5L1KA 4W92B 1MG7A 2LQ5A 1X4AA 2HQ3A 2QTWA 2WVCA 3A3OB 1CQNA 4QR1A 4PQUA 3ZTPA 5KFSA 1QJHA 4R0EA 2H4YB 1QY7A 5CZXA 3T1HF 2IMOA 3FMWA 3MM5A 3L3CA 2UUAJ 2RU3A 4EBCA 5GMDA 3WC2A 1T94A 2KG1A 2PMHA 2MZ1A 4ZVUB 2I38A 3CDAA 4P2FA 2DNNA 2ZNYA 5KFIA 2YWGA 1KWMA 3CCSS 2FYXA 2B9WA 2GIFA 1KLMA 2ATCB 1Z2LA 4MYUA 3UN2A 3CXCR 2IC3A 3RAXA 3LAKA 3D2WA 3O2IA 1VBYA 4PWDA 1SQFA 1WF0A 3H98A 4ZIVA 5IT9Y 4ZVGA 1RAFB 2UUTA 4OYBA 2KTQA 5G0RA 4I67A 4OYOA 2GO9A 2V0NA 1CJTA 4CO0A 3T6JA 4LF6F 1Q8KA 3I96A 4J37A 2R7SA 1VQ4S 4X62J 1RWPB 2FHMA 4CH1A 4Y34A 4QYZJ 4L6V3 2ZVSA 4UOGA 2D3UA 2YH0A 2IDLA 4GVLA 4H4KC 1XQIA 1SC3B 2MQPA 4DBQA 4DV1F 1HNXF 3CB4A 4DL3A 3TVKA 4EEYA 4O3SA 1NB7A 3MM7A 1FEHA 2VKRA 1BUXA 5BYQA 1XEZA 5LJ3Y 4IFYB 5DGAA 4K0KF 1QAJA 1S48A 2ZOGA 4NLVA 3CPWR 1OO0B 4ZVRB 2WBMA 1S1TA 3CD6S 2HAFA 2C3OA 4U67Q 3DU5A 4DSKA 3FCWA 3IM9A 3CCUS 2AYEA 1VHFA 3HULA 2CPZA 4D3HA 4D3GA 2AMCB 2ZH9A 3MDFA 1N5SA 2QRRA 3I87A 4DQQA 5H9EK 2AGQA 3EE3A 4LRFA 2CJQA 3HMJG 3KK1A 3SI8A 3NL0A 1ZA1B 2QC3A 1N54B 2YXLA 1N36J 1XBWA 4FVMA 3UD4P 4F26A 2I0XA 1WUUA 1L3KA 2YVSA 1YWXA 2IM2A 3HFVA 5GAHU 3GYXB 1HW9A 3R1LA 1BQNB 2B4PA 3I5BA 3I0RB 5HL7Q 2UVVA 1UFWA 2YNHB 4RW4B 1X0FA 4DL6A 1WDTA 2Q3PA 3NS7B 2LQ9A 1RT3B 2KXFA 2D9OA 2JFDA 4LJMA 2IVFB 1FCAA 3NG8A 4WE1B 4K2JA 4WWSA 4QWBA 3RGIA 3UNGC 5AXKA 5LMNF 4N76A 4JI8J 3V6JA 3EPIA 3BQ0A 3Q89A 1HPZA 3IR6B 1QSYA 1QLNA 2YNGB 3CJRA 4USJC 3OD2A 2MKSA 4OZNA 1VQ9S 4CLZA 4LSNB 1EKRA 1QSLA 3I9V9 4M1KA 5C42B 4X4NA 2AT1B 2IJFA 2JWNA 4A47A 3MR6A 3AB4B 1FNMA 3CMAS 2E1PA 2W2PP 3PKYA 1D3WA 4NA2A 4OI3A 1S9EA 4J5OA 3T1YJ 1KBRA 1LWFB 2K3IA 4TKTA 3V4MA 1WC3A 4B9MA 2K1RB 3VAHA 2EK1A 2QSWA 3ENQA 1YRTA 2NLWA 4GRSA 4F7VA 2HBZB 3PFOA 2IFXA 4LBIA 3TX8A 3ZZUA 4YP3A 3VAIA 4WBFA 1KS2A 1V3RA 2XWYA 3D6HB 4HH0A 3TX0A 3OFFA 1BMQB 2A18A 3IMQJ 1ELOA 5BYSA 1F3FA 2C42A 5KAKA 2VG6B 2BYCA 2WOMA 5CA5A 3CCWA 5CAAA 4RNMA 4DV1J 3UR0A 3TA2A 3MR5A 2R3VA 2OPSB 4QR2A 3SZ2A 5K8OA 1SKWA 4ES1A 1X5PA 2BDPA 5A8KB 4GKJF 2CAJA 1FWLA 4P72A 2ZHOA 1Q8IA 3WX8A 2HNYA 3CCJS 1OIAA 1UFLA 3MR7A 5F3TA 4F2SA 2H4WB 4J9RA 5A8WB 3D54A 3J80Y 5DZ6A 2AV5A 1NJWA 3V4IA 4Y2AA 2VQFF 1P27B 4OJ3A 4I6YA 4K4YA 2KT5A 1RKIA 3CGIA 2LQ8A 1QVGR 2ALZA 5ETQA 4LF9F 4DR6J 1DAXA 3K5OA 4G3IA 1TK8A 5FD1A 1MU2A 1OY9A 3CJTA 2QYCA 1DBDA 3HP6A 2CJKA 3OTDA 5DZ7A 1V3ZA 2AJ1A 2MSSA 4I68A 4K4SA 2ASYA 1FRKA 4NRUA 1EP4A 3ISND 2MQNA 3K89A 2PSZA 4DFJA 1DHMA 2V34A 4E98A 1KC8T 3GIMA 3CDUA 2BJEA 2FJVA 2IRXA 5U47A 1RQ0A 4AD6A 1T9XA 3O6QA 1L3VA 4UY8T 3PYGA 2OFGX 4JI3F 1WC0A 3PJXA 2F40A 4ZCKA 4CYUA 2VV5A 4KAIA 4O3QA 1U1RA 1RGVA 1RT4B 4QPTA 3JQMA 3G71S 1TAUA 1FJCA 4Y2MA 3FJ2A 3HI9A 3M6XA 1ZTTA 2B4UA 2UU9J 3W3SA 1HQUA 3QIDA 2OGUA 2VDHA 3M30A 3MD1A 4WKRA 2E5GA 3CNQP 2QIFA 1S1XA 4DFKA 3NWGA 2KVQE 1UVJA 3NOGA 2EFQA 2UUWA 1K0TA 1NDCA 2WVDA 2HG4A 2XZDB 4CLWA 3J7ZT 3UFCX 4IDKA 4TU8A 1M1GA 2MKYA 1VQMS 2BANB 1FDNA 3BKUA 4HEA9 2M70A 4ECTA 3FFIB 1J2VA 2QJ3A 2O3DA 1X4BA 3N9UC 3WHIA 2QLJB 3MUVP 4ZHRB 5DM7Q 1WJ9A 1VGYA 3MEDB 4IRDA 1IR2A 1O5JA 2B0GA 3HHKA 4U8YA 3THTA 4CLLA 4ED0A 1S1WB 2N4DA 2XLJA 4IRCA 2R7TA 2I8EA 2AZ1A 3X3UA 1C4CA 4F4AA 2X51A 4KB7A 3W62A 4R25A 2DJWA 3MAAB 3SSSA 4ECSA 3R6GB 3SXLA 1PGZA 4IRKA 5KT7A 3MCSA 2Y8WA 1UKUA 4WFNQ 3HJFA 8AT1B 3G82B 4GKJJ 4NEYA 3C6UB 1S6UA 3M8PA 4OX8A 1HNVA 1OMSA 4O44A 4KY3A 4EZ9A 1KDNA 4ZCIA 3U1NA 1M5VC 3HT0A 1YHQS 2V8VA 1PO6A 3QQCD 2M8DB 4B3TJ 2RMLA 2VBZA 3TUZC 5L1JA 5A8RA 3OTOJ 3BO2A 1N6QB 2DPJA 1U8SA 3FZ2A 2PI4A 3NP5A 2XGQA 1FF2A 2IBKA 1RT7A 1TL5A 1R8HA 4NEZA 1OJ4A 3N01A 2E1AA 1IKXA 3HFKA 3ITHB 4NZ6A 3TA1A 3G6ES 2FB0A 2YNFA 1U2FA 3H0PA 3HD2A 5B08A 3PIOQ 1S0NA 2NUHA 4B3SF 5D3GB 3ZNUA 3R5GA 3QPIA 1REGX 3BSAA 3JTPA 4ECUA 2UUCJ 3GB0A 3OPKA 4JI2F 3RR8A 4OZLA 1AUSL 3DLKB 4USMA 3FEXB 3OVSA 4DQIA 4PXEA 2HGMA 3DXSX 1V5VA 4I7FB 1AB8A 5HATA 1EKSA 2M0GB 2OPRB 1H74A 4NMLA 1APSA 4NLWA 1U45A 1KNZA 2CA9A 4K4UA 3A8KA 3UO0A 4DV2J 2J0WA 3FCVA 3OL7A 2R8KA 2VG7A 1HHTP 2W2NP 3CT9A 2J8SA 1LWCA 3P96A 4DU8A 5DG8A 1DLOA 4GO7X 3KLGA 4CP5A 3MD3A 3CC2S 3ENWA 2VL1A 5I42B 4M5DA 1HPZB 5HJYA 1TUWA 2XI3A 4B3MF 3FVYA 3OL6A 2QSFA 3QWUA 3TA0A 2CKWA 1SUQB 3PG9A 4ILRA 2FVPA 5BXIA 1M0SA 3TZZA 4WFAQ 1HWJA 2FGCA 4OI6A 4DFMA 3MM9B 3ZTRA 4DX8H 1VLYA 2V50A 3N6NA 3ET6A 4DUYF 2CQGA 2ZNZA 4IH6A 1FDDA 4M5NA 4W4MA 1P9YA 2P5VA 1E6YA 1MMNA 4OHXA 2DGXA 4EU0A 3Q8SB 3CF5Q 2L48A 3MM6A 5ADZA 2LQJA 2FZCB 1WTFA 4USWA 1S0VA 3D6MB 3JSMB 1SJ4P 1KD1T 3ZNJ1 3SDEA 1SIZA 4K5RA 1S7HA 2RKIB 4H4MB 1FKAF 4B9VA 1WOSA 2UXCJ 3BB5A 2JZ5A 1WORA 2XYPB 6FDRA 1WKKA 2M2BA 3PW4A 1GMVA 3C6TB 4URGA 3MPYA 2J5AA 2J9DE 2GS8A 4LFAJ 3OHAA 1R8AA 1XJWB 2DD8S 3DGPB 4KPCA 1MN9A 2JX2A 3GJSB 1RK8A 1T9VA 2VBYA 3NNCA 1JK9B 3AJ1A 5C2GA 3MR2A 5F0UA 4DL5A 1RHJB 2RHQB 1U02A 4OX6A 3RBZA 4CNYA 4DN0A 3GONA 1V5IB 3CIMA 2IYGA 1W2IA 4TY8A 3POTA 5D0HA 1LK5A 4NYPA 3H42A 4J9MA 2MLZA 3A8EA 3R3TA 2CFXA 1RYSA 4RUBA 2OIHA 2Z0GA 3KJQB 4GVBA 1WHWA 4LF5F 3CDBA 3BSCA 4TLRA 1NKCA 2G1DA 3S01A 1IR1A 2EFOA 2YKNB 1XR5A 2AWZA 4UUXA 2EFVA 3FFIA 4BWJA 3RU0A 4CLUA 4YY3J 2W2MP 3KDOA 5KFHA 2GA7A 4ZJQA 3K58A 1RT6B 2PFFB 1UJ5A 1R0CB 2HLTA 2XM3A 1Q7YT 2MZQA 2DGOA 2L9WA 1P6TA 2OSRA 4L3NA 3C14B 2ACYA 3EVOA 3IM8A 5LSRA 2ROGA 1H98A 1HBNA 2D69A 4IOAQ 1WF2A 1CC7A 2W2OP 2RQKA 2GVZB 2GFFA 4TU7A 2CNLB 3KHHA 3MAQA 4ED3A 1U48A 4OV1A 1HQUB 2AW0A 4ZHRA 4CZCA 5H1SV 4ZA1A 2B4OA 5D0EA 4QCLA 3QFWA 4DUZF 3QRPA 1PAEX 4WIQA 3P3DA 3H5YA 2R7XA 4KHRA 2QO3A 2DNOA 2VBWA 5D78A 1N52B 1UJ6A 1ZA2B 2PD1A 1URNA 4ZVEA 1XR6A 3MI7X 1Q5VA 3DLEA 2U2FA 2JEFA 3B54A 1UFKA 2A2DA 3T19A 2E5JA 1R3NA 2MKKA 1N34F 3M6WA 3K17A 1UMJA 2W25A 2FUG9 4IO1A 1VQPS 1HNIA 5J1NA 1Y00A 4OZ0A 3S8SA 2X1FA 1S1WA 2WRMA 3MEEA 4FYWB 1HNZJ 1UVMA 3LQVA 2NR0A 2ZH1A 4H4OB 1C1CA 2ZD1B 1KVKA 3JQKA 4ANEA 1S1UB 3J81j 5IC6B 3D1OA 4G65A 3Q0AA 2ZBPA 1RT5A 3DXBA 4ZJOA 3PW0A 2P9EA 4JI1J 2LQBA 2DR9A 1CC8A 2H5EA 4NLYA 1VLOA 4UZCA 3TUJC 4F0HA 4ECVA 3HLUA 4NLQA 1YTYA 2ADBA 2FY8A 4KKOA 5K8NA 2KJVA 3Q8PB 1XNQJ 3LP0B 4B9NA 4AL6A 1FRLA 2VOOA 1HBMB 2QLWA 2OI2A 2DEJA 1M5SA 5HK4A 3TW0A 3EX7B 4P7TA 1RT7B 4DR5F 3H20A 3T6BA 1FXLA 4DV0F 2CZVC 1PYOB 4USVA 2CJYB 3VV2B 4F3MA 1CJVA 4KBIA 3BQ1A 3FC9A 4IG0B 4LF8F 1F1BB 2OMLA 4YEAA 4AL7A 4B9TA 1KN6A 4OZ3A 3IXQA 1NPRA 1PC5A 3BBCA 5IZHA 4ZVTB 1T03B 4F02A 2KU7A 3V2UC 4Q8FA 4YB1P 4L74A 4MK7A 2DR6A 3ILLA 3MCMA 1FNOA 2H1YA 4PYDA 5E2QA 3KLIA 4WKYA 1KR4A 5IT0A 3SFUA 1A9NB 1Y9OA 3MPWA 1S9GB 3R97A 4B02A 1U1QA 4BCAA 2HFZA 2CPHA 3G86A 3M2RB 2XLIA 1K0VA 1ZAXA 3L4BC 3PIPQ 1LWXA 1R89A 2N4CA 4Y28C 4JUZA 1TL1A 3OJUA 3BO4A 2J6TA 3IRXA 1SL0A 1T9TA 5GMEA 1LEOA 3GV8B 1FHTA 1V6HA 1B0PA 4DL7A 2XO7A 1BWVA 2MKHA 4URSA 4C8KA 3HO1A 2VFRA 2WSCC 2XWXA 5EX3A 5A8WA 2P6SA 2B6AA 4FNIA 4DSEA 3ONQA 1X4GA 1VC0A 5IV4A 3LPEA 4IKAA 3NKYA 3W2VA 5IFMA 2D3O1 1HI0P 4KPYA 1UJ4A 2IY5B 5GADI 1I1GA 2E7XA 3C16A 3HSZA 4LF6J 2XGPA 3GWCA 3W61A 5GVQA 2GIQA 2FZGB 2WK4A 2L9NA 3WDOA 3TAPA 4HHUA 1U1NA 4LF4J 4DDFA 2YWKA 5ETTA 3C46A 3L9ZA 1RADB 2RF2A 1JLCA 1PIEA 5IWAJ 1DQAA 3NGKA 4OZ2A 4RBVA 2XY7A 3BDEA 3VHQA 4URQU 2B3TB 1X5OA 2VDIA 1TKZB 2YKMA 1Y3KA 3G8QA 1E6YB 1EX8A 1O0PA 1KHVA 2VFTA 2ZBIA 4DR1J 2NZ4A 4IO9Q 4EYHB 2CJAA 1NZ8A 2K8GA 2MMYA 5M2PA 2NPFA 2OKQA 3KHRA 1EAYC 1ZAVA 2MLXA 1XERA 2PA8D 3SMZA 3KTQA 2K1RA 1UEUA 4DZ6A 2BE9B 1I6JA 1RT2B 1S1VA 3H8YA 1RWXB 3PTWA 3RG6A 4RZRA 3EVMA 4YHHJ 1QDUB 4DQPA 3KMSA 5ETPA 5KG3A 2DNGA 4LSLA 4LF2A 3SFGA 3WIVA 3ZZOA 2A10A 5AXNA 1M1KT 2VA2A 2EVZA 3UDLA 1S6QB 1M5PC 3T1HJ 5DLFA 1U6BA 2JL9A 5L8RC 1B0VA 2ACMA 5DDQC 4WXWA 1N36F 1F5BA 5KG0A 1N32F 1GEHA 1UZHA 3NLCA 4RW9A 4TXSA 5D4NA 5A6PA 1F5AA 3KUGA 4X64F 4UQGA 1S4EA 3J7AN 2QLFB 3MECA 3QIPB 1FVSA 1MROA 4R5PB 4DR7J 1OS5A 3AQPA 4OYPA 1HBOB 2DXDA 2GVZA 1KONA 4U7UK 1U6ZA 1FNXH 2E29A 2R8JA 1B0TA 1Q8LA 2MQ8A 1GTHA 2OPSA 3PRVA 2X3GA 2PE8A 3GJQB 3V81B 2D3ZA 1NK7A 2HHVA 4QU6A 1RWUA 4NZ7A 1YK9A 4PG6A 1NMEB 2VG5B 3HVAA 1XR7A 1Y0HA 4WTOB 2MLYA 2VPZB 3I4HX 4C98A 1RTDB 3QRRA 1KLMB 1V9OA 3CW2C 4C8LA 2HAIA 4P9SA 4DV0J 4JP8A 3PW5A 3KHGA 1AYEA 3BM7A 3BDPA 4FPRA 4LF8J 3LANA 4NLPA 2ZUGA 3J81Y 4B3SJ 4YB6A 1TV6A 3S6EA 2HHQA 3W2WA 3MMCB 1JLGA 2ZWPA 3NBPB 5BR8J 3W65A 3PACA 2YWHA 3MZIA 2MPUA 3MTJA 4YN3B 2AZ3A 2QA4G 4ED2A 3DLEB 4MTPA 5D4OA 1Z2ZA 1PYSB 4F36A 3R1HA 2ZE2B 4WYLA 4K0KJ 1GX6A 2CVEA 2CQ1A 5EUHA 1I3OB 5HN0A 3ZZZA 2HVEA 4TVAB 3RBEA 1AFJA 5IS2A 4G1QB 3THVA 4CYUB 2UV8A 5CYQA 2HS3A 4G6VB 2E1RA 4OYAA 5J2PB 4DR2F 4GC6A 3R2CJ 2LEPA 5I42A 2F65A 3CDWA 2MQMA 3VGTA 3D67A 1BQMB 4A48A 1TKXB 5FLXU 3BS9A 4DV6F 2BABA 2R2UA 3V6HA 4LVOP 2NREA 3TYTA 3VTIA 3O1LA 4G1IA 1TFYA 4Q0BB 3W5XA 2FQQB 5C2CA 3S7RA 2XY5A 3KK1B 4ZLLA 2CZ4A 5A8RB 2RUSA 3K7RA 1WHXA 3D3CJ 4M94A 3QJJA 5EDWA 3ZTQA 4LF7J 4RNOA 2XMJA 1JNRB 1ZZFA 5DRKA 1KTVA 1NM2A 2HHPA 2HWHA 4PG4A 3R9LA 5F8JA 1O51A 4RW7A 1VBKA 3QAUA 3ZZPA 2ASJA 1RAAB 2J7WA 2MDAA 2YQ1A 1VRTA 2RIJA 4KC5A 4WFYA 2LKZA 2W24A 1R0AA 3NMRA 2BM0A 3SEOA 1YLXA 1PC4A 2CG4A 2B7BB 4RPFA 1JJCB 4N47A 4NCAA 3HHLA 3TZYA 1VYAA 2Z56B 1WD6A 3DI6B 4LFAF 1AW0A 2BBEA 3TQEA 3WBZA 1UTAA 2IHR1 1RWKB 2OD6A 3SBMA 1T8EA 1NO8A 5LT5A 3BN7A 2JLFA 2DNRA 1HL6A 1QAYA 1F2HA 2X3DA 3BR8A 1DTTB 3I9ZA 1S9FA 3QMQA 1UWAA 2LXIA 3DLKA 4UF4A 3FEYB 5E3QA 4X4OA 2CJXB 4CCHA 4NLUA 3AOBA 4NCBA 2AX1A 2CIMA 4WJBA 5KFUA 5J2QA 4C11A 3GU0A 1UVLA 3M1VB 2R7UA 2AKWB 2ROPA 1PKUA 4HI2A 4ZITA 5HBMA 2WONB 3H4DA 2AP6A 1S6PB 1PJ6A 5IT9U 1TKTB 3SIPB 4B3OB 2ZVIA 5HSPA 1WWHA 1Q5YA 4WYWA 2XS2A 3D68A 2MQQA 3OFGA 1W7WA 3JSBA 3AD9C 5I3UB 1JKHA 3R5AA 4TU9A 2RAQA 2ZZTA 3J7A1 1VMBA 4X2BA 2HSEB 4FP9A 2CQ4A 2QT7A 1FI4A 2XMUA 4DPTA 4IFVB 2VBXA 2JSXA 3G87A 1GMWD 3HHDA 3SDEB 2VFSA 4AT1B 5A8KA 3KMQA 4KH1B 4ZMMA 2BJDA 4OIXA 2CQHA 3EZUA 2BX6A 4P74A 2MJUA 2CQ2A 3JS9A 3I56S 4JI6J 2ZOMA 3NXZA 2I6WA 4YR2A 1SJRA 1XMQJ 2F8MA 2QLXA 3M8WA 1TK0A 1N5YB 4B3TF 2B4VA 4ELUA 3RB0A 4FF1A 4IG3B 2CUYA 1N4LA 1RAOA 1U8WA 2H54B 5E3RA 4O0IA 2VU5A 4I2QA 2V63A 1FXDA 2R2RA 4K5SA 4NMXA 4F04B 2UXBJ 2HIQA 1IQZA 1MWYA 3GR0A 4NLOA 1EP4B 2A6OA 2CQ0A 3IS9B 1S12A 1CS4A 4I2PB 4P10A 4Y6IA 2HQDA 4DPYA 1Y5IB 2OSQA 2MXYA 3H40A 2CPYA 1T05A 3PYDA 2P9CA 1S1XB 1W26A 2Y1LB 2HHUA 1YGYA 4CDIA 2QA1A 4PPZA 3NEKA 4YOEA 2CPIA 2IBOA 3HSJA 5DO2A 3F0NA 5M2UA 2HRUA 3AD7C 4A4JA 3MFHA 1WI6A 2XEXA 1UW9A 1GT8A 1Y11A 4OJ1A 3TAMA 2HFSA 4IG3A 1DQ8A 2RQMA 1YKWA 5L9XA 1TMJA 1RTDA 1YJUA 1GXLA 3QT5A 2VG5A 4U9RA 3RW7A 3DCAA 3SV3A 3FBCA 4FXDA 2F9JA 2KHDA 2E1MC 2EKYA 4DX5A 2MQOA 2AD9A 1T7PA 3R5JB 5G0RB 4ZKAA 3NNAA 2BJ9A 1NBEB 1U2CA 2LDIA 2DYAA 2NSBA 4KYZA 3HF5A 1IM4A 2O5DA 5KFWA 2HRYA 1FXRA 4USKA 2GJIA 3UR3C 4YDDB 3HT3A 3BGLA 4J9UE 1UZDA 2LU2A 2VUGA 3FCHA 4RUHA 4CH7A 2ZKTA 5CYQB 5EWEA 4K4ZA 4M5HA 1NSQA 2XNQA 2X1AA 1ZPWX 3FBEA 4HYKA 1Q16B 1MW7A 3LH2S 4XO0A 5LMNJ 4KO0B 1RTHA 2VPYB 3G82A 1RAHB 1CJKB 1JLQA 1NDKA 4A8KA 3GG1A 3OTOF 1T3NA 5L39A 4B17A 4LFCJ 3AA9A 2J9CA 3MPVA 3G9CA 1PG5B 4OYWA 2HEKA 1HBNB 1RBAA 1GTEA 2IA0A 1UW4A 2RILA 3DDIA 4I6WA 3PRBA 4DZDA 4EK2A 4Z37A 4M5KA 3KK2A 5HROA 3CC4S 1X9WA 2E9RX 1C0TA 3MEGA 1T0TV 4YB5A 2DNHA 5KFAA 1RAIB 1U7LA 1XMQF 4KR0B 4NCGA 1B3TA 2UP1A 4K59A 4CO4A 1K44A 3TEHB 4OLPA 1I51B 1F6TA 2ZBQA 4OV6A 2R2TA 2HNZB 1UP1A 2OAUA 2W4DA 2ZOFA 1NCLA 1WTBA 3BKTA 4B3RF 5D3GA 1YX2A 4O3RA 3QT7A 4UY85 2F7VA 3Q22A 3T5KA 5F8IA 2RD5C 2VPWB 4IOBA 8RUCA 2R7RA 3I0SB 2LVWA 3W66A 4XPEA 1SCJB 3DN9A 3ET6B 3GE9A 3KKFA 3W64A 3C15B 1YSJA 1T03A 2QMUB 4QOTA 4DPUA 1RWMB 2VG7B 4F3QA 2ZH3A 3NCQA 3PRDA 3P49B 4LF1A 2YTCA 1SUQA 2ZJQQ 2GX8A 2P6TA 4ITSA 4ZPWR 3T41A 5EWGA 3DDNA 3RB3A 1QSSA 2R7QA 1XMOJ 3Q8UA 5C5JA 1K1SA 2ASLA 1HARA 5CHCB 5KT3A 1S6QA 1RAGB 2FJWA 4LF9J 2HHXA 5A2QU 1WDDA 1RJJA 4KHPF 1ZS6A 3EGNA 4C11B 3CIZA 1PJ7A 3N6MA 1FK9B 3LWMA 2BEFA 2XYHB 1TUVA 1M5OC 4TQSA 2B6AB 4OFZA 2KZZA 1DJ0A 1NKBA 1KKHA 4C0HA 3KK3B 4K8RA 2J6UA 3MM9A 2W2QP 2DBBA 3IG1B 1KP6A 4RNFA 4TLQA 4JV5J 2DGWA 2QL9B 2QMXA 3O5TB 3DHXA 4MKVA 1N5VA 2E5IA 4XAKA 2EFPA 2CWXA 7FDRA 1HWUA 5K20B 2GHWA 4AUKA 1FD2A 4BHQA 3QO9B 2HVDA 5DQIA 5KFFA 1N34J 1NK4A 5M2RA 2BMBA 3QT8A 5E41A 4NA3A 4J9KA 1CBKA 4ED5A 5KT4A 1NNDA 3E3XA 2X1BA 2DO0A 5E3AA 1Y5LB 3GIIA 2DH9A 4OLOA 4DV4J 4DR4F 5SZTA 1GNKA 2DISA 3PJWA 4A8XA 3RR7A 4FVCA 2CNNB 4XDCA 3H5XA 1ZETA 3HVRA 3I6PA 5K8MA 1HYSB 4FBTA 1TU0B 1MWQA 5DQHA 4RU2A 1RTJB 1R8BA 3QGHA 3IFEA 3KYLA 1UVKA 1JQGA 4Q8EA 1SVDA 2PIIA 3KHLA 1HW8A 3LW5C 4NPOA 3UNYA 3PVXA 3RW6A 1U24A 1OQ3A 1WC5A 2IMWP 1KFDA 2W4CA 1UWBB 5J2NA 2DXEA 1HA1A 2DNYA 3BGRB 1SQEA 1YZ6A 5KFOA 2BOPA 4LVNP 1X4HA 1SQGA 2I5JA 2RS2A 3LAMA 1PYTA 1JJHA 1RWNB 2XI2A 2DY9A 3DNCA 1RB0A 5KFMA 3PR5B 3DM2B 1FTRA 4HR2A 3MECB 3QIPA 2DHAA 1N6QA 3ILIA 2HVIA 1Q1KA 1WSRA 2EFNA 4M63A 2AEMA 1VQNS 2Q79A 1HYSA 5D0RA 1D8ZA 2WHOA 1ROFA 4HLBA 2ZZNA 3J7Z5 4CLTA 4FN5A 1NUEA 4ED1A 2CPEA 1SL2A 1N33F 3KNGA 4X4SA 5E0OA 1TR0A 3EZ5A 3VAFA 1TVRA 4H54A 2C2RA 4WZMA 5KFRA 3D0HE 3MM7B 1AUDA 3TUPA 1YRXA 2YWEA 1JNZB 4CT8A 4KHPJ 2DH8A 4HTJA 4LF7F 1K1QA 1PJ5A 3RYLA 2M8HA 3UW1A 2NXEA 3KNAA 1ACMB 2G0JA 4CRJA 1Y10A 4IYQA 1HR0J 1ZM9A 4OHVA 3VAKA 3PXGa 3KXDA 2BR0A 2JEGA 3IO1A 2CNOB 2FZKB 2PT0A 2PI5A 3PW7A 2BW2A 4EMDA 1KLNA 3D3BJ 1SXLA 3ENVA 3W9HA 4F67A 4YUDA 1QAIA 2I5JB 1S59A 2OJ3A 2CPXA 4IDKB 1X5TA 5CZVA 4DS5A 9RUBA 5KTQA 3LUYA 1VRTB 1GMWA 1KOHA 2RJZA 2R2SA 4GKKJ 1FKPA 4PWUA 2F3JA 4KGXB 1IJEB 3BKFA 4DCPB 5AE3A 1X5SA 2W4PA 5K8PA 4DUTA 1VC5A 1FJ7A 3ZZ0A 4DR5J 3MMCA 3FQKA 1ZM2A 3GIJA 3GPAA 5EWFA 2HFOA 2MZRA 1VK3A 2GO8A 2WB1D 2P8IA 3CJ3A 3DI6A 3UN5A 3A8IA 3SYZA 4A8SA 4JI5F 4X66F 3GYNA 2JJ4D 4IG0A 4NOHA 2WW4A 4NI2A 4YHHF 2HS0A 3CJQA 3OXLA 3GCXP 3TR5A 4CIOA 1Y3JA 4JV0A 2N3OA 2LEBA 3I82A 3UVJB 2WW8A 3JSMA 4RUCA 3MAHA 2KRBA 2BV3A 4Y2IA 2MHNA 1SC6A 5ITHA 3VVTA 5J2QB 3IBFB 4A8MP 1SKUB 1HFEL 3T9ZA 3RBDA 4C6AA 2Q1LA 4C0OC 1FKOB 1SC1B 2V8HA 3FNNA 3N5FA 4Q7AA 5F8MA 4JI8F 3T5HA 3C6TA 1OWXA 1A7GE 1VQ5S 5DQGA 1HWKA 2BE2A 5GAHI 5B0EA 3MM8B 4UW2A 5A76A 4OYIA 4YQWA 5B0FA 3CCVS 4OX7A 4WU3A 3NGDA 1J5EF 4ZLJA 5KT2A 2F9DA 2G2ZA 2NPIA 2MY7A 5K14B 3GFHA 5B09A 1D9FA 1U4BA 2QV6A 2AF6A 4LRBA 1EB0A 1FO1A 5KFJA 4I64A 4RU9A 2CQ3A 3ULHA 2R7WA 3IWLA 1NH8A 2QG9B 4ZPAA 2EK6A 4CLPA 4B9SA 4HACA 2WOMB 3SQOP 3DC2A 1P8GA 4RWWA 1SL1A 2JC0A 2CNKB 1T11A 1QUVA 5BJRA 1FRHA 3GILA 2FLLA 4LF5J 4CQ1A 3OV7A 1DRZA 2GW8A 2FIUA 2NXCA 4Y65A 5D4PA 3I31A 5JVHQ 2UVUA 4OHYA 4TYBA 3KLHB 1NRKA 2PMWA 3DLGB 3IWXA 1BQNA 3G8SA 2C22A 1TKZA 2YKMB 2K7KA 4FYVB 1EETA 3MMJA 4I2PA 4KGVB 2XCPA 2DIVA 2NQPA 4QW8A 1WHYA 4O3OA 3RZAA 4AFFA 1GXUA 2LECA 1XMBA 1QD1A 4QWAA 2NUUG 3ETMA 4I69A 3IAS9 4DR6F 3WC0A 3IA0A 4XDDA 3G8TA 2E5LF 1XNRJ 1RAJA 2RDIA 4Q5VA 3T5JA 3P45B 1AZSA 1E6VA 2BKNA 1XK8A 2KB2A 1UVIA 3X1LB 2MKCA 4IH7A 2XMMA 3B82A 3PW2A 1HR0F 4JI5J 4HVZA 3EXCX 1GH8A 1OPIA 1HBUA 5AT1B 5LMUF 4DV5F 1YVFA 1JIHA 2H5JB 3DRRB 4LFBF 2B56A 4CNZA 2V4QA 4JI3J 5HVHA 5IM0B 2XMVA 3U02A 1H3DA 3AXKA 4DFPA 3ZTOA 1ZZNA 1U6FA 2CZ9A 4DOZA 3EJMA 1W2BR 3GMGA 3DDKA 4ZLNA 2E1CA 1YI2S 1U0SA 1UA0A 4HL9A 4LFBJ 5KG6A 2Z30B 2Q6CA 2RE1A 2EFGA 3GFXA 2GCFA 1H38A 1FJGF 3N79A 1X4CA 4RW6A 1KSPA 5E7OB 2BANA 1J5EJ 4JI1F 1O8BA 4NRTA 3CSKA 4LT6A 4QIFA 3KLVA 3MURP 4FF2A 5HANA 2C2MB 1URRA 1RU2A 1IKWA 4I4BA 4U6PA 2OTJS 1F9EB 4PUOB 2HMIA 3LP1B 3PO5A 4TN2A 5CQGA 3MMAA 4HDHA 2GMLA 3M8ZA 4C8ZA 4KV8A 3MWBA 1IBLJ 2QL7B 4ZVQB 1VI7A 1F9HA 1VIOA 5A0YB 1CVJA 2FHKA 1RA7A 2C2KB 4QYZK 1G4CA 1RWWB 2CQIA 3QRQA 1OY8A 2MKIA 3PDNA 3PCOB 3H90A 4NZ0A 5EHHA 2DHSA 2COLA 1HKAA 1VDHA 3FDSA 3SCLE 4J9NA 2B5JB 3M2UB 4FXWA 2XHWA 4J9PA 3Q83A 3MAAA 2CJ9A 4CTAB 2HQFA 3EXYA 4ANDA 2EWHA 1JLFB 1H2UX 1ZM4A 3GSIA 3DOLA 4PYAA 3V5RA 1N48A 4PABA 4CWBA 3BH6B 4P2XA 3IBCB 4DG1A 1S1UA 4DPOA 3OVBA 1HLWA 3KLFB 3K8WA 3KUHA 1IR0A 2ZH8A 1C0UA 1JLAB 2BRKA 1NAQA 1LKZA 3NAIA 1IVZA 2Z58B 4KV8B 3J81U 2FJBB 1IBKF 4IR1A 1CULA 1Q79A 1T9YA 2IM1A 3GFYA 4P2MA 1HNXJ 2HHTA 1RSCA 2WB4A 2KL8A 3PHEA 3DMJB 1WKLA 4PXBA 2XO6A 2QA4S 4AQYJ 2RRAA 4BDPA 2FLPA 2D7SA 3D4JA 1R0AB 4OL8A 2D9PA 1P1LA 1C4AA 3UVJA 3TOQA 4X4PA 2BQRA 1LFWA 4KO0A 2YWWA 1FX2A 3NGTA 3CMES 1FVQA 4EYIB 4Y2KA 3SV4A 5DJBA 4DV2F 3CCTA 1KQSR 2HBYB 3GP9A 1OPZA 1G6BA 4I7FA 3QGIA 3K5NA 4DR1F 3M32B 1EARA 1RHKB 3HZEA 2SXLA 3FBFA 3WQPA 2YNHA 4RW4A 4ETZA 2CPDA 2E5LJ 2JRSA 1XNRF 2IVYA 2QGFB 3I0SA 3NRBA 2V2KA 3GG0A 3DOMB 3Q8RB 4ENOA 2HLUA 7FD1A 1X8DA 2QE5A 2XY6A 2ZH4A 3ZZRA 2DT9A 2Z2LA 3DRSA 2DNLA 1UCNA 3HHLD 4BS2A 1M5KC 4UUWA 3THPA 5DETA 4YFUA 3CWJA 4C7QA 2M88A 1DTQB 2LA6A 5KG5A 3CO0P 3FGVA 1N8RT 1B99A 2L3MA 3MTKA 1H2VZ 5KG1A 5AXLA 3G96A 3EYZA 4O3NA 4FBUA 4MKYA 3DYAB 4X4RA 2F8EX 4NCGB 3A3NB 1FJEB 2HW3A 4X4UA 1SC4B 2BOAA 1LWFA 3FQLA 5JJBA 1LWEB 1DURA 2GV1A 3MF5A 4CO5A 3KWMA 3AOAA 4DR3F 2DCLA 3I32A 2VZ9A 2N7YA 3FMBA 3BO3A 4FKYA 5C42A 3BBBA 3KLEB 3PZPA 2DR5A 3MOJB 4WXOA 2OEJA 1TELA 1KFSA 1YJ7A 1M90T 2G2YA 3TEGA 4LIRA 4MFBB 4ECWA 7AT1B 2VG6A 4J9OA 4RO0A 2XS7A 1S77D 1OQ6A 1E6VB 4LREA 1NK8A 4JI6F 5DGBA 4CO3A 3LP2A 1RAEB 3GIRA 3GJRB 1X7VA 3OXGA 4QIGA 3BBFA 3QWPA 3W60A 4N8OA 2VJVA 4B9LA 3RUBL 1R27B 3OHBA 2FVCA 3LF0A 2R8GA 2YH1A 4IUFA 2EW9A 1K47A 4P52A 3MUMP 2AJ2A 4NE9C 4P7VA 4JI0F 4LMZA 3O44A 2OPPA 1HI1A 3JB9k 1KEKA 1GAOA 2UXBF 5HAOA 1IJFB 4EFAC 5I3QA 5HO4A 2EC0A 5BR8F 4NL5A 4PQAA 4C9DA 2BUNA 4NYZA 1I94F 3B8HA 3W7BA 2M5YA 3PX0A 2GNKA 1NDLA 2V4JA 4RW9B 1HD1A 1FRIA 1VCTA 2CWKA 3CD0A 1JLEB 4WP3A 4FF3A 1EQMA 1K9MT 4RR5A 2CG8A 3DLLQ 1D09B 4LQ9A 1JXEA 3UCGA 1AT1B 2HQGA 2VQFJ 2M9KA 3OR1B 2MEWA 3R7BB 4ETXA 3SSRA 3HHEA 3SQGA 3CCLS 2YKOA 2MKJA 4IFYA 1IBMJ 2R42A 3ETOA 3UDEA 2OEMA 3M6UA 2XMAA 3JYTB 1IBKJ 1TL7B 1UEVA 2RSQA 5D77A 1NJYA 1RT2A 1S1VB 1YJNS 4DSJA 3IWNC 2Y1JA 3IGNA 2ZEJA 4DQRA 3WZ0A 3R8YA 1DARA 1NLKL 2WAQD 5HMWA 1TAQA 2VB6A 3BPSP 1Q95G 2V69A 2Z2ZA 1MROB 4MT1A 4DV3J 1XWLA 4YDXA 3MPUB 2GMJA 4J7CA 2RVJA 3TVZA 2XHCA 5LSLA 1G7CB 2CYYA 3PKMA 1IUJA 3HKZD 3OTCA 2F5GA 1RHRB 2HZVA 3DRPA 1N0VC 3M8SA 2DPIA 4NA1A 3HX9A 5I4MA 5KT6A 3GR1A 1AA1B 5E33A 3W9JA 2AX0A 3GJTB 2RRBA 5KFNA 1LXNA 4RX6A 1S97A 1WNEA 3SQGB 5KFXA 4ID5B 2J9DA 4AYBD 4DN9A 5GMKa 1F3VA 2XQCA 1PBAA 3QJLA 4MKBA 3FUYA 1N88A 2LMIA 4PG8A 5L9NA 4N5SA 3G4SS 4WF9Q 1DFDA 3UI3A 1GX5A 4A8YA 2ZZMA 1DTTA 2ZC4A 2GHVC 5IQ6A 3VAMA 3KFWX 1HIYA 1WEYA 4KGMA 1NHVA 5KFPA 2VHGA 2JOQA 1PCAA 1HQEB 1JLFA 1NSAA 5CYJA 5JMNA 1MN7A 5D8HB 1SJFA 1A0OB 5KFZA 4UZBA 1FFWB 4U95A 4ECRA 1RXOB 1TKXA 2C3MA 5FIIA 1ZYQA 3HD1A 2ERRA 1NK6A 5ETOA 5IC4B 4MMOA 4UTGA 3DLJA 2A2CA 4ZCLA 1I94J 3EDRB 3MEKA 1WEXA 4ZK7M 2DRBA 2AJQA 2Z8QA 4EBDA 3IP0A 1X9MA 2MYFA 4O4GA 3GV7B 4PEOA 2DR8A 3NY0A 1P1TA 3QT6A 3BREA 3VCDA 2HHHJ 5LM7E 4ECQA 5HVGA 2NYIA 4ID5A 4QBUA 3ITHA 2V5HG 4M5LA 4WP8A 1VISA 1RLDA 5HP1A 4F3OA 2DY1A 3NAHA 3D6FB 4CO2A 5F8HA 1IBMF 2HRTA 2Y0BB 2E9TA 1RBOB 2ZWOA 5MAOA 4LQ3A 3ZC4A 4NXNF 2PGCA 2WBRA 4KGZB 4OJHA 5J2MB 2DGSA 1G1XA 2POKA 3R6LB 3IG1A 1N33J 2ZBCA 4FXVA 4EBEA 1AXQA 1FEEA 1L3SA 4MIWA 3I5CA 2IVMA 4TNOA 2GHPA 5CD4A 4K4XA 2FTRA 2LCWA 3QLHB 4J9QA 4X4TA 2W01A 3OVAA 4ILLA 2HZCA 3IAM9 4QYRA 3PNIA 1WOOA 1LOUA 3H7HB 2HPUA 2VD3A 4QJVA 1NEEA 1YBUA 2JNJA 1VQSA 2ZH6A 3HFZB 1NHUA 1FE0A 3HVWA 3DRRA 2G9OA 4I56A 4UQTA 3WX4A 5KFYA 3VZIA 2W7PA 2W7OA 1RABB 2XZTB 1BQXA 3CE8A 4HI1A 4RNHA 5ETRA 4ZVPB 5HQ8A 2PEBA 2R7OA 3T3FA 1FWPA 1VQ7S 2HHWA 1T9WA 3AHPA 4DMZA 3Q8YA 1NH7A 3L7OA 4YB7A 4RWXA 4LR7A 5KG2A 5DDRC 1RT4A 2I2YA 3HHLB 4B08A 1VQOS 4ILMA 4K50A 3AD8C 3FSXA 3K2YA 4O4RA 3W1YC 2FD2A 4UOCA 3D1QA 4KT0C 2GQQA 4E2FB 1T9UA 4PRFA 4JV5F 3GSDA 4K2XA 2KZMA 1QUPA 3OW2R 4EWTA 2MHEA 2RNEA 2VASA 1YDLA 2G0CA 1MMDA 4LBPA 1IKVA 1D9AA 2OLWA 3F44A 5B0AA 3UWTA 4CLSA 3JYTA 3W8PA 1RA6A 3ELHA 4PAAA 1YITS 3DLGA 1AZSB 4UT4A 3G2XA 5C25B 2AQ4A 3FZBA 4DR7F 4NLTA 3MMBA 2DGTA 2D3OR 3CUNA 5D4LA 4GVBB 3C66A 3NNHA 3VAGA 1VQLS 2EEYA 2HURA 3IR5B 3MGJA 1YJWS 2LFVA 1WEZA 3NGUA 1N0UA 1W25A 1ZBTA 4JOUA 4O23A 4ZLPA 2V9KA 4RUAA 3KK2B 3Q2SC 3GV5B 1YJ9S 2ZHAA 1T05B 3M2UA 2MJNA 1U0HA 1NDPA 3BV8A 5B0DA 3GYGA 1LQ9A 2DR7A 3VQSA 3OJSA 2AJFE 3C14A 4ZDNA 4WTYA 2R8IA 2G4BA 5J2PA 1TV6B 1NK9A 2W9CB 4PXCA 1DQ9A 2JVRA 2M4MA 3V6DA 2E5HA 3H2VE 3AJ2A 3D5MA 2VKZG 4C3KA 2IPOB 4WU2A 4JI7J 3P5TL 4DI6A 5LXYA 2X1GA 1R31A 4UOHA 3N6LA 2PDAA 4MJKA 5L46A 4AQYF 3EMTA 4P75A 3FSYA 1VRQC 1H2TZ 4A46A 4EO8A 4YR3A 1C2PA 1AROP 4LSLB 5FLXY 1IKWB 5KOXA 2ZM6F 2VQEJ 3HHLC 3K57A 1VQ6S 4Q0BA 2H65B 2MB0B 4EZ6A 4ZCMA 3CJ0A 2KFZA 1WOPA 5DS7A 3PFEA 4F0MA 2V8DA 3TRGA 2DVIA 2VC0A 1S72S 4RW6B 1OYDA 1SJQA 4DR2J 3CCQS 4ZVFA 2EC2A 3UCUP 1VR6A 3CEDA 3VGSA 3HPOA 4A8FA 3P5BP 2AGOA 3M9NB 3PX4A 4IQXA 5F8NA 1EHWA 3MXHP 2J6SA 4C48A 1NB2A 2HBRB 2KT3A 4DUZJ 1HWLA 5GADU 3V6DB 1ZH5A 4ED4A 1D8YA 2BRLA 1GQEA 2KXNB 3LP1A 5KFEA 3V81A 2RT3A 1XMOF 1Q82T 3CTRA 2FJAB 3EZOA 1FKPB 3NGSA 2B9XA 2V6AA 4CM2A 3M2VA 3PYEA 3KLGB 1S5ZA 4R8UA 3CJSA 1IBCB 2V67A 5D15A 4AE5A 1LWEA 3H5UA 2MQLA 2OPQA 1BE4A 2XMWA 2JDJA 2YWFA 3QGPA 4BWMA 2KYXA 3R7NB 5G4DA 4C3MA 2AGPA 3ICLA 1R7IA 2DNMA 3RRHA 1LW0A 3R2DJ 5B0CA 4DR3J 3EWGA 2FJEB 1WC6A 2BA9A 5E3PA 4DX6A 4NX9A 3T5LA 2IRYA 4DV5J 5FJ4A 4OYXA 2GJFA 3PEHA 4NLDA 5F9NA 2RKIA 2HNDB 2Q43A 4H4MA 4USIA 5IOLA 3BSNA 3PHTA 4YR0A 3ZXWA 4KFBA 4HDGA 5EX0A 2OELA 4C8MA 2NS1B 2ZBRA 1KHWA 4M5DB 1Q7LB 4C0BA 2KDOA 1BXNA 4I6AA 4YMEA 2FLNA 2J0QD 1JWWA 2NXNA 5DG7A 1YIJS 2EKNA 2HVHA 2EPIA 1YBAA 2L9DA 3UD5A 1Q53A 3CJ4A 4LRCA 4U96A 4C8NA 2XZWA 3M32A 1Q0NA 1RTJA 4XTTA 1N5QA 2IM0A 1TP7A 3LWLA 1FJGJ 1TFWA 1B70B 3VVUA 4ZPTR 3J7YI 3QZ8A 4ED6A 5KT5A 2UUBF 3MR3A 2JFKA 3BF4A 2R8HA 5ETLA 1RTIB 2YNIA 2ILYA 2J9EA 2QYGA 2WVBA 1S6PA 5KFBA 2DB1A 2HHSA 1VBZA 3VF0B 4KRWA 1DTQA 4NLRA 2YY3A 3OR2B 5J1EA 4FYDA 2O1PA 2QN6B 2FVQA 2YPZA 1DZ5A 3AXMA 3CMQA 1RZMA 1RU1A 3PM9A 1TL3A 4ICLA 9ATCB 3KLHA 1QAXA 3DOKB 1B64A 3ADAC 1FRXA 3V4IB 1RDRA 4O3PA 2L08A 1FT8A 4M95A 3DFEA 4HHHA 4N77A 2EXUA 5A6WA 2IDEA 2CADA 1TL1B 2Y0SD 4Y2CA 4TY8B 3PY8A 4WZQA 4K4TA 2YKAA 3Q86A 4JI7F 2GAGC 3EPGA 3LA0A 4ANCA 1U1PA 4KIAA 5F8LA 4EGLA 3MM5B 3ISNC 3QAEA 5E3CA 4CO1A 1R8CA 2XG8A 4ZVSB 4S0MA 1L3UA 4Y00A 4OX9J 4DV3F 2ZM6J 3R5CA 3SSQA 1D0EA 4WP9A 1MLAA 5L1LA 5IWAF 4V1Ak 4OYZA 2OH2A 1NXIA 2LEAA 4HHJA 4Z2XA 1SH3A 3OUYA 1SJ3P 3BZQA 4DCOB 2ZH5A 1R8PA 4IH5A 5T7LB 1RISA 2F63A 4DCJB 1B4SA 4W90B 2HQCA 1VC6A 3DLBA 5CYMB 2KM8C 5KOWA 4NLGA 2WTFA 3TJAA 1V3SA 2O01C 4L76A 3BN4A 1FERA 2FHJD 2WCXA 3DKDA 3BEGB 5J2NB 1QVFR 5SUHA 3CC7S 1FRJA 1X4DA 1U1MA 2RDDA 1H73A 4QIWD 3KJVA 2W9AA 4NI2B 1C1CB 2ZD1A 3BGFA 1RWVB 3H59A 4KSEB 1D1UA 4ZP7A 4X4VA 3O3LA 2W9CA 1HNIB 3N5BA 5L1IA 1T95A 2BACA 3RAMA 2DTJA 2CDQA 2VOPA 3R7SB 1KVJA 2D74B 2IM3A 3I0RA 3ILJA 1U47A 2UZAA 2CXEA 3L09A 4WCEQ 4ECYA 2IJRA 4DS4A 5C24B 2OEKA 3VQTA 2V8GA 3W8GA 1FX4A 2K06A 4X64J 2VODA 2EBGA 4PQUB 3N0VA 3U27A 1H72C 1OY6A 1RHMB 2RS8A 2PO4A 1SI9A 2FY1A 4O0NA 1RYRA 2QFIA 2DITA 2HNZA 2KFYA 1HI8A 2BVZA 2ATLA 2XNRA 2YKNA 5HI7A 2VONA 2OTLS 3MUTP 3KJVB 1R6VA 4ES3A 3DM2A 2DK2A 1LW0B 5IQQA 4RLEA 4DG1B 3OL8A 3VALA 2BQ3A 2H48B 3HK2A 1NJZA 3TJ9A 2PFDA 2XCAA 4XPCA 3LALA 2BZ2A 3IC1A 4P6QA 6AT1B 2HK2A 3HXMA 5ETNA 2A3JA 1UETA 1PAUB 2ZFHA 5GAEU 2ZKUA 2M7SA 3MHYA 3EGWB 4DL4A 1BQMA 3PEJA 4LSNA 5K9FA 2O67A 4F4ZA 3AJDA 3RTVA 2PC6A 5T41A 2ZHBA 1HQ2A 2XBPA 2W9BB 4F2RA 4DWIA 2KRRA 2XC9A 3BPDA 1UA1A 2VH7A 1UL3A 2KKHA 2F8HA 3HJVA 3MCOA 4FYYB 4G1QA 4C2MA 1WG1A 3AB2B 3K5LA 3JSRA 2UXDF 1TTHB 4HKQA 1S7IA 4LF4F 3MOZA 2HQIA 2ABYA 1U2RA 2ZE2A 1NSPA 2V2VA 3IRXB 2G13A 3KG0A 1X4FA 1FDBA 3H2LA 4ZPCA 5JVGQ 1YQHA 4JI4F 5IV3A 1PBUA 2IJNA 2LXUA 2QZ8A 2DGVA 5ETVA 2KXHA 3DGPA 2VICA 3B6BA 3A8JA 5AJ3J 2LLZA 3NS5A 1S0MA 4DF8A 3Q8QB 1YJVA 5KFVA 1WKJA 1LK7A 3FK4A 2N7CA 5ETMA 3HM9A 3TZWA 3FEZA 5D0GA 3DYAA 2EBEA 1WC4A 3VWSA 5GAEI 4LFCF 3BYPA 1VRUA 2B7CB 4HTIA 1ZTWA 2Y8YA 2DEIA 2J8AA 1BC6A 4QZVB 4FZVA 3E01A 3CJKA 5AE1A 5EGYA 3CCES 1Q81T 4EI2A 3RB6A 2Z2YB 1KQGB 1JLCB 2LXFA 3MM6B 2OO4A 5AXMA 1SV5B 5HROB 3TANA 2ILZA 4ZP6A 2OD4A 3EGVA 3HSGA 1HBMA 5DDOC 4A8QA 2J0SD 1IXKA 5AE2A 5LMUJ 3M7VA 3UCZP 1NU4A 4ZN3A 2ZH7A 3TQ1A 3FRYA 3I4PA 1HNWF 1MNEA 4KH0B 4MIAA 3E51A 4ID8A 5B0GA 5HJXA 5KFLA 4PKDB 1WHVA 3GTYX 3ILOA 3M8YA 1QTNB 4USTA 5HQMA 1U1OA 1WF1A 2GVDB 2W7AA 2XSJB 3ZFVA 1MSWD 2F4FA 2EG2A 1FWKA 1KOOA 2DNKA 3MMBB 5HMXA 2LDYA 3D66A 3TO8A 1VJQA 2UXCF 1GXTA 2BE2B 3LP2B 1JXVA 3TVYA 4CLFA 4R0JA 1VQ8S 4DF4A 3UPFA 3AAWB 5E5NA 3FSIA 4Z7CA 2XB2D 1RHUB 2FHJA 1S79A 3IBWA 4DV4F 2UVRA 1CQMA 3SCIE 3ZZTA 3T1YF 2BKOA 2XSFA 3A1YG 4LIWA 4RBUA 1PILA 3GIKA 2JEIA 1EETB 1UWBA 4L72B 4BBYA 2FHOB 3KJFB 2DKOB 3D1HA 4FS1A 1QTMA 1NSKL 3R5BA 2GQ2A 4ZIWA 2QFJA 5D6GA 3OTBA 1VK8A 4NWBA 3Q2TC 1T3OA 3DU6A 3OUYB 5I3UA 2HVZA 3W9IA 4F0KA 2C2EA 1N5YA 4F50A 3OXFA 1GFWB 2CJBA 3AY0A 5FDLA 1IBLF 3A12A 1RT1B 1X4EA 5H9FK 2A0FB 4OI2A 2PEHA 3J80U 2XMTA 4DU7A 3TZXA 3K59A 2J7KA 3LPYA 2KT2A 2UUAF 1FD8A 2P2CB 2HFVA 5CD4H 3HKWA 2ZH2A 4RJVA 4JI4J 2IA6A 1BY9A 2ZITA 4LR8A 3T1AA 1ICEB 5DLGA 3AODA 1Z4UA 2AHOB 4ZP9A 1JLAA 1Q4RA 4Z7YA 5BYRA 4C97A 4QWCA 4MKAA 2IC3B 4C8OA 3JTOA 4FYXB 4I2QB 1VIXA 2U1AA 3C6UA 1F60B 1SIWB 4PZVA 1K73T 3A13A 3TJ8A 2OUGA 1H7WA 2E44A 2OPQB 2AEJA 1J27A 1BHNA 2DH7A 2M52A 4X65J 4DV6J 1CJTB 3JQJA 1RI7A 4E8UA 1Z1ZA 4NXNJ 3M2VB 1WI8A 3F73A 1EQ0A 5DM6Q 1HBUB 3IN5A 1YJTA 2VF3A 2Z57B 2LU1A 1UPPA 1WG5A 2B9YA 2CQBA 1YJRA 2I1RA 3R27A 1KTQA 5FDLB 1LW2A 1LFPA 5A0YA 4JV2A 4CLKA 5LL6d 3MFIA 1RT5B 4FS2A 2UU9F 4KTQA 1VBXA 1HNZF 2Q66A 3EICA 5DDPC 3NWRA 1CPZA 2B9EA 5DG9A 3JTNA 2AYMA 2MGZB 3M9MB 4GKKF 1RUSA 2IIHA 1VHIA 3HDSA 4J9SA 4DQSA 4JB8B 1T02A 2K7JA 1F2GA 4CLYA 2KVIA 2IAJB 2WSFC 3J7YU 4WPAA 3CVKA 3CULA 5CH7B 4PG5A 1HMVB 3TI0A 1FE4A 1X0PA 2RQ4A 2Z4PA 4JV1A 4V19J 5LSOA 2ROEA 4QQBA 4H4KA 3F56A
chains in the Genus database with same CATH topology
1HQEA 3TUIC 1QE1B 1JLBB 3CJ2A 1U26A 5HMYA 1KVIA 1QM9A 3V6KA 4N41A 4WE1A 1TL3B 4ICLB 1VOMA 2HFNA 2MY8A 2UVWA 4EUVA 1RT3A 5KFQA 4IOCQ 2V9WA 2RQCA 4CTAA 3JAMY 1HWIA 2PA3A 4RW8A 4TQRA 3K5MA 2GIRA 3LGNA 4BC9A 4KGKA 5HP1B 3AQOA 4DV7F 1SV5A 5F8GA 3IRWP 4KKOB 5KFCA 2RDJA 4I1TA 5K14A 2RB7A 2JHEA 3H5SA 4NYOA 2A1BA 4OZ1A 5LXRA 4RNNA 2DHGA 2K3KA 3U7JA 3NMAA 3UD3P 1HHSA 3MM8A 5JXSA 1RKJA 4O44B 1TL4A 1JLBA 5EN1A 5K5MA 4USHA 4WK3A 4DJBA 5KFKA 1NKEA 1VQKS 3B78A 5KFDA 1Q86T 4G1PA 1HMVA 1H6KX 2B43A 3POTB 1F9FA 3DRSB 3H2UB 2C3UA 4X65F 2UUCF 2FLOA 3CJKB 2BM1A 1U49A 4R8UB 1IKXB 2APOA 2HNDA 2JLEA 3CO9A 4KE5A 4PG7A 3R5DA 2YNGA 5KFTA 3EGZA 2GJ2A 1Y4ZB 3QZ7A 3BQ2A 2N82B 1U1KA 2VQEF 3SCJE 5F0WA 3KG4A 3SCKE 1S9EB 2MZSA 2UV8G 4WFBQ 1S6OA 2RF2B 3TARA 5IM0A 3BGUA 2JLGA 2HGLA 2DRAA 5CXTA 3M8QB 2AJ0A 1LXJA 1WG4A 4I0WA 3PX6A 1LWCB 2DNQA 1J5OA 1JLGB 3NBPA 2HYIB 1G3OA 4OZ5A 1D9DA 4QIEA 2KN4A 4ZS6A 2F1FA 3M9OB 4ED8A 4Q44A 3Q23A 4AXJA 2OP5A 1JX4A 1ZPVA 4OQJA 3S1TA 1Y5NB 2YX7A 1FTCA 3CCZA 4JBCA 4MFBA 1U1LA 3GZ7A 4DLEA 4ED7A 4U7CA 5C24A 5HMXA 1U09A 3LO3A 3NCPA 3F41A 4DL0C 5CCMA 4IOAQ 4C9DA 3CDEA 1SKRA 4PWDB 3TP2A 4RKUC 2KJWA 3M30B 4XIUA 4R5PA 4C8YA 4ATNA 1CLFA 5T7LA 1JJ2R 2ADCA 3U1MA 1JMTA 4QW9A 2FJXA 4DSFA 1SKSA 2C3PA 4DSLA 2V4JB 3MMAB 4MAKA 3OSNA 4WFZA 2OFHX 1S1TB 4ZVHA 3VR1A 4PUOA 1ZM3A 2XS5A 4X84A 1TQLA 2KI2A 1XN9A 2W8KA 3HVTA 2OPPB 1NK0A 1LV5A 2LA4A 2B5JA 1TKDA 2FVRA 5F41A 2I9SA 1C0UB 1BWEA 4TY9A 3MEDA 2P9GA 4WFXA 3DRYA 4YY3F 5KFGA 2KHCA 2D1CA 1R43A 3Q24A 3UQSA 3PO4A 1QE1A 2HS4A 3C8YA 3DOLB 1SH0A 4ZPBA 1X9SA 5CCLA 4KJIA 1Q78A 3MEGB 1HNVB 3KOAA 4OJGA 3US5A 3B4DA 2O66A 5J1PA 5CYMA 1TVRB 3KLIB 4Q2LA 1WACA 3K5PA 3M05A 5HLFA 4WIIA 3DMJA 2MGZA 3B4MA 2CVIA 3ISZA 1X9MA 4DHVA 3E01B 4X4VA 2IRUA 2MSTA 4PPDA 1UAWA 5GAGI 2VC1A 3QLHA 1C1BB 3EUNA 1NJIT 1TKTA 2E66A 4B3OA 3C2PA 3AH6A 4OHWA 2QEXS 2ZDPA 1P9QC 2GMHA 2KFNA 4P2SA 4WK1A 4RW8B 1Q8BA 3K8VA 3LGMA 3N4WA 3DLHA 1FESA 1ZOTA 2VFVA 4KHMA 1NZAA 1XC9A 4FF4A 3HZGA 3BSOA 2F4VF 4JYAF 1JJ4A 2JC1A 2MZJA 6FD1A 1MMLA 3PR4A 4RW7B 3GQCA 2HWIA 4KQZA 3G6XA 1BGXT 4F4WA 5KG4A 2FDNA 1XTZA 1MWZA 2XSJA 2EI5A 4ZPDA 3OSPA 2FPHX 2ZDOA 3OBIA 1R6YA 2V4RA 1FK9A 4C4WA 1ZAWA 2W9BA 3RB4A 1TK5A 2ASDA 3BDPA 1REVB 2JVOA 5HLFB 2GGPA 3GFZA 3KG1A 1M5HA 3RRKA 1U25A 2C3YA 3JSYA 3M1VA 5JUMA 2C2DA 2MZTA 2V94A 2YKPA 2YNIB 1RTIA 1RT1A 4PCQA 4DEZA 3QO9A 4A8OA 2IYIA 4O4GB 1FDAA 4LUBA 2NXUA 2JH3A 4OHZA 4E0DA 4FNHA 1A6LA 4ELTA 3NCRA 2WONA 3IGVA 2YX1A 2RH3A 1FKOA 2J76E 3TNVA 3OLBA 1IQTA 1S99A 3BR9A 4ZP8A 4XK8C 4Y0FA 4V19X 2RRNA 3CD7A 3CCMS 3BGRA 3M8QA 3CJ5A 3NS6A 1VFJA 3OQ2A 1S9GA 1MU2B 1HBOA 2DIUA 3TAQA 2Y1RI 2ZJPQ 4ERDA 3UE2A 3VAJA 2EG1A 4IFVA 2DGUA 4OMFG 4OX9F 3OL9A 4QU7A 1FA0A 1OSDA 2FC9A 1YRUA 2BQUA 4DSIA 4M8LA 2RU9A 3PV8A 4C3LA 1JXLA 2AYBA 2Z2MA 5KG7A 1HD0A 1OSCA 1VRUB 4Q2MA 4ES2A 1J5OB 1S10A 2XLKA 4Q45A 2KYZA 3FRZA 2DNPA 4GO5X 2KH9A 1IKYB 4MIBA 4RBTA 4AXIA 3OLAA 3L95X 2KG0A 3M8SA 1SB6A 2D41A 2H9ZA 1CEZA 1TK0A 3AA8A 2CQDA 4Y3CA 1RTHB 3W2WB 2OMOA 3OFEA 2GC8A 2KO1A 5I3PA 4PXDA 2J0XA 4QIVA 3P6YC 1L5UA 2J7UA 4NLXA 3OFHA 3OR1A 2NSCA 4HH1A 3LOUA 2XMKA 3D28A 3TAMB 2CQCA 2E7WA 2AYGA 1N56A 1JLEA 1L3TA 4OZJA 2JEJA 4NLSA 1SH2A 4N56A 2RUGA 2M3DA 1PSDA 4HT7A 2N3LA 4PR6A 1IKVB 1WELA 3HVTB 4QR0A 3E2EA 2YNFB 1B7FA 2CPFA 4NXMF 1IKYA 4F4YA 4QPXA 2YKQA 4ECZA 1K8AT 5LJ5Y 1UVNA 2DNZA 3DRPB 4F4KA 5THWA 4CT9A 3H25A 2OPRA 4CI0B 3CD5A 3HHNB 3M8PB 4IQMA 4H4OA 5C25A 2CPJA 4EO6A 1FRMA 3MEEB 1SBRA 3UDCA 4TYAA 4F4XA 2DCUB 4IR9A 1DLOB 4ZOSA 1KRPA 1ULRA 3M6VA 3OTEA 3DRXA 2CQPA 4GMKA 1S4FA 2CRLA 3BJYA 2QA2A 2ZC3A 3D0GE 2VA3A 3I5AA 1S49A 1IN0A 2HGNA 2PMZD 3T9NA 1QAJA 5MLCV 4ALZA 1JLQB 2E9ZA 3G9CA 5H9EJ 4MK9A 2YX4A 1C1BA 5B0BA 3O8WA 2PN6A 4DLGA 2XULA 3VZHA 2HW3A 2FC8A 1SJ1A 1C0TB 4A8WA 4HT5A 4DL2A 2HMIB 3I55S 4N8NA 5F3ZA 5HBMB 3DHWC 3M4XA 3LP0A 4X62F 3KLEA 4F2RA 5HMZA 1REVA 5IT4A 4OI4A 2FJDB 2KM8B 3H4BA 3QJPA 3M2RA 4F25A 1BLUA 1JKHB 2Q6BA 2VFUA 4OI1A 4K4VA 5AJ3F 1RP5A 3G6VA 2ZJRQ 2HHHF 1AFIA 1LW2B 4BC7A 3KLFA 1N5TA 3M8RA 4AL5A 3RAQA 4QWEA 5J2MA 2HWTA 4ZPVR 1BD6A 4MK8A 5B7WA 2AJ4A 2DGQA 4ECXA 4ELVA 2BXJA 1S0OA 3K0JA 1CG2A 2IAJA 2FGOA 3DOMA 3L7PA 1F0XA 5GAGU 5F9LA 2W8LA 2GGPB 1TZ0A 2YQ3A 3E8OA 2Y1IA 3CCRS 3QGGA 2R9LA 4B9UA 1JB0C 3RRGA 2AU0A 1KQKA 1VJWA 2K2PA 1Y7PA 3D0IE 1G2EA 1YG0A 2HNYB 3QYYA 2FVSA 3G6YA 1H0HB 2B51A 2GQCA 4MH8A 4GC7A 4OI0A 1KQFB 4Q43A 3KK3A 4QWDA 5A2QY 2DHXA 2DO4A 3N28A 3C3LA 2QMWA 3ZZYA 3IS9A 4KFBB 1CSJA 3U1LA 3OR2A 1F5CA 3W2VB 1H7XA 4CH0S 5J1EB 2C28A 1RT6A 4F8RA 1XNQF 5T14A 1S76D 3IR7B 2LYVA 4MYTA 4X4QA 2R4FA 3DOKA 5IXUA 1VQYA 2WSEC 4K4WA 1NK5A 1VS3A 2VPXB 2L41A 5L1KA 4W92B 2LQ5A 1X4AA 2HQ3A 1CQNA 4QR1A 4PQUA 5KFSA 1QJHA