1H32B

Reduced soxax complex from rhodovulum sulfidophilum
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
137
structure length
134
Chain Sequence
AEVAPGDVAIDGQGHVARPLTDAPGDPVEGRRLMTDRSVGNCIACHEVTEMQFPGTVGPSLDGVAARYPEAMIRGILVNSKNVFPETVMPAYYRVEGFNRPGIAFTSKPIEGEIRPLMTAGQIEDVVAYLMTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHEME CYTOCHROME C
publication title Structural Basis for the Oxidation of Thiosulfate by a Sulfur Cycle Enzyme
pubmed doi rcsb
molecule tags Electron transfer
total genus 34
structure length 134
sequence length 137
ec nomenclature
pdb deposition date 2002-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1h32B00
4U3FD 5CYTR 1CO6A 4UB6V 3L70D 4WQ8A 4H0KA 5DJQB 1YEBA 2N18B 2CA3B 3L74D 1P84D 1ZZHA 1M60A 5EXQA 1H33B 1CHJA 1KV9A 5KLIB 3M97X 1YICA 5CICB 1C6SA 2QJPB 3WUIA 3ZBMA 1U75B 1NIRA 5KLVD 4EICA 351CA 4EIFA 3A9FA 3ORVA 1H31A 3MK7C 1F1FA 1PP9D 1DIIC 1YEAA 4LJIA 1CXAA 1GJQA 4L3HA 4PD4D 4O1WA 4XXLA 4AALA 5CIHB 4GYDA 1M70A 2C1DA 3OCDA 1DVHA 1CCHA 1C52A 4FA9A 1SQQD 3C2CA 4AANA 2BGVX 1YFCA 1CCRA 1DW0A 2OZ1A 4PW9B 4K3IA 1WEJF 3WC8A 2YIUB 3ZOXA 3H1KD 1OCDA 1BE3D 2ORLA 4EIEA 2BH4X 1SQVD 1K3HA 3TYIA 4H0JA 1DW3A 1CRJA 1WVEC 2YCCA 1DVVA 1OAEA 2ZXYA 1LC1A 1S5LV 1CORA 1QN2A 4IL6V 3CYTI 1ETPA 1LFMA 2IBZD 3OA8A 1CEDA 1CTJA 2QJKB 1FI9A 1CYIA 2DGEA 5KAFV 1SQBD 4EIDA 3O1YA 1MG3D 4Q5PA 1KX7A 2BPBB 1CRIA 3ZOOA 1KB0A 2A06D 1MZ4A 2ZBOA 1GDVA 1QKSA 2YQBA 2FYNB 1QL3A 1CIEA 4KMGA 2XTSB 2YK3A 2BLFB 2V08A 1HRCA 4WQDA 5DFSA 4L1QA 1ZRTD 1CRHA 1JDLA 3PXTA 4FA4A 1DW1A 2N9JA 1W2LA 4PWAA 1N9CA 2GC7D 3NBSA 4RSZA 4MU8A 1CSUA 155CA 4UB8V 3X39A 3PH2B 1C2RA 1M6ZA 1CYCA 1RZ5A 3H1HD 3L4MA 4FA5A 3SVWA 3A0HV 4O1QA 3HQ6A 1DIQC 2CE1A 3BCCD 1BL9A 4GEDB 3WFEC 1HJ3A 1IQCA 2PCBB 1N50A 1CIFA 1C75A 5AURA 4J20A 2MTAC 2JQRA 3SLEA 1H32B 2C1UA 1CIGA 2N3YA 1YNRA 1E2RA 1HZVA 4L3GA 4Y5RA 1L9JC 2LIRA 2FWLA 3ZIYA 1FHBA 1I55A 2GIWA 4WQ9A 1YCCA 1YIQA 4PJ0V 2CA4B 5C0ZA 1I54A 3SJLA 2MHMA 1BCCD 4FB1A 1KB9D 1I5TA 1COTA 4YE1A 1FI3A 1H33A 3WFCC 1GIWA 3RLMA 1I6DA 4AAMA 1QYZA 1N15A 1CNOA 5DF5A 3DR0A 2AXTV 5CIBB 2B0ZB 3CX5W 451CA 1HROA 1H32A 4WQBA 4N0KA 1I8PA 3RN1A 1HJ4A 2VHDA 1CYJA 4JCGA 1U74B 2CXBA 1NMIA 3WU2V 1NTZD 1YTCA 5IY51 1KYOD 2B11B 2I8FA 2ZZS1 1CTZA 1SQXD 3ZCFA 3WFDC 3WFBC 2FRCA 2PACA 1CHIA 2DVHA 3CXHD 3L72D 1FOCA 3HQ7A 4AAOA 4NFGB 4D6TD 1R0QA 4P4QB 4QAOA 1FCDC 1HH7A 2QJYB 1CXCA 1RAPA 3O5CA 1EB7A 2N3BA 1GU2A 2GB8B 3RN0A 3CX5D 3CP5A 1LMSA 1H31B 1C6OA 1IZL0 1CIHA 2BCCD 1CRGA 4WQ7A 1C2NA 1DW2A 1B7VA 3VYMA 1LS9A 1I8OA 4WQAA 4XYDB 1H9XA 1E8EA 2BH5X 2HV4A 3ZOYA 2C1DB 2C9XB 1FI7A 1H1OA 1L9BC 1F1CA 3VNWA 2PCCB 5CIEB 1IRWA 1GQ1A 1A56A 2OZ1B 1CHHA 3DMIA 1DT1A 1HJ5A 3CWBD 5CIFB 1KIBA 2D0WA 3PXWA 5C9MA 1RZ6A 2V07A 1IO3A 1PPJD 5GTHV 2D0SA 3CU4A 1L0LD 4FAVA 1A2SA 3HQ8A 3NWVA 5CIDB 3DP5A 4DY9A 2C1VA 5B66V 2ZOOA 4AX3A 3JBTB 5KKZB 5CIGB 3VRDA 1NNOA 3OA8B 1SQPD 1E29A 1KYOW 1IRVA 2N9IA 1EZVD 3O0RC 3O20A 3RMZA 1H9YA 1AKKA 1I6EA 1VYDA 1HZUA 3TGUD 1MG2D 1RAQA 3CXHW 5B5EV 2ZONG 5H2FV 1CC5A 1J3SA 1L0ND 5KAIV 5DJQC 2L4DA 2N18C 3ZOWA 1BGYD 1KX2A 1NMLA 4FA1A 1NTMD 3L75D 2LITA 1AOQA 3L73D 3H1ID 1A8CA 1AYGA 1LC2A 2C2CA 2GC4D 2B12B 1N90A 2AIUA 4WQCA 3SWSA 2CE0A 4FANA 3H1JD 1CTYA 2B10B 3PXSA 1W5CT 3KZIV 3H1LD 5GTIV 1NTKD 2B4ZA 1CSXA 1CRYA 2C8SA 3NBTA 3MK7B 1CRCA 2AI5A 1S6VB 1CSWA 4WQEA 3SXTA 1K3GA 3L4OA 5TISV 4V2KA 1C6RA 2EXVA 3HQ9A 1NU1D 1QL4A 1HCMA 1C7MA 2BCNB 3L71D 2JTIB 5E79V 1CSVA 3A0BV 3OCDB 1GKSA 1FJ0A 1AOFA 2FYUD 5B6QA
chains in the Genus database with same CATH superfamily
4U3FD 5CYTR 1CO6A 4UB6V 3L70D 4WQ8A 4H0KA 5DJQB 1YEBA 2N18B 2CA3B 3L74D 1P84D 1ZZHA 1M60A 5EXQA 1H33B 1CHJA 1KV9A 5KLIB 3M97X 1YICA 5CICB 1C6SA 2QJPB 3WUIA 3ZBMA 1U75B 1NIRA 5KLVD 4EICA 351CA 4EIFA 3A9FA 3ORVA 1H31A 3MK7C 1F1FA 1PP9D 1DIIC 1YEAA 4LJIA 1CXAA 1GJQA 4L3HA 4PD4D 4O1WA 4XXLA 4AALA 5CIHB 4GYDA 1M70A 2C1DA 3OCDA 1DVHA 1CCHA 1C52A 4FA9A 1SQQD 3C2CA 4AANA 2BGVX 1YFCA 1CCRA 1DW0A 2OZ1A 4PW9B 4K3IA 1WEJF 3WC8A 2YIUB 3ZOXA 3H1KD 1OCDA 1BE3D 2ORLA 4EIEA 2BH4X 1SQVD 1K3HA 3TYIA 4H0JA 1DW3A 1CRJA 1WVEC 2YCCA 1DVVA 1OAEA 3D0WA 2ZXYA 1LC1A 1S5LV 1CORA 1QN2A 4IL6V 3CYTI 1ETPA 1LFMA 2IBZD 3OA8A 1CEDA 1CTJA 2QJKB 1FI9A 1CYIA 2DGEA 5KAFV 1SQBD 4EIDA 3O1YA 1MG3D 4Q5PA 1KX7A 2BPBB 1CRIA 3ZOOA 1KB0A 2A06D 1MZ4A 2ZBOA 1GDVA 1QKSA 2YQBA 2FYNB 1QL3A 1CIEA 4KMGA 2XTSB 2YK3A 2BLFB 2V08A 1HRCA 4WQDA 5DFSA 4L1QA 1ZRTD 1CRHA 1JDLA 3PXTA 4FA4A 1DW1A 2N9JA 1W2LA 4PWAA 1N9CA 2GC7D 3NBSA 4RSZA 4MU8A 1CSUA 155CA 4UB8V 3X39A 3PH2B 1C2RA 1M6ZA 1CYCA 1RZ5A 3H1HD 3L4MA 4FA5A 3SVWA 3A0HV 4O1QA 3HQ6A 1DIQC 2CE1A 3BCCD 1BL9A 4GEDB 3WFEC 1HJ3A 1IQCA 2PCBB 1N50A 1CIFA 1C75A 5AURA 4J20A 2MTAC 2JQRA 3SLEA 1H32B 2C1UA 1CIGA 2N3YA 1YNRA 1E2RA 1HZVA 4L3GA 4Y5RA 1L9JC 2LIRA 2FWLA 3ZIYA 1FHBA 1I55A 2GIWA 4WQ9A 1YCCA 1YIQA 4PJ0V 2CA4B 5C0ZA 1I54A 3SJLA 2MHMA 1BCCD 4FB1A 1KB9D 1I5TA 1COTA 4YE1A 1FI3A 1H33A 3WFCC 1GIWA 3RLMA 1I6DA 4AAMA 1QYZA 1N15A 1CNOA 5DF5A 3DR0A 2AXTV 5CIBB 2B0ZB 3CX5W 451CA 1HROA 1H32A 4WQBA 4N0KA 1I8PA 3RN1A 1HJ4A 2VHDA 1CYJA 4JCGA 1U74B 2CXBA 1NMIA 3WU2V 1NTZD 1YTCA 5IY51 1KYOD 2B11B 2I8FA 2ZZS1 1CTZA 1SQXD 3ZCFA 3WFDC 3WFBC 2FRCA 2PACA 1CHIA 2DVHA 3CXHD 3L72D 1FOCA 3HQ7A 4AAOA 4NFGB 4D6TD 1R0QA 4P4QB 4QAOA 1FCDC 1HH7A 2QJYB 1CXCA 1RAPA 3O5CA 1EB7A 2N3BA 1GU2A 2GB8B 3RN0A 3CX5D 3CP5A 1LMSA 1H31B 1C6OA 1IZL0 1CIHA 2BCCD 1CRGA 4WQ7A 1C2NA 1DW2A 1B7VA 3VYMA 1LS9A 1I8OA 4WQAA 4XYDB 1H9XA 1E8EA 2BH5X 2HV4A 3ZOYA 2C1DB 2C9XB 1FI7A 1H1OA 1L9BC 1F1CA 3VNWA 2PCCB 5CIEB 1IRWA 1GQ1A 1A56A 2OZ1B 1CHHA 3DMIA 1DT1A 1HJ5A 3CWBD 5CIFB 1KIBA 2D0WA 3PXWA 5C9MA 1RZ6A 2V07A 1IO3A 1PPJD 5GTHV 2D0SA 3CU4A 1L0LD 4FAVA 1A2SA 3HQ8A 3NWVA 5CIDB 3DP5A 4DY9A 2C1VA 5B66V 2ZOOA 4AX3A 3JBTB 5KKZB 5CIGB 3VRDA 1NNOA 3OA8B 1SQPD 1E29A 1KYOW 1IRVA 2N9IA 1EZVD 3O0RC 3O20A 3RMZA 1H9YA 1AKKA 1I6EA 1VYDA 1HZUA 3TGUD 1MG2D 1RAQA 3CXHW 5B5EV 2ZONG 5H2FV 1CC5A 1J3SA 1L0ND 5KAIV 5DJQC 2L4DA 2N18C 3ZOWA 1BGYD 1KX2A 1NMLA 4FA1A 1NTMD 3L75D 2LITA 1AOQA 3L73D 3H1ID 1A8CA 1AYGA 1LC2A 2C2CA 2GC4D 2B12B 1N90A 2AIUA 4WQCA 3SWSA 2CE0A 4FANA 3H1JD 1CTYA 2B10B 3PXSA 1W5CT 3KZIV 3H1LD 5GTIV 1NTKD 2B4ZA 1CSXA 1CRYA 2C8SA 3NBTA 3MK7B 1CRCA 2AI5A 1S6VB 1CSWA 4WQEA 3SXTA 1K3GA 3L4OA 5TISV 4V2KA 1C6RA 2EXVA 3HQ9A 1NU1D 1QL4A 1HCMA 1C7MA 2BCNB 3L71D 2JTIB 5E79V 1CSVA 3A0BV 3OCDB 1GKSA 1FJ0A 1AOFA 2FYUD 5B6QA
chains in the Genus database with same CATH topology
4U3FD 5CYTR 1CO6A 4UB6V 3L70D 4WQ8A 4H0KA 5DJQB 1YEBA 2N18B 2CA3B 3L74D 1P84D 1ZZHA 1M60A 5EXQA 1H33B 1CHJA 1KV9A 5KLIB 3M97X 1YICA 5CICB 1C6SA 2QJPB 3WUIA 3ZBMA 1U75B 1NIRA 5KLVD 4EICA 351CA 4EIFA 3A9FA 3ORVA 1H31A 3MK7C 1F1FA 1PP9D 1DIIC 1YEAA 4LJIA 1CXAA 1GJQA 4L3HA 4PD4D 4O1WA 4XXLA 4AALA 5CIHB 4GYDA 1M70A 2C1DA 3OCDA 1DVHA 1CCHA 1C52A 4FA9A 1SQQD 3C2CA 4AANA 2BGVX 1YFCA 1CCRA 1DW0A 2OZ1A 4PW9B 4K3IA 1WEJF 3WC8A 2YIUB 3ZOXA 3H1KD 1OCDA 1BE3D 2ORLA 4EIEA 2BH4X 1SQVD 1K3HA 3TYIA 4H0JA 1DW3A 1CRJA 1WVEC 2YCCA 1DVVA 1OAEA 2ZXYA 1LC1A 1S5LV 1CORA 1QN2A 4IL6V 3CYTI 1ETPA 1LFMA 2IBZD 3OA8A 1CEDA 1CTJA 2QJKB 1FI9A 1CYIA 2DGEA 5KAFV 1SQBD 4EIDA 3O1YA 1MG3D 4Q5PA 1KX7A 2BPBB 1CRIA 3ZOOA 1KB0A 2A06D 1MZ4A 2ZBOA 1GDVA 1QKSA 2YQBA 2FYNB 1QL3A 1CIEA 4KMGA 2XTSB 2YK3A 2BLFB 2V08A 1HRCA 4WQDA 5DFSA 4L1QA 1ZRTD 1CRHA 1JDLA 3PXTA 4FA4A 1DW1A 2N9JA 1W2LA 4PWAA 1N9CA 2GC7D 3NBSA 4RSZA 4MU8A 1CSUA 155CA 4UB8V 3X39A 3PH2B 1C2RA 1M6ZA 1CYCA 1RZ5A 3H1HD 3L4MA 4FA5A 3SVWA 3A0HV 4O1QA 3HQ6A 1DIQC 2CE1A 3BCCD 1BL9A 4GEDB 3WFEC 1HJ3A 1IQCA 2PCBB 1N50A 1CIFA 1C75A 5AURA 4J20A 2MTAC 2JQRA 3SLEA 1H32B 2C1UA 1CIGA 2N3YA 1YNRA 1E2RA 1HZVA 4L3GA 4Y5RA 1L9JC 2LIRA 2FWLA 3ZIYA 1FHBA 1I55A 2GIWA 4WQ9A 1YCCA 1YIQA 4PJ0V 2CA4B 5C0ZA 1I54A 3SJLA 2MHMA 1BCCD 4FB1A 1KB9D 1I5TA 1COTA 4YE1A 1FI3A 1H33A 3WFCC 1GIWA 3RLMA 1I6DA 4AAMA 1QYZA 1N15A 1CNOA 5DF5A 3DR0A 2AXTV 5CIBB 2B0ZB 3CX5W 451CA 1HROA 1H32A 4WQBA 4N0KA 1I8PA 3RN1A 1HJ4A 2VHDA 1CYJA 4JCGA 1U74B 2CXBA 1NMIA 3WU2V 1NTZD 1YTCA 5IY51 1KYOD 2B11B 2I8FA 2ZZS1 1CTZA 1SQXD 3ZCFA 3WFDC 3WFBC 2FRCA 2PACA 1CHIA 2DVHA 3CXHD 3L72D 1FOCA 3HQ7A 4AAOA 4NFGB 4D6TD 1R0QA 4P4QB 4QAOA 1FCDC 1HH7A 2QJYB 1CXCA 1RAPA 3O5CA 1EB7A 2N3BA 1GU2A 2GB8B 3RN0A 3CX5D 3CP5A 1LMSA 1H31B 1C6OA 1IZL0 1CIHA 2BCCD 1CRGA 4WQ7A 1C2NA 1DW2A 1B7VA 3VYMA 1LS9A 1I8OA 4WQAA 4XYDB 1H9XA 1E8EA 2BH5X 2HV4A 3ZOYA 2C1DB 2C9XB 1FI7A 1H1OA 1L9BC 1F1CA 3VNWA 2PCCB 5CIEB 1IRWA 1GQ1A 1A56A 2OZ1B 1CHHA 3DMIA 1DT1A 1HJ5A 3CWBD 5CIFB 1KIBA 2D0WA 3PXWA 5C9MA 1RZ6A 2V07A 1IO3A 1PPJD 5GTHV 2D0SA 3CU4A 1L0LD 4FAVA 1A2SA 3HQ8A 3NWVA 5CIDB 3DP5A 4DY9A 2C1VA 5B66V 2ZOOA 4AX3A 3JBTB 5KKZB 5CIGB 3VRDA 1NNOA 3OA8B 1SQPD 1E29A 1KYOW 1IRVA 2N9IA 1EZVD 3O0RC 3O20A 3RMZA 1H9YA 1AKKA 1I6EA 1VYDA 1HZUA 3TGUD 1MG2D 1RAQA 3CXHW 5B5EV 2ZONG 5H2FV 1CC5A 1J3SA 1L0ND 5KAIV 5DJQC 2L4DA 2N18C 3ZOWA 1BGYD 1KX2A 1NMLA 4FA1A 1NTMD 3L75D 2LITA 1AOQA 3L73D 3H1ID 1A8CA 1AYGA 1LC2A 2C2CA 2GC4D 2B12B 1N90A 2AIUA 4WQCA 3SWSA 2CE0A 4FANA 3H1JD 1CTYA 2B10B 3PXSA 1W5CT 3KZIV 3H1LD 5GTIV 1NTKD 2B4ZA 1CSXA 1CRYA 2C8SA 3NBTA 3MK7B 1CRCA 2AI5A 1S6VB 1CSWA 4WQEA 3SXTA 1K3GA 3L4OA 5TISV 4V2KA 1C6RA 2EXVA 3HQ9A 1NU1D 1QL4A 1HCMA 1C7MA 2BCNB 3L71D 2JTIB 5E79V 1CSVA 3A0BV 3OCDB 1GKSA 1FJ0A 1AOFA 2FYUD 5B6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U3F D;  5CYT R;  1CO6 A;  4UB6 V;  3L70 D;  4WQ8 A;  4H0K A;  5DJQ B;  1YEB A;  2N18 B;  2CA3 B;  3L74 D;  1P84 D;  1ZZH A;  1M60 A;  5EXQ A;  1H33 B;  1CHJ A;  1KV9 A;  5KLI B;  3M97 X;  1YIC A;  5CIC B;  1C6S A;  2QJP B;  3WUI A;  3ZBM A;  1U75 B;  1NIR A;  5KLV D;  4EIC A;  351C A;  4EIF A;  3A9F A;  3ORV A;  1H31 A;  3MK7 C;  1F1F A;  1PP9 D;  1DII C;  1YEA A;  4LJI A;  1CXA A;  1GJQ A;  4L3H A;  4PD4 D;  4O1W A;  4XXL A;  4AAL A;  5CIH B;  4GYD A;  1M70 A;  2C1D A;  3OCD A;  1DVH A;  1CCH A;  1C52 A;  4FA9 A;  1SQQ D;  3C2C A;  4AAN A;  2BGV X;  1YFC A;  1CCR A;  1DW0 A;  2OZ1 A;  4PW9 B;  4K3I A;  1WEJ F;  3WC8 A;  2YIU B;  3ZOX A;  3H1K D;  1OCD A;  1BE3 D;  2ORL A;  4EIE A;  2BH4 X;  1SQV D;  1K3H A;  3TYI A;  4H0J A;  1DW3 A;  1CRJ A;  1WVE C;  2YCC A;  1DVV A;  1OAE A;  2ZXY A;  1LC1 A;  1S5L V;  1COR A;  1QN2 A;  4IL6 V;  3CYT I;  1ETP A;  1LFM A;  2IBZ D;  3OA8 A;  1CED A;  1CTJ A;  2QJK B;  1FI9 A;  1CYI A;  2DGE A;  5KAF V;  1SQB D;  4EID A;  3O1Y A;  1MG3 D;  4Q5P A;  1KX7 A;  2BPB B;  1CRI A;  3ZOO A;  1KB0 A;  2A06 D;  1MZ4 A;  2ZBO A;  1GDV A;  1QKS A;  2YQB A;  2FYN B;  1QL3 A;  1CIE A;  4KMG A;  2XTS B;  2YK3 A;  2BLF B;  2V08 A;  1HRC A;  4WQD A;  5DFS A;  4L1Q A;  1ZRT D;  1CRH A;  1JDL A;  3PXT A;  4FA4 A;  1DW1 A;  2N9J A;  1W2L A;  4PWA A;  1N9C A;  2GC7 D;  3NBS A;  4RSZ A;  4MU8 A;  1CSU A;  155C A;  4UB8 V;  3X39 A;  3PH2 B;  1C2R A;  1M6Z A;  1CYC A;  1RZ5 A;  3H1H D;  3L4M A;  4FA5 A;  3SVW A;  3A0H V;  4O1Q A;  3HQ6 A;  1DIQ C;  2CE1 A;  3BCC D;  1BL9 A;  4GED B;  3WFE C;  1HJ3 A;  1IQC A;  2PCB B;  1N50 A;  1CIF A;  1C75 A;  5AUR A;  4J20 A;  2MTA C;  2JQR A;  3SLE A;  1H32 B;  2C1U A;  1CIG A;  2N3Y A;  1YNR A;  1E2R A;  1HZV A;  4L3G A;  4Y5R A;  1L9J C;  2LIR A;  2FWL A;  3ZIY A;  1FHB A;  1I55 A;  2GIW A;  4WQ9 A;  1YCC A;  1YIQ A;  4PJ0 V;  2CA4 B;  5C0Z A;  1I54 A;  3SJL A;  2MHM A;  1BCC D;  4FB1 A;  1KB9 D;  1I5T A;  1COT A;  4YE1 A;  1FI3 A;  1H33 A;  3WFC C;  1GIW A;  3RLM A;  1I6D A;  4AAM A;  1QYZ A;  1N15 A;  1CNO A;  5DF5 A;  3DR0 A;  2AXT V;  5CIB B;  2B0Z B;  3CX5 W;  451C A;  1HRO A;  1H32 A;  4WQB A;  4N0K A;  1I8P A;  3RN1 A;  1HJ4 A;  2VHD A;  1CYJ A;  4JCG A;  1U74 B;  2CXB A;  1NMI A;  3WU2 V;  1NTZ D;  1YTC A;  5IY5 1;  1KYO D;  2B11 B;  2I8F A;  2ZZS 1;  1CTZ A;  1SQX D;  3ZCF A;  3WFD C;  3WFB C;  2FRC A;  2PAC A;  1CHI A;  2DVH A;  3CXH D;  3L72 D;  1FOC A;  3HQ7 A;  4AAO A;  4NFG B;  4D6T D;  1R0Q A;  4P4Q B;  4QAO A;  1FCD C;  1HH7 A;  2QJY B;  1CXC A;  1RAP A;  3O5C A;  1EB7 A;  2N3B A;  1GU2 A;  2GB8 B;  3RN0 A;  3CX5 D;  3CP5 A;  1LMS A;  1H31 B;  1C6O A;  1IZL 0;  1CIH A;  2BCC D;  1CRG A;  4WQ7 A;  1C2N A;  1DW2 A;  1B7V A;  3VYM A;  1LS9 A;  1I8O A;  4WQA A;  4XYD B;  1H9X A;  1E8E A;  2BH5 X;  2HV4 A;  3ZOY A;  2C1D B;  2C9X B;  1FI7 A;  1H1O A;  1L9B C;  1F1C A;  3VNW A;  2PCC B;  5CIE B;  1IRW A;  1GQ1 A;  1A56 A;  2OZ1 B;  1CHH A;  3DMI A;  1DT1 A;  1HJ5 A;  3CWB D;  5CIF B;  1KIB A;  2D0W A;  3PXW A;  5C9M A;  1RZ6 A;  2V07 A;  1IO3 A;  1PPJ D;  5GTH V;  2D0S A;  3CU4 A;  1L0L D;  4FAV A;  1A2S A;  3HQ8 A;  3NWV A;  5CID B;  3DP5 A;  4DY9 A;  2C1V A;  5B66 V;  2ZOO A;  4AX3 A;  3JBT B;  5KKZ B;  5CIG B;  3VRD A;  1NNO A;  3OA8 B;  1SQP D;  1E29 A;  1KYO W;  1IRV A;  2N9I A;  1EZV D;  3O0R C;  3O20 A;  3RMZ A;  1H9Y A;  1AKK A;  1I6E A;  1VYD A;  1HZU A;  3TGU D;  1MG2 D;  1RAQ A;  3CXH W;  5B5E V;  2ZON G;  5H2F V;  1CC5 A;  1J3S A;  1L0N D;  5KAI V;  5DJQ C;  2L4D A;  2N18 C;  3ZOW A;  1BGY D;  1KX2 A;  1NML A;  4FA1 A;  1NTM D;  3L75 D;  2LIT A;  1AOQ A;  3L73 D;  3H1I D;  1A8C A;  1AYG A;  1LC2 A;  2C2C A;  2GC4 D;  2B12 B;  1N90 A;  2AIU A;  4WQC A;  3SWS A;  2CE0 A;  4FAN A;  3H1J D;  1CTY A;  2B10 B;  3PXS A;  1W5C T;  3KZI V;  3H1L D;  5GTI V;  1NTK D;  2B4Z A;  1CSX A;  1CRY A;  2C8S A;  3NBT A;  3MK7 B;  1CRC A;  2AI5 A;  1S6V B;  1CSW A;  4WQE A;  3SXT A;  1K3G A;  3L4O A;  5TIS V;  4V2K A;  1C6R A;  2EXV A;  3HQ9 A;  1NU1 D;  1QL4 A;  1HCM A;  1C7M A;  2BCN B;  3L71 D;  2JTI B;  5E79 V;  1CSV A;  3A0B V;  3OCD B;  1GKS A;  1FJ0 A;  1AOF A;  2FYU D;  5B6Q A; 
#chains in the Genus database with same CATH topology
 4U3F D;  5CYT R;  1CO6 A;  4UB6 V;  3L70 D;  4WQ8 A;  4H0K A;  5DJQ B;  1YEB A;  2N18 B;  2CA3 B;  3L74 D;  1P84 D;  1ZZH A;  1M60 A;  5EXQ A;  1H33 B;  1CHJ A;  1KV9 A;  5KLI B;  3M97 X;  1YIC A;  5CIC B;  1C6S A;  2QJP B;  3WUI A;  3ZBM A;  1U75 B;  1NIR A;  5KLV D;  4EIC A;  351C A;  4EIF A;  3A9F A;  3ORV A;  1H31 A;  3MK7 C;  1F1F A;  1PP9 D;  1DII C;  1YEA A;  4LJI A;  1CXA A;  1GJQ A;  4L3H A;  4PD4 D;  4O1W A;  4XXL A;  4AAL A;  5CIH B;  4GYD A;  1M70 A;  2C1D A;  3OCD A;  1DVH A;  1CCH A;  1C52 A;  4FA9 A;  1SQQ D;  3C2C A;  4AAN A;  2BGV X;  1YFC A;  1CCR A;  1DW0 A;  2OZ1 A;  4PW9 B;  4K3I A;  1WEJ F;  3WC8 A;  2YIU B;  3ZOX A;  3H1K D;  1OCD A;  1BE3 D;  2ORL A;  4EIE A;  2BH4 X;  1SQV D;  1K3H A;  3TYI A;  4H0J A;  1DW3 A;  1CRJ A;  1WVE C;  2YCC A;  1DVV A;  1OAE A;  3D0W A;  2ZXY A;  1LC1 A;  1S5L V;  1COR A;  1QN2 A;  4IL6 V;  3CYT I;  1ETP A;  1LFM A;  2IBZ D;  3OA8 A;  1CED A;  1CTJ A;  2QJK B;  1FI9 A;  1CYI A;  2DGE A;  5KAF V;  1SQB D;  4EID A;  3O1Y A;  1MG3 D;  4Q5P A;  1KX7 A;  2BPB B;  1CRI A;  3ZOO A;  1KB0 A;  2A06 D;  1MZ4 A;  2ZBO A;  1GDV A;  1QKS A;  2YQB A;  2FYN B;  1QL3 A;  1CIE A;  4KMG A;  2XTS B;  2YK3 A;  2BLF B;  2V08 A;  1HRC A;  4WQD A;  5DFS A;  4L1Q A;  1ZRT D;  1CRH A;  1JDL A;  3PXT A;  4FA4 A;  1DW1 A;  2N9J A;  1W2L A;  4PWA A;  1N9C A;  2GC7 D;  3NBS A;  4RSZ A;  4MU8 A;  1CSU A;  155C A;  4UB8 V;  3X39 A;  3PH2 B;  1C2R A;  1M6Z A;  1CYC A;  1RZ5 A;  3H1H D;  3L4M A;  4FA5 A;  3SVW A;  3A0H V;  4O1Q A;  3HQ6 A;  1DIQ C;  2CE1 A;  3BCC D;  1BL9 A;  4GED B;  3WFE C;  1HJ3 A;  1IQC A;  2PCB B;  1N50 A;  1CIF A;  1C75 A;  5AUR A;  4J20 A;  2MTA C;  2JQR A;  3SLE A;  1H32 B;  2C1U A;  1CIG A;  2N3Y A;  1YNR A;  1E2R A;  1HZV A;  4L3G A;  4Y5R A;  1L9J C;  2LIR A;  2FWL A;  3ZIY A;  1FHB A;  1I55 A;  2GIW A;  4WQ9 A;  1YCC A;  1YIQ A;  4PJ0 V;  2CA4 B;  5C0Z A;  1I54 A;  3SJL A;  2MHM A;  1BCC D;  4FB1 A;  1KB9 D;  1I5T A;  1COT A;  4YE1 A;  1FI3 A;  1H33 A;  3WFC C;  1GIW A;  3RLM A;  1I6D A;  4AAM A;  1QYZ A;  1N15 A;  1CNO A;  5DF5 A;  3DR0 A;  2AXT V;  5CIB B;  2B0Z B;  3CX5 W;  451C A;  1HRO A;  1H32 A;  4WQB A;  4N0K A;  1I8P A;  3RN1 A;  1HJ4 A;  2VHD A;  1CYJ A;  4JCG A;  1U74 B;  2CXB A;  1NMI A;  3WU2 V;  1NTZ D;  1YTC A;  5IY5 1;  1KYO D;  2B11 B;  2I8F A;  2ZZS 1;  1CTZ A;  1SQX D;  3ZCF A;  3WFD C;  3WFB C;  2FRC A;  2PAC A;  1CHI A;  2DVH A;  3CXH D;  3L72 D;  1FOC A;  3HQ7 A;  4AAO A;  4NFG B;  4D6T D;  1R0Q A;  4P4Q B;  4QAO A;  1FCD C;  1HH7 A;  2QJY B;  1CXC A;  1RAP A;  3O5C A;  1EB7 A;  2N3B A;  1GU2 A;  2GB8 B;  3RN0 A;  3CX5 D;  3CP5 A;  1LMS A;  1H31 B;  1C6O A;  1IZL 0;  1CIH A;  2BCC D;  1CRG A;  4WQ7 A;  1C2N A;  1DW2 A;  1B7V A;  3VYM A;  1LS9 A;  1I8O A;  4WQA A;  4XYD B;  1H9X A;  1E8E A;  2BH5 X;  2HV4 A;  3ZOY A;  2C1D B;  2C9X B;  1FI7 A;  1H1O A;  1L9B C;  1F1C A;  3VNW A;  2PCC B;  5CIE B;  1IRW A;  1GQ1 A;  1A56 A;  2OZ1 B;  1CHH A;  3DMI A;  1DT1 A;  1HJ5 A;  3CWB D;  5CIF B;  1KIB A;  2D0W A;  3PXW A;  5C9M A;  1RZ6 A;  2V07 A;  1IO3 A;  1PPJ D;  5GTH V;  2D0S A;  3CU4 A;  1L0L D;  4FAV A;  1A2S A;  3HQ8 A;  3NWV A;  5CID B;  3DP5 A;  4DY9 A;  2C1V A;  5B66 V;  2ZOO A;  4AX3 A;  3JBT B;  5KKZ B;  5CIG B;  3VRD A;  1NNO A;  3OA8 B;  1SQP D;  1E29 A;  1KYO W;  1IRV A;  2N9I A;  1EZV D;  3O0R C;  3O20 A;  3RMZ A;  1H9Y A;  1AKK A;  1I6E A;  1VYD A;  1HZU A;  3TGU D;  1MG2 D;  1RAQ A;  3CXH W;  5B5E V;  2ZON G;  5H2F V;  1CC5 A;  1J3S A;  1L0N D;  5KAI V;  5DJQ C;  2L4D A;  2N18 C;  3ZOW A;  1BGY D;  1KX2 A;  1NML A;  4FA1 A;  1NTM D;  3L75 D;  2LIT A;  1AOQ A;  3L73 D;  3H1I D;  1A8C A;  1AYG A;  1LC2 A;  2C2C A;  2GC4 D;  2B12 B;  1N90 A;  2AIU A;  4WQC A;  3SWS A;  2CE0 A;  4FAN A;  3H1J D;  1CTY A;  2B10 B;  3PXS A;  1W5C T;  3KZI V;  3H1L D;  5GTI V;  1NTK D;  2B4Z A;  1CSX A;  1CRY A;  2C8S A;  3NBT A;  3MK7 B;  1CRC A;  2AI5 A;  1S6V B;  1CSW A;  4WQE A;  3SXT A;  1K3G A;  3L4O A;  5TIS V;  4V2K A;  1C6R A;  2EXV A;  3HQ9 A;  1NU1 D;  1QL4 A;  1HCM A;  1C7M A;  2BCN B;  3L71 D;  2JTI B;  5E79 V;  1CSV A;  3A0B V;  3OCD B;  1GKS A;  1FJ0 A;  1AOF A;  2FYU D;  5B6Q A; 
#chains in the Genus database with same CATH homology
 4U3F D;  5CYT R;  1CO6 A;  4UB6 V;  3L70 D;  4WQ8 A;  4H0K A;  5DJQ B;  1YEB A;  2N18 B;  2CA3 B;  3L74 D;  1P84 D;  1ZZH A;  1M60 A;  5EXQ A;  1H33 B;  1CHJ A;  1KV9 A;  5KLI B;  3M97 X;  1YIC A;  5CIC B;  1C6S A;  2QJP B;  3WUI A;  3ZBM A;  1U75 B;  1NIR A;  5KLV D;  4EIC A;  351C A;  4EIF A;  3A9F A;  3ORV A;  1H31 A;  3MK7 C;  1F1F A;  1PP9 D;  1DII C;  1YEA A;  4LJI A;  1CXA A;  1GJQ A;  4L3H A;  4PD4 D;  4O1W A;  4XXL A;  4AAL A;  5CIH B;  4GYD A;  1M70 A;  2C1D A;  3OCD A;  1DVH A;  1CCH A;  1C52 A;  4FA9 A;  1SQQ D;  3C2C A;  4AAN A;  2BGV X;  1YFC A;  1CCR A;  1DW0 A;  2OZ1 A;  4PW9 B;  4K3I A;  1WEJ F;  3WC8 A;  2YIU B;  3ZOX A;  3H1K D;  1OCD A;  1BE3 D;  2ORL A;  4EIE A;  2BH4 X;  1SQV D;  1K3H A;  3TYI A;  4H0J A;  1DW3 A;  1CRJ A;  1WVE C;  2YCC A;  1DVV A;  1OAE A;  2ZXY A;  1LC1 A;  1S5L V;  1COR A;  1QN2 A;  4IL6 V;  3CYT I;  1ETP A;  1LFM A;  2IBZ D;  3OA8 A;  1CED A;  1CTJ A;  2QJK B;  1FI9 A;  1CYI A;  2DGE A;  5KAF V;  1SQB D;  4EID A;  3O1Y A;  1MG3 D;  4Q5P A;  1KX7 A;  2BPB B;  1CRI A;  3ZOO A;  1KB0 A;  2A06 D;  1MZ4 A;  2ZBO A;  1GDV A;  1QKS A;  2YQB A;  2FYN B;  1QL3 A;  1CIE A;  4KMG A;  2XTS B;  2YK3 A;  2BLF B;  2V08 A;  1HRC A;  4WQD A;  5DFS A;  4L1Q A;  1ZRT D;  1CRH A;  1JDL A;  3PXT A;  4FA4 A;  1DW1 A;  2N9J A;  1W2L A;  4PWA A;  1N9C A;  2GC7 D;  3NBS A;  4RSZ A;  4MU8 A;  1CSU A;  155C A;  4UB8 V;  3X39 A;  3PH2 B;  1C2R A;  1M6Z A;  1CYC A;  1RZ5 A;  3H1H D;  3L4M A;  4FA5 A;  3SVW A;  3A0H V;  4O1Q A;  3HQ6 A;  1DIQ C;  2CE1 A;  3BCC D;  1BL9 A;  4GED B;  3WFE C;  1HJ3 A;  1IQC A;  2PCB B;  1N50 A;  1CIF A;  1C75 A;  5AUR A;  4J20 A;  2MTA C;  2JQR A;  3SLE A;  1H32 B;  2C1U A;  1CIG A;  2N3Y A;  1YNR A;  1E2R A;  1HZV A;  4L3G A;  4Y5R A;  1L9J C;  2LIR A;  2FWL A;  3ZIY A;  1FHB A;  1I55 A;  2GIW A;  4WQ9 A;  1YCC A;  1YIQ A;  4PJ0 V;  2CA4 B;  5C0Z A;  1I54 A;  3SJL A;  2MHM A;  1BCC D;  4FB1 A;  1KB9 D;  1I5T A;  1COT A;  4YE1 A;  1FI3 A;  1H33 A;  3WFC C;  1GIW A;  3RLM A;  1I6D A;  4AAM A;  1QYZ A;  1N15 A;  1CNO A;  5DF5 A;  3DR0 A;  2AXT V;  5CIB B;  2B0Z B;  3CX5 W;  451C A;  1HRO A;  1H32 A;  4WQB A;  4N0K A;  1I8P A;  3RN1 A;  1HJ4 A;  2VHD A;  1CYJ A;  4JCG A;  1U74 B;  2CXB A;  1NMI A;  3WU2 V;  1NTZ D;  1YTC A;  5IY5 1;  1KYO D;  2B11 B;  2I8F A;  2ZZS 1;  1CTZ A;  1SQX D;  3ZCF A;  3WFD C;  3WFB C;  2FRC A;  2PAC A;  1CHI A;  2DVH A;  3CXH D;  3L72 D;  1FOC A;  3HQ7 A;  4AAO A;  4NFG B;  4D6T D;  1R0Q A;  4P4Q B;  4QAO A;  1FCD C;  1HH7 A;  2QJY B;  1CXC A;  1RAP A;  3O5C A;  1EB7 A;  2N3B A;  1GU2 A;  2GB8 B;  3RN0 A;  3CX5 D;  3CP5 A;  1LMS A;  1H31 B;  1C6O A;  1IZL 0;  1CIH A;  2BCC D;  1CRG A;  4WQ7 A;  1C2N A;  1DW2 A;  1B7V A;  3VYM A;  1LS9 A;  1I8O A;  4WQA A;  4XYD B;  1H9X A;  1E8E A;  2BH5 X;  2HV4 A;  3ZOY A;  2C1D B;  2C9X B;  1FI7 A;  1H1O A;  1L9B C;  1F1C A;  3VNW A;  2PCC B;  5CIE B;  1IRW A;  1GQ1 A;  1A56 A;  2OZ1 B;  1CHH A;  3DMI A;  1DT1 A;  1HJ5 A;  3CWB D;  5CIF B;  1KIB A;  2D0W A;  3PXW A;  5C9M A;  1RZ6 A;  2V07 A;  1IO3 A;  1PPJ D;  5GTH V;  2D0S A;  3CU4 A;  1L0L D;  4FAV A;  1A2S A;  3HQ8 A;  3NWV A;  5CID B;  3DP5 A;  4DY9 A;  2C1V A;  5B66 V;  2ZOO A;  4AX3 A;  3JBT B;  5KKZ B;  5CIG B;  3VRD A;  1NNO A;  3OA8 B;  1SQP D;  1E29 A;  1KYO W;  1IRV A;  2N9I A;  1EZV D;  3O0R C;  3O20 A;  3RMZ A;  1H9Y A;  1AKK A;  1I6E A;  1VYD A;  1HZU A;  3TGU D;  1MG2 D;  1RAQ A;  3CXH W;  5B5E V;  2ZON G;  5H2F V;  1CC5 A;  1J3S A;  1L0N D;  5KAI V;  5DJQ C;  2L4D A;  2N18 C;  3ZOW A;  1BGY D;  1KX2 A;  1NML A;  4FA1 A;  1NTM D;  3L75 D;  2LIT A;  1AOQ A;  3L73 D;  3H1I D;  1A8C A;  1AYG A;  1LC2 A;  2C2C A;  2GC4 D;  2B12 B;  1N90 A;  2AIU A;  4WQC A;  3SWS A;  2CE0 A;  4FAN A;  3H1J D;  1CTY A;  2B10 B;  3PXS A;  1W5C T;  3KZI V;  3H1L D;  5GTI V;  1NTK D;  2B4Z A;  1CSX A;  1CRY A;  2C8S A;  3NBT A;  3MK7 B;  1CRC A;  2AI5 A;  1S6V B;  1CSW A;  4WQE A;  3SXT A;  1K3G A;  3L4O A;  5TIS V;  4V2K A;  1C6R A;  2EXV A;  3HQ9 A;  1NU1 D;  1QL4 A;  1HCM A;  1C7M A;  2BCN B;  3L71 D;  2JTI B;  5E79 V;  1CSV A;  3A0B V;  3OCD B;  1GKS A;  1FJ0 A;  1AOF A;  2FYU D;  5B6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...