1H3QA

Crystal structure of sedl at 2.4 angstroms resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
MSGSFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFDRKVQFLGKKHLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Sedl and its Implications for a Genetic Disease Spondyloepiphyseal Dysplasia Tarda
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport
molecule keywords SEDLIN
total genus 37
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2002-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04628 Sedlin_N Sedlin, N-terminal conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.70 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1h3qA00
3CUEA 2J3TC 3PR6A 2ZMVA 1H3QA 2J3TD 3CUEC 2J3WA
chains in the Genus database with same CATH superfamily
4NKPA 4EBLA 4E3KA 3CMZA 2H28A 4EESA 4LCMA 1G5UA 3T4QA 2ZM0A 4F3LA 3F1PB 1OJ5A 4DN0A 3ZG7B 4JGRA 1K6SA 2ZD8A 3IHBA 1J9MA 3NOTC 1KGEA 3DTKA 3L9KA 1QMEA 2P9VA 2H10A 2XGNA 3ISGA 2ZMAA 2W0NA 4I5SA 4PM5A 4RVAA 1GSVA 2Y2KA 1GA9A 1FIKA 3VSLA 4QU3A 2QHKA 2A3UA 5A92A 4Z9QA 2UWXA 3T4SA 1K54A 4OQGA 2EX6A 2VJWA 2XA7M 5EVIC 3IF5A 2J80A 1JWPA 3ZFZA 5FAOA 5FI6A 3MJQA 4UA9A 2XH9A 2A24B 1NZUA 1V9ZA 1F2KA 2ZQAA 2WKRA 2Y2MA 1L0GA 5EM1A 5FAPA 5EOOA 4GOGA 4OH0A 5CTMA 2PAVP 1P9RA 1W79A 5M1AA 3GECA 5HPFA 4Q8IA 5DJTA 5JYPA 2ZC4B 2A49A 3IHAA 1DJCA 1ALQA 4HIAA 4RX2A 2Y2JA 5FQMA 3WRTA 4GNUA 3E0YA 2NUPC 1BTLA 3VOLA 3QHYA 3LR0A 4GDBA 1LHYA 2JE5A 1D06A 4FSFA 3V39A 1OT9A 3G35A 3ZGAB 3MXRA 4DE1A 3F1NB 2Y4AA 2Q9MA 4B4ZA 3B33A 4GDNA 4BJPA 3DWKA 3F1OA 2EXBA 5FQQA 2ZBBA 3BM6A 2WZXA 2W3HA 3LEQA 4R3BA 1P0ZA 5HWWA 5GLDA 1YPRA 2PR6A 2ZOIA 4DJ2A 2W1RA 4WN5A 1BZAA 5AQAA 1N9OA 4WZ5C 1K25A 3UDFA 2PYPA 2P04A 1W5DA 4KQRA 1Z09A 4EBPA 2Y2OA 4E04A 5DJUA 2PHYA 1L0DA 3UPOA 2ZC6B 4MLLA 1IEMA 1MBLA 1N4OA 2LB9A 1EI5A 3HUNA 1K54C 3M2JA 2Y2GA 3NJAA 3AGDA 4M3KA 4EQIA 1KOUA 4Y0TA 2GJ3A 1TF1A 1XA7A 4KZ7A 4HBUA 3PXPA 4KZ3A 3T1QB 4PKYA 4WEJA 3BECA 1BLHA 2KDKA 1W8QA 3RJUA 4RYEA 4LCLA 3ZG8B 3T4TA 5L09A 4MBHA 4HY8A 2WYXA 2FFYA 2Y2QA 3AGFA 2W3GA 3ZVTA 4DDSA 1MZUA 2QJ7A 4FOFA 3IX8A 2OAQ1 4CLCD 3VOZA 1E25A 2PU2A 2QWSA 5HARA 1LLBA 4R3AA 3ZNTA 3KO6A 4OOLA 3IT9A 4WMCD 1SKOA 2PR5A 4IUKA 2RCXA 3B42A 2W1TB 5DKLA 5EPHA 3C8CA 1PIOA 1YT4A 2HDQA 5BOHA 5CEBA 3SH7A 2Y79A 4BD0A 2E8IA 3U2AA 1L0FA 2VGLS 3V67A 2W3DA 1PYYA 4GZBA 3IF6C 1GHIA 3MS6A 3MQQA 4ZRRA 4XT2B 1K38A 4QY5A 3M6HA 4KUKA 2LB5A 4U0XA 1VB6A 3S4XA 1O7EA 3NIAA 1S4RA 2BLSA 5FAQA 2CC1A 3FKWA 3WS0A 2Z6CA 2C5WB 2W3FA 2JC7A 1HLUP 1IOUA 2WKEA 5DF9A 5DTSA 4H6JB 3CG5A 4QWOA 3SOIA 3TRCA 4S2PA 4OKPA 4EEPA 4JPMA 3HCYA 4R4RA 1DJBA 5G18A 3MMHA 1S67L 1VHMA 2ACGA 1YKDA 3BFFA 2O9CA 4LV3A 3SS3A 3A0RA 4YFMA 2JKTI 1K0KA 3GVBA 4ID4A 5E43A 2ZC3B 3W8KA 3TSGA 1PWGA 1TEMA 1YSQA 3IF6B 3OCNA 4LLOB 2ZC5B 1VETA 5GLAA 2JKTM 3W4PA 5HAQA 2FFFB 4HI4A 3P09A 4CLCE 3G2YA 1NWZA 5J3WA 4DJ3A 1TDGA 3T50A 1NLYA 4UAAA 1YLZA 3C7VA 3OZHA 1RGYA 3HUMA 1IYOA 2PD8A 4YINA 3ZG9B 2DCFA 4B4XA 5DFYA 3ULFA 2KX6A 4UEYA 2Z6DA 5L8MA 2V1BA 5EVIB 2Y2PA 4H8RA 1NLZA 4NG2A 2R9WA 3HVFA 4E3OA 2V1AA 3G34A 2JHEA 1W63M 3JVUA 4HJ4A 3KSFA 4X1LA 3T1XA 4F94A 2JKFA 4ETZA 2NUTC 4Q0IA 2Q0OA 3KX0X 1PRQA 4F3LB 3LR3A 1ZKJA 1I5QA 3A3FA 5KZHA 3Q7ZA 3V50A 3ZHHA 2FH5A 2OLVA 5FI7A 3MKEA 1OTEA 2DRWA 1T1CA 4WZ5A 4X69A 4AFIA 2PRFA 5EOEA 3DTEA 5J4EA 2Y2HA 1HTZA 3ZYTA 3ICYA 1YMSA 4JXSA 3UB6A 3OPPA 4YWZA 4IJGA 4LENA 2A2LA 3QP1A 2WKPA 5FI2A 2ZM2A 4A5RA 4EBNA 3M6BA 4UHUA 3UB8A 4R38A 4IUHA 4MDZA 4IHQA 5CX7A 4LV1A 4KQQA 4Y0UA 5HAPA 3I7JA 3KYEA 3A3IA 4BENA 3PAEA 3EEHA 1XA1A 3BLMA 4ZBEA 2XF3A 3UMDA 3GDIA 3GRJA 2ZQDA 3DW0A 1N9BA 3PHYA 5IU1A 3T4KA 2WKHA 3KSIA 4CJNA 1ZHHB 3UB7A 1YLJA 3E2LA 4DDYA 5GHXA 2OV5A 3QNBA 4GLQA 3LYXA 1S1ZA 2PT7A 4GS9B 2J8YA 3D3OA 5MC7A 3BEBA 3UDXA 1MWSA 1NYMA 2CMNA 3WS1A 1EWZA 2WGVA 3FC7A 3CAXA 5CHJA 5E2FA 4E6WA 5IHVA 1KDWA 1MWTA 4MN7A 5J8XA 3IF6A 1L2SA 3HREA 5L2FA 2QKPA 4E3NA 1G6OA 1LI0A 5HD3A 2ZMVA 4MBKA 3N8SA 3BLSA 3UMEA 4ZDXA 4OQ0A 2WUQA 3BFDA 3V5MA 5CGWA 4XXRA 5FA7A 2G7UA 5EV0A 3CPTA 4IBXA 1ACFA 3DBAA 3VFHA 4KG5A 4M4XA 4HJ6A 4L9FA 3F1NA 4Q0HA 1YQSA 2X02A 2HP6A 4X53A 3D9YA 4IVIA 4JF4A 3HLWA 4X6TA 1GHMA 1T18A 5HX9A 1DP8A 4EUZA 1K57C 3CUEA 3FYZA 5GLCA 4UQIM 1T1BA 1Z6FA 4PMAA 5EFWA 4ESPA 2WADA 1GCEA 1WE4A 3UNWA 3GV9A 4CPKA 5DFXA 4R3JA 1FR1A 1PWCA 3NDGA 3HLEA 1IFQA 1I2SA 1C3BA 2PDRA 2HPBA 5F82A 4QHCA 4WZ4A 5U47A 4Z1WA 1YMXA 4R70A 4FH4A 4KZ5A 4HP4A 3NDEA 5HWVA 5CRFA 1YLWA 3AGEA 4HESA 4X1MA 4B93A 2V0UA 1IYSA 4U0TA 3NULA 4P87A 5D3OA 1IKIA 1FOFA 5A91A 1ERMA 2OWHA 3IXGA 4FUWA 2V20A 3VFFA 2W27A 3CITA 3VSKA 1XJ2A 4MMNA 4BMWA 4HJ3A 3BY8A 1H8YA 1NRFA 4ZAMA 1NRJA 4OLGA 3OCLA 5DTTA 4NXEA 3SH9A 1N9NA 3C2WA 4O01A 5AQ9A 4X56A 2H0TA 1LSXA 5KSHA 2JN7A 1IKGA 3EQUA 2ZQ9A 4Y0OA 4NEED 5FATA 2V8CA 5DKKA 1SHVA 4Y17A 5FQKA 2KOIA 1BLCA 3N4IA 2QJ5A 2JCHA 3HJIA 1PW8A 2YKFA 4S2MA 1ES3A 2GNXA 2JKGA 1MWUA 4I3IA 4X55A 5EECA 2WGWA 2XEPA 1PI4A 5HL6A 1NJ4A 1CK3A 2X01A 1QMFA 3OPHA 3P7NA 4CLCB 3BY9A 2GX5A 4E3JA 1S0WA 2VV7A 5IS1A 3HLCA 5HPIA 5G4ZA 2HP5A 3UB9A 4EWFA 3E4PA 5J7EA 2EX9A 5TFQA 2WGIA 4HP9A 4S2OA 3C5AA 2WKQA 1NZOA 4HNBA 2Y2LA 4E3MA 3TOIA 1SDNA 1BYWA 3UE3A 4LRXC 1MWRA 3FZCA 4N9KA 3ZVWA 3ITBA 3LY3A 5DF8A 4KG2A 4I3AA 3T4OA 3RXWA 3LCEA 1PI5A 4OQHA 5FQ9A 2HF6A 2P08A 3VP1A 3EQVA 4BD1A 4C75A 4WMCA 4EQ1A 2EXAA 4IBRA 2VLGA 2PU4A 4CLCC 2Y2NA 4B88A 2HJ9C 3K2NA 1SZVA 4BL2A 5AVFA 3MF0A 1KGFA 4MBFA 4PAUA 5F83A 1VETB 3QP2A 4OPYA 5CGSA 1PWDA 4QPRA 2IA2A 2VK3A 5GHYA 1Q2PA 4EEUA 4EV4A 2MJ6A 2XA7S 1TVFA 2HGVA 1SDEA 3QP6A 4E3IA 2EX2A 1LL8A 3UPNA 2Z2MB 2XD5A 1E4DA 3EGDC 5DF7A 1ONGA 3S7PA 1G68A 4PM7A 4Y15A 1FSWA 4BWIA 4C6YA 1D7EA 3IXDA 4XUZA 1RGZA 4P0MA 1NXYA 2ZQ8A 2PBDP 4Y2FA 4BLMA 4S2JA 5FL3A 1ESIA 1XX2A 3B3XA 3EOIA 4IVKA 4WYYA 2B02A 4G3KA 4QD4A 3KSHA 4FCFA 4NK3A 4LV2A 4R1GA 3UO9A 2PD7A 3FWLA 3L7HA 4HQAA 5A93A 4MN5A 4RA7A 4NXFA 4GB7A 2O9BA 3VP4A 1ODVA 4PM9A 3DAVA 4MN6A 3UY6A 3A0VA 4HOIA 2V9AA 1N9LA 1KDSA 3SW1A 2J9OA 3S7OA 5HFOA 4YNRA 1PW1A 1I2WA 3NI9A 5I94A 1UWPX 3WWXA 2V1ZA 2IWBA 2WAEA 2HZ5A 2ZMFA 3QNCA 5FQJA 5KSCA 1DY6A 1ES2A 3UPPA 3SS4A 5CGXA 1BUEA 4O8GA 4WUJA 3LEZA 2W1TA 4LPZA 3S1YA 1XJ3A 2XROA 4R0QA 3WS4A 3W4OA 2BG1A 1AWIA 4HH2A 1CI9A 3SH8A 3BQAA 4GS9A 5A90A 3IXBA 4N1HA 3ZNYA 4XUXA 3DWZA 5CEDA 3VMAA 3CUEC 2XQZA 5HDDA 4XT2A 1PZOA 4E3LA 5JYOA 1JNUA 4HHDA 5FDSA 2VZWA 1YLPA 3LO7A 4GD8A 3OOVA 5I5LA 5K5BA 1VM1A 1FCOA 4EXOA 4K08A 3CJMA 3VP0A 3NY4A 2XLNA 2E8JA 2O0YA 1JWZA 3O88A 3LIFA 4D2OA 4ME4A 4I38A 1P97A 2I72A 4OOMA 4WEKA 3TJZC 3LIBA 2G2WA 4LRYC 4PPRA 3WRZA 5KIZA 4JGPA 1SKOB 4JGQA 3ITAA 1OPXA 1FR6A 1K55A 4WELA 2IWDA 4Q0JA 3LR4A 3GSGA 4JXGA 2V2FF 3LI8A 3BWLA 3T1SA 2QPNA 2JBFA 1W8YA 5HDSA 3PBRA 2XD1A 3OLOA 3MKFA 4GKUA 5F68A 4LV0A 5E2EA 1LSVA 3N7WA 3HLFA 2I9VA 3MQ0A 3LIEA 4L9EA 3JYIA 2R78A 1TS6A 5FDHA 2ZM8A 4CQHA 1G6AA 5CERA 1OTAA 1GSXA 1TS0A 5E2GA 4ZTKA 3C30A 5HWTA 2PYRA 3CLOA 3SS5A 1YLTA 3VE3A 5EVIA 4X68A 1S4SA 2EFXA 4LGWA 3K3CA 3S22A 3D72A 1EROA 5HZHA 2P7JA 4X25A 1K6RA 3MXSA 4DE3A 4HBTA 1BULA 2O9AA 4DXCA 2IWCA 2QZ6A 3NHQA 1H8ZA 3MQOA 3CWFA 3UE6A 1ONHA 3DTMA 2K31A 4JF5A 3W2ZA 2OWJA 4I3JA 3FKVA 3Q7VB 4NETA 1L0EA 2QMIA 1T1AA 1OMEA 1MC0A 1BLPA 1HZOA 1M6KA 1K4EA 4BBVA 2K2NA 1K56A 2K7SA 3PBTA 4S2IA 5HAIA 3TW8A 3T4LA 3LI9A 4HEFA 4BBTA 3BJNA 3S7NA 1MY8A 3T4JA 3G4PA 1M40A 3CPTB 3OPRA 5CTNA 3IS2A 3CZDA 5TBMA 4ETXA 2ZOHA 2L1MA 3IQAA 3O3VA 5AVEA 4P6ZM 3P01A 4OLDA 5CHUA 2OSUA 4JF6A 4Y3IA 3JVVA 2XRNA 2HP9A 1ES5A 1FSYA 1WYCA 3LIDA 4OP8A 2P74A 3H7WB 3MZEA 2XSSA 3NCKA 4KQOA 3KYZA 3BYDA 4GHIA 1STZA 2M7UA 3H82B 4DE2A 1HVBA 3DTIA 3UDIA 1XJ6A 1YLYA 3T12B 1V9YA 2OAP1 3IBJA 1OT6A 3LICA 4Y13A 4QB8A 1TD5A 4KZAA 5IT5A 4N92A 1K56D 4KG6A 3IWOA 2V0WA 4R4SA 2VA0A 1JWVA 1OTIA 5CHMA 3ZG5A 4CLCA 2HDUA 5FSRA 2EWVA 3Q81A 1JVJA 1L3LA 3JPUA 5DTKA 3BQ8A 4GN2A 4OPRA 3V3RA 3U4LP 4KZ9A 3PBOA 1VQQA 3G6OA 5LBRA 5TGFA 1Q2QA 2C6WB 1GHPA 4MEZA 3BRMA 1GSWA 2VX8A 3R4KA 1HD8A 3G30A 2Y2IA 1JTDA 2VEAA 3QP5A 4K0XA 1LSWA 3LR5A 1TDLA 2XFSA 2H5SA 2P9VB 4C3QA 2Y55A 4JBFA 2Z2LB 3A3EA 2RL3A 3A3DA 2OOLA 5KMWA 1S6RA 5F1FA 1H8MA 4ZJ3A 1P9WA 2XFTA 4G3WA 1ES4A 1T19A 3LFVA 3G2ZA 1CJFA 4NXBA 5TJJA 4KUOA 4R23A 3PAGA 5FEGA 1E3UA 3C4PA 5F69A 3GQZA 3ZQ5A 1Y4OA 4WM9A 2Y91A 1OJGA 3MBZA 4UA7A 1PFLA 2VGLM 2VV8A 5CXWA 2ZJ9A 4II7A 3HLDA 4OP5A 1KGGA 3H7WA 3EGXC 5E2HA 1WYBA 1F9IA 1PNEA 4D60A 3WS2A 3BFGA 3TE8A 2ZQ7A 3R7WB 3PBNA 4GHIB 1KVLA 4MCWA 2UV0E 4N1XA 1ZC2A 5F5YA 3QP4A 3BFEA 3EWKA 4KZ6A 3VV4A 1XFNA 4QJGA 3KYQA 1U60A 3IBRA 3S7QA 2B18A 5HD5A 3BFCA 1JTGA 1XP4A 2VV6A 2DNSA 3EEAA 5L07A 2O99A 3CI6A 4ARZA 3C38A 2B5RA 4S2KA 5GHZA 4OPQA 4ZJ2A 1ZTUA 1XJ4A 1H3QA 4EW7A 5TBMB 1X0OA 4WLAA 3E4OA 2HJEA 3F1PA 3ZCZA 5HL1A 4FTXA 1K55C 1CEFA 3PR6A 2AVXA 4E6XA 2A24A 3N6IA 2DMWA 4N9LA 4RX3A 3HBRA 1LL9A 3OBFA 3G32A 4S2NA 3IX3A 3MSHA 2PBYA 1XXMA 3O5YA 1FILA 2WZZA 2XR0A 3MFDA 1YM1A 3LGOA 2ZL1B 4G3VA 4UQIS 3H82A 1Y54A 2WGWB 2L0WA 4DKIA 1EW0A 2GDNA 1FQGA 3Q82A 5AJGA 2J7VA 1WA9A 1SCWA 2Y59A 3M2KA 3UE0A 3GMWA 1Y28A 3UE1A 3W4QA 1S1YA 1F98A 2J3TD 2VKSA 2BTFP 2ZC7A 5GLBA 2V8FA 5M19A 2M7VA 1VEUA 3Q7VA 1DRMA 5EVLA 4KZ8A 1LT0A 3MXQA 2JKRI 3QP8A 3P98A 4JXWA 1F5MA 2EFUA 4S2NC 3H9WA 2HDRA 5EE8A 5HW3A 1LI9A 3KSGA 1IYPA 5F6AA 1H5XA 5FEFA 3TG9A 1RP5A 1XGIA 2WK0A 2W3EA 5AQ7A 4B9OA 4L9GA 2H0YA 3FPWA 1TS8A 4OONA 3OPLA 3RH8B 3MZFA 4EERA 3ZDJA 3RXXA 2BASA 5AQBA 1CEGA 3O87A 4OPZA 3SZTA 3VP2A 2J3WA 5FASA 4NXGA 3V3SA 3ZG0A 3GR2A 3LY4A 1KVMA 5DVAA 1OTDA 3IWQA 1K57A 3O86A 4L0LA 3G31A 2OLUA 4LFUA 5CECA 3N8LA 1SKFA 2EX8A 2D02A 3IH9A 3E98A 4JLFA 1NYYA 1MKMA 3UB5P 2WAFA 1DP9A 2J9PA 2Q9NA 1IYQA 3PYPA 2M1CA 1MXOA 3A0SA 1XKZA 4O0PA 3NBLA 3R7WA 3C7UA 1DJAA 3LIAA 4PM6A 1XFQA 1UGUA 4DXBA 5HDCA 2VGJA 1K4FA 5FQIA 4KQDA 4JXVA 1A0KA 3N8RA 1ZG4A 4OVDA 4WL9A 4BQMA 2J3TC 2EA9A 3NC8A 3E2KA 4ZJ1A 1RCJA 5HSQA 1XPBA 2X71A 1J3WA 1G28A 4PKYG 4KENB 4GW9A 4ARZB 4WF0A 4DRTA 3F1OB 2HDSA 3WS5A 1NY0A 5GL9A 1CF0A 3HLBA 5F1GA 1PZPA 3CHWP 3PTEA 1D1JA 4Y5FA 4HH3A 4FD8A 4GD6A 1KE0A 3HUOA 3IWIA 2ZLYA 1OTBA 3IS2B 5M18A 2YKHA 1BSGA 5EVID 4Y7PA 1FCNA 4R6LA 3HLGA 3NOUC 4MNRA 5EM0A 4GJ4A 4O7DA 3A3JA 3HJKA 1W7FA 4I39A 1KE4A 4U3TA 1ZG6A 3GTCA 3T1RA 2ZQCA 2L4RA 4KZ4A 5G4YA 3Q1FA 4P85A 1TS7A 3FPVA 3Q07A 1ERQA 5L10A 2Y8HA 4EU0A 4OOYA 4DMZA 2FZ0A 1GA0A 1W63Q 1MPLA 1MKIA 4EUVA 3IX4A 4S2LA 5A8BA 2D01A 1BLSA 1YAXA 5C5KA 3D4FA 1BT5A 1FCMA 4EETB 2XK1A 3C4OA 4JKTA 2KLIA 2B95A 4BL3A 4PM8A 4PHTA 3VOYA 2HV1A 4KZBA 1H0MA 1E3UD 5TR7A 4WBGA 2QYBA 4UA6A 2GZAA 3K3DA 5EVEA 1CI8A 3RTYA 2JKRM 1O07A 2XDMA 1IELA 4P6ZS 4RQ9A 3RFBA 4DF6A 4DE0A 2EWWA 1XGJA 3BW6A 2G2UA 1DP6A 1S66L 3MR0A 3HL9A 1AXBA 4YOFA 3UN7A 4GCZA 2VGKA 3PBQA 2ZL1A 2R9XA 4FH2A 4K91A 4LRZE 3PBSA 1UWNX 3MFXA 3B47A 1YSPA 3FV7A 3OC2A 2WKIA 3IH8A 4IEDA 2INWA 3FG8A 3VE4A 3VP3A 1ESUA 4BBUA 4QY6A 4H6JA 1LL5A 4JGOA 3LUQA 3NOPC 4K0WA 4OQIA 5EUAA 1CQAA 3IXHA 4P6BA 3E4QA 3MZDA 3NECA 1KE3A 1VEUB
chains in the Genus database with same CATH topology
3EWKA 4NKPA 2FH5A 2PD7A 3VV4A 4HQAA 1XFNA 4MN5A 2H28A 4EESA 3KYQA 1OTEA 3T4QA 1T1CA 4AFIA 3IBRA 3S7QA 4F3LA 4NXFA 3F1PB 2O9BA 1OJ5A 1ODVA 2B18A 5HD5A 4DN0A 5J4EA 4JGRA 4MN6A 2VV6A 3EEAA 3ZYTA 3A0VA 3ICYA 2O99A 3UB6A 3CI6A 3NOTC 4ARZA 3C38A 4HOIA 4YWZA 2V9AA 1N9LA 4IJGA 2A2LA 3SW1A 1ZTUA 2WKPA 1XJ4A 1H3QA 3S7OA 4EW7A 4YNRA 5TBMB 1X0OA 4WLAA 3E4OA 1UWPX 2HJEA 2W0NA 4I5SA 3F1PA 3UB8A 4R38A 4IUHA 4MDZA 1GSVA 2ZMFA 3PR6A 4IHQA 5CX7A 2A24A 2QHKA 2DMWA 4O8GA 4WUJA 3EEHA 2W1TA 4LPZA 3OBFA 1XJ3A 3T4SA 2XROA 2VJWA 3O5YA 2XA7M 2J80A 3UMDA 3GDIA 4HH2A 3BQAA 4GS9A 3MJQA 3PHYA 4G3VA 4UQIS 2A24B 5IU1A 3H82A 1V9ZA 3CUEC 5HDDA 4XT2A 2WKRA 3T4KA 3KSIA 1ZHHB 2L0WA 3UB7A 1JNUA 4HHDA 4GLQA 1EW0A 2VZWA 3LYXA 1S1ZA 2PT7A 4GS9B 3OOVA 5I5LA 3D3OA 5K5BA 5AJGA 1WA9A 4EXOA 5MC7A 1P9RA 4K08A 1Y28A 3GECA 1S1YA 1F98A 2J3TD 2VKSA 5HPFA 5DJTA 2O0YA 2CMNA 2M7VA 3LIFA 1DRMA 4ME4A 1LT0A 3MXQA 2JKRI 4HIAA 1P97A 3FC7A 4I38A 3CAXA 3E0YA 2NUPC 3VOLA 4OOMA 4WEKA 3LR0A 3TJZC 1F5MA 3LIBA 1D06A 4FSFA 4MN7A 3H9WA 1OT9A 4LRYC 5KIZA 3KSGA 4JGPA 4JGQA 2QKPA 5F6AA 3F1NB 1OPXA 1G6OA 5HD3A 2ZMVA 3UMEA 4WELA 2W3EA 4Q0JA 3LR4A 4B9OA 3B33A 4L9GA 2G7UA 3FPWA 4BJPA 3F1OA 1TS8A 3LI8A 2ZBBA 3BWLA 3RH8B 4EERA 3DBAA 5HDSA 2W3HA 3PBRA 1P0ZA 5HWWA 4M4XA 2BASA 4HJ6A 4L9FA 2PR6A 3OLOA 2ZOIA 3F1NA 4Q0HA 2J3WA 5F68A 4NXGA 4DJ2A 1LSVA 2W1RA 4WN5A 2I9VA 3MQ0A 3LIEA 4L9EA 1N9OA 2PYPA 2R78A 1TS6A 2P04A 1T18A 1DP8A 1OTDA 4L0LA 4CQHA 3CUEA 4E04A 5DJUA 4UQIM 1OTAA 2PHYA 1GSXA 1T1BA 1TS0A 5EFWA 2D02A 3C30A 5HWTA 3E98A 2PYRA 2LB9A 3CLOA 3VE3A 1S4SA 1MKMA 3K3CA 3D72A 1DP9A 5DFXA 5HZHA 2P7JA 3NJAA 1IFQA 3PYPA 2M1CA 2O9AA 3A0SA 3NHQA 1KOUA 3MQOA 4O0PA 2GJ3A 1TF1A 2PDRA 3CWFA 3R7WA 3UE6A 3LIAA 1XFQA 4Z1WA 1UGUA 2K31A 4R70A 3PXPA 5HDCA 4HP4A 3W2ZA 2OWJA 4I3JA 4KQDA 4PKYA 5HWVA 4WEJA 2KDKA 1T1AA 4B93A 2V0UA 1MC0A 3T4TA 4BBVA 4HY8A 4WL9A 2K2NA 2OWHA 2J3TC 2K7SA 2EA9A 3PBTA 2W3GA 3TW8A 2W27A 3CITA 3T4LA 1XJ2A 3LI9A 5HSQA 1G28A 4MMNA 4PKYG 4BMWA 4HJ3A 4BBTA 1MZUA 3BY8A 4GW9A 4ARZB 3BJNA 4WF0A 3S7NA 2QJ7A 4FOFA 1NRJA 3T4JA 3F1OB 3OCLA 4NXEA 2OAQ1 4CLCD 1N9NA 2QWSA 3C2WA 4O01A 3IS2A 5TBMA 4R3AA 4ETXA 2ZOHA 3KO6A 4OOLA 1LSXA 2L1MA 5KSHA 2PR5A 2JN7A 4IUKA 5AVEA 4P6ZM 3P01A 3EQUA 4Y5FA 4HH3A 3B42A 4Y3IA 2W1TB 5DKLA 3C8CA 4NEED 3JVVA 2XRNA 2Y79A 5DKKA 3U2AA 2KOIA 2VGLS 3V67A 3LIDA 2QJ5A 3HJIA 1OTBA 3IS2B 3H7WB 2YKHA 2YKFA 2W3DA 2XSSA 2GNXA 4R6LA 4I3IA 3NOUC 3MQQA 4KQOA 3KYZA 4GJ4A 4ZRRA 4XT2B 4GHIA 1STZA 2M7UA 3HJKA 3H82B 5HL6A 4KUKA 2LB5A 4I39A 1VB6A 1S4RA 3P7NA 4CLCB 3BY9A 1XJ6A 2GX5A 1V9YA 2OAP1 2VV7A 5IS1A 3IBJA 5HPIA 5G4ZA 1OT6A 3LICA 2Z6CA 3UB9A 2L4RA 2W3FA 1TD5A 5IT5A 5G4YA 3E4PA 1IOUA 2V0WA 2VA0A 5J7EA 1TS7A 3FPVA 5DF9A 4H6JB 1OTIA 4HP9A 3TRCA 2Y8HA 4EU0A 2WKQA 4HNBA 4CLCA 4DMZA 2FZ0A 2EWVA 1W63Q 4EEPA 3HCYA 3BQ8A 1BYWA 3MMHA 3UE3A 1S67L 4EUVA 4LRXC 1VHMA 1YKDA 5A8BA 2D01A 2O9CA 3PBOA 3G6OA 5LBRA 3A0RA 1YAXA 5C5KA 2JKTI 4I3AA 3T4OA 1GSWA 2VX8A 4EETB 3R4KA 2KLIA 1YSQA 3OCNA 2VEAA 4LLOB 4PHTA 2HF6A 2P08A 3EQVA 2HV1A 1LSWA 2JKTM 3LR5A 4EQ1A 2VLGA 4HI4A 4CLCC 4CLCE 1NWZA 2QYBA 5J3WA 2HJ9C 3K2NA 4DJ3A 2GZAA 5AVFA 2OOLA 3MF0A 3K3DA 3T50A 1H8MA 1NLYA 3RTYA 4PAUA 1P9WA 2JKRM 4G3WA 1T19A 3LFVA 4P6ZS 4NXBA 4RQ9A 5TJJA 3RFBA 4KUOA 4QPRA 2IA2A 2EWWA 2PD8A 3BW6A 1DP6A 1S66L 3MR0A 5DFYA 4EEUA 3ULFA 2KX6A 4UEYA 5F69A 4YOFA 2MJ6A 2XA7S 2Z6DA 4GCZA 5L8MA 3PBQA 3ZQ5A 2HGVA 2V1BA 4LRZE 1NLZA 1UWNX 3MFXA 3PBSA 3B47A 1LL8A 1YSPA 1OJGA 2V1AA 2VGLM 3OC2A 2VV8A 3EGDC 4II7A 3S7PA 2INWA 3H7WA 3EGXC 2JHEA 3FG8A 3VE4A 1W63M 3JVUA 4BWIA 4HJ4A 1F9IA 1D7EA 3KSFA 4BBUA 3TE8A 3R7WB 3PBNA 4Y2FA 4H6JA 4GHIB 2NUTC 5FL3A 4ETZA 4Q0IA 3EOIA 3KX0X 4JGOA 4F3LB 3LR3A 4MCWA 3LUQA 2B02A 3NOPC 4G3KA 3KSHA 5F5YA 3E4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUE A;  2J3T C;  3PR6 A;  2ZMV A;  1H3Q A;  2J3T D;  3CUE C;  2J3W A; 
#chains in the Genus database with same CATH topology
 4NKP A;  4EBL A;  4E3K A;  3CMZ A;  2H28 A;  4EES A;  4LCM A;  1G5U A;  3T4Q A;  2ZM0 A;  4F3L A;  3F1P B;  1OJ5 A;  4DN0 A;  3ZG7 B;  4JGR A;  1K6S A;  2ZD8 A;  3IHB A;  1J9M A;  3NOT C;  1KGE A;  3DTK A;  3L9K A;  1QME A;  2P9V A;  2H10 A;  2XGN A;  3ISG A;  2ZMA A;  2W0N A;  4I5S A;  4PM5 A;  4RVA A;  1GSV A;  2Y2K A;  1GA9 A;  1FIK A;  3VSL A;  4QU3 A;  2QHK A;  2A3U A;  5A92 A;  4Z9Q A;  2UWX A;  3T4S A;  1K54 A;  4OQG A;  2EX6 A;  2VJW A;  2XA7 M;  5EVI C;  3IF5 A;  2J80 A;  1JWP A;  3ZFZ A;  5FAO A;  5FI6 A;  3MJQ A;  4UA9 A;  2XH9 A;  2A24 B;  1NZU A;  1V9Z A;  1F2K A;  2ZQA A;  2WKR A;  2Y2M A;  1L0G A;  5EM1 A;  5FAP A;  5EOO A;  4GOG A;  4OH0 A;  5CTM A;  2PAV P;  1P9R A;  1W79 A;  5M1A A;  3GEC A;  5HPF A;  4Q8I A;  5DJT A;  5JYP A;  2ZC4 B;  2A49 A;  3IHA A;  1DJC A;  1ALQ A;  4HIA A;  4RX2 A;  2Y2J A;  5FQM A;  3WRT A;  4GNU A;  3E0Y A;  2NUP C;  1BTL A;  3VOL A;  3QHY A;  3LR0 A;  4GDB A;  1LHY A;  2JE5 A;  1D06 A;  4FSF A;  3V39 A;  1OT9 A;  3G35 A;  3ZGA B;  3MXR A;  4DE1 A;  3F1N B;  2Y4A A;  2Q9M A;  4B4Z A;  3B33 A;  4GDN A;  4BJP A;  3DWK A;  3F1O A;  2EXB A;  5FQQ A;  2ZBB A;  3BM6 A;  2WZX A;  2W3H A;  3LEQ A;  4R3B A;  1P0Z A;  5HWW A;  5GLD A;  1YPR A;  2PR6 A;  2ZOI A;  4DJ2 A;  2W1R A;  4WN5 A;  1BZA A;  5AQA A;  1N9O A;  4WZ5 C;  1K25 A;  3UDF A;  2PYP A;  2P04 A;  1W5D A;  4KQR A;  1Z09 A;  4EBP A;  2Y2O A;  4E04 A;  5DJU A;  2PHY A;  1L0D A;  3UPO A;  2ZC6 B;  4MLL A;  1IEM A;  1MBL A;  1N4O A;  2LB9 A;  1EI5 A;  3HUN A;  1K54 C;  3M2J A;  2Y2G A;  3NJA A;  3AGD A;  4M3K A;  4EQI A;  1KOU A;  4Y0T A;  2GJ3 A;  1TF1 A;  1XA7 A;  4KZ7 A;  4HBU A;  3PXP A;  4KZ3 A;  3T1Q B;  4PKY A;  4WEJ A;  3BEC A;  1BLH A;  2KDK A;  1W8Q A;  3RJU A;  4RYE A;  4LCL A;  3ZG8 B;  3T4T A;  5L09 A;  4MBH A;  4HY8 A;  2WYX A;  2FFY A;  2Y2Q A;  3AGF A;  2W3G A;  3ZVT A;  4DDS A;  1MZU A;  2QJ7 A;  4FOF A;  3IX8 A;  2OAQ 1;  4CLC D;  3VOZ A;  1E25 A;  2PU2 A;  2QWS A;  5HAR A;  1LLB A;  4R3A A;  3ZNT A;  3KO6 A;  4OOL A;  3IT9 A;  4WMC D;  1SKO A;  2PR5 A;  4IUK A;  2RCX A;  3B42 A;  2W1T B;  5DKL A;  5EPH A;  3C8C A;  1PIO A;  1YT4 A;  2HDQ A;  5BOH A;  5CEB A;  3SH7 A;  2Y79 A;  4BD0 A;  2E8I A;  3U2A A;  1L0F A;  2VGL S;  3V67 A;  2W3D A;  1PYY A;  4GZB A;  3IF6 C;  1GHI A;  3MS6 A;  3MQQ A;  4ZRR A;  4XT2 B;  1K38 A;  4QY5 A;  3M6H A;  4KUK A;  2LB5 A;  4U0X A;  1VB6 A;  3S4X A;  1O7E A;  3NIA A;  1S4R A;  2BLS A;  5FAQ A;  2CC1 A;  3FKW A;  3WS0 A;  2Z6C A;  2C5W B;  2W3F A;  2JC7 A;  1HLU P;  1IOU A;  2WKE A;  5DF9 A;  5DTS A;  4H6J B;  3CG5 A;  4QWO A;  3SOI A;  3TRC A;  4S2P A;  4OKP A;  4EEP A;  4JPM A;  3HCY A;  4R4R A;  1DJB A;  5G18 A;  3MMH A;  1S67 L;  1VHM A;  2ACG A;  1YKD A;  3BFF A;  2O9C A;  4LV3 A;  3SS3 A;  3A0R A;  4YFM A;  2JKT I;  1K0K A;  3GVB A;  4ID4 A;  5E43 A;  2ZC3 B;  3W8K A;  3TSG A;  1PWG A;  1TEM A;  1YSQ A;  3IF6 B;  3OCN A;  4LLO B;  2ZC5 B;  1VET A;  5GLA A;  2JKT M;  3W4P A;  5HAQ A;  2FFF B;  4HI4 A;  3P09 A;  4CLC E;  3G2Y A;  1NWZ A;  5J3W A;  4DJ3 A;  1TDG A;  3T50 A;  1NLY A;  4UAA A;  1YLZ A;  3C7V A;  3OZH A;  1RGY A;  3HUM A;  1IYO A;  2PD8 A;  4YIN A;  3ZG9 B;  2DCF A;  4B4X A;  5DFY A;  3ULF A;  2KX6 A;  4UEY A;  2Z6D A;  5L8M A;  2V1B A;  5EVI B;  2Y2P A;  4H8R A;  1NLZ A;  4NG2 A;  2R9W A;  3HVF A;  4E3O A;  2V1A A;  3G34 A;  2JHE A;  1W63 M;  3JVU A;  4HJ4 A;  3KSF A;  4X1L A;  3T1X A;  4F94 A;  2JKF A;  4ETZ A;  2NUT C;  4Q0I A;  2Q0O A;  3KX0 X;  1PRQ A;  4F3L B;  3LR3 A;  1ZKJ A;  1I5Q A;  3A3F A;  5KZH A;  3Q7Z A;  3V50 A;  3ZHH A;  2FH5 A;  2OLV A;  5FI7 A;  3MKE A;  1OTE A;  2DRW A;  1T1C A;  4WZ5 A;  4X69 A;  4AFI A;  2PRF A;  5EOE A;  3DTE A;  5J4E A;  2Y2H A;  1HTZ A;  3ZYT A;  3ICY A;  1YMS A;  4JXS A;  3UB6 A;  3OPP A;  4YWZ A;  4IJG A;  4LEN A;  2A2L A;  3QP1 A;  2WKP A;  5FI2 A;  2ZM2 A;  4A5R A;  4EBN A;  3M6B A;  4UHU A;  3UB8 A;  4R38 A;  4IUH A;  4MDZ A;  4IHQ A;  5CX7 A;  4LV1 A;  4KQQ A;  4Y0U A;  5HAP A;  3I7J A;  3KYE A;  3A3I A;  4BEN A;  3PAE A;  3EEH A;  1XA1 A;  3BLM A;  4ZBE A;  2XF3 A;  3UMD A;  3GDI A;  3GRJ A;  2ZQD A;  3DW0 A;  1N9B A;  3PHY A;  5IU1 A;  3T4K A;  2WKH A;  3KSI A;  4CJN A;  1ZHH B;  3UB7 A;  1YLJ A;  3E2L A;  4DDY A;  5GHX A;  2OV5 A;  3QNB A;  4GLQ A;  3LYX A;  1S1Z A;  2PT7 A;  4GS9 B;  2J8Y A;  3D3O A;  5MC7 A;  3BEB A;  3UDX A;  1MWS A;  1NYM A;  2CMN A;  3WS1 A;  1EWZ A;  2WGV A;  3FC7 A;  3CAX A;  5CHJ A;  5E2F A;  4E6W A;  5IHV A;  1KDW A;  1MWT A;  4MN7 A;  5J8X A;  3IF6 A;  1L2S A;  3HRE A;  5L2F A;  2QKP A;  4E3N A;  1G6O A;  1LI0 A;  5HD3 A;  2ZMV A;  4MBK A;  3N8S A;  3BLS A;  3UME A;  4ZDX A;  4OQ0 A;  2WUQ A;  3BFD A;  3V5M A;  5CGW A;  4XXR A;  5FA7 A;  2G7U A;  5EV0 A;  3CPT A;  4IBX A;  1ACF A;  3DBA A;  3VFH A;  4KG5 A;  4M4X A;  4HJ6 A;  4L9F A;  3F1N A;  4Q0H A;  1YQS A;  2X02 A;  2HP6 A;  4X53 A;  3D9Y A;  4IVI A;  4JF4 A;  3HLW A;  4X6T A;  1GHM A;  1T18 A;  5HX9 A;  1DP8 A;  4EUZ A;  1K57 C;  3CUE A;  3FYZ A;  5GLC A;  4UQI M;  1T1B A;  1Z6F A;  4PMA A;  5EFW A;  4ESP A;  2WAD A;  1GCE A;  1WE4 A;  3UNW A;  3GV9 A;  4CPK A;  5DFX A;  4R3J A;  1FR1 A;  1PWC A;  3NDG A;  3HLE A;  1IFQ A;  1I2S A;  1C3B A;  2PDR A;  2HPB A;  5F82 A;  4QHC A;  4WZ4 A;  5U47 A;  4Z1W A;  1YMX A;  4R70 A;  4FH4 A;  4KZ5 A;  4HP4 A;  3NDE A;  5HWV A;  5CRF A;  1YLW A;  3AGE A;  4HES A;  4X1M A;  4B93 A;  2V0U A;  1IYS A;  4U0T A;  3NUL A;  4P87 A;  5D3O A;  1IKI A;  1FOF A;  5A91 A;  1ERM A;  2OWH A;  3IXG A;  4FUW A;  2V20 A;  3VFF A;  2W27 A;  3CIT A;  3VSK A;  1XJ2 A;  4MMN A;  4BMW A;  4HJ3 A;  3BY8 A;  1H8Y A;  1NRF A;  4ZAM A;  1NRJ A;  4OLG A;  3OCL A;  5DTT A;  4NXE A;  3SH9 A;  1N9N A;  3C2W A;  4O01 A;  5AQ9 A;  4X56 A;  2H0T A;  1LSX A;  5KSH A;  2JN7 A;  1IKG A;  3EQU A;  2ZQ9 A;  4Y0O A;  4NEE D;  5FAT A;  2V8C A;  5DKK A;  1SHV A;  4Y17 A;  5FQK A;  2KOI A;  1BLC A;  3N4I A;  2QJ5 A;  2JCH A;  3HJI A;  1PW8 A;  2YKF A;  4S2M A;  1ES3 A;  2GNX A;  2JKG A;  1MWU A;  4I3I A;  4X55 A;  5EEC A;  2WGW A;  2XEP A;  1PI4 A;  5HL6 A;  1NJ4 A;  1CK3 A;  2X01 A;  1QMF A;  3OPH A;  3P7N A;  4CLC B;  3BY9 A;  2GX5 A;  4E3J A;  1S0W A;  2VV7 A;  5IS1 A;  3HLC A;  5HPI A;  5G4Z A;  2HP5 A;  3UB9 A;  4EWF A;  3E4P A;  5J7E A;  2EX9 A;  5TFQ A;  2WGI A;  4HP9 A;  4S2O A;  3C5A A;  2WKQ A;  1NZO A;  4HNB A;  2Y2L A;  4E3M A;  3TOI A;  1SDN A;  1BYW A;  3UE3 A;  4LRX C;  1MWR A;  3FZC A;  4N9K A;  3ZVW A;  3ITB A;  3LY3 A;  5DF8 A;  4KG2 A;  4I3A A;  3T4O A;  3RXW A;  3LCE A;  1PI5 A;  4OQH A;  5FQ9 A;  2HF6 A;  2P08 A;  3VP1 A;  3EQV A;  4BD1 A;  4C75 A;  4WMC A;  4EQ1 A;  2EXA A;  4IBR A;  2VLG A;  2PU4 A;  4CLC C;  2Y2N A;  4B88 A;  2HJ9 C;  3K2N A;  1SZV A;  4BL2 A;  5AVF A;  3MF0 A;  1KGF A;  4MBF A;  4PAU A;  5F83 A;  1VET B;  3QP2 A;  4OPY A;  5CGS A;  1PWD A;  4QPR A;  2IA2 A;  2VK3 A;  5GHY A;  1Q2P A;  4EEU A;  4EV4 A;  2MJ6 A;  2XA7 S;  1TVF A;  2HGV A;  1SDE A;  3QP6 A;  4E3I A;  2EX2 A;  1LL8 A;  3UPN A;  2Z2M B;  2XD5 A;  1E4D A;  3EGD C;  5DF7 A;  1ONG A;  3S7P A;  1G68 A;  4PM7 A;  4Y15 A;  1FSW A;  4BWI A;  4C6Y A;  1D7E A;  3IXD A;  4XUZ A;  1RGZ A;  4P0M A;  1NXY A;  2ZQ8 A;  2PBD P;  4Y2F A;  4BLM A;  4S2J A;  5FL3 A;  1ESI A;  1XX2 A;  3B3X A;  3EOI A;  4IVK A;  4WYY A;  2B02 A;  4G3K A;  4QD4 A;  3KSH A;  4FCF A;  4NK3 A;  4LV2 A;  4R1G A;  3UO9 A;  2PD7 A;  3FWL A;  3L7H A;  4HQA A;  5A93 A;  4MN5 A;  4RA7 A;  4NXF A;  4GB7 A;  2O9B A;  3VP4 A;  1ODV A;  4PM9 A;  3DAV A;  4MN6 A;  3UY6 A;  3A0V A;  4HOI A;  2V9A A;  1N9L A;  1KDS A;  3SW1 A;  2J9O A;  3S7O A;  5HFO A;  4YNR A;  1PW1 A;  1I2W A;  3NI9 A;  5I94 A;  1UWP X;  3WWX A;  2V1Z A;  2IWB A;  2WAE A;  2HZ5 A;  2ZMF A;  3QNC A;  5FQJ A;  5KSC A;  1DY6 A;  1ES2 A;  3UPP A;  3SS4 A;  5CGX A;  1BUE A;  4O8G A;  4WUJ A;  3LEZ A;  2W1T A;  4LPZ A;  3S1Y A;  1XJ3 A;  2XRO A;  4R0Q A;  3WS4 A;  3W4O A;  2BG1 A;  1AWI A;  4HH2 A;  1CI9 A;  3SH8 A;  3BQA A;  4GS9 A;  5A90 A;  3IXB A;  4N1H A;  3ZNY A;  4XUX A;  3DWZ A;  5CED A;  3VMA A;  3CUE C;  2XQZ A;  5HDD A;  4XT2 A;  1PZO A;  4E3L A;  5JYO A;  1JNU A;  4HHD A;  5FDS A;  2VZW A;  1YLP A;  3LO7 A;  4GD8 A;  3OOV A;  5I5L A;  5K5B A;  1VM1 A;  1FCO A;  4EXO A;  4K08 A;  3CJM A;  3VP0 A;  3NY4 A;  2XLN A;  2E8J A;  2O0Y A;  1JWZ A;  3O88 A;  3LIF A;  4D2O A;  4ME4 A;  4I38 A;  1P97 A;  2I72 A;  4OOM A;  4WEK A;  3TJZ C;  3LIB A;  2G2W A;  4LRY C;  4PPR A;  3WRZ A;  5KIZ A;  4JGP A;  1SKO B;  4JGQ A;  3ITA A;  1OPX A;  1FR6 A;  1K55 A;  4WEL A;  2IWD A;  4Q0J A;  3LR4 A;  3GSG A;  4JXG A;  2V2F F;  3LI8 A;  3BWL A;  3T1S A;  2QPN A;  2JBF A;  1W8Y A;  5HDS A;  3PBR A;  2XD1 A;  3OLO A;  3MKF A;  4GKU A;  5F68 A;  4LV0 A;  5E2E A;  1LSV A;  3N7W A;  3HLF A;  2I9V A;  3MQ0 A;  3LIE A;  4L9E A;  3JYI A;  2R78 A;  1TS6 A;  5FDH A;  2ZM8 A;  4CQH A;  1G6A A;  5CER A;  1OTA A;  1GSX A;  1TS0 A;  5E2G A;  4ZTK A;  3C30 A;  5HWT A;  2PYR A;  3CLO A;  3SS5 A;  1YLT A;  3VE3 A;  5EVI A;  4X68 A;  1S4S A;  2EFX A;  4LGW A;  3K3C A;  3S22 A;  3D72 A;  1ERO A;  5HZH A;  2P7J A;  4X25 A;  1K6R A;  3MXS A;  4DE3 A;  4HBT A;  1BUL A;  2O9A A;  4DXC A;  2IWC A;  2QZ6 A;  3NHQ A;  1H8Z A;  3MQO A;  3CWF A;  3UE6 A;  1ONH A;  3DTM A;  2K31 A;  4JF5 A;  3W2Z A;  2OWJ A;  4I3J A;  3FKV A;  3Q7V B;  4NET A;  1L0E A;  2QMI A;  1T1A A;  1OME A;  1MC0 A;  1BLP A;  1HZO A;  1M6K A;  1K4E A;  4BBV A;  2K2N A;  1K56 A;  2K7S A;  3PBT A;  4S2I A;  5HAI A;  3TW8 A;  3T4L A;  3LI9 A;  4HEF A;  4BBT A;  3BJN A;  3S7N A;  1MY8 A;  3T4J A;  3G4P A;  1M40 A;  3CPT B;  3OPR A;  5CTN A;  3IS2 A;  3CZD A;  5TBM A;  4ETX A;  2ZOH A;  2L1M A;  3IQA A;  3O3V A;  5AVE A;  4P6Z M;  3P01 A;  4OLD A;  5CHU A;  2OSU A;  4JF6 A;  4Y3I A;  3JVV A;  2XRN A;  2HP9 A;  1ES5 A;  1FSY A;  1WYC A;  3LID A;  4OP8 A;  2P74 A;  3H7W B;  3MZE A;  2XSS A;  3NCK A;  4KQO A;  3KYZ A;  3BYD A;  4GHI A;  1STZ A;  2M7U A;  3H82 B;  4DE2 A;  1HVB A;  3DTI A;  3UDI A;  1XJ6 A;  1YLY A;  3T12 B;  1V9Y A;  2OAP 1;  3IBJ A;  1OT6 A;  3LIC A;  4Y13 A;  4QB8 A;  1TD5 A;  4KZA A;  5IT5 A;  4N92 A;  1K56 D;  4KG6 A;  3IWO A;  2V0W A;  4R4S A;  2VA0 A;  1JWV A;  1OTI A;  5CHM A;  3ZG5 A;  4CLC A;  2HDU A;  5FSR A;  2EWV A;  3Q81 A;  1JVJ A;  1L3L A;  3JPU A;  5DTK A;  3BQ8 A;  4GN2 A;  4OPR A;  3V3R A;  3U4L P;  4KZ9 A;  3PBO A;  1VQQ A;  3G6O A;  5LBR A;  5TGF A;  1Q2Q A;  2C6W B;  1GHP A;  4MEZ A;  3BRM A;  1GSW A;  2VX8 A;  3R4K A;  1HD8 A;  3G30 A;  2Y2I A;  1JTD A;  2VEA A;  3QP5 A;  4K0X A;  1LSW A;  3LR5 A;  1TDL A;  2XFS A;  2H5S A;  2P9V B;  4C3Q A;  2Y55 A;  4JBF A;  2Z2L B;  3A3E A;  2RL3 A;  3A3D A;  2OOL A;  5KMW A;  1S6R A;  5F1F A;  1H8M A;  4ZJ3 A;  1P9W A;  2XFT A;  4G3W A;  1ES4 A;  1T19 A;  3LFV A;  3G2Z A;  1CJF A;  4NXB A;  5TJJ A;  4KUO A;  4R23 A;  3PAG A;  5FEG A;  1E3U A;  3C4P A;  5F69 A;  3GQZ A;  3ZQ5 A;  1Y4O A;  4WM9 A;  2Y91 A;  1OJG A;  3MBZ A;  4UA7 A;  1PFL A;  2VGL M;  2VV8 A;  5CXW A;  2ZJ9 A;  4II7 A;  3HLD A;  4OP5 A;  1KGG A;  3H7W A;  3EGX C;  5E2H A;  1WYB A;  1F9I A;  1PNE A;  4D60 A;  3WS2 A;  3BFG A;  3TE8 A;  2ZQ7 A;  3R7W B;  3PBN A;  4GHI B;  1KVL A;  4MCW A;  2UV0 E;  4N1X A;  1ZC2 A;  5F5Y A;  3QP4 A;  3BFE A;  3EWK A;  4KZ6 A;  3VV4 A;  1XFN A;  4QJG A;  3KYQ A;  1U60 A;  3IBR A;  3S7Q A;  2B18 A;  5HD5 A;  3BFC A;  1JTG A;  1XP4 A;  2VV6 A;  2DNS A;  3EEA A;  5L07 A;  2O99 A;  3CI6 A;  4ARZ A;  3C38 A;  2B5R A;  4S2K A;  5GHZ A;  4OPQ A;  4ZJ2 A;  1ZTU A;  1XJ4 A;  1H3Q A;  4EW7 A;  5TBM B;  1X0O A;  4WLA A;  3E4O A;  2HJE A;  3F1P A;  3ZCZ A;  5HL1 A;  4FTX A;  1K55 C;  1CEF A;  3PR6 A;  2AVX A;  4E6X A;  2A24 A;  3N6I A;  2DMW A;  4N9L A;  4RX3 A;  3HBR A;  1LL9 A;  3OBF A;  3G32 A;  4S2N A;  3IX3 A;  3MSH A;  2PBY A;  1XXM A;  3O5Y A;  1FIL A;  2WZZ A;  2XR0 A;  3MFD A;  1YM1 A;  3LGO A;  2ZL1 B;  4G3V A;  4UQI S;  3H82 A;  1Y54 A;  2WGW B;  2L0W A;  4DKI A;  1EW0 A;  2GDN A;  1FQG A;  3Q82 A;  5AJG A;  2J7V A;  1WA9 A;  1SCW A;  2Y59 A;  3M2K A;  3UE0 A;  3GMW A;  1Y28 A;  3UE1 A;  3W4Q A;  1S1Y A;  1F98 A;  2J3T D;  2VKS A;  2BTF P;  2ZC7 A;  5GLB A;  2V8F A;  5M19 A;  2M7V A;  1VEU A;  3Q7V A;  1DRM A;  5EVL A;  4KZ8 A;  1LT0 A;  3MXQ A;  2JKR I;  3QP8 A;  3P98 A;  4JXW A;  1F5M A;  2EFU A;  4S2N C;  3H9W A;  2HDR A;  5EE8 A;  5HW3 A;  1LI9 A;  3KSG A;  1IYP A;  5F6A A;  1H5X A;  5FEF A;  3TG9 A;  1RP5 A;  1XGI A;  2WK0 A;  2W3E A;  5AQ7 A;  4B9O A;  4L9G A;  2H0Y A;  3FPW A;  1TS8 A;  4OON A;  3OPL A;  3RH8 B;  3MZF A;  4EER A;  3ZDJ A;  3RXX A;  2BAS A;  5AQB A;  1CEG A;  3O87 A;  4OPZ A;  3SZT A;  3VP2 A;  2J3W A;  5FAS A;  4NXG A;  3V3S A;  3ZG0 A;  3GR2 A;  3LY4 A;  1KVM A;  5DVA A;  1OTD A;  3IWQ A;  1K57 A;  3O86 A;  4L0L A;  3G31 A;  2OLU A;  4LFU A;  5CEC A;  3N8L A;  1SKF A;  2EX8 A;  2D02 A;  3IH9 A;  3E98 A;  4JLF A;  1NYY A;  1MKM A;  3UB5 P;  2WAF A;  1DP9 A;  2J9P A;  2Q9N A;  1IYQ A;  3PYP A;  2M1C A;  1MXO A;  3A0S A;  1XKZ A;  4O0P A;  3NBL A;  3R7W A;  3C7U A;  1DJA A;  3LIA A;  4PM6 A;  1XFQ A;  1UGU A;  4DXB A;  5HDC A;  2VGJ A;  1K4F A;  5FQI A;  4KQD A;  4JXV A;  1A0K A;  3N8R A;  1ZG4 A;  4OVD A;  4WL9 A;  4BQM A;  2J3T C;  2EA9 A;  3NC8 A;  3E2K A;  4ZJ1 A;  1RCJ A;  5HSQ A;  1XPB A;  2X71 A;  1J3W A;  1G28 A;  4PKY G;  4KEN B;  4GW9 A;  4ARZ B;  4WF0 A;  4DRT A;  3F1O B;  2HDS A;  3WS5 A;  1NY0 A;  5GL9 A;  1CF0 A;  3HLB A;  5F1G A;  1PZP A;  3CHW P;  3PTE A;  1D1J A;  4Y5F A;  4HH3 A;  4FD8 A;  4GD6 A;  1KE0 A;  3HUO A;  3IWI A;  2ZLY A;  1OTB A;  3IS2 B;  5M18 A;  2YKH A;  1BSG A;  5EVI D;  4Y7P A;  1FCN A;  4R6L A;  3HLG A;  3NOU C;  4MNR A;  5EM0 A;  4GJ4 A;  4O7D A;  3A3J A;  3HJK A;  1W7F A;  4I39 A;  1KE4 A;  4U3T A;  1ZG6 A;  3GTC A;  3T1R A;  2ZQC A;  2L4R A;  4KZ4 A;  5G4Y A;  3Q1F A;  4P85 A;  1TS7 A;  3FPV A;  3Q07 A;  1ERQ A;  5L10 A;  2Y8H A;  4EU0 A;  4OOY A;  4DMZ A;  2FZ0 A;  1GA0 A;  1W63 Q;  1MPL A;  1MKI A;  4EUV A;  3IX4 A;  4S2L A;  5A8B A;  2D01 A;  1BLS A;  1YAX A;  5C5K A;  3D4F A;  1BT5 A;  1FCM A;  4EET B;  2XK1 A;  3C4O A;  4JKT A;  2KLI A;  2B95 A;  4BL3 A;  4PM8 A;  4PHT A;  3VOY A;  2HV1 A;  4KZB A;  1H0M A;  1E3U D;  5TR7 A;  4WBG A;  2QYB A;  4UA6 A;  2GZA A;  3K3D A;  5EVE A;  1CI8 A;  3RTY A;  2JKR M;  1O07 A;  2XDM A;  1IEL A;  4P6Z S;  4RQ9 A;  3RFB A;  4DF6 A;  4DE0 A;  2EWW A;  1XGJ A;  3BW6 A;  2G2U A;  1DP6 A;  1S66 L;  3MR0 A;  3HL9 A;  1AXB A;  4YOF A;  3UN7 A;  4GCZ A;  2VGK A;  3PBQ A;  2ZL1 A;  2R9X A;  4FH2 A;  4K91 A;  4LRZ E;  3PBS A;  1UWN X;  3MFX A;  3B47 A;  1YSP A;  3FV7 A;  3OC2 A;  2WKI A;  3IH8 A;  4IED A;  2INW A;  3FG8 A;  3VE4 A;  3VP3 A;  1ESU A;  4BBU A;  4QY6 A;  4H6J A;  1LL5 A;  4JGO A;  3LUQ A;  3NOP C;  4K0W A;  4OQI A;  5EUA A;  1CQA A;  3IXH A;  4P6B A;  3E4Q A;  3MZD A;  3NEC A;  1KE3 A;  1VEU B; 
#chains in the Genus database with same CATH homology
 3EWK A;  4NKP A;  2FH5 A;  2PD7 A;  3VV4 A;  4HQA A;  1XFN A;  4MN5 A;  2H28 A;  4EES A;  3KYQ A;  1OTE A;  3T4Q A;  1T1C A;  4AFI A;  3IBR A;  3S7Q A;  4F3L A;  4NXF A;  3F1P B;  2O9B A;  1OJ5 A;  1ODV A;  2B18 A;  5HD5 A;  4DN0 A;  5J4E A;  4JGR A;  4MN6 A;  2VV6 A;  3EEA A;  3ZYT A;  3A0V A;  3ICY A;  2O99 A;  3UB6 A;  3CI6 A;  3NOT C;  4ARZ A;  3C38 A;  4HOI A;  4YWZ A;  2V9A A;  1N9L A;  4IJG A;  2A2L A;  3SW1 A;  1ZTU A;  2WKP A;  1XJ4 A;  1H3Q A;  3S7O A;  4EW7 A;  4YNR A;  5TBM B;  1X0O A;  4WLA A;  3E4O A;  1UWP X;  2HJE A;  2W0N A;  4I5S A;  3F1P A;  3UB8 A;  4R38 A;  4IUH A;  4MDZ A;  1GSV A;  2ZMF A;  3PR6 A;  4IHQ A;  5CX7 A;  2A24 A;  2QHK A;  2DMW A;  4O8G A;  4WUJ A;  3EEH A;  2W1T A;  4LPZ A;  3OBF A;  1XJ3 A;  3T4S A;  2XRO A;  2VJW A;  3O5Y A;  2XA7 M;  2J80 A;  3UMD A;  3GDI A;  4HH2 A;  3BQA A;  4GS9 A;  3MJQ A;  3PHY A;  4G3V A;  4UQI S;  2A24 B;  5IU1 A;  3H82 A;  1V9Z A;  3CUE C;  5HDD A;  4XT2 A;  2WKR A;  3T4K A;  3KSI A;  1ZHH B;  2L0W A;  3UB7 A;  1JNU A;  4HHD A;  4GLQ A;  1EW0 A;  2VZW A;  3LYX A;  1S1Z A;  2PT7 A;  4GS9 B;  3OOV A;  5I5L A;  3D3O A;  5K5B A;  5AJG A;  1WA9 A;  4EXO A;  5MC7 A;  1P9R A;  4K08 A;  1Y28 A;  3GEC A;  1S1Y A;  1F98 A;  2J3T D;  2VKS A;  5HPF A;  5DJT A;  2O0Y A;  2CMN A;  2M7V A;  3LIF A;  1DRM A;  4ME4 A;  1LT0 A;  3MXQ A;  2JKR I;  4HIA A;  1P97 A;  3FC7 A;  4I38 A;  3CAX A;  3E0Y A;  2NUP C;  3VOL A;  4OOM A;  4WEK A;  3LR0 A;  3TJZ C;  1F5M A;  3LIB A;  1D06 A;  4FSF A;  4MN7 A;  3H9W A;  1OT9 A;  4LRY C;  5KIZ A;  3KSG A;  4JGP A;  4JGQ A;  2QKP A;  5F6A A;  3F1N B;  1OPX A;  1G6O A;  5HD3 A;  2ZMV A;  3UME A;  4WEL A;  2W3E A;  4Q0J A;  3LR4 A;  4B9O A;  3B33 A;  4L9G A;  2G7U A;  3FPW A;  4BJP A;  3F1O A;  1TS8 A;  3LI8 A;  2ZBB A;  3BWL A;  3RH8 B;  4EER A;  3DBA A;  5HDS A;  2W3H A;  3PBR A;  1P0Z A;  5HWW A;  4M4X A;  2BAS A;  4HJ6 A;  4L9F A;  2PR6 A;  3OLO A;  2ZOI A;  3F1N A;  4Q0H A;  2J3W A;  5F68 A;  4NXG A;  4DJ2 A;  1LSV A;  2W1R A;  4WN5 A;  2I9V A;  3MQ0 A;  3LIE A;  4L9E A;  1N9O A;  2PYP A;  2R78 A;  1TS6 A;  2P04 A;  1T18 A;  1DP8 A;  1OTD A;  4L0L A;  4CQH A;  3CUE A;  4E04 A;  5DJU A;  4UQI M;  1OTA A;  2PHY A;  1GSX A;  1T1B A;  1TS0 A;  5EFW A;  2D02 A;  3C30 A;  5HWT A;  3E98 A;  2PYR A;  2LB9 A;  3CLO A;  3VE3 A;  1S4S A;  1MKM A;  3K3C A;  3D72 A;  1DP9 A;  5DFX A;  5HZH A;  2P7J A;  3NJA A;  1IFQ A;  3PYP A;  2M1C A;  2O9A A;  3A0S A;  3NHQ A;  1KOU A;  3MQO A;  4O0P A;  2GJ3 A;  1TF1 A;  2PDR A;  3CWF A;  3R7W A;  3UE6 A;  3LIA A;  1XFQ A;  4Z1W A;  1UGU A;  2K31 A;  4R70 A;  3PXP A;  5HDC A;  4HP4 A;  3W2Z A;  2OWJ A;  4I3J A;  4KQD A;  4PKY A;  5HWV A;  4WEJ A;  2KDK A;  1T1A A;  4B93 A;  2V0U A;  1MC0 A;  3T4T A;  4BBV A;  4HY8 A;  4WL9 A;  2K2N A;  2OWH A;  2J3T C;  2K7S A;  2EA9 A;  3PBT A;  2W3G A;  3TW8 A;  2W27 A;  3CIT A;  3T4L A;  1XJ2 A;  3LI9 A;  5HSQ A;  1G28 A;  4MMN A;  4PKY G;  4BMW A;  4HJ3 A;  4BBT A;  1MZU A;  3BY8 A;  4GW9 A;  4ARZ B;  3BJN A;  4WF0 A;  3S7N A;  2QJ7 A;  4FOF A;  1NRJ A;  3T4J A;  3F1O B;  3OCL A;  4NXE A;  2OAQ 1;  4CLC D;  1N9N A;  2QWS A;  3C2W A;  4O01 A;  3IS2 A;  5TBM A;  4R3A A;  4ETX A;  2ZOH A;  3KO6 A;  4OOL A;  1LSX A;  2L1M A;  5KSH A;  2PR5 A;  2JN7 A;  4IUK A;  5AVE A;  4P6Z M;  3P01 A;  3EQU A;  4Y5F A;  4HH3 A;  3B42 A;  4Y3I A;  2W1T B;  5DKL A;  3C8C A;  4NEE D;  3JVV A;  2XRN A;  2Y79 A;  5DKK A;  3U2A A;  2KOI A;  2VGL S;  3V67 A;  3LID A;  2QJ5 A;  3HJI A;  1OTB A;  3IS2 B;  3H7W B;  2YKH A;  2YKF A;  2W3D A;  2XSS A;  2GNX A;  4R6L A;  4I3I A;  3NOU C;  3MQQ A;  4KQO A;  3KYZ A;  4GJ4 A;  4ZRR A;  4XT2 B;  4GHI A;  1STZ A;  2M7U A;  3HJK A;  3H82 B;  5HL6 A;  4KUK A;  2LB5 A;  4I39 A;  1VB6 A;  1S4R A;  3P7N A;  4CLC B;  3BY9 A;  1XJ6 A;  2GX5 A;  1V9Y A;  2OAP 1;  2VV7 A;  5IS1 A;  3IBJ A;  5HPI A;  5G4Z A;  1OT6 A;  3LIC A;  2Z6C A;  3UB9 A;  2L4R A;  2W3F A;  1TD5 A;  5IT5 A;  5G4Y A;  3E4P A;  1IOU A;  2V0W A;  2VA0 A;  5J7E A;  1TS7 A;  3FPV A;  5DF9 A;  4H6J B;  1OTI A;  4HP9 A;  3TRC A;  2Y8H A;  4EU0 A;  2WKQ A;  4HNB A;  4CLC A;  4DMZ A;  2FZ0 A;  2EWV A;  1W63 Q;  4EEP A;  3HCY A;  3BQ8 A;  1BYW A;  3MMH A;  3UE3 A;  1S67 L;  4EUV A;  4LRX C;  1VHM A;  1YKD A;  5A8B A;  2D01 A;  2O9C A;  3PBO A;  3G6O A;  5LBR A;  3A0R A;  1YAX A;  5C5K A;  2JKT I;  4I3A A;  3T4O A;  1GSW A;  2VX8 A;  4EET B;  3R4K A;  2KLI A;  1YSQ A;  3OCN A;  2VEA A;  4LLO B;  4PHT A;  2HF6 A;  2P08 A;  3EQV A;  2HV1 A;  1LSW A;  2JKT M;  3LR5 A;  4EQ1 A;  2VLG A;  4HI4 A;  4CLC C;  4CLC E;  1NWZ A;  2QYB A;  5J3W A;  2HJ9 C;  3K2N A;  4DJ3 A;  2GZA A;  5AVF A;  2OOL A;  3MF0 A;  3K3D A;  3T50 A;  1H8M A;  1NLY A;  3RTY A;  4PAU A;  1P9W A;  2JKR M;  4G3W A;  1T19 A;  3LFV A;  4P6Z S;  4NXB A;  4RQ9 A;  5TJJ A;  3RFB A;  4KUO A;  4QPR A;  2IA2 A;  2EWW A;  2PD8 A;  3BW6 A;  1DP6 A;  1S66 L;  3MR0 A;  5DFY A;  4EEU A;  3ULF A;  2KX6 A;  4UEY A;  5F69 A;  4YOF A;  2MJ6 A;  2XA7 S;  2Z6D A;  4GCZ A;  5L8M A;  3PBQ A;  3ZQ5 A;  2HGV A;  2V1B A;  4LRZ E;  1NLZ A;  1UWN X;  3MFX A;  3PBS A;  3B47 A;  1LL8 A;  1YSP A;  1OJG A;  2V1A A;  2VGL M;  3OC2 A;  2VV8 A;  3EGD C;  4II7 A;  3S7P A;  2INW A;  3H7W A;  3EGX C;  2JHE A;  3FG8 A;  3VE4 A;  1W63 M;  3JVU A;  4BWI A;  4HJ4 A;  1F9I A;  1D7E A;  3KSF A;  4BBU A;  3TE8 A;  3R7W B;  3PBN A;  4Y2F A;  4H6J A;  4GHI B;  2NUT C;  5FL3 A;  4ETZ A;  4Q0I A;  3EOI A;  3KX0 X;  4JGO A;  4F3L B;  3LR3 A;  4MCW A;  3LUQ A;  2B02 A;  3NOP C;  4G3K A;  3KSH A;  5F5Y A;  3E4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...