1H3QA

Crystal structure of sedl at 2.4 angstroms resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
MSGSFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFDRKVQFLGKKHLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEDLIN
publication title Crystal Structure of Sedl and its Implications for a Genetic Disease Spondyloepiphyseal Dysplasia Tarda
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport
total genus 37
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2002-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04628 Sedlin_N Sedlin, N-terminal conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.70 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1h3qA00
2J3TC 2J3TD 3PR6A 2ZMVA 3CUEA 1H3QA 2J3WA 3CUEC
chains in the Genus database with same CATH superfamily
1VHMA 2XH9A 3NC8A 4KZ5A 5HL6A 4DDSA 1LL9A 1NYYA 4EU0A 1IYQA 2PAVP 2QWSA 3UB8A 4R6LA 3DW0A 4F3LA 3WS5A 3E2LA 3IBRA 1W8QA 3QNCA 4GDBA 1YPRA 3DTIA 5HAQA 3O5YA 5GL9A 2O0YA 4LFUA 4P0MA 3SH8A 3VV4A 4FCFA 4KZ6A 4RX2A 4MMNA 4E04A 1K54C 2O9BA 1H5XA 5HW3A 2ZJ9A 2AVXA 5EVIA 3WS1A 1BLHA 4GS9A 1YQSA 1HD8A 3BY8A 1VEUB 2ZMAA 4HP4A 2CC1A 3BECA 4LV2A 1BT5A 1NJ4A 4LGWA 3Q82A 4FSFA 3BRMA 1DJBA 5TBMA 4IUHA 1ZHHB 4EETB 3VFHA 4WELA 4RVAA 1ES5A 4CPKA 2W27A 2BTFP 5G4ZA 2H10A 3IXHA 4EEUA 3LFVA 3DAVA 4X68A 1JVJA 1P97A 4PKYG 3CPTB 4ZAMA 2PT7A 3GMWA 4X53A 3S7PA 4D2OA 3LIEA 4WYYA 4IBRA 3VP2A 3VOZA 4HIAA 2HDUA 4KZ7A 3UE0A 5HWVA 4PM6A 5J3WA 2IWCA 4GZBA 3T4LA 1K54A 2I9VA 1PI4A 5DF8A 3MKFA 1V9YA 3UNWA 2Y2HA 4MN7A 5DTSA 4KQOA 1NWZA 4ZJ2A 4BMWA 4QWOA 4XUZA 2XDMA 4DF6A 3QP4A 3T1XA 3AGFA 5U47A 4ARZA 4LV1A 5AQ7A 4JGOA 2EX8A 2QZ6A 3P7NA 5GHYA 3O86A 4LV3A 1UGUA 3LGOA 1K56D 3NIAA 1N9LA 3MZEA 3Q07A 1DY6A 1JWVA 2K31A 4QJGA 2HDSA 2Y2PA 5GLAA 1XX2A 4OPYA 3HUNA 2FZ0A 5HD3A 4Y15A 4OPRA 4YOFA 4X25A 1VM1A 5F83A 1G5UA 1N4OA 1PWGA 4KENB 4N92A 3KSFA 3S1YA 1YLYA 2V8CA 4ZJ1A 3DWZA 4BQMA 3V39A 4ID4A 4JGRA 5JYPA 2VLGA 3JYIA 3ZCZA 2V0WA 2WZZA 2O9CA 4JXGA 5FI7A 4ZRRA 3PXPA 3BLMA 3MZDA 3FG8A 1PIOA 3GVBA 1JTGA 3SS5A 1TDLA 4EUZA 2JE5A 2VV8A 2WKQA 2QMIA 3F1NA 3F1OB 3BLSA 3N7WA 3GRJA 4UA9A 3IXBA 2ZL1B 4Y5FA 1NLYA 1KGGA 4X1MA 3N8LA 1C3BA 1DRMA 4MN5A 3HL9A 4S2KA 1BSGA 5L09A 1KGEA 1WYBA 4JKTA 2V1ZA 3KYZA 2R78A 3N8SA 1PZPA 4YNRA 3QHYA 3A3FA 1MY8A 1XJ6A 5DKKA 1PWDA 1WYCA 3T4QA 4R1GA 1DP6A 3NY4A 4EQIA 2ZMFA 1K25A 5A93A 4G3WA 2H0YA 3EEAA 4M3KA 1E4DA 1NXYA 2B5RA 3E0YA 2PU4A 3ZYTA 4GLQA 1OTDA 3ITBA 4H6JB 4JXVA 3PBNA 3T12B 3ZNYA 3HLGA 3D9YA 3B3XA 3HCYA 1ERMA 5HARA 4GD8A 3VMAA 1LL8A 2EXAA 4QHCA 2J80A 4F3LB 2OAP1 4UQIM 3IT9A 1OJGA 1L3LA 2Y2IA 5EFWA 5DKLA 4OLGA 2BLSA 5G4YA 3UB6A 4MLLA 4Q8IA 2ZD8A 3LUQA 4Y13A 3UPOA 5AVFA 4R4SA 5FEGA 2ZBBA 5GLDA 5EVIB 2EWVA 4GS9B 1Y4OA 1YMXA 4HHDA 4DXBA 4LCMA 4FD8A 1K57C 3LCEA 3MXRA 3BM6A 5FQMA 3MJQA 2W1RA 1ZKJA 2JBFA 5TBMB 2VEAA 3T4TA 1PNEA 1MWUA 3IF5A 3UE3A 5I94A 4HH3A 2HDQA 2JKTI 4Q0IA 1S67L 1UWNX 3CLOA 1EWZA 3G35A 4OQGA 3SW1A 4DJ3A 5L10A 4HQAA 3VSLA 5DF7A 4NXFA 2XLNA 3NOPC 4JBFA 1VETA 5EOEA 4Y7PA 1BZAA 3IWOA 3IHAA 2K7SA 4LRXC 3W8KA 1XJ3A 3LIBA 2Z6DA 3HLEA 3UMDA 2WGIA 4HI4A 3NULA 4PM5A 5CXWA 1K57A 2P08A 2RL3A 5GLBA 4ARZB 2UWXA 1RP5A 4GCZA 2J3WA 3RJUA 3CUEC 2KDKA 3BEBA 1W8YA 5F82A 2G7UA 5HAPA 3UN7A 1YMSA 5HDSA 2EWWA 3QP2A 4HOIA 2P9VA 3NHQA 5FEFA 4IVIA 2QPNA 2V0UA 3VFFA 4R3BA 1TDGA 2D01A 2G2UA 4LCLA 2Y2JA 3C7VA 1CK3A 5E2EA 1KDSA 2GX5A 3ISGA 3LYXA 4IVKA 4DE0A 3UB5P 4UQIS 3LI9A 5FSRA 1CEGA 2HP6A 2GNXA 5M1AA 1P9WA 1CQAA 3S4XA 4ME4A 3Q1FA 2C6WB 3UPNA 4WMCA 3FV7A 2BASA 3VP3A 3M6HA 2JKTM 2D02A 1HVBA 1ONGA 2ZC6B 5AJGA 3HVFA 5J4EA 3CI6A 5IS1A 2PBDP 4DXCA 3F1NB 3MBZA 1N9BA 4ETXA 2QYBA 3CUEA 2J7VA 1MC0A 4I3AA 4N9KA 5J7EA 3ZHHA 4K91A 4OP8A 1YLZA 2IA2A 3HJIA 5FQKA 2WADA 3PR6A 2L1MA 2JKRI 5D3OA 4Y3IA 1T1BA 3KYQA 3MSHA 2OWHA 3T1SA 3OPLA 4I3IA 2ACGA 3RFBA 3UY6A 1IELA 1GSXA 5G18A 3HLDA 1PFLA 4MN6A 4F94A 1D1JA 5FAOA 1EROA 4A5RA 2HV1A 4GKUA 1IYSA 4MBFA 4EWFA 1KE3A 2PBYA 1F9IA 1ZC2A 4MDZA 1FCNA 3UB9A 2ZOHA 4C3QA 4CLCE 1KGFA 1FIKA 3LEQA 4UHUA 1J3WA 1Q2PA 2Y91A 2WKHA 1BYWA 1OTEA 4R23A 2B18A 3ZG7B 4WZ5C 4P87A 2V2FF 2DRWA 1MBLA 3K3DA 1D06A 1DJCA 1E25A 1LI9A 4ZBEA 3IWQA 3NBLA 5F1FA 3T1QB 1LI0A 2DCFA 4MBKA 4FH2A 1L2SA 3IH9A 3O3VA 3C8CA 2PYPA 2XSSA 4S2LA 4HJ6A 3MXQA 5CEDA 1NYMA 4PM8A 1K56A 1GCEA 2Y2GA 2PU2A 1T1AA 5CGSA 2O9AA 3D4FA 1YSQA 1M40A 3KSGA 3VSKA 3NECA 3DTMA 5CTMA 4K08A 4Y0OA 4U3TA 5DFYA 2XD1A 2JKFA 2OV5A 1GHIA 2KX6A 3P09A 3IF6C 2WGWA 5GHXA 5FDHA 3HLCA 2EX6A 2JN7A 2JKGA 2VKSA 3G4PA 4R38A 2OLUA 4X69A 4ZDXA 2BG1A 1BLCA 2WAEA 4WZ5A 2JKRM 3A3IA 2PD8A 4R3JA 3OCNA 5L07A 2PD7A 3H7WA 2W1TA 2A2LA 1VETB 3EEHA 3IH8A 1YLPA 1RGYA 4IEDA 5EVLA 4BL2A 3NCKA 4KG6A 2X71A 1HLUP 5FQQA 4JF4A 2W3HA 5GHZA 4EBPA 1YT4A 4GN2A 2EXBA 3CG5A 4X56A 5HAIA 4LV0A 1SDEA 4KQDA 3AGEA 1S1YA 3EQUA 2E8JA 2B02A 1J9MA 3CZDA 2WYXA 2YKHA 3L9KA 4X55A 2L0WA 3K3CA 2Y2KA 1LHYA 4KG5A 5F68A 3EGDC 2Q9NA 3GTCA 3IF6A 2OSUA 2P9VB 2FH5A 4RA7A 4NEED 2M7VA 2VX8A 3MKEA 2QKPA 3QP6A 3T4SA 4EQ1A 3VE3A 3MFXA 1Y28A 3MQOA 3OZHA 3IWIA 4C6YA 5L8MA 4E6XA 4MNRA 3T50A 1NRFA 4R0QA 5EPHA 3V50A 3MXSA 3TOIA 3TW8A 1FCMA 3PBRA 1BLPA 2GDNA 2Y55A 3ICYA 4UAAA 5CEBA 1ESUA 3G6OA 4WF0A 3M2JA 1W63Q 2J8YA 3LR0A 2ZM8A 2QJ7A 5F6AA 3C7UA 1OTBA 4HNBA 2W3FA 3EGXC 1TS7A 1G28A 3T4KA 4PKYA 2H5SA 3PYPA 1DP9A 3R7WA 5FAPA 2XF3A 3H82A 4S2OA 4EEPA 2ZQCA 3IXGA 4NXBA 5EVEA 5EOOA 3C30A 3BW6A 3GR2A 1ALQA 2PDRA 3HBRA 4LRZE 1OPXA 3HLFA 2XGNA 3E2KA 3QP1A 2WKEA 3WWXA 1ESIA 3NOUC 1FR6A 3EWKA 1AWIA 5IU1A 1K4EA 5FL3A 1I2WA 1L0FA 3O87A 3IS2A 3GECA 5HX9A 4EBNA 4QPRA 2WUQA 5F5YA 1MKMA 4PPRA 1L0GA 3IX8A 4S2NC 1FSYA 3WS2A 2VGLM 4NKPA 4JGQA 3GQZA 2VV6A 4CJNA 4OP5A 5FDSA 1XA7A 4WN5A 4OQ0A 1DJAA 2DNSA 4Q0HA 3ZG9B 2XQZA 4KG2A 5HDDA 2ZC5B 4OPQA 4S2JA 1K38A 3FKVA 2HGVA 1CI9A 4I39A 1VQQA 3OC2A 4OQIA 3RH8B 4O0PA 4Y2FA 4S2IA 3LEZA 3V5MA 2Q9MA 3QP8A 4DE1A 5HZHA 3MMHA 5DFXA 3C4PA 4QY5A 1IKIA 5FQJA 4XXRA 1OTIA 3G30A 1SZVA 3G2YA 1O7EA 2ZM0A 5E2GA 3VOYA 4MEZA 4C75A 1IKGA 1S66L 3HLBA 4EERA 2J9PA 4II7A 4WLAA 3WRTA 4O01A 5CX7A 4BLMA 3PTEA 1KE4A 3TE8A 4NK3A 3N4IA 4QB8A 4DE3A 1LT0A 2W0NA 4WM9A 4CLCC 1N9NA 3V3RA 5BOHA 3LO7A 4S2NA 1IFQA 1LLBA 3UMEA 2R9XA 2HDRA 2VJWA 5FQIA 5FA7A 4U0TA 1FR1A 2QJ5A 3H9WA 3NOTC 2ZLYA 3SH9A 3B47A 1YKDA 2WGWB 1BLSA 1KVMA 3OCLA 1FILA 1NZUA 4BBUA 3VE4A 1TS6A 4WL9A 3ZG0A 1ODVA 4GNUA 4G3KA 3RTYA 2Y2LA 3H7WB 2W1TB 3SS3A 2H28A 2A3UA 1GHMA 4E3KA 3LR3A 2MJ6A 1ZTUA 5DJTA 3UO9A 3W4OA 1PRQA 3CJMA 1WA9A 3M2KA 2Y79A 2ZMVA 2XA7S 1UWPX 3Q7ZA 1OMEA 3MFDA 1S4RA 4E3IA 2XEPA 4CLCA 3GDIA 4BD0A 4BWIA 4DJ2A 1YAXA 5FQ9A 1LL5A 3NJAA 4NXGA 5DTKA 4UA6A 2VK3A 3FZCA 3IF6B 3QP5A 2J9OA 4FUWA 3MZFA 1S0WA 2VGJA 2VGLS 3BQ8A 4NXEA 4OH0A 4U0XA 1XKZA 4R70A 1MWRA 3VP1A 1E3UD 2B95A 3PAEA 3W4PA 4Y17A 4DE2A 1GHPA 2QHKA 1SKOA 4KZ8A 1S1ZA 4GW9A 4XT2A 2FFYA 1H8MA 5F69A 3S7QA 1KOUA 2PHYA 3G2ZA 3LR5A 3R7WB 1AXBA 3A0SA 1H3QA 1K55C 4MBHA 3H82B 4YWZA 5DJUA 3WS0A 3Q81A 2IWDA 4EXOA 2E8IA 4KZBA 3BYDA 2EA9A 1YSPA 4GHIA 1RGZA 4BBTA 1XFNA 3TJZC 5HWWA 4GD6A 1FSWA 2PR6A 4XUXA 1PZOA 2Y2NA 3DTEA 4Z1WA 1BUEA 3S22A 4KZ9A 4GB7A 4OQHA 4EESA 3IS2B 3CAXA 3G34A 1A0KA 3G31A 2V1BA 2PRFA 3C5AA 3LIDA 2EFXA 2WZXA 4HBUA 4Z9QA 1M6KA 4L9GA 2YKFA 4RX3A 5TGFA 1K55A 5KZHA 2Y2MA 2A49A 4HESA 1SDNA 1W63M 3NI9A 2V1AA 3S7OA 1FCOA 1XJ4A 2XD5A 1XPBA 5KIZA 3HUMA 1KVLA 5F1GA 3LIFA 1HTZA 4E3JA 3VP0A 4JGPA 4LRYC 4AFIA 2CMNA 4B88A 4YINA 4B4XA 2HF6A 1YLTA 5J8XA 1SCWA 3CMZA 4KUKA 3ZG8B 2HPBA 3MQ0A 1KDWA 2GJ3A 4S2MA 4I38A 4Y0UA 5AQBA 2Y4AA 2IWBA 3OPRA 2LB9A 3BY9A 2L4RA 5M19A 3JVUA 3TG9A 4B4ZA 1Z09A 2W3DA 4PM9A 3C2WA 4L0LA 5HD5A 3IHBA 5EECA 1WE4A 5FASA 4P6BA 1H8ZA 4BL3A 1L0EA 3A3EA 4O7DA 4PM7A 1CJFA 3WRZA 3N6IA 1P9RA 4JF6A 1PW1A 4PAUA 3ZGAB 1JTDA 4PHTA 3E4OA 3JVVA 2W3GA 4OLDA 1IYOA 4D60A 4MCWA 3M6BA 5IT5A 3W4QA 3I7JA 3PAGA 1CI8A 3R4KA 3UPPA 1Z6FA 4WEJA 5CGWA 4LENA 3GSGA 3UDFA 2HP9A 4OOMA 2HP5A 1BTLA 2K2NA 4I3JA 3PBOA 4I5SA 3RXWA 3KO6A 4HP9A 3AGDA 4CLCB 4WMCD 2R9WA 2A24B 1GSWA 4M4XA 5HSQA 4JLFA 5DF9A 1IYPA 2WK0A 2I72A 5DVAA 4NETA 1PI5A 2VGKA 3OPHA 1H0MA 5FI2A 1ERQA 2HJ9C 3ZNTA 2VA0A 4R4RA 1F5MA 2PYRA 4E6WA 1W79A 1K6SA 4N9LA 3SOIA 2XK1A 2XROA 2OWJA 1ZG6A 2VV7A 5L2FA 1YM1A 5TR7A 1SKOB 4ZJ3A 1RCJA 4L9EA 2V20A 3HJKA 4XT2B 3UE1A 1TS0A 3ZFZA 1I5QA 4HEFA 1IOUA 2WKRA 3HLWA 1OT6A 1STZA 3ZDJA 4IUKA 4KZ3A 4BJPA 4ETZA 4LLOB 5EUAA 4WEKA 3PBTA 4GHIB 4BBVA 3B33A 1MWTA 3D72A 5AVEA 5HL1A 1MXOA 3PBSA 5FAQA 1P0ZA 2JHEA 2XFSA 3E4QA 4IBXA 4HH2A 4WUJA 5GLCA 2WGVA 3DBAA 1G6AA 3C38A 3UE6A 3T4OA 3JPUA 2ZOIA 3LR4A 3ZVWA 3E4PA 2RCXA 1K0KA 1BULA 2W3EA 1PYYA 2O99A 2V9AA 5CGXA 4BENA 1PW8A 2NUTC 1FOFA 3F1PA 5KSCA 4E3NA 2OLVA 3HREA 5A90A 2JC7A 3MQQA 3LICA 2C5WB 2XA7M 1NRJA 5CECA 2J3TD 2EX9A 1MPLA 5IHVA 5I5LA 3RXXA 1L0DA 2WAFA 4B93A 4JXSA 1OJ5A 3Q7VA 5C5KA 1XFQA 5EM1A 1QMEA 5EVID 3W2ZA 2Y8HA 1SHVA 3A3JA 4IHQA 4H8RA 5CHJA 4OVDA 1ONHA 5TJJA 1LSXA 2NUPC 1XP4A 2OAQ1 3LIAA 4R3AA 3DTKA 2Z2MB 3ZG5A 1XGIA 3T1RA 4O8GA 3EOIA 3A0VA 3BFGA 3KSIA 4HJ3A 1DP8A 2X02A 1F98A 3SS4A 3BQAA 2M7UA 2P7JA 4OOLA 1E3UA 3V67A 4P85A 4KUOA 4QU3A 1W7FA 2WKPA 1H8YA 5M18A 4WBGA 3CHWP 1CF0A 1MZUA 1MWSA 1GA0A 5A8BA 3A3DA 5KMWA 3KX0X 4FH4A 3OBFA 4WZ4A 2HZ5A 4OONA 2JCHA 4N1XA 2EFUA 3ZQ5A 2KLIA 3HUOA 3UDIA 4K0XA 1JWPA 1D7EA 5MC7A 4P6ZM 5KSHA 2ZQ9A 3UB7A 3D3OA 5CHMA 2XRNA 3UDXA 2OOLA 2ZQ7A 1N9OA 4DDYA 3SZTA 1HZOA 1O07A 1K4FA 5JYOA 2ZQ8A 2XFTA 3GV9A 2X01A 5K5BA 3IXDA 5EV0A 4B9OA 1T1CA 3V3SA 5E2HA 1W5DA 1JWZA 2XR0A 4E3MA 3B42A 1JNUA 5A92A 3BWLA 4EV4A 3C4OA 1YLJA 4ZTKA 5TFQA 3U2AA 1NLZA 1YLWA 3N8RA 3TRCA 1QMFA 2A24A 2KOIA 5A91A 3DWKA 3OLOA 1ES3A 1TD5A 3A0RA 1TS8A 2PR5A 1T19A 1OTAA 4HJ4A 3CWFA 4JPMA 1VEUA 4JXWA 1EW0A 3FC7A 1ZG4A 3ULFA 4KQRA 2V8FA 1IEMA 3BFFA 4HBTA 1G6OA 5EE8A 4UA7A 2Y2OA 1XGJA 4GOGA 3K2NA 2DMWA 3FKWA 4YFMA 1XA1A 4E3LA 4N1HA 1FQGA 2ZQDA 4L9FA 1K6RA 5HPIA 3IX4A 1GSVA 2Q0OA 3ITAA 4LPZA 3CPTA 5CHUA 1GA9A 5HDCA 1LSVA 1TVFA 1X0OA 4QD4A 1XJ2A 2FFFB 5CTNA 1S6RA 4K0WA 1CEFA 2Z6CA 2Y59A 4KZ4A 2ZQAA 3WS4A 2Z2LB 3LI8A 4OKPA 2VZWA 1KE0A 4DRTA 3F1PB 2INWA 2LB5A 2ZC4B 3OPPA 2P04A 4EW7A 3LY4A 2ZC7A 5FI6A 1XXMA 3BFCA 5E43A 4P6ZS 4FTXA 1SKFA 3MS6A 1Y54A 3P01A 3Q7VB 4EBLA 1EI5A 4QY6A 4Y0TA 5LBRA 3LY3A 1Q2QA 3IQAA 2H0TA 3L7HA 3VP4A 4PMAA 1ES4A 1ACFA 4DN0A 4BD1A 4S2PA 4E3OA 3TSGA 4UEYA 5HWTA 3NDGA 4OOYA 5E2FA 4X1LA 4KZAA 1OT9A 3SH7A 4DKIA 3IBJA 3NDEA 4EUVA 4Q0JA 2ZM2A 2UV0E 3CITA 1NZOA 3T4JA 4G3VA 4IJGA 3ZVTA 3FPWA 3PHYA 2P74A 4HY8A 3MF0A 4CLCD 4DMZA 3E98A 1MKIA 1G68A 5CRFA 3G32A 2GZAA 2WKIA 4RQ9A 3PBQA 3FWLA 1I2SA 4KQQA 5CERA 1U60A 4RYEA 3F1OA 1TEMA 4FOFA 3KYEA 4JF5A 2Y2QA 1ES2A 4CQHA 2ZL1A 1LSWA 5HPFA 1V9ZA 1VB6A 3QNBA 3OOVA 2J3TC 3VOLA 2HJEA 5AQ9A 5EM0A 5AQAA 1S4SA 4ESPA 3BFDA 3IX3A 3P98A 3FPVA 5FATA 3BJNA 5EVIC 1PWCA 3FYZA 5DTTA 3EQVA 3KSHA 1F2KA 2M1CA 3BFEA 4GJ4A 3O88A 1TF1A 4X6TA 2G2WA 2EX2A 2ZC3B 1T18A 1NY0A 3S7NA 3MR0A 4OPZA 4H6JA 5HFOA 4NG2A 3U4LP 4GDNA
chains in the Genus database with same CATH topology
1VHMA 2GX5A 3B47A 1YKDA 3LYXA 5HL6A 2W3EA 4EU0A 2QWSA 4UQIS 3LI9A 3UB8A 3OCLA 4R6LA 2O99A 2V9AA 4F3LA 4BBUA 3IBRA 3VE4A 1TS6A 2NUTC 2GNXA 4WL9A 1ODVA 1P9WA 3F1PA 4G3KA 3RTYA 4ME4A 3O5YA 2O0YA 3H7WB 2W1TB 3MQQA 3LICA 2BASA 2H28A 2XA7M 2JKTM 3VV4A 2D02A 1NRJA 5AJGA 2J3TD 5I5LA 4MMNA 4E04A 5J4EA 3CI6A 2O9BA 5IS1A 3LR3A 3F1NB 4ETXA 2QYBA 2MJ6A 3CUEA 4B93A 1ZTUA 1MC0A 5DJTA 4I3AA 1OJ5A 5C5KA 1XFQA 1WA9A 4GS9A 5J7EA 3W2ZA 2Y8HA 2Y79A 3BY8A 2IA2A 4HP4A 2ZMVA 4IHQA 2XA7S 1UWPX 3HJIA 1S4RA 3PR6A 2L1MA 2JKRI 4FSFA 4CLCA 5TJJA 3GDIA 1LSXA 5TBMA 4IUHA 1ZHHB 4Y3IA 2NUPC 4EETB 1T1BA 4WELA 4BWIA 3KYQA 4DJ2A 1YAXA 2OAQ1 2OWHA 2W27A 3NJAA 4NXGA 5G4ZA 3LIAA 4R3AA 4I3IA 4EEUA 3RFBA 3LFVA 1GSXA 4O8GA 3EOIA 4MN6A 3A0VA 3KSIA 2VGLS 1P97A 3BQ8A 4NXEA 4PKYG 4HJ3A 2PT7A 1DP8A 1F98A 4R70A 3BQAA 2M7UA 2P7JA 4OOLA 2HV1A 3S7PA 1F9IA 3LIEA 3V67A 4MDZA 4KUOA 2WKPA 4HIAA 2ZOHA 4CLCE 5HWVA 5J3WA 3T4LA 1MZUA 2I9VA 2QHKA 5A8BA 1BYWA 1OTEA 1S1ZA 4GW9A 1V9YA 2B18A 3KX0X 4XT2A 4MN7A 3OBFA 4KQOA 3K3DA 1D06A 1NWZA 4BMWA 1H8MA 5F69A 3S7QA 1KOUA 2PHYA 3LR5A 3R7WB 3ZQ5A 3A0SA 1H3QA 2KLIA 4ARZA 3H82B 4YWZA 5DJUA 4JGOA 1D7EA 4EXOA 5MC7A 3C8CA 2PYPA 2XSSA 3P7NA 4P6ZM 5KSHA 4HJ6A 3MXQA 2EA9A 3UB7A 3D3OA 1UGUA 1YSPA 4GHIA 1T1AA 2O9AA 2XRNA 4BBTA 1N9LA 1YSQA 1XFNA 2K31A 2OOLA 3KSGA 3TJZC 1N9OA 5HWWA 2PR6A 2FZ0A 5HD3A 4K08A 4YOFA 5DFYA 5K5BA 4Z1WA 4B9OA 2KX6A 3KSFA 1T1CA 4JGRA 2JN7A 2VLGA 4EESA 3B42A 2VKSA 3IS2B 1JNUA 4R38A 3CAXA 2V0WA 2O9CA 3BWLA 2JKRM 4ZRRA 2V1BA 2PD8A 3U2AA 3PXPA 3LIDA 3OCNA 2PD7A 3H7WA 1NLZA 2W1TA 4L9GA 2A2LA 2YKFA 3FG8A 3TRCA 2A24A 3EEHA 2KOIA 3OLOA 2VV8A 1W63M 2WKQA 3F1NA 2V1AA 1TD5A 3S7OA 1XJ4A 3F1OB 3A0RA 2W3HA 1TS8A 2PR5A 1T19A 4Y5FA 1OTAA 5KIZA 1NLYA 4HJ4A 3CWFA 1DRMA 4MN5A 3LIFA 1EW0A 3FC7A 3ULFA 4KQDA 4JGPA 1S1YA 3EQUA 4LRYC 4AFIA 2CMNA 2B02A 1G6OA 3KYZA 2HF6A 2R78A 2YKHA 4YNRA 3K2NA 2DMWA 2L0WA 4KUKA 3K3CA 1XJ6A 5DKKA 5F68A 3MQ0A 3EGDC 3T4QA 2GJ3A 1DP6A 4I38A 4L9FA 5HPIA 2ZMFA 2FH5A 4G3WA 1GSVA 4NEED 2LB9A 2VX8A 3BY9A 2QKPA 2M7VA 3T4SA 4EQ1A 2L4RA 3JVUA 3VE3A 3MFXA 3EEAA 1Y28A 4LPZA 3MQOA 2W3DA 3E0YA 5HDCA 3ZYTA 1LSVA 4GLQA 1OTDA 5L8MA 1X0OA 3C2WA 4L0LA 3T50A 1XJ2A 4H6JB 5HD5A 3PBNA 3TW8A 3PBRA 3HCYA 3ICYA 2Z6CA 3G6OA 4WF0A 1LL8A 2J80A 4F3LB 2OAP1 1P9RA 4UQIM 3LI8A 4PAUA 1W63Q 3LR0A 1OJGA 2VZWA 3F1PB 2INWA 2QJ7A 2LB5A 5F6AA 5EFWA 5DKLA 2P04A 4EW7A 1OTBA 4HNBA 3E4OA 4PHTA 2W3FA 2W3GA 3EGXC 1TS7A 1G28A 3JVVA 5G4YA 3T4KA 3UB6A 4MCWA 4PKYA 5IT5A 3LUQA 3PYPA 1DP9A 3R7WA 3R4KA 5AVFA 4P6ZS 3H82A 4WEJA 4EEPA 2ZBBA 3P01A 4NXBA 4OOMA 2EWVA 4GS9B 4HHDA 3C30A 5LBRA 2K2NA 3BW6A 4I3JA 3PBOA 4I5SA 2PDRA 4LRZE 1OPXA 4DN0A 3MJQA 3KO6A 4HP9A 2W1RA 4CLCB 4UEYA 5HWTA 2A24B 1GSWA 5TBMB 2VEAA 3T4TA 3NOUC 4M4XA 5HSQA 3UE3A 4HH3A 2JKTI 5DF9A 3EWKA 4Q0IA 1S67L 5IU1A 1UWNX 5FL3A 1OT9A 3CLOA 3IBJA 4EUVA 4Q0JA 3IS2A 3CITA 3T4JA 3GECA 4G3VA 4QPRA 2HJ9C 1MKMA 4IJGA 5F5YA 2VA0A 3FPWA 2VGLM 4NKPA 4JGQA 3SW1A 2VV6A 3PHYA 4DJ3A 1F5MA 2PYRA 4HQAA 4HY8A 3MF0A 4CLCD 4DMZA 3E98A 4NXFA 4WN5A 3NOPC 2GZAA 4Q0HA 4RQ9A 3PBQA 5HDDA 2XROA 2HGVA 2OWJA 4I39A 3OC2A 3RH8B 2VV7A 2K7SA 4LRXC 1XJ3A 3LIBA 4O0PA 4Y2FA 3F1OA 4FOFA 2Z6DA 3UMDA 4CQHA 4HI4A 4L9EA 3HJKA 4XT2B 1LSWA 5HZHA 3MMHA 5DFXA 5HPFA 1TS0A 1V9ZA 1VB6A 3OOVA 1IOUA 2J3TC 2WKRA 3VOLA 2HJEA 2P08A 1OTIA 1OT6A 1STZA 4ARZB 1S4SA 4IUKA 4GCZA 4BJPA 2J3WA 4ETZA 3CUEC 2KDKA 1S66L 4LLOB 3FPVA 4EERA 3BJNA 2G7UA 4II7A 3PBTA 4WEKA 4WLAA 4O01A 5CX7A 4GHIB 3EQVA 3B33A 3KSHA 5HDSA 4BBVA 3D72A 2EWWA 2M1CA 5AVEA 4GJ4A 3TE8A 4HOIA 3PBSA 1P0ZA 1TF1A 2JHEA 3E4QA 3NHQA 2V0UA 1LT0A 4HH2A 2W0NA 4WUJA 4CLCC 1N9NA 2D01A 3DBAA 3C38A 3UE6A 1IFQA 3T4OA 1T18A 3LR4A 2ZOIA 3S7NA 3UMEA 2VJWA 3E4PA 3MR0A 2QJ5A 3H9WA 4H6JA 3UB9A 3NOTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3T C;  2J3T D;  3PR6 A;  2ZMV A;  3CUE A;  1H3Q A;  2J3W A;  3CUE C; 
#chains in the Genus database with same CATH topology
 1VHM A;  2XH9 A;  3NC8 A;  4KZ5 A;  5HL6 A;  4DDS A;  1LL9 A;  1NYY A;  4EU0 A;  1IYQ A;  2PAV P;  2QWS A;  3UB8 A;  4R6L A;  3DW0 A;  4F3L A;  3WS5 A;  3E2L A;  3IBR A;  1W8Q A;  3QNC A;  4GDB A;  1YPR A;  3DTI A;  5HAQ A;  3O5Y A;  5GL9 A;  2O0Y A;  4LFU A;  4P0M A;  3SH8 A;  3VV4 A;  4FCF A;  4KZ6 A;  4RX2 A;  4MMN A;  4E04 A;  1K54 C;  2O9B A;  1H5X A;  5HW3 A;  2ZJ9 A;  2AVX A;  5EVI A;  3WS1 A;  1BLH A;  4GS9 A;  1YQS A;  1HD8 A;  3BY8 A;  1VEU B;  2ZMA A;  4HP4 A;  2CC1 A;  3BEC A;  4LV2 A;  1BT5 A;  1NJ4 A;  4LGW A;  3Q82 A;  4FSF A;  3BRM A;  1DJB A;  5TBM A;  4IUH A;  1ZHH B;  4EET B;  3VFH A;  4WEL A;  4RVA A;  1ES5 A;  4CPK A;  2W27 A;  2BTF P;  5G4Z A;  2H10 A;  3IXH A;  4EEU A;  3LFV A;  3DAV A;  4X68 A;  1JVJ A;  1P97 A;  4PKY G;  3CPT B;  4ZAM A;  2PT7 A;  3GMW A;  4X53 A;  3S7P A;  4D2O A;  3LIE A;  4WYY A;  4IBR A;  3VP2 A;  3VOZ A;  4HIA A;  2HDU A;  4KZ7 A;  3UE0 A;  5HWV A;  4PM6 A;  5J3W A;  2IWC A;  4GZB A;  3T4L A;  1K54 A;  2I9V A;  1PI4 A;  5DF8 A;  3MKF A;  1V9Y A;  3UNW A;  2Y2H A;  4MN7 A;  5DTS A;  4KQO A;  1NWZ A;  4ZJ2 A;  4BMW A;  4QWO A;  4XUZ A;  2XDM A;  4DF6 A;  3QP4 A;  3T1X A;  3AGF A;  5U47 A;  4ARZ A;  4LV1 A;  5AQ7 A;  4JGO A;  2EX8 A;  2QZ6 A;  3P7N A;  5GHY A;  3O86 A;  4LV3 A;  1UGU A;  3LGO A;  1K56 D;  3NIA A;  1N9L A;  3MZE A;  3Q07 A;  1DY6 A;  1JWV A;  2K31 A;  4QJG A;  2HDS A;  2Y2P A;  5GLA A;  1XX2 A;  4OPY A;  3HUN A;  2FZ0 A;  5HD3 A;  4Y15 A;  4OPR A;  4YOF A;  4X25 A;  1VM1 A;  5F83 A;  1G5U A;  1N4O A;  1PWG A;  4KEN B;  4N92 A;  3KSF A;  3S1Y A;  1YLY A;  2V8C A;  4ZJ1 A;  3DWZ A;  4BQM A;  3V39 A;  4ID4 A;  4JGR A;  5JYP A;  2VLG A;  3JYI A;  3ZCZ A;  2V0W A;  2WZZ A;  2O9C A;  4JXG A;  5FI7 A;  4ZRR A;  3PXP A;  3BLM A;  3MZD A;  3FG8 A;  1PIO A;  3GVB A;  1JTG A;  3SS5 A;  1TDL A;  4EUZ A;  2JE5 A;  2VV8 A;  2WKQ A;  2QMI A;  3F1N A;  3F1O B;  3BLS A;  3N7W A;  3GRJ A;  4UA9 A;  3IXB A;  2ZL1 B;  4Y5F A;  1NLY A;  1KGG A;  4X1M A;  3N8L A;  1C3B A;  1DRM A;  4MN5 A;  3HL9 A;  4S2K A;  1BSG A;  5L09 A;  1KGE A;  1WYB A;  4JKT A;  2V1Z A;  3KYZ A;  2R78 A;  3N8S A;  1PZP A;  4YNR A;  3QHY A;  3A3F A;  1MY8 A;  1XJ6 A;  5DKK A;  1PWD A;  1WYC A;  3T4Q A;  4R1G A;  1DP6 A;  3NY4 A;  4EQI A;  2ZMF A;  1K25 A;  5A93 A;  4G3W A;  2H0Y A;  3EEA A;  4M3K A;  1E4D A;  1NXY A;  2B5R A;  3E0Y A;  2PU4 A;  3ZYT A;  4GLQ A;  1OTD A;  3ITB A;  4H6J B;  4JXV A;  3PBN A;  3T12 B;  3ZNY A;  3HLG A;  3D9Y A;  3B3X A;  3HCY A;  1ERM A;  5HAR A;  4GD8 A;  3VMA A;  1LL8 A;  2EXA A;  4QHC A;  2J80 A;  4F3L B;  2OAP 1;  4UQI M;  3IT9 A;  1OJG A;  1L3L A;  2Y2I A;  5EFW A;  5DKL A;  4OLG A;  2BLS A;  5G4Y A;  3UB6 A;  4MLL A;  4Q8I A;  2ZD8 A;  3LUQ A;  4Y13 A;  3UPO A;  5AVF A;  4R4S A;  5FEG A;  2ZBB A;  5GLD A;  5EVI B;  2EWV A;  4GS9 B;  1Y4O A;  1YMX A;  4HHD A;  4DXB A;  4LCM A;  4FD8 A;  1K57 C;  3LCE A;  3MXR A;  3BM6 A;  5FQM A;  3MJQ A;  2W1R A;  1ZKJ A;  2JBF A;  5TBM B;  2VEA A;  3T4T A;  1PNE A;  1MWU A;  3IF5 A;  3UE3 A;  5I94 A;  4HH3 A;  2HDQ A;  2JKT I;  4Q0I A;  1S67 L;  1UWN X;  3CLO A;  1EWZ A;  3G35 A;  4OQG A;  3SW1 A;  4DJ3 A;  5L10 A;  4HQA A;  3VSL A;  5DF7 A;  4NXF A;  2XLN A;  3NOP C;  4JBF A;  1VET A;  5EOE A;  4Y7P A;  1BZA A;  3IWO A;  3IHA A;  2K7S A;  4LRX C;  3W8K A;  1XJ3 A;  3LIB A;  2Z6D A;  3HLE A;  3UMD A;  2WGI A;  4HI4 A;  3NUL A;  4PM5 A;  5CXW A;  1K57 A;  2P08 A;  2RL3 A;  5GLB A;  4ARZ B;  2UWX A;  1RP5 A;  4GCZ A;  2J3W A;  3RJU A;  3CUE C;  2KDK A;  3BEB A;  1W8Y A;  5F82 A;  2G7U A;  5HAP A;  3UN7 A;  1YMS A;  5HDS A;  2EWW A;  3QP2 A;  4HOI A;  2P9V A;  3NHQ A;  5FEF A;  4IVI A;  2QPN A;  2V0U A;  3VFF A;  4R3B A;  1TDG A;  2D01 A;  2G2U A;  4LCL A;  2Y2J A;  3C7V A;  1CK3 A;  5E2E A;  1KDS A;  2GX5 A;  3ISG A;  3LYX A;  4IVK A;  4DE0 A;  3UB5 P;  4UQI S;  3LI9 A;  5FSR A;  1CEG A;  2HP6 A;  2GNX A;  5M1A A;  1P9W A;  1CQA A;  3S4X A;  4ME4 A;  3Q1F A;  2C6W B;  3UPN A;  4WMC A;  3FV7 A;  2BAS A;  3VP3 A;  3M6H A;  2JKT M;  2D02 A;  1HVB A;  1ONG A;  2ZC6 B;  5AJG A;  3HVF A;  5J4E A;  3CI6 A;  5IS1 A;  2PBD P;  4DXC A;  3F1N B;  3MBZ A;  1N9B A;  4ETX A;  2QYB A;  3CUE A;  2J7V A;  1MC0 A;  4I3A A;  4N9K A;  5J7E A;  3ZHH A;  4K91 A;  4OP8 A;  1YLZ A;  2IA2 A;  3HJI A;  5FQK A;  2WAD A;  3PR6 A;  2L1M A;  2JKR I;  5D3O A;  4Y3I A;  1T1B A;  3KYQ A;  3MSH A;  2OWH A;  3T1S A;  3OPL A;  4I3I A;  2ACG A;  3RFB A;  3UY6 A;  1IEL A;  1GSX A;  5G18 A;  3HLD A;  1PFL A;  4MN6 A;  4F94 A;  1D1J A;  5FAO A;  1ERO A;  4A5R A;  2HV1 A;  4GKU A;  1IYS A;  4MBF A;  4EWF A;  1KE3 A;  2PBY A;  1F9I A;  1ZC2 A;  4MDZ A;  1FCN A;  3UB9 A;  2ZOH A;  4C3Q A;  4CLC E;  1KGF A;  1FIK A;  3LEQ A;  4UHU A;  1J3W A;  1Q2P A;  2Y91 A;  2WKH A;  1BYW A;  1OTE A;  4R23 A;  2B18 A;  3ZG7 B;  4WZ5 C;  4P87 A;  2V2F F;  2DRW A;  1MBL A;  3K3D A;  1D06 A;  1DJC A;  1E25 A;  1LI9 A;  4ZBE A;  3IWQ A;  3NBL A;  5F1F A;  3T1Q B;  1LI0 A;  2DCF A;  4MBK A;  4FH2 A;  1L2S A;  3IH9 A;  3O3V A;  3C8C A;  2PYP A;  2XSS A;  4S2L A;  4HJ6 A;  3MXQ A;  5CED A;  1NYM A;  4PM8 A;  1K56 A;  1GCE A;  2Y2G A;  2PU2 A;  1T1A A;  5CGS A;  2O9A A;  3D4F A;  1YSQ A;  1M40 A;  3KSG A;  3VSK A;  3NEC A;  3DTM A;  5CTM A;  4K08 A;  4Y0O A;  4U3T A;  5DFY A;  2XD1 A;  2JKF A;  2OV5 A;  1GHI A;  2KX6 A;  3P09 A;  3IF6 C;  2WGW A;  5GHX A;  5FDH A;  3HLC A;  2EX6 A;  2JN7 A;  2JKG A;  2VKS A;  3G4P A;  4R38 A;  2OLU A;  4X69 A;  4ZDX A;  2BG1 A;  1BLC A;  2WAE A;  4WZ5 A;  2JKR M;  3A3I A;  2PD8 A;  4R3J A;  3OCN A;  5L07 A;  2PD7 A;  3H7W A;  2W1T A;  2A2L A;  1VET B;  3EEH A;  3IH8 A;  1YLP A;  1RGY A;  4IED A;  5EVL A;  4BL2 A;  3NCK A;  4KG6 A;  2X71 A;  1HLU P;  5FQQ A;  4JF4 A;  2W3H A;  5GHZ A;  4EBP A;  1YT4 A;  4GN2 A;  2EXB A;  3CG5 A;  4X56 A;  5HAI A;  4LV0 A;  1SDE A;  4KQD A;  3AGE A;  1S1Y A;  3EQU A;  2E8J A;  2B02 A;  1J9M A;  3CZD A;  2WYX A;  2YKH A;  3L9K A;  4X55 A;  2L0W A;  3K3C A;  2Y2K A;  1LHY A;  4KG5 A;  5F68 A;  3EGD C;  2Q9N A;  3GTC A;  3IF6 A;  2OSU A;  2P9V B;  2FH5 A;  4RA7 A;  4NEE D;  2M7V A;  2VX8 A;  3MKE A;  2QKP A;  3QP6 A;  3T4S A;  4EQ1 A;  3VE3 A;  3MFX A;  1Y28 A;  3MQO A;  3OZH A;  3IWI A;  4C6Y A;  5L8M A;  4E6X A;  4MNR A;  3T50 A;  1NRF A;  4R0Q A;  5EPH A;  3V50 A;  3MXS A;  3TOI A;  3TW8 A;  1FCM A;  3PBR A;  1BLP A;  2GDN A;  2Y55 A;  3ICY A;  4UAA A;  5CEB A;  1ESU A;  3G6O A;  4WF0 A;  3M2J A;  1W63 Q;  2J8Y A;  3LR0 A;  2ZM8 A;  2QJ7 A;  5F6A A;  3C7U A;  1OTB A;  4HNB A;  2W3F A;  3EGX C;  1TS7 A;  1G28 A;  3T4K A;  4PKY A;  2H5S A;  3PYP A;  1DP9 A;  3R7W A;  5FAP A;  2XF3 A;  3H82 A;  4S2O A;  4EEP A;  2ZQC A;  3IXG A;  4NXB A;  5EVE A;  5EOO A;  3C30 A;  3BW6 A;  3GR2 A;  1ALQ A;  2PDR A;  3HBR A;  4LRZ E;  1OPX A;  3HLF A;  2XGN A;  3E2K A;  3QP1 A;  2WKE A;  3WWX A;  1ESI A;  3NOU C;  1FR6 A;  3EWK A;  1AWI A;  5IU1 A;  1K4E A;  5FL3 A;  1I2W A;  1L0F A;  3O87 A;  3IS2 A;  3GEC A;  5HX9 A;  4EBN A;  4QPR A;  2WUQ A;  5F5Y A;  1MKM A;  4PPR A;  1L0G A;  3IX8 A;  4S2N C;  1FSY A;  3WS2 A;  2VGL M;  4NKP A;  4JGQ A;  3GQZ A;  2VV6 A;  4CJN A;  4OP5 A;  5FDS A;  1XA7 A;  4WN5 A;  4OQ0 A;  1DJA A;  2DNS A;  4Q0H A;  3ZG9 B;  2XQZ A;  4KG2 A;  5HDD A;  2ZC5 B;  4OPQ A;  4S2J A;  1K38 A;  3FKV A;  2HGV A;  1CI9 A;  4I39 A;  1VQQ A;  3OC2 A;  4OQI A;  3RH8 B;  4O0P A;  4Y2F A;  4S2I A;  3LEZ A;  3V5M A;  2Q9M A;  3QP8 A;  4DE1 A;  5HZH A;  3MMH A;  5DFX A;  3C4P A;  4QY5 A;  1IKI A;  5FQJ A;  4XXR A;  1OTI A;  3G30 A;  1SZV A;  3G2Y A;  1O7E A;  2ZM0 A;  5E2G A;  3VOY A;  4MEZ A;  4C75 A;  1IKG A;  1S66 L;  3HLB A;  4EER A;  2J9P A;  4II7 A;  4WLA A;  3WRT A;  4O01 A;  5CX7 A;  4BLM A;  3PTE A;  1KE4 A;  3TE8 A;  4NK3 A;  3N4I A;  4QB8 A;  4DE3 A;  1LT0 A;  2W0N A;  4WM9 A;  4CLC C;  1N9N A;  3V3R A;  5BOH A;  3LO7 A;  4S2N A;  1IFQ A;  1LLB A;  3UME A;  2R9X A;  2HDR A;  2VJW A;  5FQI A;  5FA7 A;  4U0T A;  1FR1 A;  2QJ5 A;  3H9W A;  3NOT C;  2ZLY A;  3SH9 A;  3B47 A;  1YKD A;  2WGW B;  1BLS A;  1KVM A;  3OCL A;  1FIL A;  1NZU A;  4BBU A;  3VE4 A;  1TS6 A;  4WL9 A;  3ZG0 A;  1ODV A;  4GNU A;  4G3K A;  3RTY A;  2Y2L A;  3H7W B;  2W1T B;  3SS3 A;  2H28 A;  2A3U A;  1GHM A;  4E3K A;  3LR3 A;  2MJ6 A;  1ZTU A;  5DJT A;  3UO9 A;  3W4O A;  1PRQ A;  3CJM A;  1WA9 A;  3M2K A;  2Y79 A;  2ZMV A;  2XA7 S;  1UWP X;  3Q7Z A;  1OME A;  3MFD A;  1S4R A;  4E3I A;  2XEP A;  4CLC A;  3GDI A;  4BD0 A;  4BWI A;  4DJ2 A;  1YAX A;  5FQ9 A;  1LL5 A;  3NJA A;  4NXG A;  5DTK A;  4UA6 A;  2VK3 A;  3FZC A;  3IF6 B;  3QP5 A;  2J9O A;  4FUW A;  3MZF A;  1S0W A;  2VGJ A;  2VGL S;  3BQ8 A;  4NXE A;  4OH0 A;  4U0X A;  1XKZ A;  4R70 A;  1MWR A;  3VP1 A;  1E3U D;  2B95 A;  3PAE A;  3W4P A;  4Y17 A;  4DE2 A;  1GHP A;  2QHK A;  1SKO A;  4KZ8 A;  1S1Z A;  4GW9 A;  4XT2 A;  2FFY A;  1H8M A;  5F69 A;  3S7Q A;  1KOU A;  2PHY A;  3G2Z A;  3LR5 A;  3R7W B;  1AXB A;  3A0S A;  1H3Q A;  1K55 C;  4MBH A;  3H82 B;  4YWZ A;  5DJU A;  3WS0 A;  3Q81 A;  2IWD A;  4EXO A;  2E8I A;  4KZB A;  3BYD A;  2EA9 A;  1YSP A;  4GHI A;  1RGZ A;  4BBT A;  1XFN A;  3TJZ C;  5HWW A;  4GD6 A;  1FSW A;  2PR6 A;  4XUX A;  1PZO A;  2Y2N A;  3DTE A;  4Z1W A;  1BUE A;  3S22 A;  4KZ9 A;  4GB7 A;  4OQH A;  4EES A;  3IS2 B;  3CAX A;  3G34 A;  1A0K A;  3G31 A;  2V1B A;  2PRF A;  3C5A A;  3LID A;  2EFX A;  2WZX A;  4HBU A;  4Z9Q A;  1M6K A;  4L9G A;  2YKF A;  4RX3 A;  5TGF A;  1K55 A;  5KZH A;  2Y2M A;  2A49 A;  4HES A;  1SDN A;  1W63 M;  3NI9 A;  2V1A A;  3S7O A;  1FCO A;  1XJ4 A;  2XD5 A;  1XPB A;  5KIZ A;  3HUM A;  1KVL A;  5F1G A;  3LIF A;  1HTZ A;  4E3J A;  3VP0 A;  4JGP A;  4LRY C;  4AFI A;  2CMN A;  4B88 A;  4YIN A;  4B4X A;  2HF6 A;  1YLT A;  5J8X A;  1SCW A;  3CMZ A;  4KUK A;  3ZG8 B;  2HPB A;  3MQ0 A;  1KDW A;  2GJ3 A;  4S2M A;  4I38 A;  4Y0U A;  5AQB A;  2Y4A A;  2IWB A;  3OPR A;  2LB9 A;  3BY9 A;  2L4R A;  5M19 A;  3JVU A;  3TG9 A;  4B4Z A;  1Z09 A;  2W3D A;  4PM9 A;  3C2W A;  4L0L A;  5HD5 A;  3IHB A;  5EEC A;  1WE4 A;  5FAS A;  4P6B A;  1H8Z A;  4BL3 A;  1L0E A;  3A3E A;  4O7D A;  4PM7 A;  1CJF A;  3WRZ A;  3N6I A;  1P9R A;  4JF6 A;  1PW1 A;  4PAU A;  3ZGA B;  1JTD A;  4PHT A;  3E4O A;  3JVV A;  2W3G A;  4OLD A;  1IYO A;  4D60 A;  4MCW A;  3M6B A;  5IT5 A;  3W4Q A;  3I7J A;  3PAG A;  1CI8 A;  3R4K A;  3UPP A;  1Z6F A;  4WEJ A;  5CGW A;  4LEN A;  3GSG A;  3UDF A;  2HP9 A;  4OOM A;  2HP5 A;  1BTL A;  2K2N A;  4I3J A;  3PBO A;  4I5S A;  3RXW A;  3KO6 A;  4HP9 A;  3AGD A;  4CLC B;  4WMC D;  2R9W A;  2A24 B;  1GSW A;  4M4X A;  5HSQ A;  4JLF A;  5DF9 A;  1IYP A;  2WK0 A;  2I72 A;  5DVA A;  4NET A;  1PI5 A;  2VGK A;  3OPH A;  1H0M A;  5FI2 A;  1ERQ A;  2HJ9 C;  3ZNT A;  2VA0 A;  4R4R A;  1F5M A;  2PYR A;  4E6W A;  1W79 A;  1K6S A;  4N9L A;  3SOI A;  2XK1 A;  2XRO A;  2OWJ A;  1ZG6 A;  2VV7 A;  5L2F A;  1YM1 A;  5TR7 A;  1SKO B;  4ZJ3 A;  1RCJ A;  4L9E A;  2V20 A;  3HJK A;  4XT2 B;  3UE1 A;  1TS0 A;  3ZFZ A;  1I5Q A;  4HEF A;  1IOU A;  2WKR A;  3HLW A;  1OT6 A;  1STZ A;  3ZDJ A;  4IUK A;  4KZ3 A;  4BJP A;  4ETZ A;  4LLO B;  5EUA A;  4WEK A;  3PBT A;  4GHI B;  4BBV A;  3B33 A;  1MWT A;  3D72 A;  5AVE A;  5HL1 A;  1MXO A;  3PBS A;  5FAQ A;  1P0Z A;  2JHE A;  2XFS A;  3E4Q A;  4IBX A;  4HH2 A;  4WUJ A;  5GLC A;  2WGV A;  3DBA A;  1G6A A;  3C38 A;  3UE6 A;  3T4O A;  3JPU A;  2ZOI A;  3LR4 A;  3ZVW A;  3E4P A;  2RCX A;  1K0K A;  1BUL A;  2W3E A;  1PYY A;  2O99 A;  2V9A A;  5CGX A;  4BEN A;  1PW8 A;  2NUT C;  1FOF A;  3F1P A;  5KSC A;  4E3N A;  2OLV A;  3HRE A;  5A90 A;  2JC7 A;  3MQQ A;  3LIC A;  2C5W B;  2XA7 M;  1NRJ A;  5CEC A;  2J3T D;  2EX9 A;  1MPL A;  5IHV A;  5I5L A;  3RXX A;  1L0D A;  2WAF A;  4B93 A;  4JXS A;  1OJ5 A;  3Q7V A;  5C5K A;  1XFQ A;  5EM1 A;  1QME A;  5EVI D;  3W2Z A;  2Y8H A;  1SHV A;  3A3J A;  4IHQ A;  4H8R A;  5CHJ A;  4OVD A;  1ONH A;  5TJJ A;  1LSX A;  2NUP C;  1XP4 A;  2OAQ 1;  3LIA A;  4R3A A;  3DTK A;  2Z2M B;  3ZG5 A;  1XGI A;  3T1R A;  4O8G A;  3EOI A;  3A0V A;  3BFG A;  3KSI A;  4HJ3 A;  1DP8 A;  2X02 A;  1F98 A;  3SS4 A;  3BQA A;  2M7U A;  2P7J A;  4OOL A;  1E3U A;  3V67 A;  4P85 A;  4KUO A;  4QU3 A;  1W7F A;  2WKP A;  1H8Y A;  5M18 A;  4WBG A;  3CHW P;  1CF0 A;  1MZU A;  1MWS A;  1GA0 A;  5A8B A;  3A3D A;  5KMW A;  3KX0 X;  4FH4 A;  3OBF A;  4WZ4 A;  2HZ5 A;  4OON A;  2JCH A;  4N1X A;  2EFU A;  3ZQ5 A;  2KLI A;  3HUO A;  3UDI A;  4K0X A;  1JWP A;  1D7E A;  5MC7 A;  4P6Z M;  5KSH A;  2ZQ9 A;  3UB7 A;  3D3O A;  5CHM A;  2XRN A;  3UDX A;  2OOL A;  2ZQ7 A;  1N9O A;  4DDY A;  3SZT A;  1HZO A;  1O07 A;  1K4F A;  5JYO A;  2ZQ8 A;  2XFT A;  3GV9 A;  2X01 A;  5K5B A;  3IXD A;  5EV0 A;  4B9O A;  1T1C A;  3V3S A;  5E2H A;  1W5D A;  1JWZ A;  2XR0 A;  4E3M A;  3B42 A;  1JNU A;  5A92 A;  3BWL A;  4EV4 A;  3C4O A;  1YLJ A;  4ZTK A;  5TFQ A;  3U2A A;  1NLZ A;  1YLW A;  3N8R A;  3TRC A;  1QMF A;  2A24 A;  2KOI A;  5A91 A;  3DWK A;  3OLO A;  1ES3 A;  1TD5 A;  3A0R A;  1TS8 A;  2PR5 A;  1T19 A;  1OTA A;  4HJ4 A;  3CWF A;  4JPM A;  1VEU A;  4JXW A;  1EW0 A;  3FC7 A;  1ZG4 A;  3ULF A;  4KQR A;  2V8F A;  1IEM A;  3BFF A;  4HBT A;  1G6O A;  5EE8 A;  4UA7 A;  2Y2O A;  1XGJ A;  4GOG A;  3K2N A;  2DMW A;  3FKW A;  4YFM A;  1XA1 A;  4E3L A;  4N1H A;  1FQG A;  2ZQD A;  4L9F A;  1K6R A;  5HPI A;  3IX4 A;  1GSV A;  2Q0O A;  3ITA A;  4LPZ A;  3CPT A;  5CHU A;  1GA9 A;  5HDC A;  1LSV A;  1TVF A;  1X0O A;  4QD4 A;  1XJ2 A;  2FFF B;  5CTN A;  1S6R A;  4K0W A;  1CEF A;  2Z6C A;  2Y59 A;  4KZ4 A;  2ZQA A;  3WS4 A;  2Z2L B;  3LI8 A;  4OKP A;  2VZW A;  1KE0 A;  4DRT A;  3F1P B;  2INW A;  2LB5 A;  2ZC4 B;  3OPP A;  2P04 A;  4EW7 A;  3LY4 A;  2ZC7 A;  5FI6 A;  1XXM A;  3BFC A;  5E43 A;  4P6Z S;  4FTX A;  1SKF A;  3MS6 A;  1Y54 A;  3P01 A;  3Q7V B;  4EBL A;  1EI5 A;  4QY6 A;  4Y0T A;  5LBR A;  3LY3 A;  1Q2Q A;  3IQA A;  2H0T A;  3L7H A;  3VP4 A;  4PMA A;  1ES4 A;  1ACF A;  4DN0 A;  4BD1 A;  4S2P A;  4E3O A;  3TSG A;  4UEY A;  5HWT A;  3NDG A;  4OOY A;  5E2F A;  4X1L A;  4KZA A;  1OT9 A;  3SH7 A;  4DKI A;  3IBJ A;  3NDE A;  4EUV A;  4Q0J A;  2ZM2 A;  2UV0 E;  3CIT A;  1NZO A;  3T4J A;  4G3V A;  4IJG A;  3ZVT A;  3FPW A;  3PHY A;  2P74 A;  4HY8 A;  3MF0 A;  4CLC D;  4DMZ A;  3E98 A;  1MKI A;  1G68 A;  5CRF A;  3G32 A;  2GZA A;  2WKI A;  4RQ9 A;  3PBQ A;  3FWL A;  1I2S A;  4KQQ A;  5CER A;  1U60 A;  4RYE A;  3F1O A;  1TEM A;  4FOF A;  3KYE A;  4JF5 A;  2Y2Q A;  1ES2 A;  4CQH A;  2ZL1 A;  1LSW A;  5HPF A;  1V9Z A;  1VB6 A;  3QNB A;  3OOV A;  2J3T C;  3VOL A;  2HJE A;  5AQ9 A;  5EM0 A;  5AQA A;  1S4S A;  4ESP A;  3BFD A;  3IX3 A;  3P98 A;  3FPV A;  5FAT A;  3BJN A;  5EVI C;  1PWC A;  3FYZ A;  5DTT A;  3EQV A;  3KSH A;  1F2K A;  2M1C A;  3BFE A;  4GJ4 A;  3O88 A;  1TF1 A;  4X6T A;  2G2W A;  2EX2 A;  2ZC3 B;  1T18 A;  1NY0 A;  3S7N A;  3MR0 A;  4OPZ A;  4H6J A;  5HFO A;  4NG2 A;  3U4L P;  4GDN A; 
#chains in the Genus database with same CATH homology
 1VHM A;  2GX5 A;  3B47 A;  1YKD A;  3LYX A;  5HL6 A;  2W3E A;  4EU0 A;  2QWS A;  4UQI S;  3LI9 A;  3UB8 A;  3OCL A;  4R6L A;  2O99 A;  2V9A A;  4F3L A;  4BBU A;  3IBR A;  3VE4 A;  1TS6 A;  2NUT C;  2GNX A;  4WL9 A;  1ODV A;  1P9W A;  3F1P A;  4G3K A;  3RTY A;  4ME4 A;  3O5Y A;  2O0Y A;  3H7W B;  2W1T B;  3MQQ A;  3LIC A;  2BAS A;  2H28 A;  2XA7 M;  2JKT M;  3VV4 A;  2D02 A;  1NRJ A;  5AJG A;  2J3T D;  5I5L A;  4MMN A;  4E04 A;  5J4E A;  3CI6 A;  2O9B A;  5IS1 A;  3LR3 A;  3F1N B;  4ETX A;  2QYB A;  2MJ6 A;  3CUE A;  4B93 A;  1ZTU A;  1MC0 A;  5DJT A;  4I3A A;  1OJ5 A;  5C5K A;  1XFQ A;  1WA9 A;  4GS9 A;  5J7E A;  3W2Z A;  2Y8H A;  2Y79 A;  3BY8 A;  2IA2 A;  4HP4 A;  2ZMV A;  4IHQ A;  2XA7 S;  1UWP X;  3HJI A;  1S4R A;  3PR6 A;  2L1M A;  2JKR I;  4FSF A;  4CLC A;  5TJJ A;  3GDI A;  1LSX A;  5TBM A;  4IUH A;  1ZHH B;  4Y3I A;  2NUP C;  4EET B;  1T1B A;  4WEL A;  4BWI A;  3KYQ A;  4DJ2 A;  1YAX A;  2OAQ 1;  2OWH A;  2W27 A;  3NJA A;  4NXG A;  5G4Z A;  3LIA A;  4R3A A;  4I3I A;  4EEU A;  3RFB A;  3LFV A;  1GSX A;  4O8G A;  3EOI A;  4MN6 A;  3A0V A;  3KSI A;  2VGL S;  1P97 A;  3BQ8 A;  4NXE A;  4PKY G;  4HJ3 A;  2PT7 A;  1DP8 A;  1F98 A;  4R70 A;  3BQA A;  2M7U A;  2P7J A;  4OOL A;  2HV1 A;  3S7P A;  1F9I A;  3LIE A;  3V67 A;  4MDZ A;  4KUO A;  2WKP A;  4HIA A;  2ZOH A;  4CLC E;  5HWV A;  5J3W A;  3T4L A;  1MZU A;  2I9V A;  2QHK A;  5A8B A;  1BYW A;  1OTE A;  1S1Z A;  4GW9 A;  1V9Y A;  2B18 A;  3KX0 X;  4XT2 A;  4MN7 A;  3OBF A;  4KQO A;  3K3D A;  1D06 A;  1NWZ A;  4BMW A;  1H8M A;  5F69 A;  3S7Q A;  1KOU A;  2PHY A;  3LR5 A;  3R7W B;  3ZQ5 A;  3A0S A;  1H3Q A;  2KLI A;  4ARZ A;  3H82 B;  4YWZ A;  5DJU A;  4JGO A;  1D7E A;  4EXO A;  5MC7 A;  3C8C A;  2PYP A;  2XSS A;  3P7N A;  4P6Z M;  5KSH A;  4HJ6 A;  3MXQ A;  2EA9 A;  3UB7 A;  3D3O A;  1UGU A;  1YSP A;  4GHI A;  1T1A A;  2O9A A;  2XRN A;  4BBT A;  1N9L A;  1YSQ A;  1XFN A;  2K31 A;  2OOL A;  3KSG A;  3TJZ C;  1N9O A;  5HWW A;  2PR6 A;  2FZ0 A;  5HD3 A;  4K08 A;  4YOF A;  5DFY A;  5K5B A;  4Z1W A;  4B9O A;  2KX6 A;  3KSF A;  1T1C A;  4JGR A;  2JN7 A;  2VLG A;  4EES A;  3B42 A;  2VKS A;  3IS2 B;  1JNU A;  4R38 A;  3CAX A;  2V0W A;  2O9C A;  3BWL A;  2JKR M;  4ZRR A;  2V1B A;  2PD8 A;  3U2A A;  3PXP A;  3LID A;  3OCN A;  2PD7 A;  3H7W A;  1NLZ A;  2W1T A;  4L9G A;  2A2L A;  2YKF A;  3FG8 A;  3TRC A;  2A24 A;  3EEH A;  2KOI A;  3OLO A;  2VV8 A;  1W63 M;  2WKQ A;  3F1N A;  2V1A A;  1TD5 A;  3S7O A;  1XJ4 A;  3F1O B;  3A0R A;  2W3H A;  1TS8 A;  2PR5 A;  1T19 A;  4Y5F A;  1OTA A;  5KIZ A;  1NLY A;  4HJ4 A;  3CWF A;  1DRM A;  4MN5 A;  3LIF A;  1EW0 A;  3FC7 A;  3ULF A;  4KQD A;  4JGP A;  1S1Y A;  3EQU A;  4LRY C;  4AFI A;  2CMN A;  2B02 A;  1G6O A;  3KYZ A;  2HF6 A;  2R78 A;  2YKH A;  4YNR A;  3K2N A;  2DMW A;  2L0W A;  4KUK A;  3K3C A;  1XJ6 A;  5DKK A;  5F68 A;  3MQ0 A;  3EGD C;  3T4Q A;  2GJ3 A;  1DP6 A;  4I38 A;  4L9F A;  5HPI A;  2ZMF A;  2FH5 A;  4G3W A;  1GSV A;  4NEE D;  2LB9 A;  2VX8 A;  3BY9 A;  2QKP A;  2M7V A;  3T4S A;  4EQ1 A;  2L4R A;  3JVU A;  3VE3 A;  3MFX A;  3EEA A;  1Y28 A;  4LPZ A;  3MQO A;  2W3D A;  3E0Y A;  5HDC A;  3ZYT A;  1LSV A;  4GLQ A;  1OTD A;  5L8M A;  1X0O A;  3C2W A;  4L0L A;  3T50 A;  1XJ2 A;  4H6J B;  5HD5 A;  3PBN A;  3TW8 A;  3PBR A;  3HCY A;  3ICY A;  2Z6C A;  3G6O A;  4WF0 A;  1LL8 A;  2J80 A;  4F3L B;  2OAP 1;  1P9R A;  4UQI M;  3LI8 A;  4PAU A;  1W63 Q;  3LR0 A;  1OJG A;  2VZW A;  3F1P B;  2INW A;  2QJ7 A;  2LB5 A;  5F6A A;  5EFW A;  5DKL A;  2P04 A;  4EW7 A;  1OTB A;  4HNB A;  3E4O A;  4PHT A;  2W3F A;  2W3G A;  3EGX C;  1TS7 A;  1G28 A;  3JVV A;  5G4Y A;  3T4K A;  3UB6 A;  4MCW A;  4PKY A;  5IT5 A;  3LUQ A;  3PYP A;  1DP9 A;  3R7W A;  3R4K A;  5AVF A;  4P6Z S;  3H82 A;  4WEJ A;  4EEP A;  2ZBB A;  3P01 A;  4NXB A;  4OOM A;  2EWV A;  4GS9 B;  4HHD A;  3C30 A;  5LBR A;  2K2N A;  3BW6 A;  4I3J A;  3PBO A;  4I5S A;  2PDR A;  4LRZ E;  1OPX A;  4DN0 A;  3MJQ A;  3KO6 A;  4HP9 A;  2W1R A;  4CLC B;  4UEY A;  5HWT A;  2A24 B;  1GSW A;  5TBM B;  2VEA A;  3T4T A;  3NOU C;  4M4X A;  5HSQ A;  3UE3 A;  4HH3 A;  2JKT I;  5DF9 A;  3EWK A;  4Q0I A;  1S67 L;  5IU1 A;  1UWN X;  5FL3 A;  1OT9 A;  3CLO A;  3IBJ A;  4EUV A;  4Q0J A;  3IS2 A;  3CIT A;  3T4J A;  3GEC A;  4G3V A;  4QPR A;  2HJ9 C;  1MKM A;  4IJG A;  5F5Y A;  2VA0 A;  3FPW A;  2VGL M;  4NKP A;  4JGQ A;  3SW1 A;  2VV6 A;  3PHY A;  4DJ3 A;  1F5M A;  2PYR A;  4HQA A;  4HY8 A;  3MF0 A;  4CLC D;  4DMZ A;  3E98 A;  4NXF A;  4WN5 A;  3NOP C;  2GZA A;  4Q0H A;  4RQ9 A;  3PBQ A;  5HDD A;  2XRO A;  2HGV A;  2OWJ A;  4I39 A;  3OC2 A;  3RH8 B;  2VV7 A;  2K7S A;  4LRX C;  1XJ3 A;  3LIB A;  4O0P A;  4Y2F A;  3F1O A;  4FOF A;  2Z6D A;  3UMD A;  4CQH A;  4HI4 A;  4L9E A;  3HJK A;  4XT2 B;  1LSW A;  5HZH A;  3MMH A;  5DFX A;  5HPF A;  1TS0 A;  1V9Z A;  1VB6 A;  3OOV A;  1IOU A;  2J3T C;  2WKR A;  3VOL A;  2HJE A;  2P08 A;  1OTI A;  1OT6 A;  1STZ A;  4ARZ B;  1S4S A;  4IUK A;  4GCZ A;  4BJP A;  2J3W A;  4ETZ A;  3CUE C;  2KDK A;  1S66 L;  4LLO B;  3FPV A;  4EER A;  3BJN A;  2G7U A;  4II7 A;  3PBT A;  4WEK A;  4WLA A;  4O01 A;  5CX7 A;  4GHI B;  3EQV A;  3B33 A;  3KSH A;  5HDS A;  4BBV A;  3D72 A;  2EWW A;  2M1C A;  5AVE A;  4GJ4 A;  3TE8 A;  4HOI A;  3PBS A;  1P0Z A;  1TF1 A;  2JHE A;  3E4Q A;  3NHQ A;  2V0U A;  1LT0 A;  4HH2 A;  2W0N A;  4WUJ A;  4CLC C;  1N9N A;  2D01 A;  3DBA A;  3C38 A;  3UE6 A;  1IFQ A;  3T4O A;  1T18 A;  3LR4 A;  2ZOI A;  3S7N A;  3UME A;  2VJW A;  3E4P A;  3MR0 A;  2QJ5 A;  3H9W A;  4H6J A;  3UB9 A;  3NOT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...