1H3QA

Crystal structure of sedl at 2.4 angstroms resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
b'MSGSFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFDRKVQFLGKKHLLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEDLIN
publication title Crystal Structure of Sedl and its Implications for a Genetic Disease Spondyloepiphyseal Dysplasia Tarda
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport
total genus 37
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2002-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04628 Sedlin_N Sedlin, N-terminal conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.70 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1h3qA00
3CUEA 2J3TC 3CUEC 1H3QA 3PR6A 2J3TD 2J3WA 2ZMVA
chains in the Genus database with same CATH superfamily
1RGZA 2VK3A 3V3RA 2H0YA 3T4KA 3UY6A 3PYPA 2C5WB 3ZG0A 1YLPA 2HZ5A 4EWFA 2MJ6A 2Y2NA 4HQAA 4E6WA 3T4TA 3NC8A 2Z2LB 2HP5A 4M4XA 3VP4A 1NJ4A 1NYMA 5HDDA 3HREA 1EI5A 5HAIA 4JF6A 1K25A 3IWOA 1JWVA 3TE8A 2WK0A 1LL5A 2B95A 2PR6A 3O86A 2DMWA 3KYQA 3TOIA 4JGQA 1IYPA 1SKFA 2ZQDA 3T1SA 1BLSA 1HTZA 4ZJ2A 3IHBA 4HI4A 4MCWA 3C8CA 3M6BA 1AXBA 2Y2GA 2INWA 2C6WB 2V1ZA 4B4ZA 3GV9A 1K55A 1VETA 5EOEA 1OTBA 3ULFA 1TS8A 3UB8A 3A3JA 4HHDA 3BWLA 3G31A 3VFHA 4B88A 3CLOA 4I3IA 1OT6A 2ZQ8A 4Q0IA 3SH8A 1VQQA 3BLSA 1NZOA 3HVFA 3LIEA 3H9WA 4KZBA 2JKGA 1D06A 3PBTA 2QWSA 3MSHA 4OPZA 1OTIA 2JKTM 2PBYA 4JXVA 4P6ZS 5EM1A 4ZBEA 1XXMA 3H82B 4NXEA 4YFMA 2XSSA 5DJTA 4CLCA 4DE0A 1K4EA 2ZM0A 3Q07A 5FI2A 3A3IA 1L0DA 4BQMA 2V8FA 2WGWA 2Q0OA 2FZ0A 4LENA 3IT9A 1RGYA 5AQBA 4WZ5A 1KDWA 3PBNA 4P87A 3K3CA 4KZ4A 4GZBA 4S2OA 2Y2KA 3ISGA 1S1ZA 2OLUA 1QMFA 3UDFA 4BL3A 4Y15A 3D9YA 1LLBA 1DP8A 2D01A 5CGSA 2WGVA 2V20A 4QPRA 4DJ2A 1SCWA 2QJ7A 3MZFA 2PDRA 3LI8A 5AQAA 1K56D 4PM8A 2J80A 2J3TC 2KOIA 2W3FA 1WYBA 3G6OA 2QKPA 5EVIB 3LEZA 3FZCA 4R3BA 3H7WA 1ZG4A 4GB7A 3TRCA 5F82A 3I7JA 3ZG9B 4OQIA 3RTYA 1G5UA 2FFYA 1IKGA 4HJ4A 3ZG8B 4OP5A 1WYCA 3F1PA 3P7NA 4OLDA 5HWTA 5LBRA 4PM7A 4UQIS 2O9BA 4Y3IA 3NDGA 5HPIA 3V67A 1ESUA 4XUZA 4KG6A 3HLEA 1KVLA 2Y2LA 3TSGA 1T19A 1LT0A 3T4OA 1P9RA 5HWVA 5DF9A 1N4OA 2O99A 1Q2QA 2Y2PA 3C38A 4ZJ3A 2QHKA 3OCNA 1G68A 2WYXA 4F94A 3VP3A 4ETXA 4OP8A 4YNRA 4U0TA 4OPYA 2OSUA 5FAQA 5HWWA 3EEAA 1DP9A 4BWIA 3N6IA 2QZ6A 4X6TA 3NECA 1H8ZA 1TDGA 4I5SA 1N9LA 4GHIA 3MFXA 1S0WA 4OONA 1JWPA 4MN7A 2Y4AA 3IS2B 4IHQA 2EFUA 5L2FA 3FV7A 1FCNA 2ZMFA 3G2ZA 2WKQA 3UE1A 1H8YA 1GHPA 5L10A 4HESA 3R4KA 5FQMA 5IU1A 3KSFA 4EQ1A 4R0QA 3F1NB 4O0PA 1XA7A 3MXRA 1JNUA 5EVLA 2M7UA 4Y17A 3WRZA 2K31A 5DTTA 5HARA 1TF1A 1XGIA 3CI6A 3DWKA 2XD1A 3SS3A 2CMNA 5HD3A 1YLTA 4AFIA 1CI8A 4S2LA 2JC7A 5EFWA 3EGXC 4S2MA 2PR5A 4DXCA 2OOLA 5I5LA 5FDSA 1IYOA 5CERA 2E8JA 1XKZA 1ERQA 2PU2A 1JWZA 4DF6A 2VGJA 3ZVWA 3V3SA 3HJKA 1SDNA 1PZOA 2K7SA 2DNSA 3VSKA 2EX8A 2PRFA 3IF6A 5CEBA 1QMEA 4RA7A 4K08A 1TS6A 3HCYA 3NY4A 3WS1A 3VE3A 3T12B 3UE0A 1J3WA 5CHMA 3GDIA 1WA9A 4MNRA 4WELA 3VP1A 1P0ZA 5F6AA 3T4SA 1S6RA 5F69A 1L2SA 1MY8A 5GLDA 1H5XA 3GVBA 3IX8A 3MF0A 4H6JA 1FCMA 5AQ7A 1GSXA 1PW1A 2OLVA 5TGFA 4MMNA 4S2IA 4N9LA 2IWCA 4E3NA 5GHZA 2HP6A 1Z09A 2WKIA 2VX8A 1MWRA 2PBDP 4F3LB 1V9ZA 3A3EA 2ZM2A 1MWTA 2EX2A 5I94A 3OZHA 1YSPA 2V2FF 2XRNA 3ZHHA 3MZDA 4S2KA 3M6HA 4Q8IA 3IWQA 1LL9A 2JKRM 4FH4A 4S2PA 5EUAA 1Y28A 4HOIA 1RCJA 2EX9A 3ITAA 4QU3A 4Z1WA 4P6BA 4WUJA 3BQAA 2RCXA 4EEUA 4HY8A 3LUQA 2WAFA 2ZL1B 4E3IA 3S4XA 5BOHA 4LCMA 3HLWA 3E2LA 2HPBA 4FCFA 1OTEA 2K2NA 1ES4A 3HLDA 3VV4A 2EWVA 3D3OA 4QWOA 2Y2IA 3VP0A 4JF4A 2JKFA 4MN5A 4ARZA 3D4FA 3V39A 4GS9A 2Y2JA 3TJZC 2ZBBA 3A3DA 1BLPA 2P7JA 1KE0A 4NG2A 2JN7A 2EWWA 2CC1A 1ONHA 1MZUA 2H0TA 1YLWA 2G2WA 3CAXA 5A8BA 4GW9A 1ES2A 1PWCA 1D1JA 5HZHA 1CEGA 2JHEA 4IUHA 3CUEA 2XROA 2E8IA 5FQKA 5GLCA 5G18A 1W5DA 1T1CA 3H82A 4PHTA 4EBNA 3IBJA 5HW3A 1IOUA 1GHMA 4GDBA 3A0VA 2I72A 3EEHA 4OPQA 2P9VB 3BYDA 4ZAMA 1YAXA 5E43A 4UQIM 4I39A 3JVUA 4HJ3A 2WAEA 4KQDA 3Q7VB 3S7PA 1F2KA 3VE4A 1Y4OA 2P74A 4E3MA 2WZZA 5IT5A 4OQGA 4BMWA 2DRWA 5CGXA 5FI6A 2Y8HA 3UNWA 3FC7A 2L4RA 2XDMA 3BFDA 1DP6A 4EBLA 5MC7A 5CEDA 5KMWA 1LI0A 4P85A 1N9NA 3OBFA 3LYXA 1PI4A 2Y2OA 3IXDA 3HL9A 4X1LA 3W4PA 4NXGA 2V1BA 2VZWA 3R7WB 1KE3A 3PHYA 3AGEA 5EM0A 1K6SA 1PZPA 3JYIA 4HIAA 1FR1A 5HAQA 3DW0A 5DF7A 1SKOA 5HL1A 3C7UA 3G32A 5K5BA 2OWJA 4JKTA 4EQIA 2W27A 3NHQA 2VGLS 3MQOA 1A0KA 1LI9A 1OT9A 3PTEA 4FH2A 3S22A 3D72A 3UN7A 1DJBA 3BM6A 3G2YA 5CTNA 4E6XA 3UDXA 4E3JA 2QYBA 1G28A 4O7DA 4PKYA 4UHUA 3QNCA 1VEUA 2WKEA 3CJMA 5DKKA 5GHXA 2EX6A 4ZRRA 1LHYA 2WKHA 3QP5A 4BD1A 3MXQA 1PNEA 2XLNA 2J3WA 5FQ9A 1DRMA 5EOOA 3M2KA 4QD4A 3TW8A 2HF6A 4R38A 3V50A 4KQQA 4R3JA 4I38A 3G34A 3LR3A 1LSVA 3C7VA 1PI5A 4KENB 4M3KA 4Y0OA 3BECA 4HP9A 3N4IA 1L0FA 1YMXA 1KGFA 3FWLA 5HDCA 2X01A 5F68A 1MBLA 3IWIA 1GCEA 4WEKA 4QHCA 2XD5A 2Q9NA 3CMZA 4Y13A 4HEFA 3IX3A 1KE4A 5C5KA 3IF6C 2BLSA 4DXBA 2A24A 2FFFB 4BLMA 4WN5A 4IVKA 1EWZA 4DDYA 4BBVA 4MBHA 1OJ5A 4GKUA 3IF5A 2QPNA 5G4ZA 1IYQA 5L8MA 4R1GA 3NOUC 1H8MA 2HP9A 4Y7PA 1FSYA 5A90A 3OOVA 2P08A 4EW7A 5FI7A 3SH7A 4Y2FA 2HDQA 2Z6DA 5AQ9A 3S7QA 1O07A 3IH8A 4ZDXA 5HFOA 1SZVA 1L0EA 3RXWA 3CPTA 4XUXA 2R78A 5EECA 3FKWA 5FQIA 1MWUA 4ZJ1A 1CJFA 4C3QA 2A3UA 3MFDA 3C2WA 2ZC5B 3NI9A 3SS5A 3C30A 4OPRA 5J4EA 5CHUA 1XJ2A 3KYEA 1W63M 5HSQA 3F1OB 3E4OA 3QP6A 3W8KA 4EERA 5HAPA 3O88A 3DWZA 2HGVA 5CHJA 3T4JA 4WM9A 3MKFA 4Q0JA 5AVFA 1VHMA 3CITA 4HH3A 2W1TA 2WUQA 1MXOA 4UA7A 1N9BA 5FSRA 2EFXA 4WL9A 4MEZA 2HJEA 4X55A 2L0WA 1NXYA 4ME4A 3EWKA 1K54A 1K57C 5FL3A 1J9MA 2PHYA 4NK3A 4WBGA 5FATA 4ETZA 2OAP1 5F5YA 1RP5A 3UB9A 3UB5P 4F3LA 5FASA 1PRQA 1ODVA 1NLYA 5J3WA 2ZM8A 4JPMA 5TBMB 3WS0A 4JGPA 3FPWA 1ZHHB 3S7NA 4X1MA 1ZG6A 3ZGAB 3QP8A 3KYZA 3E0YA 3SS4A 4FOFA 1T1BA 4N92A 5DF8A 1I2SA 4FD8A 4WEJA 4IBRA 1VETB 2H5SA 4GOGA 3RXXA 3K2NA 4JBFA 3CUEC 2VV8A 5F83A 3S7OA 1I2WA 3EQVA 5GHYA 2A2LA 4BJPA 2XR0A 3HBRA 1KGGA 2OWHA 2DCFA 3VOZA 1F9IA 3ZCZA 3LFVA 4WLAA 2ACGA 1S1YA 4LLOB 2B18A 2JE5A 1HVBA 2VA0A 3IQAA 3DTIA 3HLBA 4LV1A 1MC0A 4IBXA 2GNXA 2YKFA 1MWSA 4EEPA 1L0GA 3RJUA 3LO7A 2ZC4B 1XFNA 1XPBA 2M1CA 2WGWB 1K4FA 4DMZA 2V8CA 4HBTA 4OOYA 3M2JA 2KLIA 4P0MA 2VJWA 3W4OA 4CJNA 4GJ4A 3ICYA 2Y2HA 3MBZA 3W4QA 2O0YA 4O01A 2Y2MA 3K3DA 1XJ6A 1O7EA 4ID4A 4OLGA 3W2ZA 4L0LA 2NUPC 3KSHA 1YPRA 3C5AA 4K0XA 4ZTKA 3MQ0A 1BZAA 3ZQ5A 3KX0X 1BULA 1PYYA 5D3OA 1ALQA 2VGLM 4U0XA 2W3DA 4PAUA 4E3OA 2Y55A 3RH8B 3NOTC 4H8RA 2PT7A 1NY0A 2HDRA 3UPOA 5FQJA 4B4XA 3GR2A 3H7WB 2BASA 3T4LA 4PM5A 3U2AA 2W3HA 3A3FA 1YM1A 1CQAA 5DTSA 3P98A 1PFLA 1D7EA 5GLAA 4EV4A 4XT2B 2ZQ9A 3SH9A 2ZOIA 5TBMA 1K55C 3AGDA 4LRZE 5EVID 1K0KA 4CQHA 2O9AA 1BLHA 3CWFA 4KQOA 4KZ9A 1EROA 3WRTA 3CZDA 3C4OA 2W3EA 4KZ6A 3BJNA 1FILA 2KDKA 5A91A 4P6ZM 5M19A 2L1MA 2QJ5A 1FQGA 4EXOA 4KZ5A 2X71A 2KX6A 2HJ9C 3G35A 2G2UA 5DTKA 3RFBA 4KZAA 3A0SA 1OMEA 3GSGA 3LR0A 5FA7A 2H10A 2BG1A 4CLCC 4LRYC 3OLOA 3SZTA 3UE6A 4JXWA 1ZTUA 4EBPA 4KQRA 2J8YA 2R9XA 1N9OA 4GHIB 4EETB 5TJJA 3N8SA 2XK1A 4WZ5C 5KZHA 2B02A 2XF3A 3SOIA 2J9PA 3VSLA 1C3BA 3BRMA 3OPPA 4IJGA 4G3KA 5F1FA 3NOPC 3LI9A 5HD5A 2J9OA 1BT5A 5IS1A 2W0NA 1CF0A 5GLBA 1T1AA 1AWIA 3B3XA 4RQ9A 3ZNTA 4JXGA 1W63Q 3ITBA 1SDEA 5J7EA 2Q9MA 1OTDA 5DKLA 1YLYA 1SHVA 4HH2A 3U4LP 4JGRA 3BEBA 3OPHA 5U47A 4LFUA 4IEDA 3G30A 2Z6CA 5KSHA 1XJ3A 3NBLA 2RL3A 5JYOA 3Q7ZA 1YMSA 5FAPA 4NETA 2Y79A 5L09A 3IF6B 2NUTC 3UO9A 3HLCA 1K54C 4OKPA 4QJGA 1VM1A 4JLFA 3WS5A 1ONGA 2WADA 4PKYG 3OPRA 2ZC3B 3WS2A 4FUWA 5AJGA 4Y5FA 1FCOA 2VV6A 1FR6A 1STZA 1BYWA 1ERMA 4NKPA 4DN0A 3E4PA 4H6JB 5M18A 3IXBA 5CX7A 5E2FA 4RVAA 5EVIA 2VEAA 1IFQA 4BENA 1BUEA 5F1GA 1YLZA 3N7WA 4D60A 3ZVTA 1P97A 3PAEA 4Z9QA 2HDSA 4KZ8A 4GD8A 3BFGA 3ZG7B 4HJ6A 5JYPA 3GQZA 1T18A 1XA1A 4N1XA 2R9WA 3MR0A 4DKIA 3NIAA 1YKDA 3HLFA 3PBQA 4YWZA 3WS4A 4KZ3A 4II7A 4LV3A 1GHIA 2P04A 2PYRA 1Z6FA 4MN6A 1ESIA 3T1RA 2ZC7A 4JF5A 3ZNYA 3N8LA 2VV7A 2UV0E 2JKTI 3KO6A 3VP2A 1HLUP 1I5QA 1E3UD 4XXRA 3T50A 5L07A 1X0OA 2AVXA 4S2NA 2ZOHA 2XA7S 4ARZB 4DDSA 2BTFP 4L9FA 1U60A 4DE2A 4GS9B 3NDEA 3LR5A 3WWXA 3HLGA 4BL2A 4CPKA 1DJAA 1IKIA 4OQHA 4R3AA 3IS2A 3L7HA 3BLMA 4DE1A 5A92A 2A49A 4KG2A 1BSGA 1W8YA 5CECA 2XFTA 3T1QB 2ZQ7A 3UB7A 5AVEA 4X69A 2GDNA 3F1NA 2WKPA 2VLGA 3N8RA 4EUVA 5HX9A 1YSQA 2Y2QA 4NEED 1WE4A 3QP1A 1HZOA 3IXHA 3ZDJA 2XEPA 3FYZA 3QNBA 4GD6A 4C6YA 2V9AA 2M7VA 5FDHA 1NZUA 4GDNA 3EOIA 2OAQ1 1NRJA 4RYEA 1H3QA 3DBAA 4R4RA 2Y91A 3ZYTA 4UA6A 2ZD8A 1TVFA 4GNUA 1G6AA 4UA9A 4KUOA 5CGWA 4N9KA 4WZ4A 1ES5A 4BD0A 3UDIA 4OOMA 1UWPX 3L9KA 1UWNX 3JVVA 4X53A 1TS7A 3LGOA 3VOYA 4GLQA 4DRTA 5KIZA 1MKIA 2GJ3A 2I9VA 5DVAA 1NRFA 3ZFZA 4JGOA 4Y0TA 1ZKJA 4E3KA 2EXBA 1DJCA 4FSFA 4R6LA 2ZLYA 4KG5A 3HJIA 3LCEA 2Z2MB 3O5YA 4L9GA 5TFQA 4I3AA 2PD8A 3IXGA 5HL6A 1V9YA 1GSVA 2JBFA 1DY6A 4XT2A 3BQ8A 1SKOB 3SW1A 3BY9A 3Q1FA 5HPFA 2XFSA 2GZAA 2W1RA 2ZMAA 3UPNA 3DAVA 3HUMA 2IWBA 3E98A 4UAAA 2IA2A 4E3LA 2XH9A 3IH9A 1S4RA 2WKRA 3UB6A 1E3UA 1OJGA 3PAGA 1S66L 1LL8A 3P01A 2J3TD 2FH5A 3DTMA 3NJAA 1VEUB 1KGEA 1PWDA 5FAOA 1M40A 3IX4A 3LIBA 2YKHA 2ZL1A 4WMCD 3T1XA 4KZ7A 5E2GA 1K6RA 4QB8A 4X25A 1ZC2A 4DJ3A 4GN2A 4R23A 4IVIA 1K38A 4DE3A 1OPXA 4K91A 1XJ4A 3LICA 3MMHA 4LRXC 5TR7A 3LIFA 3PR6A 3B47A 4G3WA 2OV5A 4L9EA 1XP4A 4ESPA 4CLCB 4LV2A 4PMAA 5HDSA 1OTAA 1F98A 1FIKA 2A24B 3EGDC 5DJUA 3MKEA 1XX2A 4PM6A 2X02A 5KSCA 3P09A 1E25A 5GL9A 1P9WA 1H0MA 2PAVP 3DTEA 2HDUA 2J7VA 1S67L 3VOLA 2H28A 3A0RA 5EVIC 5FQQA 1YT4A 1PIOA 2PYPA 5CRFA 2P9VA 3CPTB 3GECA 4G3VA 3NULA 3IHAA 3O3VA 4R4SA 4LV0A 3Q7VA 3LY4A 5EVEA 4HNBA 2V0WA 1PW8A 3CHWP 5FEFA 3PBOA 3UMEA 1KVMA 3BW6A 1K56A 4A5RA 3OCLA 3PBRA 4JXSA 2ZMVA 4R70A 2V1AA 1IELA 2D02A 1Q2PA 3DTKA 4QY6A 3S1YA 3BY8A 1PWGA 4I3JA 2IWDA 4B9OA 2JKRI 5E2HA 4LCLA 1VB6A 4S2JA 3C4PA 5EV0A 3OC2A 1TDLA 5FEGA 3HUNA 4Y0UA 4B93A 3O87A 4N1HA 3Q81A 5DFXA 2W1TB 5CTMA 2XA7M 3LIDA 4LPZA 1L3LA 3FG8A 4WF0A 3F1PB 5M1AA 1F5MA 4PM9A 1HD8A 3OPLA 3T4QA 2ZC6B 1S4SA 1E4DA 1W79A 4LGWA 4MLLA 4S2NC 1G6OA 3R7WA 1LSWA 2GX5A 5CXWA 1CEFA 4D2OA 3Q82A 3VMAA 4WYYA 1M6KA 1CK3A 2EA9A 3LY3A 3MXSA 3GTCA 4KUKA 1GA0A 3GMWA 3IBRA 2V0UA 4WMCA 1BTLA 2XGNA 4BBTA 2ZQCA 4C75A 2Y59A 3VFFA 2ZQAA 2ZJ9A 4BBUA 1JVJA 5G4YA 4MBFA 4CLCE 2JCHA 1FOFA 5J8XA 2UWXA 3MZEA 4NXBA 1MKMA 1TS0A 2B5RA 5EE8A 2LB9A 1W7FA 3UPPA 3LR4A 1TEMA 4EUZA 3G4PA 4X56A 1K57A 5IHVA 4OH0A 3ZG5A 3AGFA 5EPHA 2W3GA 3MS6A 4U3TA 3HUOA 3LEQA 3FPVA 1MPLA 1XGJA 3B33A 4IUKA 4OOLA 3GRJA 3KSGA 3BFFA 4PPRA 4NXFA 3FKVA 4FTXA 1BLCA 5A93A 2XQZA 1TD5A 2VKSA 1ES3A 3KSIA 4Q0HA 2PU4A 4EU0A 4OQ0A 1NWZA 1Y54A 1EW0A 1LSXA 3BFEA 4OVDA 3EQUA 1XFQA 1YLJA 3CG5A 1GA9A 3TG9A 3BFCA 4UEYA 4CLCD 4RX3A 3JPUA 4YOFA 2WZXA 1UGUA 3PXPA 1GSWA 2HV1A 4X68A 3V5MA 5E2EA 2PD7A 4GCZA 3PBSA 4EESA 4MBKA 1NLZA 1FSWA 2EXAA 3E4QA 3QP2A 5DFYA 2LB5A 1CI9A 1NYYA 2VGKA 3MJQA 1KOUA 4YINA 3MQQA 3LIAA 4QY5A 3UE3A 1YQSA 1W8QA 1ACFA 3QHYA 1KDSA 1JTGA 3UMDA 3QP4A 4E04A 2WGIA 2QMIA 4RX2A 4HP4A 1IEMA 3E2KA 3B42A 1JTDA 4MDZA 4HBUA 2O9CA 3F1OA 4O8GA 1IYSA 3NCKA 2G7UA 4K0WA
chains in the Genus database with same CATH topology
1MC0A 3T4KA 2GNXA 2YKFA 4KUOA 3PYPA 4EEPA 1OTEA 2K2NA 4OOMA 2MJ6A 1XFNA 1UWPX 4HQAA 3VV4A 2M1CA 2EWVA 3D3OA 1UWNX 3JVVA 4DMZA 3T4TA 1TS7A 2KLIA 4M4XA 2VJWA 4GLQA 5KIZA 5HDDA 4MN5A 4ARZA 4GJ4A 2GJ3A 2I9VA 3ICYA 4GS9A 2O0YA 4JGOA 3TJZC 3TE8A 4O01A 2ZBBA 4FSFA 2PR6A 3K3DA 2P7JA 4R6LA 1XJ6A 2DMWA 2JN7A 3W2ZA 3KYQA 3HJIA 4JGQA 4L0LA 3O5YA 2EWWA 2NUPC 3KSHA 4L9GA 4I3AA 1MZUA 2PD8A 4HI4A 5HL6A 4MCWA 1V9YA 3C8CA 3CAXA 5A8BA 3MQ0A 4GW9A 2INWA 1GSVA 3ZQ5A 3KX0X 2VGLM 5HZHA 4XT2A 2W3DA 3BQ8A 4PAUA 3SW1A 2JHEA 3BY9A 4IUHA 3CUEA 1OTBA 2XROA 3ULFA 1TS8A 3UB8A 3RH8B 3NOTC 4HHDA 5HPFA 1T1CA 2GZAA 2W1RA 3H82A 4PHTA 2PT7A 3IBJA 3BWLA 1IOUA 3CLOA 4I3IA 3E98A 1OT6A 3H7WB 4Q0IA 2IA2A 2BASA 3T4LA 3U2AA 3A0VA 1S4RA 2W3HA 3EEHA 3LIEA 2WKRA 3UB6A 1OJGA 3H9WA 1D7EA 1S66L 1LL8A 3P01A 2J3TD 1D06A 1YAXA 2FH5A 3NJAA 3PBTA 4UQIM 4I39A 3JVUA 2QWSA 4HJ3A 4XT2B 1OTIA 2JKTM 4KQDA 3S7PA 4P6ZS 2ZOIA 5TBMA 3VE4A 3LIBA 2YKHA 3H82B 4NXEA 4LRZE 5IT5A 4CQHA 2XSSA 5DJTA 2O9AA 4BMWA 4CLCA 3CWFA 4KQOA 4DJ3A 2Y8HA 1OPXA 2W3EA 3FC7A 1XJ4A 2L4RA 3BJNA 3LICA 2KDKA 1DP6A 4P6ZM 3MMHA 2FZ0A 2L1MA 4LRXC 5MC7A 2QJ5A 4EXOA 3PBNA 1N9NA 3LIFA 3PR6A 2KX6A 3B47A 4G3WA 3K3CA 2HJ9C 3OBFA 3RFBA 4L9EA 3LYXA 1S1ZA 4CLCB 3A0SA 3LR0A 5HDSA 4CLCC 4LRYC 4NXGA 3OLOA 3UE6A 2V1BA 2VZWA 3R7WB 1ZTUA 1OTAA 1F98A 3PHYA 2A24B 3EGDC 1DP8A 5DJUA 2D01A 1N9OA 4HIAA 4GHIB 4EETB 5TJJA 4QPRA 4DJ2A 2QJ7A 2PDRA 3LI8A 2B02A 5K5BA 2J80A 2J3TC 2OWJA 1P9WA 4HY8A 2W27A 2KOIA 3NHQA 2VGLS 3MQOA 2W3FA 3G6OA 1S67L 1OT9A 3VOLA 2QKPA 3D72A 4IJGA 2H28A 3A0RA 4G3KA 3H7WA 3NOPC 3LI9A 3TRCA 5HD5A 2PYPA 2QYBA 1G28A 4PKYA 3RTYA 5IS1A 3GECA 4G3VA 2W0NA 5DKKA 4ZRRA 4HJ4A 1T1AA 4RQ9A 3MXQA 3F1PA 4HNBA 3P7NA 2V0WA 2J3WA 1W63Q 5HWTA 1DRMA 5LBRA 3PBOA 3UMEA 4UQIS 2O9BA 3BW6A 4Y3IA 5J7EA 3OCLA 3PBRA 2HF6A 3TW8A 1OTDA 4R38A 5HPIA 3V67A 2ZMVA 4R70A 2V1AA 4I38A 5DKLA 2D02A 3BY8A 3LR3A 1T19A 1LSVA 4I3JA 4B9OA 2JKRI 1LT0A 3T4OA 4HH2A 1VB6A 4JGRA 1P9RA 4HP9A 5HWVA 3OC2A 5DF9A 2O99A 4B93A 2Z6CA 5KSHA 5HDCA 5DFXA 3C38A 2QHKA 2W1TB 2XA7M 1XJ3A 3LIDA 4LPZA 3OCNA 5F68A 3FG8A 4WF0A 3F1PB 1F5MA 4ETXA 3T4QA 1S4SA 4WEKA 4YNRA 2Y79A 2NUTC 5HWWA 3EEAA 1G6OA 5C5KA 3R7WA 1DP9A 4BWIA 2A24A 4PKYG 4WN5A 1LSWA 2GX5A 4BBVA 4I5SA 1OJ5A 5G4ZA 1N9LA 5AJGA 4GHIA 4Y5FA 5L8MA 2VV6A 3MFXA 1H8MA 3NOUC 2EA9A 4MN7A 3IS2B 4IHQA 1STZA 1BYWA 4NKPA 4KUKA 3OOVA 2ZMFA 2P08A 2WKQA 4DN0A 3E4PA 3IBRA 4H6JB 4EW7A 2V0UA 5CX7A 3R4KA 4BBTA 5IU1A 3KSFA 4Y2FA 2Z6DA 3S7QA 4EQ1A 3F1NB 4O0PA 2VEAA 1IFQA 4BBUA 5G4YA 4CLCE 1P97A 1JNUA 2M7UA 4NXBA 1MKMA 1TS0A 2LB9A 2R78A 2K31A 4HJ6A 3LR4A 1TF1A 1T18A 3C2WA 3CI6A 3C30A 5J4EA 3MR0A 2CMNA 1XJ2A 1YKDA 5HD3A 3PBQA 4YWZA 4AFIA 5EFWA 4II7A 3EGXC 1W63M 5HSQA 2PR5A 2P04A 2W3GA 3F1OB 2OOLA 3E4OA 5I5LA 2PYRA 4EERA 3FPVA 3B33A 4IUKA 4MN6A 4OOLA 2HGVA 3KSGA 3T4JA 4Q0JA 5AVFA 1VHMA 4NXFA 2VV7A 3CITA 3HJKA 4HH3A 2JKTI 3KO6A 2W1TA 2K7SA 3T50A 4WL9A 1X0OA 1TD5A 2HJEA 2L0WA 2VKSA 4ME4A 3KSIA 4Q0HA 3EWKA 4EU0A 1NWZA 2ZOHA 2XA7S 5FL3A 1EW0A 1LSXA 4ARZB 2PHYA 3EQUA 1XFQA 4L9FA 4K08A 4ETZA 1TS6A 2OAP1 3HCYA 5F5YA 4GS9B 3VE3A 3LR5A 4UEYA 4CLCD 3GDIA 1WA9A 3UB9A 4F3LA 4YOFA 4WELA 1UGUA 3PXPA 1P0ZA 5F6AA 3T4SA 1ODVA 5F69A 1GSWA 1NLYA 5J3WA 4R3AA 2HV1A 3IS2A 4JGPA 3FPWA 2PD7A 1ZHHB 4GCZA 3PBSA 4EESA 1NLZA 3MF0A 4H6JA 3S7NA 3E4QA 5DFYA 3KYZA 1GSXA 3E0YA 2LB5A 3UB7A 5AVEA 3MJQA 4FOFA 1T1BA 3F1NA 4MMNA 1KOUA 4WEJA 3MQQA 3LIAA 3UE3A 2WKPA 2VLGA 2VX8A 3K2NA 4F3LB 3CUEC 1V9ZA 4EUVA 1YSQA 2VV8A 4NEED 3UMDA 3S7OA 1YSPA 2XRNA 2V9AA 3EQVA 2M7VA 4E04A 2A2LA 4BJPA 2OWHA 4HP4A 2JKRM 3EOIA 1F9IA 2OAQ1 1NRJA 1Y28A 3B42A 3LFVA 4HOIA 4WLAA 1H3QA 4MDZA 3DBAA 1S1YA 4LLOB 4Z1WA 4WUJA 2B18A 3BQAA 3ZYTA 2O9CA 3F1OA 4O8GA 4EEUA 2VA0A 2G7UA 5TBMB 3LUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUE A;  2J3T C;  3CUE C;  1H3Q A;  3PR6 A;  2J3T D;  2J3W A;  2ZMV A; 
#chains in the Genus database with same CATH topology
 1RGZ A;  2VK3 A;  3V3R A;  2H0Y A;  3T4K A;  3UY6 A;  3PYP A;  2C5W B;  3ZG0 A;  1YLP A;  2HZ5 A;  4EWF A;  2MJ6 A;  2Y2N A;  4HQA A;  4E6W A;  3T4T A;  3NC8 A;  2Z2L B;  2HP5 A;  4M4X A;  3VP4 A;  1NJ4 A;  1NYM A;  5HDD A;  3HRE A;  1EI5 A;  5HAI A;  4JF6 A;  1K25 A;  3IWO A;  1JWV A;  3TE8 A;  2WK0 A;  1LL5 A;  2B95 A;  2PR6 A;  3O86 A;  2DMW A;  3KYQ A;  3TOI A;  4JGQ A;  1IYP A;  1SKF A;  2ZQD A;  3T1S A;  1BLS A;  1HTZ A;  4ZJ2 A;  3IHB A;  4HI4 A;  4MCW A;  3C8C A;  3M6B A;  1AXB A;  2Y2G A;  2INW A;  2C6W B;  2V1Z A;  4B4Z A;  3GV9 A;  1K55 A;  1VET A;  5EOE A;  1OTB A;  3ULF A;  1TS8 A;  3UB8 A;  3A3J A;  4HHD A;  3BWL A;  3G31 A;  3VFH A;  4B88 A;  3CLO A;  4I3I A;  1OT6 A;  2ZQ8 A;  4Q0I A;  3SH8 A;  1VQQ A;  3BLS A;  1NZO A;  3HVF A;  3LIE A;  3H9W A;  4KZB A;  2JKG A;  1D06 A;  3PBT A;  2QWS A;  3MSH A;  4OPZ A;  1OTI A;  2JKT M;  2PBY A;  4JXV A;  4P6Z S;  5EM1 A;  4ZBE A;  1XXM A;  3H82 B;  4NXE A;  4YFM A;  2XSS A;  5DJT A;  4CLC A;  4DE0 A;  1K4E A;  2ZM0 A;  3Q07 A;  5FI2 A;  3A3I A;  1L0D A;  4BQM A;  2V8F A;  2WGW A;  2Q0O A;  2FZ0 A;  4LEN A;  3IT9 A;  1RGY A;  5AQB A;  4WZ5 A;  1KDW A;  3PBN A;  4P87 A;  3K3C A;  4KZ4 A;  4GZB A;  4S2O A;  2Y2K A;  3ISG A;  1S1Z A;  2OLU A;  1QMF A;  3UDF A;  4BL3 A;  4Y15 A;  3D9Y A;  1LLB A;  1DP8 A;  2D01 A;  5CGS A;  2WGV A;  2V20 A;  4QPR A;  4DJ2 A;  1SCW A;  2QJ7 A;  3MZF A;  2PDR A;  3LI8 A;  5AQA A;  1K56 D;  4PM8 A;  2J80 A;  2J3T C;  2KOI A;  2W3F A;  1WYB A;  3G6O A;  2QKP A;  5EVI B;  3LEZ A;  3FZC A;  4R3B A;  3H7W A;  1ZG4 A;  4GB7 A;  3TRC A;  5F82 A;  3I7J A;  3ZG9 B;  4OQI A;  3RTY A;  1G5U A;  2FFY A;  1IKG A;  4HJ4 A;  3ZG8 B;  4OP5 A;  1WYC A;  3F1P A;  3P7N A;  4OLD A;  5HWT A;  5LBR A;  4PM7 A;  4UQI S;  2O9B A;  4Y3I A;  3NDG A;  5HPI A;  3V67 A;  1ESU A;  4XUZ A;  4KG6 A;  3HLE A;  1KVL A;  2Y2L A;  3TSG A;  1T19 A;  1LT0 A;  3T4O A;  1P9R A;  5HWV A;  5DF9 A;  1N4O A;  2O99 A;  1Q2Q A;  2Y2P A;  3C38 A;  4ZJ3 A;  2QHK A;  3OCN A;  1G68 A;  2WYX A;  4F94 A;  3VP3 A;  4ETX A;  4OP8 A;  4YNR A;  4U0T A;  4OPY A;  2OSU A;  5FAQ A;  5HWW A;  3EEA A;  1DP9 A;  4BWI A;  3N6I A;  2QZ6 A;  4X6T A;  3NEC A;  1H8Z A;  1TDG A;  4I5S A;  1N9L A;  4GHI A;  3MFX A;  1S0W A;  4OON A;  1JWP A;  4MN7 A;  2Y4A A;  3IS2 B;  4IHQ A;  2EFU A;  5L2F A;  3FV7 A;  1FCN A;  2ZMF A;  3G2Z A;  2WKQ A;  3UE1 A;  1H8Y A;  1GHP A;  5L10 A;  4HES A;  3R4K A;  5FQM A;  5IU1 A;  3KSF A;  4EQ1 A;  4R0Q A;  3F1N B;  4O0P A;  1XA7 A;  3MXR A;  1JNU A;  5EVL A;  2M7U A;  4Y17 A;  3WRZ A;  2K31 A;  5DTT A;  5HAR A;  1TF1 A;  1XGI A;  3CI6 A;  3DWK A;  2XD1 A;  3SS3 A;  2CMN A;  5HD3 A;  1YLT A;  4AFI A;  1CI8 A;  4S2L A;  2JC7 A;  5EFW A;  3EGX C;  4S2M A;  2PR5 A;  4DXC A;  2OOL A;  5I5L A;  5FDS A;  1IYO A;  5CER A;  2E8J A;  1XKZ A;  1ERQ A;  2PU2 A;  1JWZ A;  4DF6 A;  2VGJ A;  3ZVW A;  3V3S A;  3HJK A;  1SDN A;  1PZO A;  2K7S A;  2DNS A;  3VSK A;  2EX8 A;  2PRF A;  3IF6 A;  5CEB A;  1QME A;  4RA7 A;  4K08 A;  1TS6 A;  3HCY A;  3NY4 A;  3WS1 A;  3VE3 A;  3T12 B;  3UE0 A;  1J3W A;  5CHM A;  3GDI A;  1WA9 A;  4MNR A;  4WEL A;  3VP1 A;  1P0Z A;  5F6A A;  3T4S A;  1S6R A;  5F69 A;  1L2S A;  1MY8 A;  5GLD A;  1H5X A;  3GVB A;  3IX8 A;  3MF0 A;  4H6J A;  1FCM A;  5AQ7 A;  1GSX A;  1PW1 A;  2OLV A;  5TGF A;  4MMN A;  4S2I A;  4N9L A;  2IWC A;  4E3N A;  5GHZ A;  2HP6 A;  1Z09 A;  2WKI A;  2VX8 A;  1MWR A;  2PBD P;  4F3L B;  1V9Z A;  3A3E A;  2ZM2 A;  1MWT A;  2EX2 A;  5I94 A;  3OZH A;  1YSP A;  2V2F F;  2XRN A;  3ZHH A;  3MZD A;  4S2K A;  3M6H A;  4Q8I A;  3IWQ A;  1LL9 A;  2JKR M;  4FH4 A;  4S2P A;  5EUA A;  1Y28 A;  4HOI A;  1RCJ A;  2EX9 A;  3ITA A;  4QU3 A;  4Z1W A;  4P6B A;  4WUJ A;  3BQA A;  2RCX A;  4EEU A;  4HY8 A;  3LUQ A;  2WAF A;  2ZL1 B;  4E3I A;  3S4X A;  5BOH A;  4LCM A;  3HLW A;  3E2L A;  2HPB A;  4FCF A;  1OTE A;  2K2N A;  1ES4 A;  3HLD A;  3VV4 A;  2EWV A;  3D3O A;  4QWO A;  2Y2I A;  3VP0 A;  4JF4 A;  2JKF A;  4MN5 A;  4ARZ A;  3D4F A;  3V39 A;  4GS9 A;  2Y2J A;  3TJZ C;  2ZBB A;  3A3D A;  1BLP A;  2P7J A;  1KE0 A;  4NG2 A;  2JN7 A;  2EWW A;  2CC1 A;  1ONH A;  1MZU A;  2H0T A;  1YLW A;  2G2W A;  3CAX A;  5A8B A;  4GW9 A;  1ES2 A;  1PWC A;  1D1J A;  5HZH A;  1CEG A;  2JHE A;  4IUH A;  3CUE A;  2XRO A;  2E8I A;  5FQK A;  5GLC A;  5G18 A;  1W5D A;  1T1C A;  3H82 A;  4PHT A;  4EBN A;  3IBJ A;  5HW3 A;  1IOU A;  1GHM A;  4GDB A;  3A0V A;  2I72 A;  3EEH A;  4OPQ A;  2P9V B;  3BYD A;  4ZAM A;  1YAX A;  5E43 A;  4UQI M;  4I39 A;  3JVU A;  4HJ3 A;  2WAE A;  4KQD A;  3Q7V B;  3S7P A;  1F2K A;  3VE4 A;  1Y4O A;  2P74 A;  4E3M A;  2WZZ A;  5IT5 A;  4OQG A;  4BMW A;  2DRW A;  5CGX A;  5FI6 A;  2Y8H A;  3UNW A;  3FC7 A;  2L4R A;  2XDM A;  3BFD A;  1DP6 A;  4EBL A;  5MC7 A;  5CED A;  5KMW A;  1LI0 A;  4P85 A;  1N9N A;  3OBF A;  3LYX A;  1PI4 A;  2Y2O A;  3IXD A;  3HL9 A;  4X1L A;  3W4P A;  4NXG A;  2V1B A;  2VZW A;  3R7W B;  1KE3 A;  3PHY A;  3AGE A;  5EM0 A;  1K6S A;  1PZP A;  3JYI A;  4HIA A;  1FR1 A;  5HAQ A;  3DW0 A;  5DF7 A;  1SKO A;  5HL1 A;  3C7U A;  3G32 A;  5K5B A;  2OWJ A;  4JKT A;  4EQI A;  2W27 A;  3NHQ A;  2VGL S;  3MQO A;  1A0K A;  1LI9 A;  1OT9 A;  3PTE A;  4FH2 A;  3S22 A;  3D72 A;  3UN7 A;  1DJB A;  3BM6 A;  3G2Y A;  5CTN A;  4E6X A;  3UDX A;  4E3J A;  2QYB A;  1G28 A;  4O7D A;  4PKY A;  4UHU A;  3QNC A;  1VEU A;  2WKE A;  3CJM A;  5DKK A;  5GHX A;  2EX6 A;  4ZRR A;  1LHY A;  2WKH A;  3QP5 A;  4BD1 A;  3MXQ A;  1PNE A;  2XLN A;  2J3W A;  5FQ9 A;  1DRM A;  5EOO A;  3M2K A;  4QD4 A;  3TW8 A;  2HF6 A;  4R38 A;  3V50 A;  4KQQ A;  4R3J A;  4I38 A;  3G34 A;  3LR3 A;  1LSV A;  3C7V A;  1PI5 A;  4KEN B;  4M3K A;  4Y0O A;  3BEC A;  4HP9 A;  3N4I A;  1L0F A;  1YMX A;  1KGF A;  3FWL A;  5HDC A;  2X01 A;  5F68 A;  1MBL A;  3IWI A;  1GCE A;  4WEK A;  4QHC A;  2XD5 A;  2Q9N A;  3CMZ A;  4Y13 A;  4HEF A;  3IX3 A;  1KE4 A;  5C5K A;  3IF6 C;  2BLS A;  4DXB A;  2A24 A;  2FFF B;  4BLM A;  4WN5 A;  4IVK A;  1EWZ A;  4DDY A;  4BBV A;  4MBH A;  1OJ5 A;  4GKU A;  3IF5 A;  2QPN A;  5G4Z A;  1IYQ A;  5L8M A;  4R1G A;  3NOU C;  1H8M A;  2HP9 A;  4Y7P A;  1FSY A;  5A90 A;  3OOV A;  2P08 A;  4EW7 A;  5FI7 A;  3SH7 A;  4Y2F A;  2HDQ A;  2Z6D A;  5AQ9 A;  3S7Q A;  1O07 A;  3IH8 A;  4ZDX A;  5HFO A;  1SZV A;  1L0E A;  3RXW A;  3CPT A;  4XUX A;  2R78 A;  5EEC A;  3FKW A;  5FQI A;  1MWU A;  4ZJ1 A;  1CJF A;  4C3Q A;  2A3U A;  3MFD A;  3C2W A;  2ZC5 B;  3NI9 A;  3SS5 A;  3C30 A;  4OPR A;  5J4E A;  5CHU A;  1XJ2 A;  3KYE A;  1W63 M;  5HSQ A;  3F1O B;  3E4O A;  3QP6 A;  3W8K A;  4EER A;  5HAP A;  3O88 A;  3DWZ A;  2HGV A;  5CHJ A;  3T4J A;  4WM9 A;  3MKF A;  4Q0J A;  5AVF A;  1VHM A;  3CIT A;  4HH3 A;  2W1T A;  2WUQ A;  1MXO A;  4UA7 A;  1N9B A;  5FSR A;  2EFX A;  4WL9 A;  4MEZ A;  2HJE A;  4X55 A;  2L0W A;  1NXY A;  4ME4 A;  3EWK A;  1K54 A;  1K57 C;  5FL3 A;  1J9M A;  2PHY A;  4NK3 A;  4WBG A;  5FAT A;  4ETZ A;  2OAP 1;  5F5Y A;  1RP5 A;  3UB9 A;  3UB5 P;  4F3L A;  5FAS A;  1PRQ A;  1ODV A;  1NLY A;  5J3W A;  2ZM8 A;  4JPM A;  5TBM B;  3WS0 A;  4JGP A;  3FPW A;  1ZHH B;  3S7N A;  4X1M A;  1ZG6 A;  3ZGA B;  3QP8 A;  3KYZ A;  3E0Y A;  3SS4 A;  4FOF A;  1T1B A;  4N92 A;  5DF8 A;  1I2S A;  4FD8 A;  4WEJ A;  4IBR A;  1VET B;  2H5S A;  4GOG A;  3RXX A;  3K2N A;  4JBF A;  3CUE C;  2VV8 A;  5F83 A;  3S7O A;  1I2W A;  3EQV A;  5GHY A;  2A2L A;  4BJP A;  2XR0 A;  3HBR A;  1KGG A;  2OWH A;  2DCF A;  3VOZ A;  1F9I A;  3ZCZ A;  3LFV A;  4WLA A;  2ACG A;  1S1Y A;  4LLO B;  2B18 A;  2JE5 A;  1HVB A;  2VA0 A;  3IQA A;  3DTI A;  3HLB A;  4LV1 A;  1MC0 A;  4IBX A;  2GNX A;  2YKF A;  1MWS A;  4EEP A;  1L0G A;  3RJU A;  3LO7 A;  2ZC4 B;  1XFN A;  1XPB A;  2M1C A;  2WGW B;  1K4F A;  4DMZ A;  2V8C A;  4HBT A;  4OOY A;  3M2J A;  2KLI A;  4P0M A;  2VJW A;  3W4O A;  4CJN A;  4GJ4 A;  3ICY A;  2Y2H A;  3MBZ A;  3W4Q A;  2O0Y A;  4O01 A;  2Y2M A;  3K3D A;  1XJ6 A;  1O7E A;  4ID4 A;  4OLG A;  3W2Z A;  4L0L A;  2NUP C;  3KSH A;  1YPR A;  3C5A A;  4K0X A;  4ZTK A;  3MQ0 A;  1BZA A;  3ZQ5 A;  3KX0 X;  1BUL A;  1PYY A;  5D3O A;  1ALQ A;  2VGL M;  4U0X A;  2W3D A;  4PAU A;  4E3O A;  2Y55 A;  3RH8 B;  3NOT C;  4H8R A;  2PT7 A;  1NY0 A;  2HDR A;  3UPO A;  5FQJ A;  4B4X A;  3GR2 A;  3H7W B;  2BAS A;  3T4L A;  4PM5 A;  3U2A A;  2W3H A;  3A3F A;  1YM1 A;  1CQA A;  5DTS A;  3P98 A;  1PFL A;  1D7E A;  5GLA A;  4EV4 A;  4XT2 B;  2ZQ9 A;  3SH9 A;  2ZOI A;  5TBM A;  1K55 C;  3AGD A;  4LRZ E;  5EVI D;  1K0K A;  4CQH A;  2O9A A;  1BLH A;  3CWF A;  4KQO A;  4KZ9 A;  1ERO A;  3WRT A;  3CZD A;  3C4O A;  2W3E A;  4KZ6 A;  3BJN A;  1FIL A;  2KDK A;  5A91 A;  4P6Z M;  5M19 A;  2L1M A;  2QJ5 A;  1FQG A;  4EXO A;  4KZ5 A;  2X71 A;  2KX6 A;  2HJ9 C;  3G35 A;  2G2U A;  5DTK A;  3RFB A;  4KZA A;  3A0S A;  1OME A;  3GSG A;  3LR0 A;  5FA7 A;  2H10 A;  2BG1 A;  4CLC C;  4LRY C;  3OLO A;  3SZT A;  3UE6 A;  4JXW A;  1ZTU A;  4EBP A;  4KQR A;  2J8Y A;  2R9X A;  1N9O A;  4GHI B;  4EET B;  5TJJ A;  3N8S A;  2XK1 A;  4WZ5 C;  5KZH A;  2B02 A;  2XF3 A;  3SOI A;  2J9P A;  3VSL A;  1C3B A;  3BRM A;  3OPP A;  4IJG A;  4G3K A;  5F1F A;  3NOP C;  3LI9 A;  5HD5 A;  2J9O A;  1BT5 A;  5IS1 A;  2W0N A;  1CF0 A;  5GLB A;  1T1A A;  1AWI A;  3B3X A;  4RQ9 A;  3ZNT A;  4JXG A;  1W63 Q;  3ITB A;  1SDE A;  5J7E A;  2Q9M A;  1OTD A;  5DKL A;  1YLY A;  1SHV A;  4HH2 A;  3U4L P;  4JGR A;  3BEB A;  3OPH A;  5U47 A;  4LFU A;  4IED A;  3G30 A;  2Z6C A;  5KSH A;  1XJ3 A;  3NBL A;  2RL3 A;  5JYO A;  3Q7Z A;  1YMS A;  5FAP A;  4NET A;  2Y79 A;  5L09 A;  3IF6 B;  2NUT C;  3UO9 A;  3HLC A;  1K54 C;  4OKP A;  4QJG A;  1VM1 A;  4JLF A;  3WS5 A;  1ONG A;  2WAD A;  4PKY G;  3OPR A;  2ZC3 B;  3WS2 A;  4FUW A;  5AJG A;  4Y5F A;  1FCO A;  2VV6 A;  1FR6 A;  1STZ A;  1BYW A;  1ERM A;  4NKP A;  4DN0 A;  3E4P A;  4H6J B;  5M18 A;  3IXB A;  5CX7 A;  5E2F A;  4RVA A;  5EVI A;  2VEA A;  1IFQ A;  4BEN A;  1BUE A;  5F1G A;  1YLZ A;  3N7W A;  4D60 A;  3ZVT A;  1P97 A;  3PAE A;  4Z9Q A;  2HDS A;  4KZ8 A;  4GD8 A;  3BFG A;  3ZG7 B;  4HJ6 A;  5JYP A;  3GQZ A;  1T18 A;  1XA1 A;  4N1X A;  2R9W A;  3MR0 A;  4DKI A;  3NIA A;  1YKD A;  3HLF A;  3PBQ A;  4YWZ A;  3WS4 A;  4KZ3 A;  4II7 A;  4LV3 A;  1GHI A;  2P04 A;  2PYR A;  1Z6F A;  4MN6 A;  1ESI A;  3T1R A;  2ZC7 A;  4JF5 A;  3ZNY A;  3N8L A;  2VV7 A;  2UV0 E;  2JKT I;  3KO6 A;  3VP2 A;  1HLU P;  1I5Q A;  1E3U D;  4XXR A;  3T50 A;  5L07 A;  1X0O A;  2AVX A;  4S2N A;  2ZOH A;  2XA7 S;  4ARZ B;  4DDS A;  2BTF P;  4L9F A;  1U60 A;  4DE2 A;  4GS9 B;  3NDE A;  3LR5 A;  3WWX A;  3HLG A;  4BL2 A;  4CPK A;  1DJA A;  1IKI A;  4OQH A;  4R3A A;  3IS2 A;  3L7H A;  3BLM A;  4DE1 A;  5A92 A;  2A49 A;  4KG2 A;  1BSG A;  1W8Y A;  5CEC A;  2XFT A;  3T1Q B;  2ZQ7 A;  3UB7 A;  5AVE A;  4X69 A;  2GDN A;  3F1N A;  2WKP A;  2VLG A;  3N8R A;  4EUV A;  5HX9 A;  1YSQ A;  2Y2Q A;  4NEE D;  1WE4 A;  3QP1 A;  1HZO A;  3IXH A;  3ZDJ A;  2XEP A;  3FYZ A;  3QNB A;  4GD6 A;  4C6Y A;  2V9A A;  2M7V A;  5FDH A;  1NZU A;  4GDN A;  3EOI A;  2OAQ 1;  1NRJ A;  4RYE A;  1H3Q A;  3DBA A;  4R4R A;  2Y91 A;  3ZYT A;  4UA6 A;  2ZD8 A;  1TVF A;  4GNU A;  1G6A A;  4UA9 A;  4KUO A;  5CGW A;  4N9K A;  4WZ4 A;  1ES5 A;  4BD0 A;  3UDI A;  4OOM A;  1UWP X;  3L9K A;  1UWN X;  3JVV A;  4X53 A;  1TS7 A;  3LGO A;  3VOY A;  4GLQ A;  4DRT A;  5KIZ A;  1MKI A;  2GJ3 A;  2I9V A;  5DVA A;  1NRF A;  3ZFZ A;  4JGO A;  4Y0T A;  1ZKJ A;  4E3K A;  2EXB A;  1DJC A;  4FSF A;  4R6L A;  2ZLY A;  4KG5 A;  3HJI A;  3LCE A;  2Z2M B;  3O5Y A;  4L9G A;  5TFQ A;  4I3A A;  2PD8 A;  3IXG A;  5HL6 A;  1V9Y A;  1GSV A;  2JBF A;  1DY6 A;  4XT2 A;  3BQ8 A;  1SKO B;  3SW1 A;  3BY9 A;  3Q1F A;  5HPF A;  2XFS A;  2GZA A;  2W1R A;  2ZMA A;  3UPN A;  3DAV A;  3HUM A;  2IWB A;  3E98 A;  4UAA A;  2IA2 A;  4E3L A;  2XH9 A;  3IH9 A;  1S4R A;  2WKR A;  3UB6 A;  1E3U A;  1OJG A;  3PAG A;  1S66 L;  1LL8 A;  3P01 A;  2J3T D;  2FH5 A;  3DTM A;  3NJA A;  1VEU B;  1KGE A;  1PWD A;  5FAO A;  1M40 A;  3IX4 A;  3LIB A;  2YKH A;  2ZL1 A;  4WMC D;  3T1X A;  4KZ7 A;  5E2G A;  1K6R A;  4QB8 A;  4X25 A;  1ZC2 A;  4DJ3 A;  4GN2 A;  4R23 A;  4IVI A;  1K38 A;  4DE3 A;  1OPX A;  4K91 A;  1XJ4 A;  3LIC A;  3MMH A;  4LRX C;  5TR7 A;  3LIF A;  3PR6 A;  3B47 A;  4G3W A;  2OV5 A;  4L9E A;  1XP4 A;  4ESP A;  4CLC B;  4LV2 A;  4PMA A;  5HDS A;  1OTA A;  1F98 A;  1FIK A;  2A24 B;  3EGD C;  5DJU A;  3MKE A;  1XX2 A;  4PM6 A;  2X02 A;  5KSC A;  3P09 A;  1E25 A;  5GL9 A;  1P9W A;  1H0M A;  2PAV P;  3DTE A;  2HDU A;  2J7V A;  1S67 L;  3VOL A;  2H28 A;  3A0R A;  5EVI C;  5FQQ A;  1YT4 A;  1PIO A;  2PYP A;  5CRF A;  2P9V A;  3CPT B;  3GEC A;  4G3V A;  3NUL A;  3IHA A;  3O3V A;  4R4S A;  4LV0 A;  3Q7V A;  3LY4 A;  5EVE A;  4HNB A;  2V0W A;  1PW8 A;  3CHW P;  5FEF A;  3PBO A;  3UME A;  1KVM A;  3BW6 A;  1K56 A;  4A5R A;  3OCL A;  3PBR A;  4JXS A;  2ZMV A;  4R70 A;  2V1A A;  1IEL A;  2D02 A;  1Q2P A;  3DTK A;  4QY6 A;  3S1Y A;  3BY8 A;  1PWG A;  4I3J A;  2IWD A;  4B9O A;  2JKR I;  5E2H A;  4LCL A;  1VB6 A;  4S2J A;  3C4P A;  5EV0 A;  3OC2 A;  1TDL A;  5FEG A;  3HUN A;  4Y0U A;  4B93 A;  3O87 A;  4N1H A;  3Q81 A;  5DFX A;  2W1T B;  5CTM A;  2XA7 M;  3LID A;  4LPZ A;  1L3L A;  3FG8 A;  4WF0 A;  3F1P B;  5M1A A;  1F5M A;  4PM9 A;  1HD8 A;  3OPL A;  3T4Q A;  2ZC6 B;  1S4S A;  1E4D A;  1W79 A;  4LGW A;  4MLL A;  4S2N C;  1G6O A;  3R7W A;  1LSW A;  2GX5 A;  5CXW A;  1CEF A;  4D2O A;  3Q82 A;  3VMA A;  4WYY A;  1M6K A;  1CK3 A;  2EA9 A;  3LY3 A;  3MXS A;  3GTC A;  4KUK A;  1GA0 A;  3GMW A;  3IBR A;  2V0U A;  4WMC A;  1BTL A;  2XGN A;  4BBT A;  2ZQC A;  4C75 A;  2Y59 A;  3VFF A;  2ZQA A;  2ZJ9 A;  4BBU A;  1JVJ A;  5G4Y A;  4MBF A;  4CLC E;  2JCH A;  1FOF A;  5J8X A;  2UWX A;  3MZE A;  4NXB A;  1MKM A;  1TS0 A;  2B5R A;  5EE8 A;  2LB9 A;  1W7F A;  3UPP A;  3LR4 A;  1TEM A;  4EUZ A;  3G4P A;  4X56 A;  1K57 A;  5IHV A;  4OH0 A;  3ZG5 A;  3AGF A;  5EPH A;  2W3G A;  3MS6 A;  4U3T A;  3HUO A;  3LEQ A;  3FPV A;  1MPL A;  1XGJ A;  3B33 A;  4IUK A;  4OOL A;  3GRJ A;  3KSG A;  3BFF A;  4PPR A;  4NXF A;  3FKV A;  4FTX A;  1BLC A;  5A93 A;  2XQZ A;  1TD5 A;  2VKS A;  1ES3 A;  3KSI A;  4Q0H A;  2PU4 A;  4EU0 A;  4OQ0 A;  1NWZ A;  1Y54 A;  1EW0 A;  1LSX A;  3BFE A;  4OVD A;  3EQU A;  1XFQ A;  1YLJ A;  3CG5 A;  1GA9 A;  3TG9 A;  3BFC A;  4UEY A;  4CLC D;  4RX3 A;  3JPU A;  4YOF A;  2WZX A;  1UGU A;  3PXP A;  1GSW A;  2HV1 A;  4X68 A;  3V5M A;  5E2E A;  2PD7 A;  4GCZ A;  3PBS A;  4EES A;  4MBK A;  1NLZ A;  1FSW A;  2EXA A;  3E4Q A;  3QP2 A;  5DFY A;  2LB5 A;  1CI9 A;  1NYY A;  2VGK A;  3MJQ A;  1KOU A;  4YIN A;  3MQQ A;  3LIA A;  4QY5 A;  3UE3 A;  1YQS A;  1W8Q A;  1ACF A;  3QHY A;  1KDS A;  1JTG A;  3UMD A;  3QP4 A;  4E04 A;  2WGI A;  2QMI A;  4RX2 A;  4HP4 A;  1IEM A;  3E2K A;  3B42 A;  1JTD A;  4MDZ A;  4HBU A;  2O9C A;  3F1O A;  4O8G A;  1IYS A;  3NCK A;  2G7U A;  4K0W A; 
#chains in the Genus database with same CATH homology
 1MC0 A;  3T4K A;  2GNX A;  2YKF A;  4KUO A;  3PYP A;  4EEP A;  1OTE A;  2K2N A;  4OOM A;  2MJ6 A;  1XFN A;  1UWP X;  4HQA A;  3VV4 A;  2M1C A;  2EWV A;  3D3O A;  1UWN X;  3JVV A;  4DMZ A;  3T4T A;  1TS7 A;  2KLI A;  4M4X A;  2VJW A;  4GLQ A;  5KIZ A;  5HDD A;  4MN5 A;  4ARZ A;  4GJ4 A;  2GJ3 A;  2I9V A;  3ICY A;  4GS9 A;  2O0Y A;  4JGO A;  3TJZ C;  3TE8 A;  4O01 A;  2ZBB A;  4FSF A;  2PR6 A;  3K3D A;  2P7J A;  4R6L A;  1XJ6 A;  2DMW A;  2JN7 A;  3W2Z A;  3KYQ A;  3HJI A;  4JGQ A;  4L0L A;  3O5Y A;  2EWW A;  2NUP C;  3KSH A;  4L9G A;  4I3A A;  1MZU A;  2PD8 A;  4HI4 A;  5HL6 A;  4MCW A;  1V9Y A;  3C8C A;  3CAX A;  5A8B A;  3MQ0 A;  4GW9 A;  2INW A;  1GSV A;  3ZQ5 A;  3KX0 X;  2VGL M;  5HZH A;  4XT2 A;  2W3D A;  3BQ8 A;  4PAU A;  3SW1 A;  2JHE A;  3BY9 A;  4IUH A;  3CUE A;  1OTB A;  2XRO A;  3ULF A;  1TS8 A;  3UB8 A;  3RH8 B;  3NOT C;  4HHD A;  5HPF A;  1T1C A;  2GZA A;  2W1R A;  3H82 A;  4PHT A;  2PT7 A;  3IBJ A;  3BWL A;  1IOU A;  3CLO A;  4I3I A;  3E98 A;  1OT6 A;  3H7W B;  4Q0I A;  2IA2 A;  2BAS A;  3T4L A;  3U2A A;  3A0V A;  1S4R A;  2W3H A;  3EEH A;  3LIE A;  2WKR A;  3UB6 A;  1OJG A;  3H9W A;  1D7E A;  1S66 L;  1LL8 A;  3P01 A;  2J3T D;  1D06 A;  1YAX A;  2FH5 A;  3NJA A;  3PBT A;  4UQI M;  4I39 A;  3JVU A;  2QWS A;  4HJ3 A;  4XT2 B;  1OTI A;  2JKT M;  4KQD A;  3S7P A;  4P6Z S;  2ZOI A;  5TBM A;  3VE4 A;  3LIB A;  2YKH A;  3H82 B;  4NXE A;  4LRZ E;  5IT5 A;  4CQH A;  2XSS A;  5DJT A;  2O9A A;  4BMW A;  4CLC A;  3CWF A;  4KQO A;  4DJ3 A;  2Y8H A;  1OPX A;  2W3E A;  3FC7 A;  1XJ4 A;  2L4R A;  3BJN A;  3LIC A;  2KDK A;  1DP6 A;  4P6Z M;  3MMH A;  2FZ0 A;  2L1M A;  4LRX C;  5MC7 A;  2QJ5 A;  4EXO A;  3PBN A;  1N9N A;  3LIF A;  3PR6 A;  2KX6 A;  3B47 A;  4G3W A;  3K3C A;  2HJ9 C;  3OBF A;  3RFB A;  4L9E A;  3LYX A;  1S1Z A;  4CLC B;  3A0S A;  3LR0 A;  5HDS A;  4CLC C;  4LRY C;  4NXG A;  3OLO A;  3UE6 A;  2V1B A;  2VZW A;  3R7W B;  1ZTU A;  1OTA A;  1F98 A;  3PHY A;  2A24 B;  3EGD C;  1DP8 A;  5DJU A;  2D01 A;  1N9O A;  4HIA A;  4GHI B;  4EET B;  5TJJ A;  4QPR A;  4DJ2 A;  2QJ7 A;  2PDR A;  3LI8 A;  2B02 A;  5K5B A;  2J80 A;  2J3T C;  2OWJ A;  1P9W A;  4HY8 A;  2W27 A;  2KOI A;  3NHQ A;  2VGL S;  3MQO A;  2W3F A;  3G6O A;  1S67 L;  1OT9 A;  3VOL A;  2QKP A;  3D72 A;  4IJG A;  2H28 A;  3A0R A;  4G3K A;  3H7W A;  3NOP C;  3LI9 A;  3TRC A;  5HD5 A;  2PYP A;  2QYB A;  1G28 A;  4PKY A;  3RTY A;  5IS1 A;  3GEC A;  4G3V A;  2W0N A;  5DKK A;  4ZRR A;  4HJ4 A;  1T1A A;  4RQ9 A;  3MXQ A;  3F1P A;  4HNB A;  3P7N A;  2V0W A;  2J3W A;  1W63 Q;  5HWT A;  1DRM A;  5LBR A;  3PBO A;  3UME A;  4UQI S;  2O9B A;  3BW6 A;  4Y3I A;  5J7E A;  3OCL A;  3PBR A;  2HF6 A;  3TW8 A;  1OTD A;  4R38 A;  5HPI A;  3V67 A;  2ZMV A;  4R70 A;  2V1A A;  4I38 A;  5DKL A;  2D02 A;  3BY8 A;  3LR3 A;  1T19 A;  1LSV A;  4I3J A;  4B9O A;  2JKR I;  1LT0 A;  3T4O A;  4HH2 A;  1VB6 A;  4JGR A;  1P9R A;  4HP9 A;  5HWV A;  3OC2 A;  5DF9 A;  2O99 A;  4B93 A;  2Z6C A;  5KSH A;  5HDC A;  5DFX A;  3C38 A;  2QHK A;  2W1T B;  2XA7 M;  1XJ3 A;  3LID A;  4LPZ A;  3OCN A;  5F68 A;  3FG8 A;  4WF0 A;  3F1P B;  1F5M A;  4ETX A;  3T4Q A;  1S4S A;  4WEK A;  4YNR A;  2Y79 A;  2NUT C;  5HWW A;  3EEA A;  1G6O A;  5C5K A;  3R7W A;  1DP9 A;  4BWI A;  2A24 A;  4PKY G;  4WN5 A;  1LSW A;  2GX5 A;  4BBV A;  4I5S A;  1OJ5 A;  5G4Z A;  1N9L A;  5AJG A;  4GHI A;  4Y5F A;  5L8M A;  2VV6 A;  3MFX A;  1H8M A;  3NOU C;  2EA9 A;  4MN7 A;  3IS2 B;  4IHQ A;  1STZ A;  1BYW A;  4NKP A;  4KUK A;  3OOV A;  2ZMF A;  2P08 A;  2WKQ A;  4DN0 A;  3E4P A;  3IBR A;  4H6J B;  4EW7 A;  2V0U A;  5CX7 A;  3R4K A;  4BBT A;  5IU1 A;  3KSF A;  4Y2F A;  2Z6D A;  3S7Q A;  4EQ1 A;  3F1N B;  4O0P A;  2VEA A;  1IFQ A;  4BBU A;  5G4Y A;  4CLC E;  1P97 A;  1JNU A;  2M7U A;  4NXB A;  1MKM A;  1TS0 A;  2LB9 A;  2R78 A;  2K31 A;  4HJ6 A;  3LR4 A;  1TF1 A;  1T18 A;  3C2W A;  3CI6 A;  3C30 A;  5J4E A;  3MR0 A;  2CMN A;  1XJ2 A;  1YKD A;  5HD3 A;  3PBQ A;  4YWZ A;  4AFI A;  5EFW A;  4II7 A;  3EGX C;  1W63 M;  5HSQ A;  2PR5 A;  2P04 A;  2W3G A;  3F1O B;  2OOL A;  3E4O A;  5I5L A;  2PYR A;  4EER A;  3FPV A;  3B33 A;  4IUK A;  4MN6 A;  4OOL A;  2HGV A;  3KSG A;  3T4J A;  4Q0J A;  5AVF A;  1VHM A;  4NXF A;  2VV7 A;  3CIT A;  3HJK A;  4HH3 A;  2JKT I;  3KO6 A;  2W1T A;  2K7S A;  3T50 A;  4WL9 A;  1X0O A;  1TD5 A;  2HJE A;  2L0W A;  2VKS A;  4ME4 A;  3KSI A;  4Q0H A;  3EWK A;  4EU0 A;  1NWZ A;  2ZOH A;  2XA7 S;  5FL3 A;  1EW0 A;  1LSX A;  4ARZ B;  2PHY A;  3EQU A;  1XFQ A;  4L9F A;  4K08 A;  4ETZ A;  1TS6 A;  2OAP 1;  3HCY A;  5F5Y A;  4GS9 B;  3VE3 A;  3LR5 A;  4UEY A;  4CLC D;  3GDI A;  1WA9 A;  3UB9 A;  4F3L A;  4YOF A;  4WEL A;  1UGU A;  3PXP A;  1P0Z A;  5F6A A;  3T4S A;  1ODV A;  5F69 A;  1GSW A;  1NLY A;  5J3W A;  4R3A A;  2HV1 A;  3IS2 A;  4JGP A;  3FPW A;  2PD7 A;  1ZHH B;  4GCZ A;  3PBS A;  4EES A;  1NLZ A;  3MF0 A;  4H6J A;  3S7N A;  3E4Q A;  5DFY A;  3KYZ A;  1GSX A;  3E0Y A;  2LB5 A;  3UB7 A;  5AVE A;  3MJQ A;  4FOF A;  1T1B A;  3F1N A;  4MMN A;  1KOU A;  4WEJ A;  3MQQ A;  3LIA A;  3UE3 A;  2WKP A;  2VLG A;  2VX8 A;  3K2N A;  4F3L B;  3CUE C;  1V9Z A;  4EUV A;  1YSQ A;  2VV8 A;  4NEE D;  3UMD A;  3S7O A;  1YSP A;  2XRN A;  2V9A A;  3EQV A;  2M7V A;  4E04 A;  2A2L A;  4BJP A;  2OWH A;  4HP4 A;  2JKR M;  3EOI A;  1F9I A;  2OAQ 1;  1NRJ A;  1Y28 A;  3B42 A;  3LFV A;  4HOI A;  4WLA A;  1H3Q A;  4MDZ A;  3DBA A;  1S1Y A;  4LLO B;  4Z1W A;  4WUJ A;  2B18 A;  3BQA A;  3ZYT A;  2O9C A;  3F1O A;  4O8G A;  4EEU A;  2VA0 A;  2G7U A;  5TBM B;  3LUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...