1H3QA

Crystal structure of sedl at 2.4 angstroms resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
MSGSFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFDRKVQFLGKKHLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Sedl and its Implications for a Genetic Disease Spondyloepiphyseal Dysplasia Tarda
pubmed doi rcsb
molecule keywords SEDLIN
source organism Mus musculus
molecule tags Transport
total genus 37
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2002-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04628 Sedlin_N Sedlin, N-terminal conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.70 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1h3qA00
2J3TC 3CUEC 2J3TD 3PR6A 3CUEA 1H3QA 2J3WA 2ZMVA
chains in the Genus database with same CATH superfamily
2O99A 2DCFA 3TW8A 1RP5A 1MWUA 3EOIA 3FKWA 4JF4A 4L9GA 3IXDA 3O5YA 4JKTA 1IFQA 3W4PA 2ZMAA 2GDNA 4DJ3A 4JXGA 5DKKA 2HV1A 3SS3A 2QJ7A 5FDHA 2VEAA 1NJ4A 2EA9A 3UN7A 1MZUA 4L9EA 1HZOA 3ZVWA 3PXPA 5E2FA 1XJ2A 2ZQ8A 3V67A 2JBFA 3GQZA 2HP6A 2QWSA 2C6WB 1OTDA 1MWTA 2OLVA 3NI9A 3VFHA 3CLOA 4P87A 5A91A 4N92A 1TVFA 2VGJA 5E43A 4EETB 2EX2A 2H10A 5FA7A 2UWXA 4BL2A 3T1SA 1ES3A 3V3RA 1CK3A 2KLIA 2V8CA 1OT6A 2ZC6B 3IX8A 3UMDA 2O9BA 1GCEA 3IF6C 3UB5P 3FKVA 4ZBEA 1JVJA 2FFFB 1XA7A 4KG6A 3LR0A 3M6HA 4K0WA 4GN2A 3F1PA 3GMWA 2X02A 1ESUA 5JYPA 1KE3A 2LB5A 3G34A 1U60A 3P7NA 1OJ5A 3FZCA 3T4KA 3BY9A 1A0KA 5DF7A 1S66L 5K5BA 5CGWA 1OTEA 3D72A 1TS6A 2Q0OA 4Y7PA 1NRFA 5CTNA 1PWDA 3ZGAB 4IEDA 4S2NC 4O8GA 3VE4A 3T4SA 4KZ7A 5IS1A 4P0MA 3KSFA 2O9CA 3MSHA 4CLCA 3GRJA 1ES5A 1F5MA 2W27A 2V20A 1GHMA 3LI9A 4B88A 4DJ2A 5GLBA 3HUMA 4XXRA 3ZFZA 4KUKA 2Q9NA 2V1ZA 1H8ZA 3D4FA 3UE3A 2QKPA 3ZG0A 1MWSA 4LV2A 3RXWA 2OV5A 4A5RA 4R3AA 2W3EA 3Q7VB 5KSHA 3CITA 1T1BA 1E25A 3N6IA 3A3EA 3VP2A 5CX7A 1BULA 1YT4A 5HL1A 4OPZA 1ODVA 5L8MA 2Y91A 2HJEA 3LIDA 4MNRA 4YOFA 3LEZA 4IVIA 1TDGA 2ZM2A 1P9WA 5IU1A 3LEQA 1FCNA 4Y0OA 1TDLA 3TJZC 1GHPA 2PYRA 2DMWA 4YNRA 1PI5A 3CPTA 1WA9A 1H3QA 3BWLA 1TS8A 3H82A 4F3LA 4ZRRA 1PFLA 1MXOA 3UE1A 3IBJA 4HP4A 1KGEA 1I5QA 1ZHHB 4MBHA 3PBTA 2E8JA 4PKYA 4PM7A 4PM6A 5A92A 5GLCA 3KSGA 4QD4A 4I3AA 2ZQDA 1K4FA 3IXBA 4NXEA 4UA7A 1FSWA 1XPBA 3PAEA 5AQ7A 1ZC2A 1DY6A 3BJNA 1XJ3A 3C2WA 2ZOHA 3DW0A 3A0VA 3KSHA 5HAQA 4GCZA 1H8MA 5TFQA 1JTDA 5I94A 3IHBA 4KUOA 5EUAA 2ZM8A 3LR5A 4GHIA 4BD1A 4KZ3A 4QJGA 4LENA 1MKMA 3M6BA 5EVIA 4CPKA 4EBLA 1LLBA 2H5SA 4BWIA 3F1OB 4FCFA 1LI9A 4PM5A 1PWGA 1Y4OA 4GOGA 3K3DA 4QY5A 2Y4AA 5J3WA 4NXBA 4S2IA 2FH5A 3VP1A 4NEED 3NCKA 1Q2QA 4X69A 1T1AA 5FEFA 1XGJA 4OKPA 5DF9A 3ZDJA 5EV0A 1J9MA 1YSPA 5F6AA 5FQJA 3HCYA 3PBQA 3HLBA 3KYZA 4JXSA 5EM1A 2WAFA 2XDMA 4GLQA 4NG2A 5HZHA 4FD8A 3E0YA 4IJGA 4ZAMA 1YLYA 4RQ9A 2ZC5B 4R3BA 1N4OA 2JKRI 1PZPA 1YAXA 3TSGA 3HBRA 3UE6A 2ZC3B 4S2OA 3N8SA 5HFOA 1YMSA 3DTIA 5CGSA 5CHJA 3WWXA 4WLAA 2EX6A 4MN5A 3O3VA 2FZ0A 1VB6A 1SKFA 2WKEA 2CMNA 3BM6A 4EESA 4OPRA 2BG1A 5DF8A 5JYOA 4U0XA 4LCMA 2Y2IA 3SW1A 1FR6A 3OCLA 1GA9A 3HUOA 2K7SA 1ERMA 2OWJA 1SHVA 3BW6A 4ETZA 2VA0A 1N9OA 3MQQA 4S2LA 1FCMA 4LFUA 2JKFA 1LHYA 3PTEA 2OLUA 2PYPA 3V50A 1DP9A 4DXBA 1XXMA 2GJ3A 4S2KA 5TR7A 3LIBA 2EFXA 3BECA 3BFGA 4B93A 2XFSA 5EOOA 5I5LA 2B5RA 3BFDA 4MBFA 4EEUA 3S7NA 4R1GA 1JNUA 3LR3A 2PR6A 3CWFA 4KG2A 1E3UD 1K54C 5TGFA 1NYMA 2Y2OA 4R6LA 3T1QB 3RXXA 3MKEA 4GD6A 1T18A 3LY4A 2WKRA 4DRTA 4OONA 3SS5A 1CEFA 3UY6A 2A49A 3FPVA 3PBOA 1YSQA 1D1JA 2K31A 2A24A 3BYDA 4WEJA 4Y0UA 3PBNA 1BSGA 3VOZA 3NOUC 3T4QA 3LYXA 3FYZA 1G28A 4S2PA 1PW1A 4E3KA 4HESA 4IUKA 1OTAA 2OAP1 1YQSA 2Y55A 1YLPA 3E2KA 1KVLA 4MN6A 2OWHA 5E2GA 3D9YA 2Y2JA 1CI9A 2PU2A 4QHCA 2Y2LA 4HBUA 2BTFP 1UWPX 3E98A 2VV7A 3HLGA 4S2NA 3IQAA 3GV9A 1JWPA 4BD0A 2WYXA 1G6OA 3UO9A 4NK3A 5HWVA 4OOMA 3ZVTA 4U3TA 4K08A 2R9WA 4Y3IA 1XFNA 3IWIA 4WZ5C 5HW3A 2VLGA 3W4QA 3N7WA 2C5WB 4RX2A 3WS4A 3HLCA 5L2FA 4N9LA 4GDNA 4NKPA 4LRYC 3UB8A 4XT2A 2MJ6A 5FQQA 3VOYA 2I9VA 3C30A 1K4EA 1L0FA 2I72A 1D7EA 3T4OA 4EXOA 4YINA 2K2NA 1CF0A 2XH9A 4PAUA 1EWZA 4JXWA 2Y2QA 1K6RA 3QP8A 4UA6A 1DJCA 3UPOA 3M2JA 2P9VA 4M4XA 3W4OA 3T12B 2IWDA 3T4JA 3NIAA 3NOPC 3PBRA 4GD8A 4KZBA 4OPYA 3CUEC 1JWZA 4N9KA 1DJAA 1W5DA 2VV6A 3G32A 3B33A 3FWLA 2E8IA 5GLDA 2WGWB 1GSXA 1NY0A 3HLWA 4Q8IA 4R3JA 3WS0A 2ZOIA 5F82A 3QNBA 5J8XA 5F68A 3IT9A 5A93A 2EX9A 1VETA 1IYPA 3DBAA 4OOLA 3A0SA 2ACGA 5AVEA 5EPHA 4X53A 2UV0E 1LL9A 3UB7A 2W1TA 3EGDC 2Z6DA 1NYYA 3Q7ZA 3AGEA 4X55A 4LV3A 4BL3A 5HWWA 3JPUA 3HLEA 4WELA 4N1XA 4K91A 4RX3A 3WS1A 4KZ4A 5DTSA 1ZG6A 5TBMA 4GS9A 5GHYA 1TF1A 3T1RA 2H0TA 3GR2A 2W3GA 4DKIA 5HX9A 3MXRA 4I3IA 4M3KA 3G2YA 3VSLA 3VOLA 4E3IA 2Y2KA 1KGFA 4KZ5A 3R7WA 4HBTA 2G2WA 3LR4A 1H8YA 2EXBA 4C75A 1KDSA 1D06A 5CECA 3IBRA 4L9FA 5FQKA 1NLZA 3F1PB 4ZJ2A 3QP5A 4ETXA 3IS2A 3W2ZA 4JGPA 4JGQA 2J3TD 1NZOA 2V2FF 4X1MA 5AQAA 2ZMFA 3E4PA 3G31A 5G18A 2OOLA 3D3OA 2PBDP 3DTKA 3MQ0A 1PZOA 1ZTUA 2VGLM 1T19A 5HD5A 3MXSA 5EVEA 3WRZA 4S2MA 1XA1A 1IKGA 1DRMA 1P97A 3CMZA 3MS6A 1FQGA 2HDQA 2B18A 3S22A 1LL8A 4NETA 1YLZA 3LUQA 4CLCB 3UMEA 3G4PA 4GNUA 4JGOA 4KZ9A 4OLGA 5KMWA 3R4KA 4MDZA 4MEZA 3DWZA 3QNCA 3PBSA 2O9AA 4FSFA 4EWFA 5FI6A 3BFCA 4E3JA 1FSYA 3OCNA 1K57C 4EU0A 1TD5A 3ZHHA 4GW9A 5C5KA 4CLCE 4FUWA 1EI5A 5E2EA 1Z6FA 1BYWA 2B95A 2HJ9C 4X6TA 1C3BA 3IXHA 1WYBA 1E4DA 2WKQA 4KQRA 2NUPC 3O88A 2P08A 2XK1A 3NDGA 3ISGA 2EXAA 4FTXA 2WZXA 3HLDA 4E6WA 4Q0HA 5F69A 2D02A 2HZ5A 5M18A 4CLCD 1AXBA 5M19A 1FOFA 5HPIA 3F1NA 2ZL1A 4LPZA 4YWZA 1LSVA 1TS0A 3K3CA 3Q07A 3CPTB 2DNSA 4IUHA 4PHTA 2XROA 3H82B 4F3LB 1DP8A 3QHYA 3AGDA 4S2JA 3DAVA 2WGIA 5F1GA 5KZHA 4NXGA 2V0UA 5EFWA 4R4RA 5EVLA 1OPXA 2Q9MA 2ZQ7A 1F98A 1H0MA 1EW0A 2X01A 5DJTA 3BLSA 3A3IA 5DVAA 4K0XA 3Q1FA 4R70A 4DE1A 2PD7A 2Y59A 1YLJA 5CXWA 2ZQ9A 3UPPA 1JWVA 1N9NA 1ONGA 4MBKA 1YMXA 4X56A 3N8LA 3HJIA 1K38A 2A3UA 3LI8A 4I38A 3MZDA 2P74A 4EBPA 3ITBA 2PT7A 4ZJ1A 4YFMA 4BQMA 3QP6A 1VEUA 2WADA 4Q0IA 1CEGA 4O7DA 5F83A 5AQBA 5CRFA 1M6KA 5CHMA 3HREA 4GHIB 1G5UA 3S7PA 3LIAA 5HL6A 2JKTM 2PR5A 4BLMA 2VV8A 1XX2A 2J9OA 4I3JA 1AWIA 1GSVA 2ZQAA 1QMEA 4E3OA 4LGWA 1O7EA 4B9OA 2WAEA 3QP2A 1S1ZA 2Y8HA 1BUEA 1ZKJA 3MKFA 1W8YA 3OPPA 1YLWA 2HF6A 4JBFA 4P6ZM 5HPFA 4WZ5A 2JHEA 3E4QA 4KQQA 2P04A 3UB6A 4Y17A 4GDBA 4ARZA 4HI4A 1FIKA 2VZWA 5FL3A 2J8YA 4OP8A 3T4TA 4QWOA 1K56A 4ZDXA 3UPNA 5GHXA 2L4RA 2ZBBA 3DWKA 3A3DA 4WMCA 2VX8A 4KQOA 3H9WA 5EVID 4WBGA 1NWZA 3JYIA 3OLOA 3TRCA 5HD3A 4AFIA 3FG8A 1F9IA 3CI6A 4H6JA 4KZ8A 3NBLA 2H0YA 3SS4A 1LL5A 3GTCA 1BLSA 3RTYA 3KYEA 3G30A 2Y79A 3BY8A 1P9RA 4HIAA 1BT5A 3KYQA 3EWKA 2Y2MA 3I7JA 4EUZA 3B47A 2HP5A 1G68A 5FQIA 4IVKA 3MQOA 1I2SA 3LCEA 3E2LA 5U47A 1OJGA 4HP9A 3TE8A 5HWTA 3HLFA 4C3QA 2INWA 4WN5A 3NDEA 2V0WA 3HUNA 4EERA 1MY8A 5FAOA 3NC8A 5BOHA 1K56D 3VV4A 4NXFA 2XRNA 4OQIA 4EV4A 1IYSA 2ZMVA 2VKSA 3IF6A 5DFXA 2J7VA 4UEYA 1ALQA 5E2HA 5GLAA 2G2UA 4XUXA 2W3DA 3KSIA 2J3WA 2PU4A 4HOIA 3NY4A 4JGRA 5CEBA 4Y15A 3BEBA 5G4YA 2HP9A 2BLSA 5FI7A 2A24B 1MKIA 4OP5A 2IWBA 2XLNA 3IH8A 4EW7A 1W63Q 4QB8A 4D2OA 1KE0A 1N9LA 2X71A 4L0LA 4DDYA 4G3VA 4GKUA 4P85A 4OQHA 4Z9QA 3HL9A 1MBLA 3MFXA 2V8FA 1MPLA 1HVBA 3MBZA 1ES4A 1L2SA 3O86A 3MR0A 5GL9A 5L09A 4MN7A 3H7WA 1XP4A 4ID4A 3BRMA 1PIOA 2KX6A 4B4ZA 5F5YA 1S4RA 2DRWA 2J9PA 2IWCA 3TG9A 5HDDA 2RL3A 3UDFA 1X0OA 4KENB 1SKOA 1NLYA 4MLLA 3FV7A 1GA0A 1UWNX 1BLPA 2M7UA 5F1FA 1K55C 4OLDA 4UAAA 4XT2B 4DF6A 1K57A 1MWRA 4E04A 1LSXA 1ERQA 4DE2A 1S4SA 3OC2A 5A8BA 1YM1A 3L7HA 3G6OA 4C6YA 3BLMA 5KIZA 1XFQA 2P9VB 4G3KA 4BBVA 4GZBA 4EEPA 2O0YA 2W0NA 2ZM0A 2B02A 2XA7M 3P01A 4HY8A 1BLHA 4Y2FA 2QJ5A 1PYYA 1STZA 2EFUA 2PHYA 3NULA 2M7VA 3MF0A 3SOIA 1NRJA 5TJJA 1XJ4A 2GX5A 3WS5A 3IX4A 2QZ6A 3IH9A 1W8QA 1KE4A 2H28A 4QU3A 5IT5A 2QMIA 5FQMA 2VK3A 1VETB 1V9YA 3DTEA 2R9XA 3UDXA 4DXCA 2OAQ1 3ZG5A 1DJBA 1XGIA 2Z2LB 5L07A 3VMAA 5HAPA 3LGOA 5AQ9A 4XUZA 3EGXC 1IYOA 3S7OA 2XA7S 3S4XA 2W1TB 5CTMA 2QYBA 2KOIA 4GJ4A 2V1BA 3OBFA 3VP0A 4ESPA 4E3NA 3VSKA 5FSRA 2QHKA 4FH2A 2WGVA 4MCWA 2XEPA 3NJAA 5EM0A 2L0WA 2XR0A 1V9ZA 5TBMB 4GS9B 4II7A 2JKTI 4KQDA 3PHYA 3LFVA 4GB7A 3EEAA 1T1CA 3G2ZA 1PWCA 3MJQA 3ULFA 1LI0A 2W3HA 2VGKA 3ZNYA 3R7WB 3C5AA 1N9BA 3MMHA 1IOUA 4WEKA 2Z2MB 2WKIA 3IS2B 1GHIA 3EEHA 4HHDA 5KSCA 3FPWA 2YKHA 3VFFA 4BBUA 3T4LA 4WM9A 2HPBA 2G7UA 3WRTA 3EQVA 4LRXC 2KDKA 3B42A 1OMEA 4X1LA 3SZTA 5HDCA 4FH4A 4WZ4A 1JTGA 4E3LA 2W1RA 1BLCA 4UHUA 2Y2HA 3T50A 1G6AA 4FOFA 4HH3A 1FR1A 2WK0A 4RVAA 2EWWA 2GNXA 4JXVA 4IBRA 5FAQA 4H8RA 2LB9A 1S1YA 3Q7VA 2OSUA 2XF3A 2VGLS 1CI8A 3LY3A 5FATA 1GSWA 1TS7A 3LO7A 3GECA 4BBTA 5HDSA 2ZLYA 3IF5A 3ZQ5A 1KVMA 3G35A 3B3XA 4Y13A 2W3FA 4DMZA 4IBXA 4HQAA 5CGXA 5EOEA 3V3SA 1F2KA 3C7VA 5J7EA 1NZUA 4KZAA 2WZZA 3MZFA 4DE3A 3UE0A 5CHUA 3KO6A 2QPNA 1ES2A 1OT9A 3FC7A 3BFFA 3IWOA 2PRFA 5GHZA 1UGUA 1W79A 3CJMA 1J3WA 4Q0JA 2ZD8A 3CAXA 1PI4A 1S67L 2J3TC 1K6SA 4LLOB 4E3MA 5FAPA 3RFBA 3A0RA 3OPRA 3UDIA 2V9AA 1NXYA 3F1NB 2ZL1B 2XD5A 4R0QA 1RGYA 3C38A 1VQQA 1K54A 4HH2A 4DE0A 3JVVA 4EBNA 1Q2PA 2Y2NA 1K25A 4QY6A 3S1YA 5M1AA 3LIEA 4X68A 2RCXA 5DJUA 1KOUA 2VJWA 5HAIA 3BQAA 2WUQA 4ME4A 3A3FA 1YKDA 1IELA 1ZG4A 4B4XA 5DFYA 3U4LP 3W8KA 2HDUA 2IA2A 1BTLA 3IXGA 3AGFA 4PM8A 3SH9A 3Q81A 3VP4A 1M40A 3P09A 3F1OA 4R23A 1FILA 2PAVP 4JF5A 4PKYG 3ITAA 3GSGA 2HDSA 4G3WA 1OTIA 3U2AA 5EVIB 3HJKA 4N1HA 4WUJA 4BJPA 2Z6CA 1L0GA 3V5MA 4EUVA 2Y2PA 3JVUA 4D60A 3BQ8A 1VEUB 4BMWA 4JPMA 2WKPA 3N8RA 1DP6A 2ZC4B 3BFEA 4HNBA 5CERA 2J80A 1YLTA 4X25A 4PPRA 4CLCC 5LBRA 3NHQA 3SH8A 3OOVA 2JN7A 4CQHA 4R4SA 2XFTA 3RH8B 2NUTC 3LICA 4O01A 2JCHA 3ZYTA 3SH7A 1IEMA 5FQ9A 3V39A 5AVFA 4UQIM 1LT0A 3GVBA 1ONHA 4HJ3A 1QMFA 5FI2A 3MFDA 1SCWA 2FFYA 3OPLA 4ARZB 3VE3A 1E3UA 1K55A 4F94A 2JC7A 1SDNA 3DTMA 3O87A 4ZJ3A 2PD8A 4O0PA 1YPRA 3NECA 4MMNA 4P6ZS 4U0TA 3PYPA 4UA9A 2HGVA 3KX0X 3CUEA 4HJ4A 5FDSA 5CEDA 1Y54A 1O07A 3RJUA 1PRQA 4E6XA 1VM1A 1S0WA 3K2NA 5EECA 4LCLA 4UQIS 1TEMA 3CHWP 1BZAA 2WKHA 3N4IA 3QP1A 1WE4A 2P7JA 3IWQA 1PNEA 1XJ6A 4QPRA 4DDSA 4H6JB 2ZQCA 1I2WA 2V1AA 4EQ1A 3ICYA 2AVXA 4Z1WA 4OVDA 2ZC7A 1VHMA 5IHVA 2EX8A 5EE8A 4KZ6A 3C4PA 4PM9A 5MC7A 3IX3A 3C4OA 4LV1A 4Y5FA 3NOTC 4I5SA 2D01A 2R78A 5HARA 1HLUP 4RYEA 1KDWA 5AJGA 3LIFA 3QP4A 2XSSA 3P98A 4ZTKA 3UNWA 4CJNA 4JLFA 5FASA 4WYYA 4OQGA 2XD1A 1SZVA 4WMCD 3MXQA 3CG5A 1Y28A 3C7UA 3ZG7B 1HTZA 3WS2A 1P0ZA 4HEFA 5HSQA 3IF6B 4OH0A 3PAGA 3A3JA 1IKIA 3ZCZA 4LV0A 2PBYA 1W63M 3MZEA 1OTBA 4I39A 1Z09A 1PW8A 4P6BA 4WF0A 4RA7A 3OPHA 5EVIC 3ZNTA 1RCJA 1XKZA 4Y0TA 1S6RA 2ZJ9A 3EQUA 2Y2GA 1LSWA 1ESIA 1HD8A 2CC1A 1SDEA 2YKFA 2GZAA 4BENA 3ZG9B 3Q82A 3L9KA 4HJ6A 2XQZA 1H5XA 3CZDA 2L1MA 3S7QA 1CQAA 3VP3A 1FCOA 4JF6A 1L0DA 1RGZA 1IYQA 2A2LA 3C8CA 4DN0A 1WYCA 4LRZE 4OQ0A 4KG5A 2JKGA 3H7WB 4R38A 3TOIA 3PR6A 3HVFA 2HDRA 5A90A 4OOYA 3IHAA 4OPQA 3OZHA 5L10A 2EWVA 3T1XA 4PMAA 1L0EA 3ZG8B 5G4ZA 5FEGA 2JE5A 4EQIA 1CJFA 1KGGA 1K0KA 3GDIA 1SKOB 1W7FA 1MC0A 2XGNA 3E4OA 5DTTA 4WL9A 2PDRA 2BASA 1ACFA 3M2KA 5DKLA 5J4EA 4IHQA 5DTKA 1L3LA 5D3OA 2JKRM 1EROA 3UB9A 2WGWA 2M1CA
chains in the Genus database with same CATH topology
4EEUA 3LI8A 4I38A 3S7NA 1JNUA 2O99A 3LR3A 2PT7A 4FOFA 4HH3A 2PR6A 3CWFA 3TW8A 3EOIA 2EWWA 2GNXA 4Q0IA 4R6LA 4L9GA 3O5YA 2LB9A 1S1YA 1IFQA 1T18A 2VGLS 4GHIB 3S7PA 3LIAA 5HL6A 4DJ3A 5DKKA 2HV1A 2JKTM 2PR5A 1GSWA 2WKRA 2QJ7A 2VV8A 1TS7A 2VEAA 2EA9A 3GECA 4BBTA 1MZUA 4I3JA 5HDSA 4L9EA 1GSVA 3PXPA 1XJ2A 3FPVA 3PBOA 3ZQ5A 4B9OA 1YSQA 3V67A 1S1ZA 2K31A 2QWSA 2A24A 2Y8HA 4WEJA 3PBNA 1OTDA 2W3FA 3CLOA 4DMZA 3NOUC 2HF6A 4P6ZM 4HQAA 5HPFA 3T4QA 5J7EA 3LYXA 1G28A 4EETB 2JHEA 3E4QA 4IUKA 1OTAA 2P04A 3UB6A 2OAP1 4ARZA 3KO6A 4HI4A 2VZWA 1OT9A 5FL3A 3FC7A 4MN6A 2KLIA 2OWHA 3T4TA 1UGUA 1OT6A 3UMDA 2O9BA 2L4RA 4Q0JA 1UWPX 2ZBBA 3CAXA 3E98A 1S67L 2J3TC 4LLOB 2VV7A 2VX8A 4KQOA 1G6OA 3RFBA 3A0RA 3H9WA 3LR0A 5HWVA 3F1PA 4OOMA 1NWZA 2V9AA 3OLOA 3F1NB 3TRCA 4K08A 3C38A 4Y3IA 1XFNA 5HD3A 4AFIA 3FG8A 2LB5A 2VLGA 1F9IA 3CI6A 4HH2A 3P7NA 1OJ5A 3JVVA 3T4KA 4H6JA 3BY9A 4NKPA 4LRYC 1S66L 3UB8A 5K5BA 4XT2A 2MJ6A 2I9VA 3C30A 3RTYA 3LIEA 5DJUA 1OTEA 1KOUA 1D7EA 2VJWA 2Y79A 3BY8A 3D72A 1P9RA 3T4OA 4EXOA 1TS6A 4HIAA 3BQAA 3KYQA 3EWKA 2K2NA 4ME4A 1YKDA 4PAUA 3B47A 5DFYA 3MQOA 4O8GA 2IA2A 3VE4A 3T4SA 5IS1A 3KSFA 1OJGA 2O9CA 4HP9A 4M4XA 4CLCA 3T4JA 3TE8A 3NOPC 3PBRA 5HWTA 3F1OA 2INWA 1F5MA 2W27A 3CUEC 4WN5A 4PKYG 2V0WA 2VV6A 3LI9A 4G3WA 4EERA 4DJ2A 3B33A 4KUKA 1OTIA 3U2AA 1GSXA 3HJKA 4WUJA 3VV4A 2Z6CA 4BJPA 4NXFA 2XRNA 3UE3A 2QKPA 4EUVA 2ZMVA 3JVUA 2VKSA 2ZOIA 3BQ8A 5DFXA 4BMWA 2WKPA 4R3AA 2W3EA 5F68A 1DP6A 4HNBA 4UEYA 5KSHA 3CITA 2J80A 1T1BA 3DBAA 4OOLA 3A0SA 5CX7A 2W3DA 3KSIA 2J3WA 4CLCC 4HOIA 5AVEA 1ODVA 4JGRA 5LBRA 5L8MA 3NHQA 3OOVA 2JN7A 5G4YA 2HJEA 3UB7A 4CQHA 3LIDA 4YOFA 2W1TA 3EGDC 2Z6DA 2A24B 3RH8B 2NUTC 3LICA 4O01A 1P9WA 3ZYTA 4EW7A 5IU1A 5AVFA 1W63Q 4UQIM 1LT0A 5HWWA 4L0LA 1N9LA 4HJ3A 4G3VA 4WELA 3TJZC 4ARZB 2PYRA 3VE3A 5TBMA 4GS9A 2DMWA 1TF1A 2W3GA 4YNRA 2PD8A 4O0PA 3MFXA 1WA9A 1H3QA 3BWLA 4I3IA 1TS8A 4MMNA 4P6ZS 3H82A 4F3LA 3VOLA 3MR0A 3PYPA 4MN7A 2HGVA 4ZRRA 3H7WA 3KX0X 3CUEA 4HJ4A 3R7WA 2KX6A 5F5YA 3IBJA 3LR4A 1D06A 4HP4A 3IBRA 1ZHHB 3K2NA 4L9FA 3PBTA 1NLZA 3F1PB 1S4RA 4PKYA 4ETXA 3IS2A 4UQIS 3W2ZA 5HDDA 4JGPA 3KSGA 4I3AA 4JGQA 1X0OA 2P7JA 2J3TD 1NLYA 1UWNX 1XJ6A 2ZMFA 3E4PA 4NXEA 4QPRA 2M7UA 4H6JB 2OOLA 3D3OA 2V1AA 3MQ0A 4EQ1A 4XT2B 3ICYA 4Z1WA 3BJNA 1XJ3A 1ZTUA 2VGLM 3C2WA 1T19A 2ZOHA 1VHMA 5HD5A 3A0VA 3KSHA 4E04A 1LSXA 1DRMA 1P97A 4GCZA 1H8MA 1S4SA 5MC7A 3OC2A 5A8BA 2B18A 3G6OA 4KUOA 1LL8A 4Y5FA 5KIZA 1XFQA 3NOTC 4I5SA 2D01A 2R78A 4G3KA 3LR5A 3LUQA 4BBVA 4CLCB 3UMEA 4GHIA 4EEPA 1MKMA 2O0YA 5AJGA 3LIFA 4JGOA 2W0NA 2XSSA 4BWIA 2B02A 3F1OB 2XA7M 3P01A 3R4KA 4MDZA 4HY8A 4Y2FA 2QJ5A 1STZA 2PHYA 3PBSA 3MXQA 3K3DA 2O9AA 1Y28A 4FSFA 2M7VA 3MF0A 5J3WA 4NXBA 1NRJA 2FH5A 3OCNA 1P0ZA 4NEED 5TJJA 1XJ4A 4EU0A 1TD5A 2GX5A 5HSQA 4GW9A 5C5KA 1T1AA 4CLCE 2H28A 5IT5A 1W63M 1OTBA 5DF9A 1BYWA 1V9YA 4I39A 2HJ9C 1YSPA 5F6AA 3HCYA 3PBQA 2OAQ1 3KYZA 2WKQA 4WF0A 4GLQA 5HZHA 2NUPC 3E0YA 4IJGA 3EGXC 4RQ9A 3S7OA 2P08A 2XA7S 2JKRI 2W1TB 3EQUA 1YAXA 2QYBA 2KOIA 4GJ4A 3UE6A 1LSWA 2V1BA 4Q0HA 5F69A 3OBFA 2YKFA 2D02A 2GZAA 2QHKA 4CLCD 4MCWA 4HJ6A 3NJAA 4WLAA 4MN5A 5HPIA 2FZ0A 1VB6A 2L1MA 3S7QA 2L0WA 3F1NA 4LPZA 4YWZA 1V9ZA 2CMNA 1LSVA 4GS9B 4II7A 2JKTI 4KQDA 5TBMB 4EESA 3PHYA 1TS0A 3K3CA 3LFVA 2A2LA 3EEAA 4IUHA 1T1CA 3C8CA 4DN0A 4LRZE 4PHTA 2XROA 3H82B 4F3LB 3SW1A 1DP8A 3MJQA 3OCLA 3ULFA 2W3HA 3H7WB 4R38A 2K7SA 3PR6A 3R7WB 4NXGA 2V0UA 2OWJA 5EFWA 3MMHA 1IOUA 4WEKA 3BW6A 4ETZA 2EWVA 1OPXA 5G4ZA 3IS2B 1F98A 2VA0A 3EEHA 1N9OA 3MQQA 4HHDA 3FPWA 1EW0A 3GDIA 2YKHA 4BBUA 3T4LA 5DJTA 1MC0A 2G7UA 2PYPA 4R70A 3E4OA 3EQVA 2PD7A 4LRXC 1DP9A 4WL9A 2KDKA 2BASA 2PDRA 3B42A 2GJ3A 5DKLA 5J4EA 4IHQA 5HDCA 3LIBA 1N9NA 4B93A 2JKRM 2W1RA 3HJIA 5I5LA 3UB9A 3T50A 2M1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3T C;  3CUE C;  2J3T D;  3PR6 A;  3CUE A;  1H3Q A;  2J3W A;  2ZMV A; 
#chains in the Genus database with same CATH topology
 2O99 A;  2DCF A;  3TW8 A;  1RP5 A;  1MWU A;  3EOI A;  3FKW A;  4JF4 A;  4L9G A;  3IXD A;  3O5Y A;  4JKT A;  1IFQ A;  3W4P A;  2ZMA A;  2GDN A;  4DJ3 A;  4JXG A;  5DKK A;  2HV1 A;  3SS3 A;  2QJ7 A;  5FDH A;  2VEA A;  1NJ4 A;  2EA9 A;  3UN7 A;  1MZU A;  4L9E A;  1HZO A;  3ZVW A;  3PXP A;  5E2F A;  1XJ2 A;  2ZQ8 A;  3V67 A;  2JBF A;  3GQZ A;  2HP6 A;  2QWS A;  2C6W B;  1OTD A;  1MWT A;  2OLV A;  3NI9 A;  3VFH A;  3CLO A;  4P87 A;  5A91 A;  4N92 A;  1TVF A;  2VGJ A;  5E43 A;  4EET B;  2EX2 A;  2H10 A;  5FA7 A;  2UWX A;  4BL2 A;  3T1S A;  1ES3 A;  3V3R A;  1CK3 A;  2KLI A;  2V8C A;  1OT6 A;  2ZC6 B;  3IX8 A;  3UMD A;  2O9B A;  1GCE A;  3IF6 C;  3UB5 P;  3FKV A;  4ZBE A;  1JVJ A;  2FFF B;  1XA7 A;  4KG6 A;  3LR0 A;  3M6H A;  4K0W A;  4GN2 A;  3F1P A;  3GMW A;  2X02 A;  1ESU A;  5JYP A;  1KE3 A;  2LB5 A;  3G34 A;  1U60 A;  3P7N A;  1OJ5 A;  3FZC A;  3T4K A;  3BY9 A;  1A0K A;  5DF7 A;  1S66 L;  5K5B A;  5CGW A;  1OTE A;  3D72 A;  1TS6 A;  2Q0O A;  4Y7P A;  1NRF A;  5CTN A;  1PWD A;  3ZGA B;  4IED A;  4S2N C;  4O8G A;  3VE4 A;  3T4S A;  4KZ7 A;  5IS1 A;  4P0M A;  3KSF A;  2O9C A;  3MSH A;  4CLC A;  3GRJ A;  1ES5 A;  1F5M A;  2W27 A;  2V20 A;  1GHM A;  3LI9 A;  4B88 A;  4DJ2 A;  5GLB A;  3HUM A;  4XXR A;  3ZFZ A;  4KUK A;  2Q9N A;  2V1Z A;  1H8Z A;  3D4F A;  3UE3 A;  2QKP A;  3ZG0 A;  1MWS A;  4LV2 A;  3RXW A;  2OV5 A;  4A5R A;  4R3A A;  2W3E A;  3Q7V B;  5KSH A;  3CIT A;  1T1B A;  1E25 A;  3N6I A;  3A3E A;  3VP2 A;  5CX7 A;  1BUL A;  1YT4 A;  5HL1 A;  4OPZ A;  1ODV A;  5L8M A;  2Y91 A;  2HJE A;  3LID A;  4MNR A;  4YOF A;  3LEZ A;  4IVI A;  1TDG A;  2ZM2 A;  1P9W A;  5IU1 A;  3LEQ A;  1FCN A;  4Y0O A;  1TDL A;  3TJZ C;  1GHP A;  2PYR A;  2DMW A;  4YNR A;  1PI5 A;  3CPT A;  1WA9 A;  1H3Q A;  3BWL A;  1TS8 A;  3H82 A;  4F3L A;  4ZRR A;  1PFL A;  1MXO A;  3UE1 A;  3IBJ A;  4HP4 A;  1KGE A;  1I5Q A;  1ZHH B;  4MBH A;  3PBT A;  2E8J A;  4PKY A;  4PM7 A;  4PM6 A;  5A92 A;  5GLC A;  3KSG A;  4QD4 A;  4I3A A;  2ZQD A;  1K4F A;  3IXB A;  4NXE A;  4UA7 A;  1FSW A;  1XPB A;  3PAE A;  5AQ7 A;  1ZC2 A;  1DY6 A;  3BJN A;  1XJ3 A;  3C2W A;  2ZOH A;  3DW0 A;  3A0V A;  3KSH A;  5HAQ A;  4GCZ A;  1H8M A;  5TFQ A;  1JTD A;  5I94 A;  3IHB A;  4KUO A;  5EUA A;  2ZM8 A;  3LR5 A;  4GHI A;  4BD1 A;  4KZ3 A;  4QJG A;  4LEN A;  1MKM A;  3M6B A;  5EVI A;  4CPK A;  4EBL A;  1LLB A;  2H5S A;  4BWI A;  3F1O B;  4FCF A;  1LI9 A;  4PM5 A;  1PWG A;  1Y4O A;  4GOG A;  3K3D A;  4QY5 A;  2Y4A A;  5J3W A;  4NXB A;  4S2I A;  2FH5 A;  3VP1 A;  4NEE D;  3NCK A;  1Q2Q A;  4X69 A;  1T1A A;  5FEF A;  1XGJ A;  4OKP A;  5DF9 A;  3ZDJ A;  5EV0 A;  1J9M A;  1YSP A;  5F6A A;  5FQJ A;  3HCY A;  3PBQ A;  3HLB A;  3KYZ A;  4JXS A;  5EM1 A;  2WAF A;  2XDM A;  4GLQ A;  4NG2 A;  5HZH A;  4FD8 A;  3E0Y A;  4IJG A;  4ZAM A;  1YLY A;  4RQ9 A;  2ZC5 B;  4R3B A;  1N4O A;  2JKR I;  1PZP A;  1YAX A;  3TSG A;  3HBR A;  3UE6 A;  2ZC3 B;  4S2O A;  3N8S A;  5HFO A;  1YMS A;  3DTI A;  5CGS A;  5CHJ A;  3WWX A;  4WLA A;  2EX6 A;  4MN5 A;  3O3V A;  2FZ0 A;  1VB6 A;  1SKF A;  2WKE A;  2CMN A;  3BM6 A;  4EES A;  4OPR A;  2BG1 A;  5DF8 A;  5JYO A;  4U0X A;  4LCM A;  2Y2I A;  3SW1 A;  1FR6 A;  3OCL A;  1GA9 A;  3HUO A;  2K7S A;  1ERM A;  2OWJ A;  1SHV A;  3BW6 A;  4ETZ A;  2VA0 A;  1N9O A;  3MQQ A;  4S2L A;  1FCM A;  4LFU A;  2JKF A;  1LHY A;  3PTE A;  2OLU A;  2PYP A;  3V50 A;  1DP9 A;  4DXB A;  1XXM A;  2GJ3 A;  4S2K A;  5TR7 A;  3LIB A;  2EFX A;  3BEC A;  3BFG A;  4B93 A;  2XFS A;  5EOO A;  5I5L A;  2B5R A;  3BFD A;  4MBF A;  4EEU A;  3S7N A;  4R1G A;  1JNU A;  3LR3 A;  2PR6 A;  3CWF A;  4KG2 A;  1E3U D;  1K54 C;  5TGF A;  1NYM A;  2Y2O A;  4R6L A;  3T1Q B;  3RXX A;  3MKE A;  4GD6 A;  1T18 A;  3LY4 A;  2WKR A;  4DRT A;  4OON A;  3SS5 A;  1CEF A;  3UY6 A;  2A49 A;  3FPV A;  3PBO A;  1YSQ A;  1D1J A;  2K31 A;  2A24 A;  3BYD A;  4WEJ A;  4Y0U A;  3PBN A;  1BSG A;  3VOZ A;  3NOU C;  3T4Q A;  3LYX A;  3FYZ A;  1G28 A;  4S2P A;  1PW1 A;  4E3K A;  4HES A;  4IUK A;  1OTA A;  2OAP 1;  1YQS A;  2Y55 A;  1YLP A;  3E2K A;  1KVL A;  4MN6 A;  2OWH A;  5E2G A;  3D9Y A;  2Y2J A;  1CI9 A;  2PU2 A;  4QHC A;  2Y2L A;  4HBU A;  2BTF P;  1UWP X;  3E98 A;  2VV7 A;  3HLG A;  4S2N A;  3IQA A;  3GV9 A;  1JWP A;  4BD0 A;  2WYX A;  1G6O A;  3UO9 A;  4NK3 A;  5HWV A;  4OOM A;  3ZVT A;  4U3T A;  4K08 A;  2R9W A;  4Y3I A;  1XFN A;  3IWI A;  4WZ5 C;  5HW3 A;  2VLG A;  3W4Q A;  3N7W A;  2C5W B;  4RX2 A;  3WS4 A;  3HLC A;  5L2F A;  4N9L A;  4GDN A;  4NKP A;  4LRY C;  3UB8 A;  4XT2 A;  2MJ6 A;  5FQQ A;  3VOY A;  2I9V A;  3C30 A;  1K4E A;  1L0F A;  2I72 A;  1D7E A;  3T4O A;  4EXO A;  4YIN A;  2K2N A;  1CF0 A;  2XH9 A;  4PAU A;  1EWZ A;  4JXW A;  2Y2Q A;  1K6R A;  3QP8 A;  4UA6 A;  1DJC A;  3UPO A;  3M2J A;  2P9V A;  4M4X A;  3W4O A;  3T12 B;  2IWD A;  3T4J A;  3NIA A;  3NOP C;  3PBR A;  4GD8 A;  4KZB A;  4OPY A;  3CUE C;  1JWZ A;  4N9K A;  1DJA A;  1W5D A;  2VV6 A;  3G32 A;  3B33 A;  3FWL A;  2E8I A;  5GLD A;  2WGW B;  1GSX A;  1NY0 A;  3HLW A;  4Q8I A;  4R3J A;  3WS0 A;  2ZOI A;  5F82 A;  3QNB A;  5J8X A;  5F68 A;  3IT9 A;  5A93 A;  2EX9 A;  1VET A;  1IYP A;  3DBA A;  4OOL A;  3A0S A;  2ACG A;  5AVE A;  5EPH A;  4X53 A;  2UV0 E;  1LL9 A;  3UB7 A;  2W1T A;  3EGD C;  2Z6D A;  1NYY A;  3Q7Z A;  3AGE A;  4X55 A;  4LV3 A;  4BL3 A;  5HWW A;  3JPU A;  3HLE A;  4WEL A;  4N1X A;  4K91 A;  4RX3 A;  3WS1 A;  4KZ4 A;  5DTS A;  1ZG6 A;  5TBM A;  4GS9 A;  5GHY A;  1TF1 A;  3T1R A;  2H0T A;  3GR2 A;  2W3G A;  4DKI A;  5HX9 A;  3MXR A;  4I3I A;  4M3K A;  3G2Y A;  3VSL A;  3VOL A;  4E3I A;  2Y2K A;  1KGF A;  4KZ5 A;  3R7W A;  4HBT A;  2G2W A;  3LR4 A;  1H8Y A;  2EXB A;  4C75 A;  1KDS A;  1D06 A;  5CEC A;  3IBR A;  4L9F A;  5FQK A;  1NLZ A;  3F1P B;  4ZJ2 A;  3QP5 A;  4ETX A;  3IS2 A;  3W2Z A;  4JGP A;  4JGQ A;  2J3T D;  1NZO A;  2V2F F;  4X1M A;  5AQA A;  2ZMF A;  3E4P A;  3G31 A;  5G18 A;  2OOL A;  3D3O A;  2PBD P;  3DTK A;  3MQ0 A;  1PZO A;  1ZTU A;  2VGL M;  1T19 A;  5HD5 A;  3MXS A;  5EVE A;  3WRZ A;  4S2M A;  1XA1 A;  1IKG A;  1DRM A;  1P97 A;  3CMZ A;  3MS6 A;  1FQG A;  2HDQ A;  2B18 A;  3S22 A;  1LL8 A;  4NET A;  1YLZ A;  3LUQ A;  4CLC B;  3UME A;  3G4P A;  4GNU A;  4JGO A;  4KZ9 A;  4OLG A;  5KMW A;  3R4K A;  4MDZ A;  4MEZ A;  3DWZ A;  3QNC A;  3PBS A;  2O9A A;  4FSF A;  4EWF A;  5FI6 A;  3BFC A;  4E3J A;  1FSY A;  3OCN A;  1K57 C;  4EU0 A;  1TD5 A;  3ZHH A;  4GW9 A;  5C5K A;  4CLC E;  4FUW A;  1EI5 A;  5E2E A;  1Z6F A;  1BYW A;  2B95 A;  2HJ9 C;  4X6T A;  1C3B A;  3IXH A;  1WYB A;  1E4D A;  2WKQ A;  4KQR A;  2NUP C;  3O88 A;  2P08 A;  2XK1 A;  3NDG A;  3ISG A;  2EXA A;  4FTX A;  2WZX A;  3HLD A;  4E6W A;  4Q0H A;  5F69 A;  2D02 A;  2HZ5 A;  5M18 A;  4CLC D;  1AXB A;  5M19 A;  1FOF A;  5HPI A;  3F1N A;  2ZL1 A;  4LPZ A;  4YWZ A;  1LSV A;  1TS0 A;  3K3C A;  3Q07 A;  3CPT B;  2DNS A;  4IUH A;  4PHT A;  2XRO A;  3H82 B;  4F3L B;  1DP8 A;  3QHY A;  3AGD A;  4S2J A;  3DAV A;  2WGI A;  5F1G A;  5KZH A;  4NXG A;  2V0U A;  5EFW A;  4R4R A;  5EVL A;  1OPX A;  2Q9M A;  2ZQ7 A;  1F98 A;  1H0M A;  1EW0 A;  2X01 A;  5DJT A;  3BLS A;  3A3I A;  5DVA A;  4K0X A;  3Q1F A;  4R70 A;  4DE1 A;  2PD7 A;  2Y59 A;  1YLJ A;  5CXW A;  2ZQ9 A;  3UPP A;  1JWV A;  1N9N A;  1ONG A;  4MBK A;  1YMX A;  4X56 A;  3N8L A;  3HJI A;  1K38 A;  2A3U A;  3LI8 A;  4I38 A;  3MZD A;  2P74 A;  4EBP A;  3ITB A;  2PT7 A;  4ZJ1 A;  4YFM A;  4BQM A;  3QP6 A;  1VEU A;  2WAD A;  4Q0I A;  1CEG A;  4O7D A;  5F83 A;  5AQB A;  5CRF A;  1M6K A;  5CHM A;  3HRE A;  4GHI B;  1G5U A;  3S7P A;  3LIA A;  5HL6 A;  2JKT M;  2PR5 A;  4BLM A;  2VV8 A;  1XX2 A;  2J9O A;  4I3J A;  1AWI A;  1GSV A;  2ZQA A;  1QME A;  4E3O A;  4LGW A;  1O7E A;  4B9O A;  2WAE A;  3QP2 A;  1S1Z A;  2Y8H A;  1BUE A;  1ZKJ A;  3MKF A;  1W8Y A;  3OPP A;  1YLW A;  2HF6 A;  4JBF A;  4P6Z M;  5HPF A;  4WZ5 A;  2JHE A;  3E4Q A;  4KQQ A;  2P04 A;  3UB6 A;  4Y17 A;  4GDB A;  4ARZ A;  4HI4 A;  1FIK A;  2VZW A;  5FL3 A;  2J8Y A;  4OP8 A;  3T4T A;  4QWO A;  1K56 A;  4ZDX A;  3UPN A;  5GHX A;  2L4R A;  2ZBB A;  3DWK A;  3A3D A;  4WMC A;  2VX8 A;  4KQO A;  3H9W A;  5EVI D;  4WBG A;  1NWZ A;  3JYI A;  3OLO A;  3TRC A;  5HD3 A;  4AFI A;  3FG8 A;  1F9I A;  3CI6 A;  4H6J A;  4KZ8 A;  3NBL A;  2H0Y A;  3SS4 A;  1LL5 A;  3GTC A;  1BLS A;  3RTY A;  3KYE A;  3G30 A;  2Y79 A;  3BY8 A;  1P9R A;  4HIA A;  1BT5 A;  3KYQ A;  3EWK A;  2Y2M A;  3I7J A;  4EUZ A;  3B47 A;  2HP5 A;  1G68 A;  5FQI A;  4IVK A;  3MQO A;  1I2S A;  3LCE A;  3E2L A;  5U47 A;  1OJG A;  4HP9 A;  3TE8 A;  5HWT A;  3HLF A;  4C3Q A;  2INW A;  4WN5 A;  3NDE A;  2V0W A;  3HUN A;  4EER A;  1MY8 A;  5FAO A;  3NC8 A;  5BOH A;  1K56 D;  3VV4 A;  4NXF A;  2XRN A;  4OQI A;  4EV4 A;  1IYS A;  2ZMV A;  2VKS A;  3IF6 A;  5DFX A;  2J7V A;  4UEY A;  1ALQ A;  5E2H A;  5GLA A;  2G2U A;  4XUX A;  2W3D A;  3KSI A;  2J3W A;  2PU4 A;  4HOI A;  3NY4 A;  4JGR A;  5CEB A;  4Y15 A;  3BEB A;  5G4Y A;  2HP9 A;  2BLS A;  5FI7 A;  2A24 B;  1MKI A;  4OP5 A;  2IWB A;  2XLN A;  3IH8 A;  4EW7 A;  1W63 Q;  4QB8 A;  4D2O A;  1KE0 A;  1N9L A;  2X71 A;  4L0L A;  4DDY A;  4G3V A;  4GKU A;  4P85 A;  4OQH A;  4Z9Q A;  3HL9 A;  1MBL A;  3MFX A;  2V8F A;  1MPL A;  1HVB A;  3MBZ A;  1ES4 A;  1L2S A;  3O86 A;  3MR0 A;  5GL9 A;  5L09 A;  4MN7 A;  3H7W A;  1XP4 A;  4ID4 A;  3BRM A;  1PIO A;  2KX6 A;  4B4Z A;  5F5Y A;  1S4R A;  2DRW A;  2J9P A;  2IWC A;  3TG9 A;  5HDD A;  2RL3 A;  3UDF A;  1X0O A;  4KEN B;  1SKO A;  1NLY A;  4MLL A;  3FV7 A;  1GA0 A;  1UWN X;  1BLP A;  2M7U A;  5F1F A;  1K55 C;  4OLD A;  4UAA A;  4XT2 B;  4DF6 A;  1K57 A;  1MWR A;  4E04 A;  1LSX A;  1ERQ A;  4DE2 A;  1S4S A;  3OC2 A;  5A8B A;  1YM1 A;  3L7H A;  3G6O A;  4C6Y A;  3BLM A;  5KIZ A;  1XFQ A;  2P9V B;  4G3K A;  4BBV A;  4GZB A;  4EEP A;  2O0Y A;  2W0N A;  2ZM0 A;  2B02 A;  2XA7 M;  3P01 A;  4HY8 A;  1BLH A;  4Y2F A;  2QJ5 A;  1PYY A;  1STZ A;  2EFU A;  2PHY A;  3NUL A;  2M7V A;  3MF0 A;  3SOI A;  1NRJ A;  5TJJ A;  1XJ4 A;  2GX5 A;  3WS5 A;  3IX4 A;  2QZ6 A;  3IH9 A;  1W8Q A;  1KE4 A;  2H28 A;  4QU3 A;  5IT5 A;  2QMI A;  5FQM A;  2VK3 A;  1VET B;  1V9Y A;  3DTE A;  2R9X A;  3UDX A;  4DXC A;  2OAQ 1;  3ZG5 A;  1DJB A;  1XGI A;  2Z2L B;  5L07 A;  3VMA A;  5HAP A;  3LGO A;  5AQ9 A;  4XUZ A;  3EGX C;  1IYO A;  3S7O A;  2XA7 S;  3S4X A;  2W1T B;  5CTM A;  2QYB A;  2KOI A;  4GJ4 A;  2V1B A;  3OBF A;  3VP0 A;  4ESP A;  4E3N A;  3VSK A;  5FSR A;  2QHK A;  4FH2 A;  2WGV A;  4MCW A;  2XEP A;  3NJA A;  5EM0 A;  2L0W A;  2XR0 A;  1V9Z A;  5TBM B;  4GS9 B;  4II7 A;  2JKT I;  4KQD A;  3PHY A;  3LFV A;  4GB7 A;  3EEA A;  1T1C A;  3G2Z A;  1PWC A;  3MJQ A;  3ULF A;  1LI0 A;  2W3H A;  2VGK A;  3ZNY A;  3R7W B;  3C5A A;  1N9B A;  3MMH A;  1IOU A;  4WEK A;  2Z2M B;  2WKI A;  3IS2 B;  1GHI A;  3EEH A;  4HHD A;  5KSC A;  3FPW A;  2YKH A;  3VFF A;  4BBU A;  3T4L A;  4WM9 A;  2HPB A;  2G7U A;  3WRT A;  3EQV A;  4LRX C;  2KDK A;  3B42 A;  1OME A;  4X1L A;  3SZT A;  5HDC A;  4FH4 A;  4WZ4 A;  1JTG A;  4E3L A;  2W1R A;  1BLC A;  4UHU A;  2Y2H A;  3T50 A;  1G6A A;  4FOF A;  4HH3 A;  1FR1 A;  2WK0 A;  4RVA A;  2EWW A;  2GNX A;  4JXV A;  4IBR A;  5FAQ A;  4H8R A;  2LB9 A;  1S1Y A;  3Q7V A;  2OSU A;  2XF3 A;  2VGL S;  1CI8 A;  3LY3 A;  5FAT A;  1GSW A;  1TS7 A;  3LO7 A;  3GEC A;  4BBT A;  5HDS A;  2ZLY A;  3IF5 A;  3ZQ5 A;  1KVM A;  3G35 A;  3B3X A;  4Y13 A;  2W3F A;  4DMZ A;  4IBX A;  4HQA A;  5CGX A;  5EOE A;  3V3S A;  1F2K A;  3C7V A;  5J7E A;  1NZU A;  4KZA A;  2WZZ A;  3MZF A;  4DE3 A;  3UE0 A;  5CHU A;  3KO6 A;  2QPN A;  1ES2 A;  1OT9 A;  3FC7 A;  3BFF A;  3IWO A;  2PRF A;  5GHZ A;  1UGU A;  1W79 A;  3CJM A;  1J3W A;  4Q0J A;  2ZD8 A;  3CAX A;  1PI4 A;  1S67 L;  2J3T C;  1K6S A;  4LLO B;  4E3M A;  5FAP A;  3RFB A;  3A0R A;  3OPR A;  3UDI A;  2V9A A;  1NXY A;  3F1N B;  2ZL1 B;  2XD5 A;  4R0Q A;  1RGY A;  3C38 A;  1VQQ A;  1K54 A;  4HH2 A;  4DE0 A;  3JVV A;  4EBN A;  1Q2P A;  2Y2N A;  1K25 A;  4QY6 A;  3S1Y A;  5M1A A;  3LIE A;  4X68 A;  2RCX A;  5DJU A;  1KOU A;  2VJW A;  5HAI A;  3BQA A;  2WUQ A;  4ME4 A;  3A3F A;  1YKD A;  1IEL A;  1ZG4 A;  4B4X A;  5DFY A;  3U4L P;  3W8K A;  2HDU A;  2IA2 A;  1BTL A;  3IXG A;  3AGF A;  4PM8 A;  3SH9 A;  3Q81 A;  3VP4 A;  1M40 A;  3P09 A;  3F1O A;  4R23 A;  1FIL A;  2PAV P;  4JF5 A;  4PKY G;  3ITA A;  3GSG A;  2HDS A;  4G3W A;  1OTI A;  3U2A A;  5EVI B;  3HJK A;  4N1H A;  4WUJ A;  4BJP A;  2Z6C A;  1L0G A;  3V5M A;  4EUV A;  2Y2P A;  3JVU A;  4D60 A;  3BQ8 A;  1VEU B;  4BMW A;  4JPM A;  2WKP A;  3N8R A;  1DP6 A;  2ZC4 B;  3BFE A;  4HNB A;  5CER A;  2J80 A;  1YLT A;  4X25 A;  4PPR A;  4CLC C;  5LBR A;  3NHQ A;  3SH8 A;  3OOV A;  2JN7 A;  4CQH A;  4R4S A;  2XFT A;  3RH8 B;  2NUT C;  3LIC A;  4O01 A;  2JCH A;  3ZYT A;  3SH7 A;  1IEM A;  5FQ9 A;  3V39 A;  5AVF A;  4UQI M;  1LT0 A;  3GVB A;  1ONH A;  4HJ3 A;  1QMF A;  5FI2 A;  3MFD A;  1SCW A;  2FFY A;  3OPL A;  4ARZ B;  3VE3 A;  1E3U A;  1K55 A;  4F94 A;  2JC7 A;  1SDN A;  3DTM A;  3O87 A;  4ZJ3 A;  2PD8 A;  4O0P A;  1YPR A;  3NEC A;  4MMN A;  4P6Z S;  4U0T A;  3PYP A;  4UA9 A;  2HGV A;  3KX0 X;  3CUE A;  4HJ4 A;  5FDS A;  5CED A;  1Y54 A;  1O07 A;  3RJU A;  1PRQ A;  4E6X A;  1VM1 A;  1S0W A;  3K2N A;  5EEC A;  4LCL A;  4UQI S;  1TEM A;  3CHW P;  1BZA A;  2WKH A;  3N4I A;  3QP1 A;  1WE4 A;  2P7J A;  3IWQ A;  1PNE A;  1XJ6 A;  4QPR A;  4DDS A;  4H6J B;  2ZQC A;  1I2W A;  2V1A A;  4EQ1 A;  3ICY A;  2AVX A;  4Z1W A;  4OVD A;  2ZC7 A;  1VHM A;  5IHV A;  2EX8 A;  5EE8 A;  4KZ6 A;  3C4P A;  4PM9 A;  5MC7 A;  3IX3 A;  3C4O A;  4LV1 A;  4Y5F A;  3NOT C;  4I5S A;  2D01 A;  2R78 A;  5HAR A;  1HLU P;  4RYE A;  1KDW A;  5AJG A;  3LIF A;  3QP4 A;  2XSS A;  3P98 A;  4ZTK A;  3UNW A;  4CJN A;  4JLF A;  5FAS A;  4WYY A;  4OQG A;  2XD1 A;  1SZV A;  4WMC D;  3MXQ A;  3CG5 A;  1Y28 A;  3C7U A;  3ZG7 B;  1HTZ A;  3WS2 A;  1P0Z A;  4HEF A;  5HSQ A;  3IF6 B;  4OH0 A;  3PAG A;  3A3J A;  1IKI A;  3ZCZ A;  4LV0 A;  2PBY A;  1W63 M;  3MZE A;  1OTB A;  4I39 A;  1Z09 A;  1PW8 A;  4P6B A;  4WF0 A;  4RA7 A;  3OPH A;  5EVI C;  3ZNT A;  1RCJ A;  1XKZ A;  4Y0T A;  1S6R A;  2ZJ9 A;  3EQU A;  2Y2G A;  1LSW A;  1ESI A;  1HD8 A;  2CC1 A;  1SDE A;  2YKF A;  2GZA A;  4BEN A;  3ZG9 B;  3Q82 A;  3L9K A;  4HJ6 A;  2XQZ A;  1H5X A;  3CZD A;  2L1M A;  3S7Q A;  1CQA A;  3VP3 A;  1FCO A;  4JF6 A;  1L0D A;  1RGZ A;  1IYQ A;  2A2L A;  3C8C A;  4DN0 A;  1WYC A;  4LRZ E;  4OQ0 A;  4KG5 A;  2JKG A;  3H7W B;  4R38 A;  3TOI A;  3PR6 A;  3HVF A;  2HDR A;  5A90 A;  4OOY A;  3IHA A;  4OPQ A;  3OZH A;  5L10 A;  2EWV A;  3T1X A;  4PMA A;  1L0E A;  3ZG8 B;  5G4Z A;  5FEG A;  2JE5 A;  4EQI A;  1CJF A;  1KGG A;  1K0K A;  3GDI A;  1SKO B;  1W7F A;  1MC0 A;  2XGN A;  3E4O A;  5DTT A;  4WL9 A;  2PDR A;  2BAS A;  1ACF A;  3M2K A;  5DKL A;  5J4E A;  4IHQ A;  5DTK A;  1L3L A;  5D3O A;  2JKR M;  1ERO A;  3UB9 A;  2WGW A;  2M1C A; 
#chains in the Genus database with same CATH homology
 4EEU A;  3LI8 A;  4I38 A;  3S7N A;  1JNU A;  2O99 A;  3LR3 A;  2PT7 A;  4FOF A;  4HH3 A;  2PR6 A;  3CWF A;  3TW8 A;  3EOI A;  2EWW A;  2GNX A;  4Q0I A;  4R6L A;  4L9G A;  3O5Y A;  2LB9 A;  1S1Y A;  1IFQ A;  1T18 A;  2VGL S;  4GHI B;  3S7P A;  3LIA A;  5HL6 A;  4DJ3 A;  5DKK A;  2HV1 A;  2JKT M;  2PR5 A;  1GSW A;  2WKR A;  2QJ7 A;  2VV8 A;  1TS7 A;  2VEA A;  2EA9 A;  3GEC A;  4BBT A;  1MZU A;  4I3J A;  5HDS A;  4L9E A;  1GSV A;  3PXP A;  1XJ2 A;  3FPV A;  3PBO A;  3ZQ5 A;  4B9O A;  1YSQ A;  3V67 A;  1S1Z A;  2K31 A;  2QWS A;  2A24 A;  2Y8H A;  4WEJ A;  3PBN A;  1OTD A;  2W3F A;  3CLO A;  4DMZ A;  3NOU C;  2HF6 A;  4P6Z M;  4HQA A;  5HPF A;  3T4Q A;  5J7E A;  3LYX A;  1G28 A;  4EET B;  2JHE A;  3E4Q A;  4IUK A;  1OTA A;  2P04 A;  3UB6 A;  2OAP 1;  4ARZ A;  3KO6 A;  4HI4 A;  2VZW A;  1OT9 A;  5FL3 A;  3FC7 A;  4MN6 A;  2KLI A;  2OWH A;  3T4T A;  1UGU A;  1OT6 A;  3UMD A;  2O9B A;  2L4R A;  4Q0J A;  1UWP X;  2ZBB A;  3CAX A;  3E98 A;  1S67 L;  2J3T C;  4LLO B;  2VV7 A;  2VX8 A;  4KQO A;  1G6O A;  3RFB A;  3A0R A;  3H9W A;  3LR0 A;  5HWV A;  3F1P A;  4OOM A;  1NWZ A;  2V9A A;  3OLO A;  3F1N B;  3TRC A;  4K08 A;  3C38 A;  4Y3I A;  1XFN A;  5HD3 A;  4AFI A;  3FG8 A;  2LB5 A;  2VLG A;  1F9I A;  3CI6 A;  4HH2 A;  3P7N A;  1OJ5 A;  3JVV A;  3T4K A;  4H6J A;  3BY9 A;  4NKP A;  4LRY C;  1S66 L;  3UB8 A;  5K5B A;  4XT2 A;  2MJ6 A;  2I9V A;  3C30 A;  3RTY A;  3LIE A;  5DJU A;  1OTE A;  1KOU A;  1D7E A;  2VJW A;  2Y79 A;  3BY8 A;  3D72 A;  1P9R A;  3T4O A;  4EXO A;  1TS6 A;  4HIA A;  3BQA A;  3KYQ A;  3EWK A;  2K2N A;  4ME4 A;  1YKD A;  4PAU A;  3B47 A;  5DFY A;  3MQO A;  4O8G A;  2IA2 A;  3VE4 A;  3T4S A;  5IS1 A;  3KSF A;  1OJG A;  2O9C A;  4HP9 A;  4M4X A;  4CLC A;  3T4J A;  3TE8 A;  3NOP C;  3PBR A;  5HWT A;  3F1O A;  2INW A;  1F5M A;  2W27 A;  3CUE C;  4WN5 A;  4PKY G;  2V0W A;  2VV6 A;  3LI9 A;  4G3W A;  4EER A;  4DJ2 A;  3B33 A;  4KUK A;  1OTI A;  3U2A A;  1GSX A;  3HJK A;  4WUJ A;  3VV4 A;  2Z6C A;  4BJP A;  4NXF A;  2XRN A;  3UE3 A;  2QKP A;  4EUV A;  2ZMV A;  3JVU A;  2VKS A;  2ZOI A;  3BQ8 A;  5DFX A;  4BMW A;  2WKP A;  4R3A A;  2W3E A;  5F68 A;  1DP6 A;  4HNB A;  4UEY A;  5KSH A;  3CIT A;  2J80 A;  1T1B A;  3DBA A;  4OOL A;  3A0S A;  5CX7 A;  2W3D A;  3KSI A;  2J3W A;  4CLC C;  4HOI A;  5AVE A;  1ODV A;  4JGR A;  5LBR A;  5L8M A;  3NHQ A;  3OOV A;  2JN7 A;  5G4Y A;  2HJE A;  3UB7 A;  4CQH A;  3LID A;  4YOF A;  2W1T A;  3EGD C;  2Z6D A;  2A24 B;  3RH8 B;  2NUT C;  3LIC A;  4O01 A;  1P9W A;  3ZYT A;  4EW7 A;  5IU1 A;  5AVF A;  1W63 Q;  4UQI M;  1LT0 A;  5HWW A;  4L0L A;  1N9L A;  4HJ3 A;  4G3V A;  4WEL A;  3TJZ C;  4ARZ B;  2PYR A;  3VE3 A;  5TBM A;  4GS9 A;  2DMW A;  1TF1 A;  2W3G A;  4YNR A;  2PD8 A;  4O0P A;  3MFX A;  1WA9 A;  1H3Q A;  3BWL A;  4I3I A;  1TS8 A;  4MMN A;  4P6Z S;  3H82 A;  4F3L A;  3VOL A;  3MR0 A;  3PYP A;  4MN7 A;  2HGV A;  4ZRR A;  3H7W A;  3KX0 X;  3CUE A;  4HJ4 A;  3R7W A;  2KX6 A;  5F5Y A;  3IBJ A;  3LR4 A;  1D06 A;  4HP4 A;  3IBR A;  1ZHH B;  3K2N A;  4L9F A;  3PBT A;  1NLZ A;  3F1P B;  1S4R A;  4PKY A;  4ETX A;  3IS2 A;  4UQI S;  3W2Z A;  5HDD A;  4JGP A;  3KSG A;  4I3A A;  4JGQ A;  1X0O A;  2P7J A;  2J3T D;  1NLY A;  1UWN X;  1XJ6 A;  2ZMF A;  3E4P A;  4NXE A;  4QPR A;  2M7U A;  4H6J B;  2OOL A;  3D3O A;  2V1A A;  3MQ0 A;  4EQ1 A;  4XT2 B;  3ICY A;  4Z1W A;  3BJN A;  1XJ3 A;  1ZTU A;  2VGL M;  3C2W A;  1T19 A;  2ZOH A;  1VHM A;  5HD5 A;  3A0V A;  3KSH A;  4E04 A;  1LSX A;  1DRM A;  1P97 A;  4GCZ A;  1H8M A;  1S4S A;  5MC7 A;  3OC2 A;  5A8B A;  2B18 A;  3G6O A;  4KUO A;  1LL8 A;  4Y5F A;  5KIZ A;  1XFQ A;  3NOT C;  4I5S A;  2D01 A;  2R78 A;  4G3K A;  3LR5 A;  3LUQ A;  4BBV A;  4CLC B;  3UME A;  4GHI A;  4EEP A;  1MKM A;  2O0Y A;  5AJG A;  3LIF A;  4JGO A;  2W0N A;  2XSS A;  4BWI A;  2B02 A;  3F1O B;  2XA7 M;  3P01 A;  3R4K A;  4MDZ A;  4HY8 A;  4Y2F A;  2QJ5 A;  1STZ A;  2PHY A;  3PBS A;  3MXQ A;  3K3D A;  2O9A A;  1Y28 A;  4FSF A;  2M7V A;  3MF0 A;  5J3W A;  4NXB A;  1NRJ A;  2FH5 A;  3OCN A;  1P0Z A;  4NEE D;  5TJJ A;  1XJ4 A;  4EU0 A;  1TD5 A;  2GX5 A;  5HSQ A;  4GW9 A;  5C5K A;  1T1A A;  4CLC E;  2H28 A;  5IT5 A;  1W63 M;  1OTB A;  5DF9 A;  1BYW A;  1V9Y A;  4I39 A;  2HJ9 C;  1YSP A;  5F6A A;  3HCY A;  3PBQ A;  2OAQ 1;  3KYZ A;  2WKQ A;  4WF0 A;  4GLQ A;  5HZH A;  2NUP C;  3E0Y A;  4IJG A;  3EGX C;  4RQ9 A;  3S7O A;  2P08 A;  2XA7 S;  2JKR I;  2W1T B;  3EQU A;  1YAX A;  2QYB A;  2KOI A;  4GJ4 A;  3UE6 A;  1LSW A;  2V1B A;  4Q0H A;  5F69 A;  3OBF A;  2YKF A;  2D02 A;  2GZA A;  2QHK A;  4CLC D;  4MCW A;  4HJ6 A;  3NJA A;  4WLA A;  4MN5 A;  5HPI A;  2FZ0 A;  1VB6 A;  2L1M A;  3S7Q A;  2L0W A;  3F1N A;  4LPZ A;  4YWZ A;  1V9Z A;  2CMN A;  1LSV A;  4GS9 B;  4II7 A;  2JKT I;  4KQD A;  5TBM B;  4EES A;  3PHY A;  1TS0 A;  3K3C A;  3LFV A;  2A2L A;  3EEA A;  4IUH A;  1T1C A;  3C8C A;  4DN0 A;  4LRZ E;  4PHT A;  2XRO A;  3H82 B;  4F3L B;  3SW1 A;  1DP8 A;  3MJQ A;  3OCL A;  3ULF A;  2W3H A;  3H7W B;  4R38 A;  2K7S A;  3PR6 A;  3R7W B;  4NXG A;  2V0U A;  2OWJ A;  5EFW A;  3MMH A;  1IOU A;  4WEK A;  3BW6 A;  4ETZ A;  2EWV A;  1OPX A;  5G4Z A;  3IS2 B;  1F98 A;  2VA0 A;  3EEH A;  1N9O A;  3MQQ A;  4HHD A;  3FPW A;  1EW0 A;  3GDI A;  2YKH A;  4BBU A;  3T4L A;  5DJT A;  1MC0 A;  2G7U A;  2PYP A;  4R70 A;  3E4O A;  3EQV A;  2PD7 A;  4LRX C;  1DP9 A;  4WL9 A;  2KDK A;  2BAS A;  2PDR A;  3B42 A;  2GJ3 A;  5DKL A;  5J4E A;  4IHQ A;  5HDC A;  3LIB A;  1N9N A;  4B93 A;  2JKR M;  2W1R A;  3HJI A;  5I5L A;  3UB9 A;  3T50 A;  2M1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...