1H3TA

Crystal structure of the human igg1 fc-fragment,glycoform (mn2f)2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
207
structure length
207
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords IG GAMMA-1 CHAIN C REGION
publication title Structural Analysis of Human Igg-Fc Glycoforms Reveals a Correlation between Glycosylation and Structural Integrity
pubmed doi rcsb
total genus 34
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h3tA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h3tA01
2CKBH 5M95B 1NCNA 2BNRE 5IROC 4NCC2 3BKCL 5F88A 2P5EA 2AXHA 2DL9A 1MHCA 1J8HB 3P77B 5BS0B 4JFQB 2YD3A 3FT2B 3KYKH 1YEHH 4HIXH 4HQQL 2EIDA 1CDYA 5AYUL 1NBZB 1NGWA 4PJGA 5F3BA 4RIRA 2KH2B 3HS0B 5DEZA 5E1HB 1IAOB 5IJKC 4OTXL 2HLAB 1SHMA 5HHVL 5EUOB 4JRYE 4UQ2B 5EB9A 3T0EB 2FYYB 1HHGB 4I3RL 3ZHKA 1F45A 3MCLL 3CFEA 1Z3GH 1I4FA 1FIEA 4LPWA 1W8NA 3V4PH 3VXMA 2HWZL 1XIWD 1GGBL 4OZFA 5I73C 3S37H 3DUUB 4PJDB 3QHFL 4F7PB 1LO2L 2ED8A 1CR9L 1J5OL 5KVEL 2YBRA 2FDBP 4NC0B 2XRAL 5EU6B 1AI1L 4JRXB 4RWYH 5KG9A 1IVLA 3S96B 3EAKA 3VE0A 4HK3N 3G5ZB 1JPGB 3NVQA 4I13B 3QCUL 5IHZB 2P8PA 4XTRD 3QIWD 2ZSVB 5EOQL 5L0QB 2Q87A 4EI6A 1H9VA 3EYSL 3CVIH 3TBVA 4GRWB 1DDHA 2XKUA 4M1DL 5JA9A 3OKEB 1BQHA 4IRZL 4NQDE 4RMTA 1HEZA 3KS0J 3KPSA 4BH7B 5IOPB 4KZDH 2NQCA 4I18A 5KN5B 5HYFA 3BZEA 3OGCA 1B2WH 4B53A 5EU3A 1M7IB 4ZTPL 3L6FB 4LSRL 4JFZH 5FOBB 4D0BB 3VXUB 5DK0B 5D7JC 3MLWL 5IMKB 3O8XD 1XCQB 3LKOB 3VMNA 1QUNA 5FGBA 2X4TB 5TE6L 5D2NC 1XGPA 3F7YB 4GQ9H 4XVSH 1EO8H 1A7OH 1T03H 5MEQA 4MAYA 2OLDA 4F58H 2JIXA 1LEIB 2HJLB 3LQAC 5I2IB 2VXSH 5F7MC 4ZS7H 3I75B 4YFEA 2JJSA 1RZKH 1I7TB 2YD4A 4YDJA 3VWKA 1DLFL 1OTSD 4ESKA 1UQSA 2Y4SA 4E41D 4JAMA 3S34H 4D3CL 1CT8B 2VLKA 5DD3L 1MQKL 1SEQL 1JF6A 3HFML 35C8H 3CLFL 5I73B 1YQVH 3T77B 1U3HA 4WO4B 1WZLA 3QH3B 2CLRA 2YUZA 3RFZC 1NFIA 5HSFA 2FO1A 2ICCA 3UPCA 3OKDB 3FRUB 2DQCH 1NL0H 3HZMA 3D0VB 5FB8B 4CVZB 4WFHD 3V95A 3HC0B 3WIHA 1FVCA 3JUZA 2FR4B 5SWZA 3ARWA 4WJ5B 1U6AH 2AK4E 1K3IA 4FZEH 4QTIH 5TQ2L 4JY5H 1X5IA 2OTUA 1D6VH 1QBMH 1A6UH 4H1LH 3C8HA 4H20H 3NIDE 3KPQA 4PP1C 3X11B 4JDZB 4UIKH 5C8JB 4O02L 1HWGB 2HJFA 2A1WL 5I1AB 2F5AH 3HC3L 2NLJA 4UBDC 1TTFA 5IP4A 4W81A 2QSCH 4ODXB 4M7LT 5GRUL 3Q5OA 4OCWL 2P7TB 5GS0L 3QHZH 2JE8A 1MFNA 4HUXA 3L3HA 4GLRI 1T6WA 3QZWA 3L3OA 3P3YA 3QDJA 5E5UB 5D7JB 2BFVH 4JO4L 2PTTA 1GVIA 4X4XA 3ZO0A 1KNOA 5F9WB 5JOEA 3JSSA 1S7QA 3RWEB 5D2NB 3F62A 5I1IH 2D7OA 3DX6B 4G9FD 4YHOL 1P5UA 3PGDA 3HRZA 1TZIA 5IBLC 1OSPH 4KK6D 3ULVC 3VW3L 3DURB 3GHBL 5E6IA 3I02B 4JG0L 1UJ3A 3NAAH 2F5BL 1IAKB 3OZ9H 5FKAB 2VZSA 4AZ8A 2OL3A 4LHUB 5TDPA 1P4LB 3NTCL 4TRPL 1EHNA 2QHRH 3JZ7A 4NZTL 2NY6C 4NCDA 1ZS8A 2ADGA 4N0YL 1MOEA 3IDYC 1ES0A 3RGVD 1XMWA 4XXCA 1MY5A 4YPGB 5C0FB 5C0RH 5HDBF 5ACMA 1E4XI 5I74C 3VXOA 5EDXA 2VITB 4XMPH 5CSBA 1NDGB 3WUZA 2HVJA 5BJTA 2MWCA 2X2YA 1MCOH 3BRFA 3KLHD 4M6NH 1XGYH 4PRNB 4M7JL 1UEYA 3SDAD 5IBUB 3GMPB 4ODUA 1S7SB 3MV7D 3R0NA 4HS3A 3BN3B 1N5AB 4UDTA 3U83A 1NGPH 1F3RB 5FYKD 1T20A 1P84J 1OAQH 5FK9A 2AJSL 3RZCA 3BH9A 2LU3A 3IT8D 3TJEL 2RB8A 1DANU 3MV9A 1A7QL 1L7TH 3Q5YA 4RX4D 4JKPH 1S9WB 3WDJA 1NGWB 2ZUYA 3BP6A 4V2CB 5F3BB 2WBKA 4K2UH 4EXKA 2JJSC 1CFNA 4JQXA 3VWKC 4XP5L 3LH2L 4OZGE 1RURH 4JFHD 1JUFB 5LQBH 1I4FB 1HKFA 4KKAD 1FYTE 2WBJB 3GSVA 2F53E 2ZNXA 3QEQA 2LABA 2ARWA 1A7NL 4YX2H 3MLSH 3GNMH 1R3LB 3OR7A 2C7UA 3C5ZD 3WLWD 4CL7A 4GRMA 2GKIA 3MUJA 1U3HC 2DQEL 2DJ4A 5SX5K 1QO3A 2V5MA 3MRJA 2YBRB 1HYRC 4AIXA 2DM7A 2EZ0D 2I07A 5CKGA 5HGHA 4I77H 3C08H 5D7LD 5KG9B 2ESVD 1A6ZA 2NX5D 2X89A 5EPMA 2WUCL 3DARA 3VGDA 4Q0XL 4BQBA 4K71B 2P8PB 3QIBD 4FTVA 2WP3T 3IDYB 2O5ZH 2DIBA 3BH8A 3U79A 1T89A 4X80H 5I74B 1TPXB 4X9GA 4BFIA 1BQHB 1A6WL 1HKLH 3V7MA 4NPYA 3MO1A 3OAZK 4JZJA 5GZND 1IM3B 4HIJA 4LSPL 3HNSH 1JPTL 1PY9A 1QVOA 1U3ZA 5C0NC 3QNZB 3ROOA 3BZEB 1WIOA 4IRSA 3ZE1F 4K7PL 3VFPB 2BHYA 3QEHA 3L3JA 3RKDC 5MEND 1X7QB 4MA7H 4YDLC 4KQ4L 1KJ2L 3DWTA 5BV7C 2CRIA 1QBLH 2APBA 3JV0A 1OP5H 1M6OB 4JO1H 5GGRA 2DQHL 3KVQA 1A4JB 5MEQB 3T3MF 1OQOA 4Y5XA 3IJHA 2A2QT 1MEXH 2JIXB 1QLEH 3MOQA 3GBMH 2GT9B 1J9CT 2Y7QA 3WJJA 2HT2D 5E6IC 3TZVA 1UJ3C 4LQFH 3FT3A 3VWKB 4K7PY 3SGDH 4OI8A 2BNUB 3CMOH 1BAFL 3EGSB 3IDIA 4ODTH 4RNRA 4D8PA 2CDFA 4JAMB 4CUCA 2J8UB 4CU8A 1WQVT 1GRWA 4HCRH 1F2XK 2VLKB 4NFDA 2YPVL 5IK3B 1DN0A 2AJXH 4R7NB 5FUZH 4P5KA 3MOAH 4OCNC 1E28B 3Q6GH 1U3HB 4U1JA 5IF0A 5JPNB 4Q6YA 4M9PA 2CLRB 2EICA 2HT4D 3CFKB 3RVTC 3HZMB 2DMKA 4X9HA 1CXHA 3BQUA 5I19L 4O2EB 4K8RD 3PG2A 1D3CA 4P9HL 1FVCB 3T0WA 1IGCH 4PRHA 4RGNC 5MI0B 5K9JH 1BP3B 1FL6A 2HLFD 1V7NL 2OR9H 5AZ2H 5KS9A 3KPQB 4MDIB 5HYSG 5B3JE 4PY8J 1A6VH 4JHAH 2HJFB 2I60H 3IDXL 5DHVB 1FL3B 3KLAA 3BD5A 1KJMB 5K9KA 4PY7A 4GMTH 4ZXBA 3DGCR 2ITDA 3EJYD 3WE6B 4BQ8A 1T2JA 2VDQH 4D9LL 4RQQA 3BJ91 1U93A 3MJ9L 3QZWB 1ZA3B 4KK9C 5MERA 2DQUL 1X5GA 4X4XB 3T2NH 5BV7B 1KNOB 4JQXC 2XQBL 3P9WB 2B5IC 3EYQD 3VGBA 3WXWL 3LRHA 3AS2A 5CJXA 1TZIB 2VWEE 1UWXH 3IFPB 3EDDA 5EIQA 4FQJH 5E6IB 3JVGA 1A22B 4KUCF 4KXZH 3BEWB 2A83A 4RMRA 1LDPH 1VHPA 4X98A 4MS8D 2OTPA 2OL3B 5TDPB 4U2ZA 2C3HA 1N3NA 4Y0GA 1XF3A 2VLRA 5D96B 3FO1B 3T2QA 4I2XE 3UDWA 1ZS8B 2R0WH 2VDKH 1ZHKA 4XMKH 4K3JL 3MQIA 2NY7H 3R06A 4C4KO 2QKIA 1RUKL 1T89C 3BDYL 1EFXD 2OK0L 2V7HA 4JFOB 4U0RB 1UH4A 3VXOB 3EOBA 3RZWA 3SKUD 1I8KB 1N0XH 4KUZH 3FN0H 1EBPA 2AQ1A 1T4KA 3MODL 2W0FA 2F8OA 1ZHNB 4NM8L 4POZC 3GSXA 4JM4H 2MHAA 1G7LA 4JZJC 5KANG 3NCYP 1RUPL 3CIQA 1NJ9A 4AH2A 5ACLA 3DO7A 4HS3B 1FNEA 4UDTB 5B21A 3SDXA 4IRSC 1L9NA 4TNWF 5FK9B 4X7TB 3CDGA 4MWFA 1KC5H 4WFED 4Q9QL 1GC1H 3MV9B 5JDJA 4QXUL 5K59F 4NQUA 3U4AA 4Y5XC 2EE3A 2K9UA 3WBDA 4R3SA 1H3XA 1YEKL 4M43H 1G7IA 4RMUA 3OKOA 1CFNB 3U9UA 3BESR 43CAB 4BZ1H 1YPZE 2BHZA 4PJXA 2EE2A 3QXDA 2B5IB 4X6DF 3B6SB 4K7PX 3GSVB 3QEQB 1AIFA 3BYYA 2HKFL 1MHPH 3OR7B 1G9MC 2C7UB 3G5VB 4GRMB 3MZGB 3V6FB 2ZCKL 5KW9L 1D5XA 4RGMC 4EUPB 2VZ1A 2A9NL 1TQBB 3MRJB 4JKLA 4C58B 5KSBE 3DOSA 4RFEB 2I07B 4M6AA 3RNQA 5HGHB 3BQUC 3T3PE 1TXKA 3D0LB 1OGTB 4PJFB 1A6ZB 5EPMB 3VXSA 3M8OL 1SJEA 4FTVB 5D5MB 5DEFB 3BVNA 5DJ6A 3ZE0F 4BFIB 4JB9H 3TVMA 4LPXA 1QA9B 4GBXD 3HE6D 3OSKA 2YD1A 3MO1B 4WFHE 1AQDB 3DIFA 4X7FC 3QFJD 4JO3L 4HIJB 2WQ8A 3PIQA 3TA3A 4PJDF 4AEFA 1MCHA 1QVOB 3MLYH 2VISA 4ZXBC 4OD3H 4BFBD 1A5FL 3OJ2C 3QQ9D 3QRFM 2AJZA 2Q6WA 3QEHB 5JW3L 1KIUA 2R2HA 1VFMA 4R0LA 5F7NC 2XTLA 4IMLB 5GGRB 2G60H 2ICWA 5BO1H 1FFRA 1LD9B 5DVKA 5BZWA 3U7WL 5TF0A 2I24N 1Y6MR 5CJXC 1TTUA 4JCLA 4Y5XB 3GIVA 2X70A 4FABL 4PLJC 1K6QL 1HNGA 4MXVF 1INEH 2PW1A 4DTGH 3MLUH 1QFHA 3JVGC 4H25B 2LAGB 4NO3A 4WHTB 2E7MA 1GAFL 3UJIL 1DSFH 3BKJL 4K23H 2CGRL 4HS8H 2WBJD 1P7KB 1UH3A 4D8PB 4OLWH 2CDFB 5E8OA 5GJSL 4G9FE 3W5MA 4S1SL 1S9VB 4HX1A 2YMXH 1UKSA 1E4WL 3C60B 5GSVA 4HUUB 3RDTA 4Y2DA 3UDWC 4U1JB 4RGMB 1MFCL 5HYIA 4GXUN 5I9QC 3AU1B 2LVEA 1CE6A 4NRZA 5C0JB 3QG7H 3G5YB 3RI5K 2ADFH 3VGHA 1FGNH 3BQUB 5ESQB 1ZMYA 3U0WH 1RMFH 5L6YL 1EPFA 4DOHE 1NMBH 1F8TH 3ABZA 3EOTH 5F1OB 5L9DL 3SE9L 1T0PB 4UNTA 2I5YH 3HPJB 5I18L 4Z0BH 4U3XA 4R26H 4BQ9A 1Q1JH 4U7MA 3GIZL 3MRNA 1XGQA 5I6XC 5J6HA 5GHWL 5GGVH 4J3TA 4Y19D 1R5VA 3GSOA 2APXA 1FC1A 5HGBA 1MIEH 1NCCL 4ZXBB 3MNZA 3MV7E 1U92B 3VH8G 4N8PA 1U93B 5J6GB 2X4SA 1WWCA 5MERB 1VACA 5FYKE 4HK0A 5T5NG 1HIML 4R2GD 4BZ2H 2CRZA 2NPLX 4YWGH 3UYRH 2A73A 2XT1B 2W1NA 1K8IB 3GMNA 3GI9L 5DJ8A 2NY4C 4BSJA 1HSBA 2YPKA 4LOUD 1XEDA 4ZDHB 1H3VA 2HKHL 3O3BB 3BIBX 4CW1A 1K5NB 3IKKA 3HUJF 1CGSL 1RK1B 2A83B 2E9JA 4PRIA 4X98B 3QWOA 1N5YH 5GZOC 1N3NB 3VD3A 1XF3B 2VLRB 4PJHF 4JFHE 1W0VA 2XPGA 1UWEL 4FN0A 2Y23A 4F7TA 1BVKB 5BOPA 5HHMD 4N0CD 2P24B 1VDGA 5B38A 1GHFH 2V2TB 3R06B 5C0AA 1ZLUK 2QKIB 2XZAH 3CSGA 3KYMB 3NZHH 3RY6A 1P6AB 5IESL 1A9BA 1JV5A 3PL6A 2NY1C 2YOCA 4XX1G 3EOBB 1CFSA 3ILQC 2R9HD 4PJIB 4CMMB 3TVMC 4PYHA 3ALXA 4HKXA 3Q0HA 5D7LE 1LILA 3GSXB 4HUVA 2GK0A 2MHAB 2NX5E 4HWBL 4XP9H 4P9ML 1KG0A 1NJ9B 2VDLH 4AH2B 3TA3C 3DO7B 1OTUD 4KV5F 5DC4B 4P99A 5E2JA 1DQLL 1FNEB 3SDXB 2FJHA 1JHLL 2WINA 5I6XB 1C12A 3CDGB 4UMGA 3HI5H 1AGCA 2I27N 4R4BB 1S7TA 4R0LC 2FHBA 3GSNA 4MA3B 3NFPB 4X5XB 4IEFB 1I8IB 2CDEA 3RPIA 5CWSA 1UKTA 3OKKA 3VXRA 3QJFB 4R3SB 1YC7A 4K07A 3OJDB 2BCKA 3OKOB 3EIFA 5ABDE 2W0LA 4WY7H 4CNIB 4LCWD 3QXDB 4PJ8A 4JN1L 1NUGA 2NY4B 1S7UB 3CXDH 4F9PA 1AIFB 1Z0NA 3R8QA 4V1DE 1CFQA 5HHOB 2XY1A 2EXYC 5T5FH 3RDTC 4Y2DC 4AG4L 4LVOC 4DKDC 1G7JB 1D5XB 2AQ2A 2A74B 2UWEB 3UTSD 1AR1D 2ARJQ 3DMMC 4O5LL 5CGYD 2CK0H 1FAIL 2L0DA 2JCCA 3R0MA 4PV8A 4XCFH 1RUQL 2X4PA 1G0YR 4FMKA 4PJGF 5HGAA 2NR6C 4MNQA 3WIFB 1MHHA 3CXHK 3BVNB 1J1XL 5MHSD 5ISZA 5F7KC 2ZJSH 3SQOH 5JHDA 2NY1B 3WD5L 4EI5A 2J12B 3K2UL 2D3VA 3ARGB 3L7EB 4A2MA 1X5FA 5ELIA 4HKBB 2NY0C 2AK1L 5K9QG 1FGVL 4AMKL 5B22A 1MCDA 3PIQB 3TA3B 3LQAH 2X4UA 3MNWB 4KI1A 5FCUH 4YHIB 1JCKA 4OUOA 3IF1A 3H3PH 5BRZA 1CZ8H 5IGXL 1H8SA 4NGHL 1MH5A 3BRGC 5I1EL 1FE8L 5ADPH 3TPUA 5D8JH 2R2HB 1KB5A 2ZUSA 5TQ0L 4R0LB 3G5XA 5F44A 5E2WH 5J13B 3N85H 5BZWB 5TFSH 4KJWC 5HYSA 4ORGA 5BVJB 1NDMB 3GIVB 1UWGL 5L7XL 5HHPA 3QCVH 4IRJC 1RHHA 1WITA 1KELH 1KN4L 1MRDL 2KQMA 1WGOA 3DSFL 3N1QC 4L8DB 4DEPC 1CFTA 5EU4B 4LFHG 1JNLL 2AQ3A 2VXTL 4NO3B 3RRQA 2OM5A 4PJAA 1OP3K 3VD9A 1QKZL 1UEMA 1O0VA 5EC1A 4GKZA 2FWOA 1LO4L 5C0CB 5M7QA 2ICES 1CVSC 1KLGA 3E2HC 5GSVB 5LBSL 1WEJH 4Y2DB 3RDTB 2ADJA 4LVOB 1BVLA 4OZHE 3QEGL 1OWWA 1KGCD 5C09A 3RY6C 3SGDI 2FO4B 3DMMB 4JKKA 1RU9H 4NNPH 3PL6C 2C3WA 5ADOH 4ELMF 2ZUVA 5D4QA 4LHJB 4KY1H 5IMMA 3OHXA 1Q9WB 2CK2A 4HS6A 1FC2D 4K7FA 1S9KC 5T3ZH 1I3UA 4S1RL 3JV5A 1F4YH 5TPWL 3TH2T 1BQSA 3PGFH 3ZSSA 4TNVK 4O00A 5DMIL 5SX4H 1FBIL 4AQOA 3ZYOA 5LXGH 2V7NA 1FAKT 2X9WA 2EDWA 1XGQB 3MX0A 3GSOB 3VD4A 1A2YB 1O7SA 1I1YB 4OLYH 1C16B 5C92A 4P57A 2FEDC 3ULVH 3TT3L 4OZFH 3MNZB 4CMHC 5EUKA 4DAGH 5F3HB 1AXIB 3QYCA 4YK4C 3TBYB 1DEDA 3FOLB 4XNUH 1D9KD 1XF5A 2YPLB 3N9GH 2IAND 2LVCA 4WENB 1ZT1A 3O2VH 2B39A 1HNFA 2G75B 1RJZA 2A73B 4PJ8C 5E99H 2R39A 5DJ8B 4F9PC 1DBKL 4P23D 3FB5B 2GCYB 4OQ1A 3UP1A 3BISA 4IRJB 1XGRB 4CJ0A 3LV3A 4CW1B 4HHAA 1BWWA 4Z7WE 2V5RA 5DFTA 1Y0LA 1U0QA 5CZVL 3VDBA 2A38A 5I71B 3QWOB 5IW3A 2OTWB 3MBEB 4FQIL 3C60D 3V0AC 1W0VB 4YDIL 1B88A 3E2HB 2WLYA 5IQ7H 4KXZI 4WWKC 1ZE3C 3KG5A 5C0AB 1YNLL 4I3SL 1JV5B 1PG7L 1F2QA 3PL6B 4EI5C 1CFSB 2FGZA 2AABL 5GRJL 4OV6F 3CSPA 4U49A 4HKXB 3NABH 4F2MA 4F58L 3T04D 1QFUL 2OP4H 4YJZL 3IDMA 5F7DA 5FUCE 3G6JE 1N8ZB 3I2CH 3C09C 1N0LA 1KG0B 2HG5A 1WWAX 2ZOKB 4Y4FA 5CCKH 2BDNL 4FFVC 3U0TA 2KQNA 3PABB 2FJHB 5I16A 2WINB 3RWJB 3DECA 1IILE 4M5YH 3PWPE 4PS4L 4DK6A 2KZWA 4HLZG 4ENEC 4XHQA 3QFJE 5A3ID 3UBXG 3CFDA 3MGAA 4HT1H 5GGQL 1BZ7A 4PRPB 5DGQA 6FABL 4YK4B 2CO7B 4QT5A 3OKKB 3VXRB 3MLTB 4NQCE 4QRPD 5HYQA 3VFWA 2BCKB 5CILH 1ZAGA 1R3IH 1OAZL 2XXCB 2YS4A 4TPRH 1B0WA 1VFBA 4PJ8B 4K3GA 4PGBA 2FCBA 5B4MC 4JY5L 3HAEG 3WIHH 3KPRA 1TJHH 1TJGL 1AXSA 1CLOL 4YXLH 4QWWD 4BFEA 1IC7L 5KJRH 4U6XB 4H26B 1AGBA 4HDIB 4X0KA 5EA0H 4FOMA 3F12A 3S9DB 4NQTA 1J0HA 3FMGH 1UZ8A 4LU5H 5IMOA 4ZUUA 5DD5H 5JW5A 4KMQA 4LSTL 4M48H 1TVHA 1OLLA 2X4PB 4L3ED 1ZEAH 1U91A 1B3JA 3VWJA 5ID1A 1PQZA 4MNQB 4WWKB 1MHHB 5IFAL 2HA1A 4RCAA 2W92A 3VRIB 5JHDB 4D94A 4MCYA 3BKYH 2QLVB 5CBAA 3SO3C 1RV6X 4EI5B 4G80A 2XWTB 5DEGA 5BV7H 2IQ9H 3U0PA 1PKQE 1MIML 3QIUD 4PUBL 1YNKL 3TBTA 5IVXE 5CEZD 4LLWA 1I7UB 1A14H 5CHNA 4FQXA 1B6UA 7FABL 1MJ7L 4U1NA 5T1DH 3NAAL 4BUGA 5KVGH 3ARBC 2MJWA 2FBOJ 4ZUTA 4OCRH 4JFXA 3IF1B 3CU7A 1F3JA 1PLGH 5BRZB 4XC1H 4X9BA 1G6RB 4G8GD 2OL3H 4HPOL 3TPUB 2R56L 1KB5B 1W0WA 5F9OH 3JTSA 1OARL 3G5XB 4Y19E 5C70A 3ZL4L 5HYSB 4P3DA 4M6OH 2PW2A 5ILTH 4XH2A 2GYSA 1R3HA 2W9DL 3IFOA 1RHHB 4KRPC 3NN8A 1F6AA 1C8PA 4N1HB 1NAML 2QSTA 5DT1L 3HNTH 4Z7QF 4PJAB 2HFFB 1FZOA 4DKFH 2AJ3A 2VLJD 4RZCA 1MHEB 4GXUM 3REVB 5HHOD 1NMAH 4RAHA 4L3CB 1HN1A 4CAGA 1INQA 2DD8L 2AKRB 3RWGB 3C5SA 1R3JA 4RFOL 1BVLB 3UJJL 4UB0L 4OQTL 3E8UH 1MFEL 4G9DA 3GGWB 3OAYK 5C09B 1Q9KA 1YYLH 2WANA 4HFWB 4LHQB 3RWFB 1Q38A 3MV8E 3MXWH 2IAMC 3PQYD 5DD1L 5DMYA 1KN2H 1RZJL 4W6YB 5IB4B 3NZ8B 3MFGB 5IMMB 3C87A 4HS6B 5ECJE 1OGAE 5KBNC 2EE6A 5HHME 1BVZA 5HHXH 4Y4FC 1ETZB 4FFWD 2NW3A 3ARGD 3SO3B 5MP6H 4LARH 1AJ7L 2V7NB 4X6CA 5IFHH 4R7DA 4D0DB 1ZA6A 1T7XA 4J3UA 4MYWB 1PG7X 3HG1A 1G9NL 3GNML 4P57B 1OSZA 3KLSA 1ZGLA 1P7QD 3RX8A 3NBNA 4NQEB 2XN9E 3ARBB 1KB9K 5EUKB 3DXAB 2HT3C 1T04A 1UG9A 1RZ7H 4RA0C 3M1BA 1BGXL 4GG6B 4WHDA 1KBGL 3C08L 2Y6SC 1XF5B 5L8JB 4OZIE 1ZT1B 3FQTA 1LP9F 2N7BA 4N8VA 3SOBH 3TN0D 2D03L 3KDMA 5KS9F 1EV2E 2L7JA 3LV3B 4HHAB 4KKBD 4XVJL 3O4LA 4HF5L 1Y0LB 4YO0B 2DIJA 3KPOA 4LCWE 1A1NA 4KQ3L 5GS0C 5IMLA 3O6MH 4EEEA 5JDSA 3EJZD 4JDVA 3K46A 3VWJC 3ZKXC 1EVUA 1KJ2A 5IKCA 2C5DC 4G5ZL 4WTZG 4PGDA 1P5VA 5D7SH 5DDHB 3H0TB 1FDLH 4X7DC 3S36X 2EXWC 5I1LB 1UM5H 4MNGB 2IAMB 3UTSE 1ED3B 3WFDL 3C9NB 3GMLA 4HJ0C 1KCSL 3IDMB 5F7DB 1KACB 2YKLH 3BP5A 4FQXC 5IB1B 5MEOB 2Q76A 2VDOH 5IR1B 2HG5B 5HYEA 1RIVL 4PYGA 4UOJA 4L5FH 1MLCA 4PRAB 4WUUA 4DN4L 2VN7A 4NO0D 3ZE2F 2IG2L 1FZMB 2EYSA 3H3KA 4ODVL 1OOAA 3EFDH 5CJQH 4LCYB 4LASH 5SWSA 3WMSA 4HG4K 2MPAL 3B9KD 5HHNA 3T8XA 1RZGB 3H9YA 3CFDB 4KK5C 5T1LA 1IL1B 3DRQA 3QDMB 1TJIL 4QT5B 3GMRA 4HGKC 5H37G 3VRLF 2FIKA 5HYQB 4XWOD 1JPSH 1VFBB 4LDLB 1YEFL 3VFGL 1HHHA 3KPRB 1GPOL 3MCKA 3QSKB 1UKQA 3RUGA 3D2UA 3U4BL 4GUPA 2DWEB 2QSVA 1WWWX 2Y36H 1CU4H 2WP3O 3LIZH 5E1AB 4CGTA 1IGFH 3SJVE 1T5XA 1QBBA 4LSSL 3HMWL 4TVPD 3F12B 2X4NB 2YXFA 1NC2B 1YN7A 1MJ8L 3MBED 5JW5B 5CD5D 4MVBD 3V5KA 4YUEH 1TVHB 1CDGA 3MJ9A 5A2LH 5DA0B 3SDDD 3UZQA 3THMH 3RNKB 3ZKXB 5ID1B 4EDWH 1BPVA 5FGCB 2R0ZL 2E27L 4KU1A 4U1MA 4PJXF 5CBAB 1KGCE 4G80B 4XAWL 5DEGB 1LO0H 1WBZA 3U0PB 1MCNA 3IDUA 3NFNA 5C0IB 2UZYB 3UZVB 3INUL 3NCEB 4PFEA 2ENSA 1NFDA 3DETC 2DLFL 4HJJL 4UTBL 1UA6L 2OYPA 5HVWA 1Z9OA 2J4WH 3GUTA 2CD0A 4U1NB 4MD0B 4OM1L 1RIUL 5JXAH 2BSSB 3RTQA 4JFXB 2CIKA 1XCTB 1F4HA 4UT9H 3GI8L 2D9QB 1QZ1A 2P8LA 3U9PL 4ZUWB 4NJ9L 3WSQH 5SX5H 1BZQK 1YMME 4PRPD 1S5IL 5HVFB 4P49A 1HE7A 2PW2B 2CUIA 4XH2B 1UC6A 3FRPA 3HZKB 1CGUA 4ODSL 1JRHH 1ZXQA 4KRMB 4MLIA 4ONOA 3A6CH 1KENH 1X5AA 2BK8A 1V3MA 3VI4F 2IANE 2XG4A 1FZOB 1TQCC 2EH8H 5LGJA 4RZCB 3SKNA 2BJML 3VH8B 4G3YH 5C9KA 2C4XA 3DRTA 4YQXL 1INQB 2ZZUT 3C5SB 1IFHL 1GGUA 3OAZH 1R3JB 3T08A 4MAUH 4Z77A 3DUSB 4OFPA 1X5HA 1Q9KB 1XZ0B 4CDHA 3LN4A 1MREL 5HDLA 4ERSH 3BI9X 1K8DB 2DQIL 4QRTA 5J3HD 1X9QA 3WCYA 1PD6A 3HCVB 1VESA 2O61A 1CLYH 5BW7A 2Q8BL 4ZAKD 1MAML 3EO1A 3MXVH 3QUML 4G7VL 5TH2B 3ZHLA 3OJMB 4J4PD 4DN3H 3S3SA 4Z76A 2NW3B 3KHOA 2YA0A 4P0DA 4X6CB 5T3XD 4PP2B 1VA9A 4YHMH 4R7DB 5FCSH 2Q20A 1UM6H 1QR1B 1JWUA 1QSFB 1W72L 2VDNL 5D7IB 1AY1L 5DZLA 3SE3A 5C0GB 4XCEA 4AJ0A 5LG1A 4MCZB 1SJXA 3STLB 3HI1A 1C08A 2UZXB 1EGJL 5FV1L 4IIQB 3V4UH 5SX4I 1T04B 4LMQI 1KIQB 4NCC1 4P9HC 3B3IA 5FHBH 1JNNL 3D39A 2P4AB 3V5HB 1YZZA 2AXJA 4YXHL 5FYJH 4RWHA 4HV8B 3T2OA 2A6IA 2BY2A 4Y2OA 3T0DA 3KDMB 5C7XL 2H1PL 2AJUL 4NQXA 1Z2KA 4Z0XA 2WWKO 5DHXB 3QHTC 1JTTA 3FQRA 1HHJA 1RVFH 4YGAB 5IHLB 1JTOA 4QRPE 4P4KD 3QUXB 2VN4A 5KSVA 1UGNA 1TQCB 3BGMB 1A1NB 1ZANL 4GKNA 1IQDA 2KL6A 1X4XA 3MLRL 5IV2A 5JDSB 3BRDA 4JDVB 3Q2CA 3D25A 5IKCB 4F7CA 3BPNC 5AEAA 2OJEA 1MRFL 3HAEA 4PRBB 4AK1A 3TNNA 4TQEH 3RWIA 1M71B 4LVHC 3WHE0 2DI8A 3QWRA 2P1YA 1BFVH 4J6RH 3GMLB 3ISWA 3BP5B 4WU7A 3X17A 1BIIB 4L3EE 3V6OA 1R0AH 1KIRB 3WNOA 3MRCB 3QCTH 5HDBE 1DSFL 1FPTL 3RTQC 3FQXA 5CSGA 5L88L 2UVFA 3CFCL 1DR9A 1NEUA 5FECA 1IJ9A 2YEZA 3TCXA 2HTLD 1NSNH 2AEPH 3WYRA 1F3DH 4PR5B 4ONGH 4NQED 4L4VB 4ZFGL 5HHNB 3T8XB 1D5BB 3MA9L 4UV7H 3DXAD 1MAJA 2Q86A 5EOCJ 4AT6B 4XPBH 5T1LB 1U8NA 4Z18A 4GMSL 2P5WD 3SKJL 3IDGA 4RBPK 1O7VA 3BDBA 4NBYB 3BZ4A 1F6FB 1OAYL 2FIKB 4ALAL 4PJ7A 3UPRA 4LGRB 4UTAH 5DQDL 4G8GE 1S7RB 1DP0A 2Y07H 3F7PC 1CBVH 3DGGB 1HHHB 4EZMA 3RUGB 3D2UB 3MYJB 3T1FB 3X13B 4FP8L 1JFQL 4ZO7A 1WCQA 4PLKD 4PV9B 1BQLL 1A21A 1A6AA 2OJZL 5DO2D 1MFAH 2F19L 1T5XB 5I75C 3CMGA 2A6DA 1JPST 4D9QE 4XC3H 2DLTA 4OV5A 4Z7NF 4DZBA 1U95B 1X5ZA 1MI5D 1YN7B 2IMMA 1U8KB 4HZLA 1P4BH 2VLJE 3JV4A 1CL7L 1I8MA 4KRLB 3W2DL 5BW7C 4I48B 4U7SA 3X3FL 5JZ7C 1CIDA 1HZHH 2DJUA 1BHGA 5FAAA 2ZP0T 3BPNB 4P59H 4U1MB 2C26A 1MQ8A 4YHLL 2KKQA 4LVHB 1F4WL 1WBZB 4L4JA 4OJFH 5C2BH 3MRDA 1XAUA 4M3KB 4WI5A 1Q72L 4GG8B 3PQYE 1NC4A 3TGXA 4J12A 2ZKHH 2CR6A 4YBLC 3SE3C 3K1DA 4P2RD 3SGJA 3BN9D 3B2VL 3ZDZF 2QTEA 1YA5A 2Z8RA 2A0LC 1TDQA 3NCBB 2JCCF 2B1HH 1A4KA 2H6PA 3WHXB 1CGXA 3SEPA 4WDIA 2P8LB 1U8OA 3GM0A 2P45B 1WBYA 4D0CA 1CDCA 4FQ2H 5E8DL 3J7HA 4K3DH 1Q0YL 3QXTA 5FYLL 3QDMD 5DJAA 2EDYA 1JYXA 3ZE1E 3P4MA 4MSWA 1DBBH 1K2DA 1I9JH 4HWBA 3H7BA 3SDYL 1JGVL 2GI7A 4ODHH 3FTGB 5LGJB 1NLBH 3SKNB 5E2TL 2CDGA 4PP1D 3T3ME 4XNYL 4OIAA 3RP1A 1Q9LA 3DRTB 4CVXA 1FZKA 2B4CL 2WV3A 3OV6A 2Z0BA 1LO5A 5DWUL 3FZUC 4Z77B 2FBJH 4JN2A 5HD8C 3O6FD 5C0EA 1OLZA 2OSLA 4DUXA 3LN4B 3VGEA 1N2RA 2I9LB 2NZ9C 4K3EL 4JDTL 3PGCA 3MBXL 5EZJA 2O61B 3IXTA 1II4E 3WFEH 3L3IB 4S1QH 4OLEA 3P11H 1Y6KR 5BQ7A 3GSNH 3V6OC 5DHYA 3MLVH 4JY6A 4F9LA 1E6OH 3PDOA 5AZEH 4Z76B 3BUYA 1HQRA 5DR5L 1AE6H 1EK3A 4QHMB 3MLZH 1Q9OA 4ORZC 1EAPA 4OLVL 3DROA 4WTZA 3C5JB 5J57B 1JWUB 3DUHA 4XCEB 3SBWA 1KFAL 3FQUB 5EG6C 3G9VA 1UZ6F 4N5ED 5I15H 1BREA 3HI1B 4XBEH 5DRXB 2DICA 2NY6D 5FUOL 4HJGA 2BOCA 3D39B 2HFGL 3DVIA 5C6TL 2RBLA 1F90H 4KI5F 3AREA 5E2UL 2IGFL 1KUMA 3LB6D 5HYJE 5JLZA 4FMFA 3PWUA 3BOVA 4JANA 2BHUA 2PYEA 3KYAA 4XPHH 4HIHA 4NQXB 4KAQH 1A1OB 3OF6A 3X3GH 4U3CA 2X4RA 3WNPA 3FQRB 1YEDA 3TJHD 4IDJH 5I1KH 4M1GH 3OX8B 1AGFA 1Y6NR 2DLGA 1TITA 3EYUL 3UBXB 5KSVB 1G6VK 3MC0A 1KF9B 4IS6B 1A6TA 1HILB 4MJIB 1AFVL 4XWGH 5EOTA 1IQDB 2H2PD 5LGHL 2O5YH 5IV2B 5D1ZB 2VQTA 3QXUA 4JFDD 3D25B 5EZIH 5H35A 3N1GC 1KJVB 3ROLA 2PXYB 3U46B 4TVPE 3HAEB 3JTTA 1B4JH 5IW6B 1FN4A 3DX9A 1JVKA 2XKSA 1KEGL 4MAYD 1KB5H 4KK8C 3JXAA 5JHLL 4J3WA 3FFCE 5GGSA 5F6IC 1HXMB 4TUKH 1T1XA 2YD9A 4WU7B 4AENB 5D72L 5D1QA 4LPCA 3Q1SL 1G7QB 3NCJH 3H9SA 1N64L 3BD3A 1SYSA 2VABA 3QDGD 2V9QA 5FECB 4FZ8L 1QSFD 4GS7B 1GGCL 4UNVA 3BKCH 3FONA 2AV1A 1U8PA 5F93C 5J7CC 3DYMA 4X5WB 3KGRA 3GJFK 2FZ3A 2JF1A 2VLMD 3IDGB 4NNPL 5L2KD 1J10A 3RVVC 3CFJA 4KH2A 4QHUA 1X3DA 3MRHA 1KXVC 4LEOB 4L8BA 4P2OA 1BJ8A 3VD7A 1C1EL 4F7EA 4MJ6A 2EDRA 4PJ7B 5AYUH 3S88L 2FL5B 1ZLUH 3V5DA 3AS1A 3Q6FA 4NUGL 1DQJA 4RISL 5T3ZL 5K59E 4OTXH 5HHVH 2FECL 3AMLA 5J1SC 1RULL 5DK2A 4I3RH 4PTUA 3MCLH 4C56A 3LS4L 4NC1E 1H5BA 4H0GA 4MJ2A 5DSCB 2A6DB 3QUXD 4OV5B 4HIEA 4XCNA 3TO4C 3V52L 1FLTX 4HSQA 2HWZH 3VFUA 3UROR 4X6DE 5C0ND 1GGBH 4U1GC 4QEGA 3QHFH 2R23B 4GT7A 1LO2H 3LZFL 1CR9H 4OIBA 2R29L 3JV4B 5HI3D 1I8MB 1CFVL 3MUGA 1MWAL 3QDJD 2XRAH 1K9TA 1AI1H 2P46B 5DF0A 4UUJA 4QRRA 1J8HE 4BJLA 4BM7A 3LQZA 5BS0E 4F9LC 4N1EA 5DUML 3QCUH 5HJ3A 1M7XA 5L2JA 3MRDB 4Z7OE 1MJUL 1NC4B 5F6IB 5EOQH 5C07A 5I76A 2GITA 2QADC 3EYSH 1AHWA 3SBWC 5IEHA 1KTDB 3LHPL 1A7BA 1PX4A 4IRZH 3WXVL 3ZE0E 3OL2A 1T1ZA 4PJCF 2F54D 2QQQA 1A4KB 2H6PB 4G8FA 3WKML 5DD6A 1RK0A 3D18A 3ELAT 4WDIB 2EDQA 1U8OB 3TYGL 1WBYB 5K9OA 4D0CB 2D7TL 2ZUXA 3AS0A 4DKAA 3AREC 1KLUB 4ZTPH 4LSRH 4HMDA 4PJDE 5B8CA 3BPCB 4GW4B 5DJAB 4DVBB 3MLWH 4X6EB 3LKQA 3ARPA 3CFBA 1NQBA 3P4MB 2YSSA 4HK3J 5TE6H 1K2DB 4YDKL 1N6UA 4JRXE 2W60A 2LQRA 3R1GL 4MQXC 2CRYA 1JNHA 2BNRB 3K4DA 3NGBB 1C5DA 4R90L 4G6KL 2OQJA 1VFOA 1DLFH 4MXVE 1JRHI 2AEWA 2IPTL 3ULSA 3RZCD 1LO5B 3ZT6A 4D3CH 2MCG1 2Z31A 3TO4B 4OF3A 4JN2B 2LV4A 5DD3H 3FKUS 1OPGL 2PO6A 2OSLB 1MQKH 4X7CC 1SEQH 5C0EB 4G6AD 3HFMH 3CLFH 5TE7L 4U1GB 4QF1A 1VKXB 1X5YA 3PGCB 4UU9A 3W0WD 2ATPA 1LNUA 4LFHD 4YEFA 4JRYB 1QLFB 3T2PA 5AUMB 3VG0L 2VZTA 3BWAA 4TTDD 2SEBA 3TFKC 1IAIL 1KEML 5DHYB 5D1QC 2NCMA 1GJIA 2VH5L 3PDOB 1WSST 2MQ0A 3BUYB 3DVGA 5EO9A 5TQ2H 5C08D 4L4TD 3C6SB 8FABB 3DROB 2QADB 3RL2B 4KKLC 4NKOA 3HZVA 4I0PA 5T1MB 3VCLA 1NCBL 4O02H 5HI4C 3TIEA 2KZ1B 5EA0L 1OP3H 3ESUF 4NKQB 4NHUA 4KC3B 1ITCA 2A1WH 3EFFB 3HC3H 1MUJA 1C5CL 3OKMB 1EXUB 3AXLB 2BOBA 1IGML 3MRGA 1WCBA 7CGTA 4MA8H 4HJGB 2BOCB 4P2OC 1X5JA 5GRUH 2C3XA 4Z9KB 4ZUSB 3GJFA 1QPPA 4OCWH 5GS0H 3AREB 1OAKL 1EJOL 2AGJL 1OM3L 5JLZB 4ONHB 4HBCL 4JO4H 3MGOA 4NQDB 4HIHB 2BSRB 4KRNA 2WWMC 1HXYA 4BK4A 1OAXL 1XR8A 3CPLA 4CADA 3BIAX 4HEPG 2IH3A 1H5BC 4YHOH 1JF1A 1YEDB 1AGFB 1A14L 3VW3H 1A6TB 1H15A 4MB5A 4DVRL 3GHBH 5EOTB 1WFNA 4JG0H 3D3VD 2XIDA 2VXQL 4HIIB 4IRSD 5HPMB 2F5BH 2F15A 3UYOD 5H35B 5ACZA 4XPAL 1G7PA 3HUJE 3NTCH 4OD1L 4TRPH 3ROLB 5INDB 4R4ND 5EBLA 4IOIB 4NZTH 4P2QA 3ES6A 2H8PA 3JTTB 3W82A 2UZIL 4LL9A 1MI5E 2ZUQC 4JFEE 4ZS6C 4N0YH 4QXTB 4YAQA 4HFUL 3ZKMC 4PJHE 1TENA 3B2UD 3QT2A 1NAMA 4LP4A 3OKLA 3RX5A 1QNZL 3TZVD 5BCAA 5D1QB 3LMJL 1AHWC 3U6RA 1J0JA 3AUVA 1IEAA 2FJFA 2X9YA 4M7JH 3RVWD 43C9A 1SYSB 1NGQH 2XFXB 4KJPD 3KWWB 5HHQA 2ICWI 2J6EL 4IDLA 5CZKA 4ZUVB 5HGGS 4OQTA 3ZKNC 4ZMAT 2J5LC 4KV5E 5B8CC 2AJSH 4P2RE 5GS2D 3UTTA 3OB0K 3KPMA 2FZ3B 4LSUH 4WVRA 3IXAB 5DJ0B 3TJEH 2AK4B 3FB6B 3QWQB 1A7QH 4L8BB 4Q2ZA 4P2OB 4X4ME 1ZLWK 3ZKSD 2GTZA 4KWUA 4F7EB 4MJ6B 1CCZA 1ZT4A 5FXCH 1QSEE 4PRHD 1FORH 4L9DA 4HXBH 4N5UA 2Z4QB 5IHUL 3CJJA 1FCGA 3RY5A 4XP5H 5CIPA 5F9DC 4C56B 4RDQF 4PJ5D 1IM9D 5IFHL 4HIEB 3ZTJG 2Z31C 1X44A 4XCNB 1BJ1J 2PO6C 4TTGA 4MJID 3VFUB 2M26A 4XVUC 1A7NH 4NRXA 5IBTL 1AQKL 4POYA 5ITFB 3IFNL 2DQEH 3DLQR 3TWCL 1QYGL 2VJXA 2P5EE 1KPRA 5CJOL 2PXYD 4JY4A 3LQZB 4AIOA 4MMZC 2VL5A 4W6WB 2WUCH 3VFNB 3SDCB 4Q0XH 2ZUQB 3S5LA 5L2JB 4XGZA 1QBAA 4PLJD 2VDPL 1YNTB 2GITB 4KKCC 4PJGE 4UINL 2NY5L 4I0PC 3NFSL 4PB9L 1AHWB 5IEHB 1BX2A 1A6WH 3VFVA 4LMQE 4NZDA 4NZUL 4B5EA 5DVOA 3STBA 3X12B 1T1ZB 1FL5B 4P5TD 5J1AA 4LSPH 1JPTH 1XIWA 4G8FB 5DD6B 4YFDB 3VXME 2AV7B 4KDTA 4N0UA 2GTWA 3TV3L 1FFNB 3L3DA 4K7PH 5J9PA 2J5LB 4BELD 3WEXA 5D7SL 4PB0L 1PGRB 4MD5B 1T3FA 3WIIL 4KQ4H 1IMHC 1KJ2H 4FQHA 2GIYA 3DHMA 2YSSB 5FF6A 1EERB 1EVTC 4S1DC 4X6FA 2Q8AL 2DQHH 2W60B 4AEHL 1NFDF 2FX7L 1JNHB 3H42L 3QIWA 4DUWA 1QG3A 2YKLL 2QEJA 3V7AG 3JWOL 3NPSC 1TMCB 1IGYA 4FNLL 3C8KB 1C5DB 3RVUD 1VFAA 2OQJB 2JELL 3ULSB 1AGEA 1BAFH 4QRQA 2WNGA 1MCBA 3QBTB 2Z31B 3IKCA 3K1KC 3QAZB 1FZJB 2YPVH 3KPSE 5CGTA 5K33A 5TGBA 5C9JA 3N1FC 2GSIB 3BKML 5KTEL 4JZOA 3CD4A 4WTWA 1AR2A 5HVGB 4QF1B 3LKSB 2PF6A 4UU9B 2ATPB 1LNUB 4DW2L 1G9ML 4UT7L 1YPZA 5F1KC 3D85B 3BWAB 5T33L 2EH7L 4OZGB 5GQBA 3O8XA 2SEBB 3RU8L 4JFDE 4UV4L 5I19H 4XVTH 3CGTA 3IJYA 3OXRA 2W9EL 4F15B 1FYTB 4P9HH 2F53B 4QHNA 3TO2A 3CCHA 3UTQA 3DVGB 3LSOA 3RY4A 4BK5A 5CBEB 1TCRB 5EO9B 4P4KC 3ULUF 4ELME 2BP3A 3MTRA 4OCMC 3BEVA 1V7NH 2NXYD 3I6KA 4NKOB 2CH8A 4I0PB 3VCLB 4D9RD 3VFRA 2W59A 2E9BA 3TIEB 4AIZA 4P3CL 4NHUB 3IDXH 3WUWG 4E41A 1MUJB 3U36B 1RZJC 4WI3A 1WCBB 4L8SA 3VXSD 1HH9A 2VLKE 4MB3A 2RJMA 3GJFB 1ZSDB 3QDGE 5IQ9A 5E8PA 3T0BA 3OAYH 4D9LH 4R9HA 3MJ9H 4CKVX 4NSKA 1A47A 2JJWA 2DQUH 3ARYA 5EFIB 3TVMD 4LIQL 2XQBH 3S4SG 4M5ZL 1CG9A 2DQFA 3WXWH 2VLME 5L2KE 2BNRD 1JF1B 1M05A 2X40A 3P30L 1G9NC 5SWZE 5F96L 3AAZA 3NPSB 4WGWB 1H15B 1G9EA 4UOW1 5FA3A 2I26N 3GSUB 2GY5A 4G8IA 4L29A 5ACZB 1G7PB 5DD0L 3BW9A 4KHTL 2OR7A 1PYWA 4KDVA 3GKWL 3ORJA 2V5TA 2H8PB 2QQLL 2QHLA 1MVUB 2E7LC 2FSEA 4YAQB 1F00I 4JRYD 4K3JH 4S0SD 4RFNB 1S9XA 1RUKH 5DVLA 3BDYH 1NAMB 3O0RL 2OK0H 2JB6A 2W91A 5EO1A 3LS5H 3WFHA 5GRYA 3QDJE 2UYLA 2DYPB 3U6RB 5KAQF 3MODH 4NM8H 1JHTA 4G6ML 2AXFA 1RUPH 1XIWC 1A7PL 5CEZL 3QUYD 4L9LA 4LNRB 4KDTC 5IM7A 2NXZB 1KCUL 5JIHA 2C4FT 4OSUL 3UTTB 3ZYIA 1ODAA 4Q9QH 4I0CC 1WT5A 4C83B 2F54E 4QXUH 1IT9L 2GTZB 3QUMA 1OL0A 4XTRC 3QIWC 3KYOB 5CINL 3VFOB 2NYYD 3RGVA 1KIPA 5JIIA 1JBJA 3UCRA 3PWJA 4Y8DC 4NQDD 4Z7VF 4P4RB 1YEKH 1WISA 4WHYH 3O41B 1L7IL 5CIPB 1BIHA 4KJQD 3W9EA 2EIZA 1U8QA 4GW5A 1W72A 3SDAA 3QG6A 3KPPB 4LQ1A 5J56B 3VXQA 2HKFH 3LN5A 4RGNE 1EGJA 1BF2A 3MJ8B 2ZCKH 2GJ6D 5KW9H 2P48B 3C2AH 2A9NH 2B2XL 2F74A 3IS0X 3QFDB 1KPRB 3O8XC 1VENA 2VQ1A 4JY4B 4ELKA 3KXFA 4F8QA 2VL5B 2NY3D 3MGTB 3M8OH 4RX4A 5JQ6L 4XGZB 4YXKL 1U3JA 5I1HL 2YHGA 3TP4A 3W0WE 5C0DB 2IALB 4X4ZA 1FFOA 1OTSC 2N56A 3QP3A 4ACPA 1GYAA 2WZPD 3WN5A 1ACZA 3HE7D 1P4IL 4HLZH 4JO3H 2R1YB 2FIRT 1T22A 1XIWB 4L8SC 3QEQE 3C5ZA 3DI2B 4G7YL 3HA0A 1LEGA 2GTWB 1A5FH 3PWNB 5JQHC 1I3RA 1PY4A 4GFTB 5J9PB 4I9WD 4R96A 5JW3H 2APTA 1T3FB 2AK4D 4WW2A 4FQHB 4LLMB 4XAKE 3VGAC 3CDYA 2ESVA 3MUZ1 5FF6B 4X6FB 2BX5A 3HAEH 1AKJD 2PKDA 3AM8A 5ICXA 3U7WH 4CN1A 3KPTA 3QIBA 3QIWB 3VI3F 2KPNA 4JPIA 2CUHA 3BE1L 4LLVA 3TBWA 3AY4A 4FABH 4ONFL 4LBEA 4AL8L 1K6QH 3GBNL 4JHWL 3CC5A 3NACH 5D93C 1VFAB 3UJIH 1GAFH 3BKJH 3UPAA 2EIEA 4ISVA 1BBJB 1AGEB 2CGRH 2EDNA 5GJSH 5TGBB 1ORSA 1WZ1L 2M1KA 4S1SH 4Z7QE 2AEPL 3FN3A 2FGWL 4JZOB 1E4WH 4L8CB 3QRGL 5AG9A 1P84K 1MFCH 3NA9L 5MENA 2HFEA 1YPZB 4JFQA 5AD0A 2EKSB 1AGDA 2ZG3A 3O8XB 4LDOB 4ZTOL 3IJYB 5BMFL 4EDXA 2Q3ZA 3BD4A 3SDCD 4QHNB 3O3AA 5AWNL 3UTQB 3BT2L 3DBXA 5L6YH 1NBZA 3NH7L 4LLYB 3HS0A 3G04A 4M61A 1RUAL 1IAOA 4KK6C 5L9DH 2HLAA 3SE9H 2YD2A 2ZG1A 1ZHLA 4L9LC 1HOCA 2FYYA 3I6KB 5I18H 2Q3AA 2XNAB 3MYZA 3GIZH 2ZPKL 4E41B 3A6BL 5GHWH 4GAJL 2RFXA 1QFWL 1WT5C 2D7NA 1NCCH 1HH9B 4LLUB 2E7BA 3OMZA 4F7PA 1FO0B 4M02A 3O3DA 5IQ9B 5E8PB 5EU6A 3RGVC 2X4QB 5ISZD 5EC2A 4OFVA 2JB5L 1AXTL 3S96A 1HIMH 3VGAB 4W6XB 1JPGA 1G7MA 1S5HB 4U05A 1CG9B 3KR3L 3KLHC 3GI9H 4ZSOE 3SDAC 2ZSVA 4XBPA 1LP9E 2HKHH 4DUVA 3K2MC 4OAWA 5DYOB 3AAZB 1RZIB 4NKDB 4PRHE 4XCYA 3OKEA 1CGSH 5KS9E 3P0YL 1AO7D 2EDXA 5FA3B 5ITBL 2R4RL 4B7LA 2B1HL 1WV7T 2MOVA 4NRYB 5ESAB 4TVPL 4JG1L 2H3NB 4PJ5E 4HW6A 1PYWB 1UWEH 4GKSA 1IZJA 5GGUA 1H3GA 2FSEB 1T1YA 3I3EA 4D0BA 3VXUA 1WJ3A 5DK0A 3BHBB 1S9XB 1U8IB 3BSZL 1XCQA 4DKEL 1YDPA 5IESH 2JB6B 1RZFL 5EO1B 3BAEL 3WFHB 1I9JL 1PX3A 4XMLL 1XH3B 3CFIC 4NUJA 5KSAB 4G9FB 4F3FB 2DAVA 2H32A 1LEIA 2HJLA 3WN5C 2XY2A 2AXFB 4HWBH 4KKAC 3UTPD 1FFQA 4JPKL 4H1LG 4LAQL 1JI1A 4OZHA 1I7TA 4L9LB 3WLWC 3C5ZC 5H8DA 4PJEF 1DQLH 1F58L 5D1XD 1VEOA 1JHLH 1RIHL 1YY9D 2X09A 4JKMA 4KVCL 2EZ0C 3K8MA 1QHOA 2IQAA 4WW2C 3ZE2E 1SBSL 2BVYA 4DOHB 4WO4A 3QH3A 3L1OL 4KI5D 2EC8A 1HWHB 2JTDA 4Z78B 2APVA 3QIBC 3MSPA 3FQNB 3OKDA 2X1QA 1M7DA 2M2DA 3AY4C 5EZOL 1EFXA 1DBML 4WUKL 4Z7UF 5AYQA 3W9EB 4JQIL 4JN1H 3RHWK 3VRLE 1BJMA 1QEWA 2EYTB 2EIZB 1U8QB 4GW5B 5GZNC 1DL7L 2DQDL 2WIIB 3VXQB 3MV7B 3LN5B 4JDZA 5C8JA 4ETYA 1MCRA 3GMMB 4AG4H 1FVEB 2YUXA 3J8F7 3QQ4B 5C86A 4O5LH 5D2LF 1FAIH 3H7LA 2G5BB 3T4AA 4ELKB 4LSDA 1RUQH 3RX7A 1EEYB 1ZTXL 3MRKA 2X7LA 2H9GA 4MJ4A 4RBPH 1J1XH 4WV1B 4RMSA 4OIIL 3NA4A 2HT2C 4OFYD 4QRUB 2DYPD 3WD5H 3X3GL 1CDJA 3K2UH 4M4PA 4IOFD 1UYWL 4FQ1L 4PJXE 2AK1H 3WN5B 1FGVH 4AMKH 2VNCA 5T3XL 2NXZD 4MGXA 3C5ZB 5I30L 1LEGB 1MY7A 5FKAA 5DA4A 2CJUL 2HT4C 4LHUA 1RJCA 5H37H 4R96B 5IGXH 4NGHH 5I1EH 1FE8H 1HCVA 4WW2B 2Q7YA 2DLEA 5D7LB 1T21A 5DS8A 5TQ0H 1G6RL 2NX5B 2OI9B 4NNYB 5FYJE 2DMBA 5CD3B 1HCFX 3VXSE 3G6DL 3HMXL 4JPIB 1UWGH 2IBGA 1WFTA 4LLVB 3TBWB 5L7XH 2HLFC 3P40A 4LBEB 4R8WL 3UYPA 4OGAD 5DFVC 4Y4FD 1KN4H 1MRDH 3DSFH 2D9CA 3CC5B 1JNLH 4Z95L 2O93L 3ECBB 2VXTH 4GBXA 4I8DA 4ISVB 4GH7B 1QKZH 5DGRA 1YECL 3QFJA 4MDJA 4U1KB 3RJQB 1S7SA 1LO4H 3TPKA 1ORSB 3SY0B 3VI4E 3DO3A 1N5AA 3TH4T 5LBSH 5KVFL 3IDNB 4JGUA 3MA7B 3V4VL 4O2FA 2X1OA 2E6PA 3QEGH 4J1UA 5CS7A 3S7GA 5MENB 1DUZA 2HFEB 5CSZA 1WAAA 5AD0B 1AGDB 3D69A 2K7QA 3TYFB 2IPUG 4NO5B 4EDXB 4YHNB 3EYQC 1WWBX 2EDTA 3O3AB 4RRPA 3C6LB 3D87B 1S9WA 3DBXB 4EN3D 3G04B 4M61B 2BC4A 5H2BA 4S1RH 2B4CC 1ZHLB 3QXVA 1HOCB 4W68A 5TPWH 1A3LL 5TDOA 4EQ3A 5DMIH 4F57L 1IEBA 1FBIH 1JUFA 4ZO8A 4MS8C 1I7ZA 1MRCL 2WBJA 4NWTL 3UJTL 2RFXB 3I85A 3DHJA 2YRZA 1R3LA 3LEVL 1MWAA 2X1PA 4WO4C 3RL1A 3TT3H 3I6LD 2FH6A 3O3DB 3RJDA 3B9VA 5EC2B 1FLRL 4M8QB 1PKQA 2Y1VA 2BY3A 1G7MB 1S9YB 5JORB 1DBKH 4QLRA 1NLDL 4XBPB 1IRAY 1EHXA 4OAWB 4K9EL 2XA3A 1OP9A 2QQNL 3KPNA 4XCYB 2GSGB 2QV2A 5CZVH 4YZFF 1GCFA 1IM3A 4Y19A 2EKJA 4LKCA 4ZOEA 3QNZA 4FQIH 5TF1L 4YDIH 1LK3L 1IKNC 5IFJB 3CH8A 3O6LL 4GKSB 5GGUB 4LF3B 3VU2A 1UT9A 3VFPA 1T1YB 3IS1X 3V6BR 4O4YL 2WM0A 1X7QA 1LGVA 1YNLH 4I3SH 1YDPB 2GJ6E 5FOJA 5F9WC 3MRQA 1M6OA 1PG7H 5ETUA 4PD4J 1SVZA 2W07A 3K8KA 4NUJB 4IBLT 5GRJH 2AABH 1A4JA 1QFUH 1FNSH 3QO1A 2H32B 3ESVF 2GT9A 3WNNA 4OZHB 4QTHA 3V0VB 1W2KT 3GK8L 5E5RB 1ZKAA 2BDNH 2BNUA 3VMOA 3EGSA 4Y8AA 3VXNA 1X6LA 4U6HA 2J8UA 4PRIE 2IQAB 2BSED 4PS4H 5IB2B 1ZT7A 5JXED 5IK3A 4R7NA 4DGVL 3OXSB 4ZG1A 5FUCC 1E28A 4PGZA 5IEKA 5JPNA 2EDLA 1IAMA 2DQGL 5GGQH 2VZOA 2D0FA 1N7ML 1M7DB 2HAZA 3CFKA 6FABH 3QI9D 1EFXB 4XPFH 4O2EA 4M6ML 4I9WE 1OAZH 3Q48A 4GBXC 1JGLL 3CUPB 2FX9L 2VXVL 1QEWB 3HB3D 5J06A 2RGSA 2VDRL 3TLRA 1TJGH 1CLOH 4LPYA 4H88L 5HI5D 1IC7H 4MDIA 4UDUA 4YHZL 2OZ4L 3MMEA 4XBGB 3QQ9C 4O58L 5J8OA 2AERT 5DHVA 3ZDXF 1FL3A 2FB4L 5F6HI 4CU7A 3S35L 1KJMA 1IQWL 4TUOA 4KMTL 5DRZA 4QHKI 4MA8L 1T2QL 3T4AB 5FM4A 4LSTH 4OF8A 4Z7NE 1JNJA 4YE4L 3WE6A 2DS4A 3MRKB 2X7LB 4PLNC 2H9GB 4KJYA 2W9LA 3GJFH 4U2YA 5IFAH 1OTTD 1EIBA 1ZA3A 1VEPA 1T5WB 2J8OA 4JFFD 4KTYA 1OCWL 3GEWB 5KSAD 1MIMH 4PUBH 1VGEL 1YNKH 1G1YA 4E9LA 1MCJA 2WBJC 5DMKB 5FGSA 2Y5TA 3QO0A 3IFPA 5MEPA 7FABH 1MJ7H 2XTJD 3KHQA 1JWMA 4YR6B 3BEWA 3W11D 5D7KD 4MQ7B 5BXFA 1R5IB 5H94A 3UTSA 1C5BL 3ARFD 3ZDZE 3FO1A 4HPOH 2Q7YB 4KROD 2R56H 1T21B 5DS8B 1DCLA 1OARH 3MROA 2JCCE 3G6JB 1TCMA 4K71C 1P9MA 3ZYZA 4UILL 3ZL4H 2PNDA 3LRSB 4UIMB 4JFOA 3WUWB 1TPXC 2W9DH 1I8KA 2C3GA 1NAMH 4WUUD 5ISZE 2O5XL 4KTEL 5DT1H 3PWPB 1ZHNA 4FXLA 4GBXB 3CZFB 3HE6B 2FD6L 3BYTA 2J6EA 1I3GL 3QFJB 1NGQL 5CP7A 3MRBA 4MDJB 3OPZL 1EHAA 2XQYG 2A77L 2DD8H 1ROWA 4NQCB 4RFOH 4O2FB 3WL9A 3UJJH 4UB0H 4O51B 4OQTH 4X7TA 1MFEH 4J1UB 5A1AA 2D7MA 1R24A 4HWZA 2P42B 3CVHL 2Y06L 1DUZB 2WW8A 4LSUL 5CSZB 4HMCA 1AO7E 1CICD 3FL7A 2FLBT 3D69B 3BIKB 5DD1H 1RZJH 4U1LA 1WUNT 2KUTA 1FORL 2ADIA 3F8UB 4HXBL 4LOUC 5IT2L 3RWHA 2BC4B 4Y4KD 5H2BB 2EEBA 43CAA 4XPGL 1A02N 5DJXB 5TDOB 3B6SA 1IEBB 1AJ7H 3P4OA 5EIIB 1I7ZB 5CIPH 3BO8A 2VUYA 1A64A 1F5WA 1G9NH 4HLJA 4HGWA 4ZPVB 3G5VA 1MWAB 1DBAL 3RL1B 3V6FA 4TULL 3UTPE 4GAYB 4N0CC 4PREB 3B9AA 4EUPA 4OGXL 2RIKA 2JJVA 3QUKA 2IH1A 4RFEA 1UM4L 5DC0A 1BGXH 3E1F1 1PKQB 2GJZB 4LAJH 1FV1A 1KBGH 1UZ6E 3DV4B 3D0LA 1OHQA 1OGTA 4LEXL 4PJFA 1PBYA 5IVXB 2R9HC 5EOCL 3TCLA 4FQLL 1GIGL 5D5MA 5GISL 5DEFA 5MI0C 2D03H 4LGSB 4LVEA 4H8WL 5E94A 3IAQA 4KI5E 5HDQL 1GGTA 1OTUC 4HWNA 2YZ8A 3KPNB 1QA9A 3RTQD 4X99B 4MX7B 4F8TA 5J1TC 4HUWB 4XVJH 4HF5H 1AQDA 3TT1L 1N4XH 4Y19B 4KQ3H 2YD8A 4LKCB 3PP3K 2FATL 1H8NA 1ACYL 3H2WA 5I1JL 1B4RA 4G5ZH 3SHSA 4LCIL 1YY8A 2CO6B 3MRQB 1D9KA 4OLXL 5ETUB 4R2GB 2IANA 4J23A 4N90E 3GM8A 4IMLA 4BQCA 4KHXL 1LD9A 1V8HA 1H0DA 3C6LD 4YPJA 2C9AA 2PETA 4V1DD 5ESVB 3WFDH 3P4NB 5CJBA 1KCSH 3QO1B 3ULUD 3S35X 4P23A 5EBWA 3R8BB 4F7MA 1EO7A 4KKNA 2BVTA 4NHCL 5FHAL 15C8L 1JJUA 4Q6IA 1RIVH 4LKXB 4QTHB 4H25A 4WHTA 4DN4H 5IB3A 1JN6A 2IG2H 3MV8B 4ODVH 1P7KA 1AR1C 3VXNB 3ILPA 4U6HB 4YC2C 3A67L 1MF2L 5CGYC 2PTUA 1S9VA 5D96C 4Y7MA 1ZT7B 2MPAH 3C60A 2DOCA 4HUUA 5E7FA 1OGAB 1P9MC 5IEKB 5HHMB 2EDJA 2HN7B 4CVWA 3AU1A 2FRGP 3DX7B 5C0JA 2YK1L 5DFWH 5I8CB 2J88H 3G5YA 1LEKB 4U0RC 1TJIH 2A6JA 1WIUA 4XVTL 1ZWIB 5ESQA 2EC9T 3EW3B 4QNPE 1T7YA 3IVKB 3BJLA 1YEFH 3VFGH 1DBJL 5DTFA 5E4EB 1GPOH 3WHE1 3U4BH 1KXQE 2YXMA 1FH5H 1MFBL 3HPJA 2H26A 4UDUB 4YBQD 3PHQA 4U6VL 4W4OA 3MMEB 4M4RA 4LSSH 1B0RB 3HMWH 1U8HB 4DFHA 3A6OA 3VDAA 4JM2B 1MJ8H 4TUOB 5DRZB 5JMRA 2OBGA 3EYOB 4JFPB 2FEEI 2LAAA 2VB5A 3V6ZB 4PJBF 1U92A 1F97A 4KJYB 3OB0H 5J6GA 2R0ZH 1PDKA 5DRWA 1K85A 2E27H 1GH7A 2GFBA 3MV01 1ZLWH 3SPVB 4JR9L 2DWDB 5FDYA 4XAWH 1K8IA 4LCWB 3V0WL 3INUH 4ZDHA 2VC2L 4MZ2A 3V79C 2Y5TB 2XA8L 2DLFH 4HJJH 4UTBH 1UA6H 3QO0B 4J3XA 3O3BA 5MEPB 1K5NA 5GPRA 1JWMB 3GO1L 1RK1A 4OM1H 1RIUH 1TQBC 3FZUD 5BXFB 5H94B 3UTSB 3GI8H 4FXGA 4YC2B 3FO9A 2K3TA 3MRMB 3O81A 1KCLA 3U9PH 5JUEL 2NZ9D 5T1KB 3I50L 4NJ9H 4U1IA 4PJCE 4OLZL 1BVKA 1T0MA 3QWRD 3MROB 2P24A 4L3EA 1LVEA 3SCMD 1S78D 3I3BA 2V2TA 1S5IH 4FRWA 2NY5C 5FO7B 3KYMA 3W9DB 1CLZL 3I6LE 3LS5L 4PG2A 4ODSH 4PJIA 4G8EB 4CMMA 3CDCA 3UTZA 3QIUA 1LDSA 4JO2L 3ZZ1A 4KMLB 3GHEL 1QPXA 2BVPB 4KGLA 3MRBB 1CLCA 5CP7B 2P8MA 2BJMH 4XP4H 1UCBL 5JR1L 4YQXH 1EMTL 1IFHH 3K4ZA 3WL9B 3O2WL 1L0YA 4R4BA 1R24B 4HWZB 4TOYL 2R8SL 3MREA 1D9KC 1MREH 3ET9F 1JP5A 2DQIH 2DQJH 5E56A 4U1LB 1D5IL 1NCUA 4XT1C 4MA3A 3JWOC 3NFPA 3N1PC 2ADIB 4X5XA 1I8IA 2Q8BH 1L6ZA 1MAMH 3QUMH 4P23C 4G7VH 4Y4HD 2B0SL 3HPLA 3QJFA 3K74B 3RWHB 2NY2D 3OJDA 3NPZB 4Q6IC 4ZFFB 2E9WA 3QQNA 5CEYB 4CNIA 2ID5A 3P4OB 1S7UA 3RGHA 1T66D 1J18A 3BO8B 5F1NA 1SJVA 2E9IA 4C4KT 2ED7A 1KCVL 5HHOA 1W72H 2DB8A 2VDNH 1AY1H 3C60C 2A9ML 2P44B 4HGWB 2XICA 5J89A 1G7JA 3B5GA 5KVDL 4OBRA 3C2AL 2A74A 2UWEA 1EGJH 3QUKB 2IH1B 1BBDL 2P43B 3G08A 3KJ6L 1QRND 3HNVL 1FV1B 1JNNH 3TBSA 3PQYA 4Z7OF 2R1XA 4YXHH 4H1LB 4ETQB 2IFFL 3NIGF 3TCLB 2DKMA 3RVXD 3WIFA 4XP1L 2AJVL 4OD2B 4XRCA 5EUOF 5C7XH 2H1PH 5E94B 2AJUH 3JV6B 3QQ3A 2AEQL 5F97E 2NNAB 3ARGA 3L7EA 4W4OC 3PWPD 2ZCLL 4HKBA 3MR9B 4OBSA 4OUUB 4MZ3A 2CLVB 3V9FA 1YMMB 1ZANH 3V8CA 4TNWK 3MNWA 3MLRH 4YHIA 3M07A 3LPWA 1JGDB 1P7QA 3E6FB 5A3IC 3HG1E 2DBLL 4H5SB 1PEZA 4NQCD 1U8JB 4G43A 3H9ZA 2BRRL 1YY8B 1MRFH 4GJTB 3UXFA 1D9KB 4XI5D 2IANB 2L4OA 1QFOA 1H0DB 4APQB 5BVJA 5DMGD 1NDMA 5D6DC 3ZDYF 3TN0A 2E3VA 4P23B 3BUTA 5EBWB 4GRWF 4F7MB 2ZSWB 1JHKL 4L8DA 4QWWC 4Q6IB 5EU4A 3QNYB 3NACL 1BF8A 3C2SA 3PHOB 4MA1B 1FPTH 4LK4A 5IB3B 1JN6B 4JFFE 1ONQB 3S6CA 5L88H 1MFDL 3CFCH 3ILPB 1CK0L 5C0CA 3O4LE 1JZ6A 4HUKB 3MLPA 4HC1L 4WRLA 1MCFA 4ZFGH 3MA9H 5GS1A 2MTPA 3KS0H 4OZFG 4J8RB 3D9AL 2XTJE 4HWEL 4DK3A 3SKJH 4GMSH 4TSBL 2FO4A 3DMMA 4KZEL 4G6FD 5D7KE 5E2VL 2A6JB 2FLRT 4PG2C 2R69L 1OAYH 4ALAH 3QIUC 1J1PL 5JOPE 5DQDH 5DXWA 4TSCL 1Q9WA 2EDEA 4K3HA 4UOW0 5DTFB 5ICZA 3PXJA 4FP8H 1JFQH 2VAAA 5FO9B 4UAOB 1BOGA 2H26B 1BQLH 2OJZH 3PHQB 1PSKL 2F19H 4NO0A 1UFUA 4PJ9D 4WUUE 2RHEA 1A0QL 1BQHG 3WO3B 1A2YA 1XF2A 1I1YA 1C16A 1P7HL 2V9TA 5SWSE 4YNYB 1CL7H 5F3HA 3LEYL 3W2DH 4DCQB 3X3FH 2APFA 3TBYA 3QPXL 3QUZB 1EEZA 1ULVA 2AP2A 3FOLA 3M17B 4M03A 3OR6B 5ALBL 5DRWB 2YPLA 2GFBB 4QRPB 5DJ2A 3MUY1 3BP7B 2IC2A 4YHLH 3ARDD 2MKLC 2G75A 1F4WH 2Z8SA 3PJSA 3QXWA 1A8JH 2PR4L 1Q72H 3AVEA 3FB5A 2GCYA 4IRJA 1XGRA 4GLRH 3B2VH 5DJZA 4J3SA 1UVQA 4GRWH 3MV8D 4FG6D 1SEBB 2WLZA 2HVKB 2OTWA 2D2OA 2VLLA 3FO2A 4FXGB 3FO9B 1TNMA 3MBEA 1B0GB 5EULV 4LLQA 4U1IB 1OGAD 1T0MB 5E8DH 3I3DA 4NKMA 4L3EB 1Q0YH 4R97B 3IDJB 3VFTB 1CQKA 3CDFA 5FYLH 3N0PB 1DTUA 2FX8L 1L6XA 1LQSR 1YQ2A 2P47B 2DM2A 4FFWC 1QHPA 3ARGC 3UTZB 1DVFD 3QIUB 3IETB 3SDYH 1JGVH 1EDQA 2VDML 5EZLB 1UCTA 1N8ZA 2XN9D 4RSVA 5J12C 2H32H 5E2TH 1A7RL 1NFDE 2P8MB 1P6FA 2ZOKA 4LPUA 4OB5L 4XNYH 3PV6B 3IYLW 2EYRA 3VFSB 1RJLA 4CDGC 3PABA 5FYJU 3BPLB 2B4CH 3RWJA 1HYSD 1U9KA 1I9RL 2IJ0C 5DWUH 2XZQL 4JM2D 4M1CD 3MREB 4G8GB 4Y16D 4DGYL 2V17L 1FCCA 4K3EH 5J13C 4JDTH 3FT4B 3MBXH 3MRLB 3GRWL 4PRPA 4EVNA 3TN0C 3MLTA 1G7HB 3HPLB 1UADC 4IMKA 3BZFA 2CSPA 3MV11 5DR5H 2AJYL 3GJEB 4KKBC 1Q94B 5E7BA 1QLRA 2J2ZA 4Y88A 3DV6A 3PP4L 5AAMA 5F1NB 1BQUA 4XNXL 5GIRB 1IKFL 2VLJB 4OLVH 2C3VA 4U6XA 4H26A 5ALCL 4HDIA 3ULUE 3EJZC 1KFAH 5DMJB 4A6YL 5GS1C 1CXKA 5DUPL 3HR6A 4U1SB 4OKDA 1WAAF 8CGTA 2K7PA 3G08B 4OCSL 1Q0XL 5FUOH 5T1KD 3TBSB 3QEUA 2HTKD 2HFGH 2XZZA 3PQYB 5C6TH 2R1XB 5E2UH 2IGFH 2QL1A 4JPVL 4WWKA 4ZAKA 1CGTA 4XRCB 3WLBA 1NGXB 3O3EA 3VRIA 4J4PA 3QQ3B 5F89A 3RBSA 2XWTA 1BZ9A 2E6JA 2MSPA 3TM6A 1UH2A 1I7UA 4UT6L 3ULVF 1INDL 3EYUH 5CLWA 5J12B 1AFVH 3B9KC 5DJDA 5LGHH 2GEEA 4UQ3B 1P7QB 1RZ8B 1SM3L 4XZUB 1S7XB 4G43B 1G6RA 1Z5LB 1MSPA 3EDFA 1KEGH 3PF2A 3HMXA 1PVHA 4XWOC 4MD4B 1D5ZA 3TNMA 4HXAL 3REWB 4BH8A 5JHLH 4WI6A 3HC4L 1HH6B 4CU6A 3SJVD 5GRWA 3TN0B 3RHWF 3SKMB 5D72H 1NGYB 3L9RA 2PN5A 4XHJD 3L3KB 3FAXA 1I7RA 5ANME 2VE6B 4O2CA 3Q1SH 2HFFA 5IWLA 2BY1A 4TUJA 1N64H 5I71C 2PO6D 2JJUA 1MHEA 3MBEC 3REVA 3NMEA 4FZ8H 3ZTNH 1GGCH 4X6BA 5CD5C 3G6AA 1F11A 4L3CA 3RWGA 2AKRA 3L3GA 5GS1B 3SDDC 3GGWA 2VSDA 4LGPB 1FQ9C 5E95B 4HFWA 4X9FA 3RWFA 1OY3B 1CTOA 1FHGA 3O3UN 1C1EH 5IB4A 3NZ8A 4A2LA 3S88H 1RY7B 1MCCA 2DTML 4RGOL 3I6GA 3TIDA 4NWUL 1LK2B 1IZKA 2BVQB 1MCLA 4NUGH 4RISH 4FFZL 3RAJL 4S11A 4V2BA 5ICZB 2VAAB 1RULH 1ETZA 1BOGB 3AC0A 4D2NA 3LS4H 4Z7VE 4NO0B 2J8UF 5ICYB 4GSDH 5E0QA 3V52H 4D0DA 1YMMD 4PIRF 1XF2B 5C6PB 5HYJB 3B9KB 4OFDA 4S0TD 5K93A 3CX2A 4NQEA 3LZFH 3VRJA 4K94L 3ARBA 3FB7B 2R29H 4RAVB 1CFVH 2D0GA 3DXAA 1MWAH 5D70L 4WI7A 1KV3A 4YBHA 2P5WA 4GG6A 3TC9A 3CSYA 5FA4B 1A6PA 1EEZB 4WU5A 4IMKC 4S1DD 5DJ2B 3NCCB 1CFBA 5LWYL 2DDQL 4P46B 5DUMH 3ZLQC 4APQD 2X4OA 4MHHI 3PJSB 3WJLA 3WO4C 3V7AE 4PJ7E 1UJTA 1MJUH 5DI8A 3EOAB 4QOKD 5DRNA 2CKNA 1I1CA 5IG7A 5C0BD 3BMVA 3MPCA 3LHPH 1IGIL 3E0GA 5DJZB 1DZBA 3WXVH 1UVQB 2I25N 5DZNA 4OGYL 4YO0A 4LCUB 1XR9B 1MI5A 2VLLB 3FO2B 4P2QD 1EUUA 3WKMH 4PJHA 5J3HC 3TYGH 3FFCB 5LJYH 1J0IA 1VSCA 4LLQB 2D7TH 1UENA 4NKMB 3SDDB 3EYFA 4ZAKC 4OF7A 3IFLH 5DDHA 3H0TA 2DN7A 4HMEA 1H3UA 3EDEA 5I1LA 4J4PC 5DUBB 4MNGA 4KPHL 5F70A 2IAMA 1NAKL 4EIZC 4YDKH 3O45B 3R1GH 1ED3A 3U48A 5SV4A 1QRNE 5E4IA 3C9NA 3FFDA 4OLUL 4I4WB 1FNSL 4NDMA 4OT1L 1I1AB 1CI5A 1WIPA 5IB1A 5MEOA 4WFFE 3GSRB 5IR1A 5F7EL 3VI3E 4R90H 4G6JL 4G6KH 4M7ZC 2EYRB 1NBVL 4PRAA 1RJLB 3F7VB 4DGIL 5EU5B 2IPTH 1FZMA 3GKZA 1QQDA 4O9HL 3E3QE 3PHSA 4M9OA 4Y1AD 3K0WA 4LCYA 2LU7A 1S7VB 1XF4B 1OPGH 4NP4L 5TE7H 1F13A 1RZGA 1MAKA 1HDMB 4DQOL 3GMQA 1IL1A 4WCYL 4EVNB 1JWSB 5SWQA 1JZ7A 3QUZD 3QDMA 3VG0H 5HBBA 1D6EA 1JL8A 5I1DB 4XPFL 1IAIH 1KEMH 2AXGA 5F7FA 3D48R 3BZFB 2VH5H 2B1AL 2ILLA 4X6DB 5IWLC 2B8OT 1QLRB 5E8EA 3DV6B 3WO4B 5E9DD 2OZ4A 2DWEA 1HHIA 3S36L 2C3VB 3HI6L 5E1AA 1A3RL 1NCBH 3NCYS 3CX5J 2CMRL 1JZ4A 1FFPA 2X4NA 1NC2A 1EHLL 3VFMA 4N8CL 1C5CH 3O6FA 1IGMH 4MXQD 5DHVH 3IGAB 3LKNB 1KLFA 3QEUB 1RD6A 1WC7B 4X7EC 1I75A 1NUNB 3RNKA 3RWCA 1DN2A 1DLHB 1OAKH 1EJOH 2AGJH 1OM3H 4ZAKB 4HBCH 2X5PA 4FS0A 3WLBB 3NCFB 3O3EB 2D31A 2QR0B 1OAXH 5F89B 3PNWB 2OMBA 4EXPX 1CTNA 1BZ9B 5C0IA 3QULA 4WNQB 3UEZA 3JWDL 2VR5A 5LCVL 3LCYA 3GB7B 5CJ8A 4DVRH 2HTLC 3HTLX 3ARQA 4MD0A 5DJDB 5L8KB 2VXQH 1QFPA 4M7ZB 2BSSA 4ZPTB 3MFFA 1XCTA 4XPAH 2F9BT 4YH6A 1JGEA 4OD1H 2BY0A 2ICEB 4PJFF 4NC2B 5E5MB 2ARJB 4HH8A 5B39G 4ZUWA 1NGZB 3DVNB 1EUTA 2UZIH 5D5MF 4NJAL 1D5ZB 1J1OL 4HFUH 3TNMB 3WJLC 4BH8B 3EDKA 4K9EC 2IBZY 4PBWD 4E0RB 3HZKA 3B8SA 1QNZH 5CZXD 4D9QD 4PLKC 1EEQA 3LMJH 3L9RB 1PG7W 2PYEE 2R2BA 5DO2C 1I7RB 2CXKA 4O2CB 2ZOLB 5CEXA 4P4KB 4TUJB 2Y9RT 4R4FL 5KZCD 4P5MA 3UAJD 3VH8A 1JK8A 1QD0A 2J6EH 4YGVB 4X6BB 3G6AB 1F11B 3KAAA 3QPQD 2Z8VC 3L3GB 3CVHA 4LCCC 4JFDA 1JMXA 3MLXL 1AP2A 3DUSA 4PJEE 1XZ0A 3U4EA 5AAWA 1K8DA 4DJMA 1KJ3L 1RJYB 4ELMA 5BVPL 3HCVA 1TZGL 4B41A 4HKZB 4MQSB 4QHLB 5B3NA 3TEUA 3I6GB 2BXYA 1MCQA 3L5WB 3TIDB 4NM4L 5IHUH 5TH2A 3CNKA 3FOMB 1KPUB 4LPTA 1Z9SA 3BN9C 3EOYG 3H9HA 3S8WA 3F6IA 3U7AA 5A40E 4Z7UE 2ZWLT 4PP2A 3MUHL 3QDGA 1QR1A 1QSFA 3H9SE 5D7IA 4GRLD 5C0GA 1N59A 4QO1A 4WFGD 4MCZA 1AQKH 5IBTH 3IFNH 3STLA 1I9IL 5A16B 3VRJB 3TWCH 1QYGH 4DFIA 3F5WA 3IAPA 3WFCL 4IIQA 1KIQA 5CJOH 2P5WB 4EUPH 3CSYB 3FO0L 5L2KA 1X4ZA 4WU5B 1EH9A 3CLEL 3V5HA 4I3GA 3QJHB 1H3PL 2W38A 5D2LE 2X4OB 4HV8A 1YEIL 2B7DT 1CL7I 1I9EA 5DI8B 4X7SL 2VDPH 5DRNB 4DWHA 4UINH 2NY5H 5IG7B 3NFSH 4PB9H 4XCCL 1JE6A 1CD9B 2OCFD 3HUJB 2WIMA 4N9GA 1NCDH 4NKIL 4NZUH 5JOFB 1WK0A 3QUXA 2XACC 4C56E 5IJVB 1N4XL 1MCSA 3O6FC 1MI5B 3BGMA 4JFEB 3LKRB 1GZPA 2H2SD 4PJHB 4C59B 4QGTA 3TV3H 4LNVA 4LCCB 2HMIC 3IJSA 2CXGA 4JFYA 1ZHBA 3EYFB 2EIBA 3I9GL 1HINL 4PB0H 5HGDB 3WIIH 1MELA 1OAUL 1ZGLM 1ND0B 4PRBA 4XNZC 3IU3B 2X41A 1M71A 4QRRE 4Z5RA 2Q8AH 4RAUA 3MOBL 3NCMA 4AEHH 4Q9RL 2VQUA 5IVZA 3PE9A 2FX7H 4QYOA 3H42H 3FFDB 4OF5A 2MCPL 5I1CL 1H8OA 4NDMB 3HN3A 5JMOC 1BIIA 3JUYA 3JWOH 4DZ8B 1KIRA 3MRCA 4FNLH 2VIRB 5C07E 3QR2A 4P2RB 4ZO6A 4E5XA 2J3SA 2JELH 3FHAA 4N5EC 1QQDB 5E6YA 2F54A 5DQJB 3LPGA 3IAGC 1KULA 1QSEB 5HYJD 3BKMH 2WUBL 5KTEH 4PR5A 2R4SH 2BNQD 4L4VA 2DM4A 1QP1A 1IC5L 1D5BA 1G84A 4AT6A 1CYGA 1UACL 4DW2H 1G9MH 3LB6C 4UT7H 3GMQB 2J88L 2IBZX 5SWQB 4Z8FL 2GQHA 2EH7H 5T33H 1D6EB 3LEXA 3VXTB 3WKNA 1UB5A 2YRPA 4PJIF 4UV4H 2AXGB 1WICA 3RU8H 4WI9A 1CQYA 2W9EH 2PCPA 4P46D 3KNBB 3O6KL 2ITCA 1UXSB 1S7RA 3GBLA 2EDKA 1IGTA 3TJHC 3DGGA 5E8EB 3MYJA 3T1FA 3X13A 1B9ZA 4I18C 4ZNEA 1FH5L 1HHIB 4PV9A 3SDXF 2H2PC 5F88B 2P5EB 4KUCD 4P3CH 1RI8A 1MHCB 5CAYB 4AQ1B 1FFPB 1BD2D 1U95A 2R0KL 3VFMB 2CRMA 5FGBC 3O6FB 4U4BA 3ARUA 3KXFD 1U8KA 2YWYA 3LPFA 3FFCD 1RUML 4MAYC 2C4FU 3W0WA 4PJGB 4I48A 3GZKA 3RWCB 4RIRB 5CUSL 1FO0L 1U8LA 4JGJA 4NZRL 2N7AA 3SE8L 2OR8A 5B38G 4XNZB 2D31B 3A0OA 4LIQH 4M5ZH 3CFEB 1U2CA 3CAFA 3QULB 4WWID 1J88A 3P30H 4GG8A 3VXMB 4X5LA 1I1AD 5C08A 2BZDA 3SGKA 5F96H 4L4TA 2ENYA 1DE4A 4OZFB 3SKOA 4P48A 1BM3L 3C8DA 3O9WD 2UWEF 4LSVL 5GS3A 2X44D 4IIQC 3MFFB 1VCAA 2JJTA 4BZYA 5CP3A 3WHXA 1JGEB 5DD0H 4FQCL 4KHTH 2NY6B 3GKWH 1X5LA 3VE0B 3U1SL 4YZFE 3DSNA 3UC0L 3BXNA 2QQLH 4H8WC 2V2WA 3SN6N 1EJ6A 1RQ5A 4EI6B 3O0RH 2VL4A 1RSFA 3TBVB 2PUQT 1DDHB 5TJWK 3O4OC 2H41A 2R2BB 1HEZB 2BVOA 3KYNA 3KPSB 4F80A 3QUXC 4G6MH 5CEXB 3FTGA 3P2TA 2CUMA 5EWIL 4P5MB 3UX9B 1A7PH 4I18B 2CR3A 1JK8B 5CEZH 4XP4L 3OGCB 1S3KL 3D3VA 1KCUH 4QOKE 5EU3B 1J8HD 12E8L 5HI3C 3CVHB 4JFDB 5BOZG 5BS0D 1AP2B 4OSUH 5C0BE 3VMPA 3VXPA 6CGTA 2ZCHL 2CIIA 3EHBD 3U4EB 3PP3H 1NMCC 1MPAL 2DQJL 1XGPB 2I9LA 4ELMB 1IT9H 1QACA 1YYML 4MAYB 4P2QE 5CINH 4XPTL 3L3IA 2ORBL 3T0ED 1BEYL 4AEEA 4KVNL 5F21B 3B5TA 4YDJB 2YZ1A 1L7IH 4N0RA 3DI3B 4QHMA 1UQSB 3H9HB 3KLDA 2E5EA 2F58L 3C5JA 3QDGB 2HH0L 1N59B 3L5XL 3FQUA 2FECI 1NFIB 5EU6D 4XXCC 4EBQL 3F5WB 2B2XH 2A6KA 4JRXD 5FYKL 5DRXA 2E7HA 5L2KB 5C2UB 3W39A 4ODWA 3UTTE 4ZSOA 3ZDXE