1H3TA

Crystal structure of the human igg1 fc-fragment,glycoform (mn2f)2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
207
structure length
207
Chain Sequence
b'PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IG GAMMA-1 CHAIN C REGION
publication title Structural Analysis of Human Igg-Fc Glycoforms Reveals a Correlation between Glycosylation and Structural Integrity
pubmed doi rcsb
molecule tags Immune system
total genus 34
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h3tA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h3tA01
4M48H 4KZEH 3BEWA 4PJXA 5IT2H 3QDGB 4Z0BL 5FCSH 5LGJA 3FONA 3KXFE 2JELL 2HFEA 1NCBL 4Y19E 3S3PA 2MPAH 3CFCL 5FYKD 1S7TB 4FABL 1R24B 3VXSA 4WV1A 1YC8A 4PJ5D 5KSVB 1GH7A 1FAIL 5HGHB 3MACH 5J3HC 1YMMB 4WEBH 1FYHB 4X9HA 1HQ4B 1FIEA 3GHBH 4NIKB 1NAMH 5T1LA 1DBBH 1XGUA 4FXKB 2Y6SC 1I8IA 1FO0H 4KK8D 1EEYA 4OJFL 5F3BB 5GRYA 1AQKL 5F7WC 2NZIA 4PJXF 5LBSH 5KSAC 4G8IA 1UH4A 3MOAL 3P9LA 3QXVA 3TBYB 5FYKU 4JFXA 1HDMA 3HUJA 3JXAA 1T1ZB 4MSWB 4Y4KD 1DN0A 5E4EB 2PTVA 5DRXA 1H9VA 2NPLX 1G7MB 2DBLL 4JHAL 1HK6A 2KQMA 4U0RC 1N3NA 3PP4L 3WFBH 1VB9A 1A3LH 2J3SA 1XFPA 3JV0A 4IDLA 3QIWB 3T3PF 3X17A 2DQIH 1QSFD 2HH0L 1QRNA 1JNHB 1RQ5A 2F53D 5C0GB 5J9PB 5BCAA 1ZVYA 1SY6A 3SKNB 1E6JH 2QKIA 2X10A 4OFYD 2DWEB 4LF3A 4XNXL 3EOBA 4X99B 5CJOL 3QPXL 3FOMA 2Y7QA 1IKFL 1S5IH 4P23B 1KT2A 1RUPL 2VDRH 5BXFA 5FYJE 1I7UA 1T2QH 4M61A 1HWHB 4OBRA 3F7VA 5FUCE 2EDNA 2PXYA 3V0AC 3RA7L 1BOGA 5FHBL 5E4IA 4ODHH 4YPGA 1N7ML 3L3JA 3NCMA 5E8DL 3EYOA 1IQWH 3VCLA 4JRXD 4D0BB 1UJ3A 4OLUH 1G1YA 4O2EB 2WWKT 3RUGA 1X6LA 4HX1B 5D8JL 2VXSH 2YUZA 3WFZA 1UWEL 5FXCH 3T2NL 3TF7C 3O4LE 2HWZH 1DLHA 5GPRA 1T5XB 3S36X 1H8OA 5J12C 4D0DB 1KOAA 3M1BA 1F90L 4AT6B 2E3VA 1A6AA 4HIJA 2CJUH 4IDJH 1JZ4A 4PJEB 4YE4H 4LGRB 4Y8DC 5ETUB 1N4XL 5EC1A 4IIQA 4H5SA 2X4SB 2Q8AL 4PGBB 3S6CA 1B2WL 2DQUL 3OGCA 4G9FD 5JW3L 1IBGL 4ZUWA 4PJ9B 4G3YH 1R3IH 2BNUB 3E8UH 4OQTL 4HEPG 4PJ8B 4R4FH 3PABB 3C8DA 3RUGF 4OI7A 3X13B 3MLSH 5D2NC 4O2FA 3WE6B 1YY8A 1NCTA 4BYHA 4OCSL 1XIWB 2G75B 5JW5B 4KI1A 2IADB 3TZVA 4G6MH 5HBBA 3ZTNL 2DF3A 3RWHA 4HD9A 4D3CL 3BZFA 1C7SA 5HDOA 1AO7E 1NMCC 4HZLA 3VXTA 3DNKA 4IHOB 4LFHG 1VEPA 3RZCC 4YXLL 4FQHA 5DRZB 3L1OL 1A21A 4RMQA 5GJSL 3FRPG 4OD3H 4H26A 4F2MB 1VFBA 1G7QB 3IJYA 3I84A 5FDYA 5HD8C 3CFKB 1TXKA 5BZWA 3OV6A 4U2ZA 2AJ3B 1AP2A 3IDNB 4QRSB 1HKLL 2HG5A 2PW2B 2F74B 1DE4B 3JSSA 4QNPE 1R3KA 3MUZ1 3NVQA 3CX2A 4ONFL 4KJQC 2X5PA 1UWGH 3UCRA 2VDPL 2OMBA 3SDDD 4EN3C 4MD5B 3BXNB 2B5IB 2P47B 5EU4B 3BT2H 4P59L 4Z77A 4DUVA 4X98A 4ERSL 1EO8L 1T20B 4MJIE 4NQXA 1EUTA 3OBAA 4LLAA 1CD0A 3TNMA 5EA0L 3MCG1 1NFKA 1JV5A 1MF2H 3KYOA 2BNQD 1YNKL 1Q9KA 1FGVH 1J11A 4HJJH 4IOFD 3QJFB 1ERNA 3RTQA 1PSKH 2P8LB 4KI5E 2Z35A 2JIXA 3W0WA 2W38A 5M95B 3VWJB 5IIEA 2DKMA 5I74C 4HPYH 2X1XR 1IGJA 1EMTH 4XNQA 1MCFA 4XB7A 2VISB 4GW4A 2DQTH 1CXLA 3JVGC 4ZO8A 5F1OB 4Q6IC 4HQQH 3O2DL 4OF6A 1QOKA 4PJDE 3WFDL 1JHLH 2J2ZA 3WKML 4F80A 3BP4A 4NQDE 4X4YB 5EUKB 5FYJU 3PXJA 1CLYH 2R29L 4ODSH 1MCNA 2E7BA 2EDLA 4PJBB 4RAUA 4Q9CA 4NHCH 2BHYA 4PJGE 1DBMH 1MHCA 2DWDB 4YLQT 4FG6C 1QKZH 1WWWX 1RMFL 1QYGL 2EE6A 5CJBA 4HKXB 4OZGE 4X4XB 1B6DA 1DVFB 5DEGA 4D9QD 1NCCH 1X5YA 1PG7W 2R4SH 2CIKA 4ZODA 1ZWIA 4Q9BA 1XCQA 4R2GB 2AXGB 4JGMA 5DK3A 1YPZE 3BDYL 4H1LG 4H25B 5C2UB 1P4BH 1K5NB 1CWVA 3GI9L 3WSQL 5D1XB 5DRWA 3LS5H 3DROB 2XTJC 3GI8H 1LK3H 3DLQR 4HDIB 1QA9A 3HI5L 2BY0A 1RFDH 2XRAL 3CXHJ 5C0EA 3I2CL 2VABA 3MCKA 4HWBL 3BP7B 3LOWA 4JPKL 4I18B 1J10A 3NCEB 3C8KA 4JO3H 3EO1B 2PTTA 2E6JA 1MCPL 1WQVT 5EORH 5TH2A 3O81A 2NTSP 3DGGB 2RFXB 1JRHI 3GBLA 1JPFA 2Q86A 5DHXB 5DDHA 2GY7B 2ADJA 2ZUTA 5I76A 5EZIH 2FHBA 1DQDH 2AQ2A 4ZTOH 3AGVA 4HUVA 1UB5B 4GG6A 1TDQA 3BO8A 4KV5F 4XBPA 4RAVA 2ID5A 1INQB 5F96L 5F7EH 1QACA 3M07A 4HJGA 4DKFL 1G9EA 5JO5A 3SY0A 1JZ7A 1CVSC 1JHTB 3B9AA 3CU7A 5IESH 2R56L 5I1IH 1U8NB 1K8DA 1RAMA 4M7KL 4P2YA 1HQRA 4NN5C 4KVNH 3CX5J 3QXAA 2UVFA 4MVBC 4P3CH 5ALCL 3LKSB 3MYJA 1CDBA 1OTTD 1GJIA 1YEEL 5HGBA 3C9NB 5D96B 1TZGL 4PB0H 1GCFA 4H0HB 1EEQA 5E8NB 4KI5D 2C7UA 4X6EB 1I3GH 1T5WA 4LSRL 2FJHB 3JWDL 4JPWH 4HGKC 5TJWK 1LO5A 4GG6F 3C09B 5BOZG 5KOVC 4XH2B 3NIGF 5FKPB 1BF8A 3KLAB 3OX8B 5JDJA 5GGSY 1G7PA 5HHVH 1RI8A 2WK2A 2V5YA 4RFOL 4CUCA 1Q1JH 2WINB 4UNVA 1F4AA 3FB7B 6CGTA 4LSQH 4DN4L 2R9HD 5MEOB 3GBNL 3GMRA 3I75A 3N1MC 2I24N 4NCC1 5T3ZL 4C58B 1LILA 4YO0B 4P2RB 2WUCL 5DI8B 1CR9L 2Y06H 3ARGB 4NKMA 3HZVA 2XV6B 3DV4B 3DVIA 2I60L 3AREB 3CNKA 2WV3A 4KC3B 2EDDA 4LEXH 5L88L 1S7VB 4NNPH 4DVRH 3PDOA 4HCRL 4KTDH 1M05A 4I0PC 3RL2B 4BK4A 2H1PH 4JE4B 1NANI 4Q9RL 4JG0L 1NBYA 1PZ5A 2DYPD 4FQ1L 1J0KA 2B2XH 2VXVH 4OFKA 2IJ0C 1KTDA 5DMJB 1A0QH 4JVUA 1QHPA 3CVIL 1NKOA 5CBAA 5HHMD 4L4TE 4ODTL 3QIBD 2R1XA 3L7EA 5F7HA 2WZPD 3MUGB 1ZLUK 5D93C 4DAGH 4JZNA 3VWKC 5F44A 1ACZA 1F58H 2W9DL 3DV6A 4YXHL 4P4KC 3WUWA 4K3GA 1BQSA 1QBAA 2IH1B 1K8IB 1BIIA 1KN4H 5ISZE 4Y7MA 1AH1A 1BP3B 3VXUA 4ODWA 5EOQL 3FFCD 5IB1B 5SX5K 1H5BC 3VU2A 2WBJB 3QDGE 2YA2A 3DO7B 3O2WH 5H37G 2LU4A 1KEMH 3F62A 3QUKB 2NY4C 3FO2A 4Q6YA 5DJAA 3KHQA 5KSBA 1VKXA 3H3PH 4FFZH 2XI9A 4P2QB 1FQ9C 4ONGH 2A74B 3X11B 1FNSH 1NAKH 1CTOA 4IRSD 4ZO9A 2F5AH 1IL1A 1SBSH 3QUYA 2XKUA 1AE6H 1ZOXA 1I1RA 1RD6A 4UTBL 3U4AA 3V95A 5IHZB 3SPVA 4U7MA 1J86A 3LQAC 5LCVL 3LVEA 1Y18A 2IFFH 4TUOA 2P5WA 3ARQA 1ZHBA 4NRZA 3AS1A 2NY0D 4OCMC 1S7WB 1VSCA 2H3NA 3LZFL 4HFWA 3UJJH 1K9TA 5EU6D 4M6NL 3BE1H 3KJ4B 3B2VH 1NCWH 4Z9KB 5TDNB 1J0JA 5IQ9B 5EO1A 2B7DT 3TVMC 5D7JB 4XP4L 3I02B 5CEZD 2HLFC 5CD5C 2EC8A 4U3HA 4R4ND 3DIFB 2VIRA 4AH2B 1WCQA 2V5TA 1CBVL 1H3WM 3O6FD 4YUEL 2VWEE 2IBZX 5GGRA 5CBEB 4DQOL 4XCYB 1OAUL 4YHPB 3V2AR 1HWGB 4OCWH 2R0WL 4R7NA 2EIEA 1G0DA 3IFLL 3Q6GL 2CLRA 2EDXA 3QQ9D 3H8NA 1G84A 5KSAA 3OHXA 5JLZB 4M93B 3PDGA 5GS1B 2A38A 2UV3A 2C3XA 4R97C 1XF4A 5EBMB 4F7EB 4F33A 1CICD 5DMKB 3FN0H 1F4XH 2JCCA 2HFTA 4FTVA 3MCLL 2DQHL 4CMMA 1GIGH 1JIBA 2WNGA 3WMSA 3GSWA 5I9QC 2XZCL 1DQQA 4K8RC 1DFBL 4XNYH 2D7OA 3VFVA 5GISL 4ETQA 3MNZA 2ZOKA 2D31A 4AM0A 3PWVA 5DZOA 2X89A 1FIGL 4YGAB 1FNGB 3MREA 3BW9A 1VGKB 3ARSA 3L95A 3ROLB 1BZ7A 1J7VR 3DYMA 1T6WA 4J4PC 4M62H 5JXAH 2FZ3A 1NC4A 4NDMA 1U2HA 3JZ7A 2YEZB 5SX5H 3FO9A 5C9KA 4EZMA 2FO1A 3L3HB 1BZ9B 1NAMB 1WIOA 4NJ9L 1YNTB 5DMIH 4UT7H 3GIVB 1FO0B 4PJEE 1I7TA 3P4MA 4UMGA 3ZYIA 3QCVH 1AKJA 3QRGL 3GJFK 4FFYH 1T7ZA 4UT6H 4KHXH 5JOPE 1EAPA 1J0ZA 1YEJL 4NM4H 1VGEH 2VLLA 3G6JA 3OKOB 4NZJA 1MRDL 2L7JA 3KYMB 3MV9A 5H8DA 1LEKA 3UYOD 5F7LB 4U1SA 3ISWA 3NGBB 3DX7B 1IEHA 2KKQA 1WZ1H 4I0KA 4BFGA 1HIMH 3FL7A 3MSPA 1D5BB 1YMMD 4XAKE 5D7LA 5F72S 5AEAA 2HJKA 1JPSH 4EI5B 4F37K 3PIQB 4KJWC 2W65B 5F1SA 1U58A 2VSDA 2LVEA 5L2JA 1KJ3L 4WW2A 3VA6A 4DW2L 4APQC 1TETL 2G5RA 4F37F 1MCSA 1VFMA 3RGHA 3O9WC 2QR0A 3QG7H 2HRPL 4QYOA 4UUJA 4CADA 4EOWH 4WO4B 5KTEL 4PJFB 1RZJH 1JF1A 3G6JF 4F7PB 2AJYL 3VFPB 4ALAH 4HGWA 5IQ7L 2L7UA 4Y2OA 3WNOA 1RZKL 4LLYA 3WFCL 4WY7L 1PAMA 1GGUA 2VR9A 1U93B 1J8HB 4GBXD 3WD5L 3JV6A 4LLQA 4LHUB 1I9IH 3RWDA 5D7IA 1GGYA 3JWOC 5C08D 2IANA 3SGKC 4KRMB 4PRHA 3X12B 4P5TB 3S3SA 2QQKL 4NM8H 1TQCB 4LCWA 1TTFA 4WWKB 1WBZA 5DA4A 3BZ4A 2AJZB 3MRIB 3PF2A 1ZS8A 4CU8A 5HYIA 4WW2F 4J3OC 5I8EA 3NCBB 3BIKA 1JF6A 3IDGB 8FABA 3EW3B 2EE3A 2EEDA 1N6VA 1RZ8A 3MLWL 1S9KC 4LVOC 4GRMB 4K23L 5ESVA 4YXKH 1NBQA 4HMDA 4NUGL 1U42A 1AGDB 3PL6B 1A6VH 5I1CL 3T0ED 3ORJA 2AW2A 4L3AA 2XKNA 2XA8H 1EBAA 5DZNA 4K94L 3ZYOA 1X5AA 4K07A 4YDVB 4MD4A 4XPAL 4JFOA 3P11H 4FQJL 4ZSOA 5EZLB 2PR4L 2VN7A 4P3DB 4EN3A 4WI5A 3PWPB 4OLZH 3WN5B 3BWUC 1MIEL 1HE7A 5D7IF 3U46B 1R3HA 5ABDE 1BBJA 4XNMA 3FJTA 3NABH 4GMSH 1FORH 4ZS6D 2OS7A 2NR6D 5BO1L 2PF6A 3IU3A 4NRYA 1IC5L 4C4KO 5HVGB 1PY9A 5I1EL 3GO1L 3GB7B 2HFEB 4WWID 2JJSC 3TC9A 1SMOA 2WW8A 2LU3A 4XT1C 2OTUB 4JFDA 4X6FA 2FRGP 2VMFA 5EO0B 2FEEL 5JOPD 4OCYL 1U8IA 5MI0B 4WV1B 3QEQA 5GQBA 1J1XH 3FB6A 2Q87A 1CDYA 4PJ9D 3HI6H 3BAEH 1IGTA 2OP4L 3JVGA 5HDQH 5JPNB 4I3RH 4Y5YC 4JANA 1DUZA 5E2VH 1Q9WA 4NBXB 1XGUB 3FZUC 3O3UN 1I8IB 1EEYB 3HC4H 4OGZA 4WUKH 2EKJA 4HHAB 2K1MA 5IB3B 2BNRE 3M8OL 1MHPH 4X7EC 3GIZH 4G8IB 2A9MH 3SKJL 4QGYA 1HDMB 1ADQL 3HUJB 2Y25A 4DGYH 5B38A 5DRXB 1P4IH 3U79A 1JF5A 1N3NB 3CMOH 3GDBA 4KVCL 1SQ2N 1QRNB 3U48A 3WNKA 3UP1A 5LGHL 3WHXB 2EZ0C 3AUVA 1S7QA 1UXWB 2JB5L 3S7GA 4G7VL 4MA1B 4UIKH 2QKIB 2WLZA 1M6OA 1UA6H 5I75C 1ZXQA 5IBUB 4LF3B 3EOBB 4KK9C 5HI3D 2AJSL 3FOMB 4PG9A 4ACPA 1I7UB 2D4FA 4M61B 4MNQD 1RZ7H 2PXYB 3GKZA 3PGCA 1BOGB 3VXPA 4M7LL 4YPGB 3BKCH 3H3BC 4O58L 3ULVD 4MQSB 4Z18A 1LQSR 4LVHB 1CXEA 3EYOB 3B5HA 5J06A 4V1DA 1UJ3B 4XVJL 1UM6H 4GXVL 5T1MA 4FQQA 2X1PA 1IFHL 5J57B 1WLHA 4TTGA 1N6QH 32C2A 2OZ4A 5I66A 1DLHB 4JRWA 2IMMA 5D1QC 5HI5C 1SBBA 3VWJD 4R6UA 1N59A 5J6GA 5IR1A 1MCHA 2AK4E 1HYSC 3MJ8A 5ICYA 4L1HA 2O5ZH 4NHUA 4Z7OF 1QZ1A 4HIJB 4QTIL 5ECJE 1PLGH 1DJSA 5F6HI 3NZ8A 2BVPA 3L3IA 4IIQB 1I9JL 4H5SB 4HAGA 4CRPA 3OKLA 2IAMC 4OT1L 5EFIA 3OGCB 1RK0A 5CGYD 5DQDH 4ZFGL 5JQHC 3U30B 4P2RE 1S9WA 3ZDYF 4L9LC 3FRUB 2AK1H 4KXZI 1F6LL 4UAOC 4O2FB 1YY8B 3KDMA 5D1ZA 2VAAA 4LSUH 3TZVB 1UENA 4JO4L 4Y1AB 5SWSD 3RWHB 3PJSB 4JHWL 5JZ7C 1I85C 2WBWB 1TLKA 4I9WD 4XCEA 3MUJA 4HZLB 5KVGL 1JNNL 3L5JA 1FPTH 2R1YA 3QUXD 3EOAB 4HS6A 4FQHB 1UACH 2XWJA 5D1XD 3DHJA 2RAMA 1KTKE 4H26B 4HMCA 5D72H 4MA3A 1NLDH 1VFBB 4L8DA 3IJYB 4OB5L 5C0BA 1OM3H 1U3HC 5BZWB 5CILL 1E4XH 4D9LH 3I6LD 1AP2B 5HSFA 2HG5B 2BMKA 1R3KB 4KDVA 1MHEA 4GAJH 4UI2A 2QBWA 1WWCA 5FO7B 3H9YA 2D03L 4YFDB 1CXFA 2W0FA 4CN1A 1F11A 4HC1H 3JWDC 4I0PA 1YUHA 3RAJH 2YRZA 3QQ4A 2K7QA 4Z77B 4X98B 1YYLL 4NQXB 3HB3D 5DK2A 4POYA 5B3JE 3NH7H 4J8RA 1M1SA 5FECA 3OZ9L 4NKIH 5IF0B 4LEOA 2AS5M 3T3ME 3IDXH 3KPMA 3OXRB 3TNMB 5E7BA 3CDGA 3IXTA 4OGYH 2CKBL 4JN1H 2W9EL 3RKDC 1JV5B 1WIPA 3BQUD 3KYOB 3MZGB 1IGML 2BY3A 1Q9KB 1UM5L 3VWKA 3V9FA 3EBAA 3DVFA 1Z3GL 1CQYA 1MH5B 1T1XA 4P4KA 3RL1A 2AKRB 2ATPA 4XVSL 3VRLE 5IIEB 1VESA 3CFIC 2PO6C 2CDEB 3VE0A 5DTFB 4HWEH 1YYMH 4GW4B 5T1KA 1H5BA 2ERJB 2R2EB 5C92A 5EBLA 5I19L 1P5UA 3MJ7A 3SE4C 3O45A 5I71C 3OSKA 2BY1A 5JQ6L 1RURH 3BGMA 5C0ND 3HR5B 1FNHA 2EE2A 1UG9A 5GZND 1JYNA 1S5HA 3FHAA 3DO3A 5JHLL 3DI3B 1A1OB 3EFDH 4LCCC 5ANMA 5EUOA 5DEGB 1OW0C 2IGFH 2CIKB 1ZWIB 2QSVA 3F65A 2OZ4H 1N2RA 1XCQB 2H32A 1PZUB 4NNYA 3ULUD 4J3WA 3QIUD 4S1DD 3RIFK 3V6OE 1CE1H 4HXBH 4FFVD 3MLPA 5I1GH 4O51B 3ARGD 3WDHA 1GOHA 4LPCA 3RIFF 3QPQD 3NA9L 3TPUA 5DRWB 1QA9B 5CMAA 5F8RC 1UZ8A 3LDBC 1RULH 4MJ6A 4TTDC 5D7SH 5FHAH 2ZCHL 3QYCA 1QSEB 4RIRA 3WO4B 4MJ5A 3C5SB 2VABB 5CIPA 1M7DA 2HA1A 2NY1C 5IBLC 4Z6AT 2MCPH 5EUOF 1UKSA 2FATL 3IDIA 4KMQA 4L3CB 2PTTB 5ITBL 1XGTB 3K2MC 3TGXA 4PJ7A 4PJCF 1G7JA 5DC0A 1CXIA 3P0YH 4JDVA 2Q86B 5DDHB 3HC0A 3DRQB 2ADJB 3ARFC 5I76B 1I8LC 2E9IA 5IVZA 4P57A 2FX9L 1MCOL 5DC4B 4HUVB 1BD2A 1IGIL 2OR9H 3BO8B 5JUEL 3PGFL 5JDSB 2Z91A 4GRWF 4HJGB 3VXRA 5JA8B 2K7PA 4HPOL 5JO5B 3SY0B 1JI1A 5FB8A 3O6KH 3HZMA 5B39B 2WBJD 4PREA 1LD9A 5C0AE 1K8DB 4HSQA 3I3DA 1HQRB 4K2UH 4U6VH 1BX2B 3KYAA 3QXAB 3IFNH 4M7LT 3FQXA 4P2QD 3UJIL 4Z7UB 2GK2A 4FQCL 1CIDA 2BJML 2XICA 4J4PA 5ERWA 2R2HA 1TENA 1JNLH 2ZCKL 5IW6A 5DO2C 5EIQA 3FB8A 4CAGA 5I1JH 4K7FB 3D39D 1T5WB 1NMAH 3LPGA 1CFSA 3OTTA 2EH7H 4TNWK 2E27H 1YDPA 4P3WA 3QI9D 2P5EA 5IFAH 3SDCA 3MRPA 2EYRB 3E2HB 4TNWF 1OAQH 2E8YA 3KPRE 4TSCL 1SYSB 4MAYD 5IB2B 1AXTL 4PJFE 3ET9F 1JK8A 1W72A 3TO2A 4ESKA 3BYTA 4ZXBC 4UV7H 1MRCL 2I07B 5FGBC 3BP5A 1QFWH 3G5VA 3I75B 2W1NA 4PJHA 4ZAKB 2P48B 5CJXA 1J8HE 1A1NA 1IGFL 1R3JA 4NKMB 4JB9H 2Z4QB 4JY4A 43CAA 3HZYA 3S34H 3T1WA 1KNOA 5DMGD 5BVPH 2Q76A 4Z7QF 1M05B 2XZAL 3N0PB 1QR4A 3RVUD 3I85A 3O9WA 3ARBC 3QHFH 3SCMC 2B4CL 1PZ5B 4G8GD 5DVOA 5HGDB 1KTDB 4RGMC 3WHE0 1RVFH 3TH3T 3IDJA 3LQAH 4BELD 3VMPA 5IW3A 2R1XB 4LQ1A 4TQEL 3Q0HA 3SDXF 2H32H 4WFGE 4LSVH 4JZNB 4JPVL 4PJHF 5HYEA 5HGGS 2LTQC 4M6OL 1FLRL 3SGKA 3PWPE 4F15B 4L3EE 5IROC 4M02A 4U1IA 3VXUB 3BIAX 1RIVH 4OIBA 1S3KH 1DBAL 4L4VA 3LRSB 4YC2C 4JFZH 2VL5A 1BM3L 1L7IL 1CS6A 4JG1H 4BQ6A 3BN9C 1XT5A 5CIPH 5KSBB 1BFOA 3KGRA 3OMZA 3U0PA 3QCTL 4WI9A 2GTZA 2WSKA 3OAUH 1RU9H 4PBVC 4W4NA 3SE8H 3D18A 3Q5YA 4S1RL 1G6RA 3DSFL 5DEZA 3HS0A 1A22B 1IL1B 3CLFL 1BJ1J 3FMGH 4NNXA 3SPVB 3MBED 4LSTH 1N5AA 1P84J 2R69L 5TGBA 1HINH 2XPGA 5C0CE 1ZHBB 4JDZA 4NRZB 1DEEA 3FT2A 3O3EB 4PFEA 3CSYA 4R4BA 2XY2A 2A73B 1FZJB 2BDNL 1CFNA 1VADA 3CFCH 4LVNC 3PWLA 4S0SD 2JJSA 4EI5D 4ELKB 4K8RH 1UWXK 1FAIH 5EO1B 3ZDZE 4IEFB 1OGTA 4DVBB 2OX5A 4XP9L 4G6JH 3UPRB 2NY2C 4RX4D 2VIRB 2VDKH 15C8L 5K9JH 2E7MA 5KN5A 1QRNE 4G43A 2V2XA 1NGQL 4U3CA 1AQKH 2ENYA 3AB0C 2N7BA 4XTRC 4HT1L 4R7NB 1DUYA 5EIIA 2X70A 4LHUD 4W6YB 2Y36L 5EBWA 5KSAB 1DANU 3EYVA 4XNUL 4P5TD 3ZL4L 1JYWA 4WWKD 4P2CG 3PP4H 4F33B 2X4UB 2VZSA 1W72H 4U0RB 4HK3N 5IK3A 1DZBA 2IPTL 2JCCB 2ZP0T 4XHJD 4CDHA 3WIHL 3K8LA 5K9QI 4CMMB 1EHNA 3TEUA 1AXSA 4PRDA 4HG4J 5F6IB 5I8CA 1KN2H 1R0AL 1FVEA 2IH3A 3VFVB 1BFVL 3PDDA 1MCIA 5TF1L 3O3AB 3VFMA 2D31B 1IM9B 1B0GA 3LHPL 3PWVB 3MREB 3PL6D 3BW9B 3QPXH 4L9DA 3V6FB 3O2DA 3L95B 1BZ7B 5GRZA 1TZIA 4KKNA 4NDMB 4ZUSA 2YBRA 4O2CA 2ITCA 2NY5L 3TPKA 5L9DL 4TSBL 5IUSA 1N7MH 5CINL 1JGLL 3GRWL 5E8DH 2VLRA 4BZ1L 1B0RB 4NSKA 3C60A 1I7TB 3P4MB 1AKJB 3EHBC 5D8JH 2ZSVA 1EAPB 4WGVB 1ZSDA 2VLLB 1NMBL 2VR4A 4DZBA 3WXVL 3HPJA 1IILE 4PV8A 5CLTA 3T2NH 3U0WH 2H41A 1R5WA 1YEHH 3HE7C 4Q58C 1Q72H 4POZD 4M5YH 3EDJA 3JWOH 5B4MD 1T04A 4ZPTA 3PUCA 1JPGA 2VLJA 1F90H 5D1QA 3VXSD 1KC5L 1L4IA 3E1F1 1Z0MA 2Y9RT 5J12B 4Y1AE 1F3JA 1Q0YL 4J6RL 2ZNXA 1MRFH 4JY6A 1CK0L 2XN9E 1JWSA 4J1UB 5D7LB 4EIZC 2HJKB 1NGXB 2PW1B 5E56A 2Q8AH 5T1LD 1FE8L 3BPCA 2DQUH 1BQHB 5JW3H 1MEXH 1ZAGA 2ORBH 4X6DA 2QR0B 4AL8L 1KFAL 1KXQE 4QYOB 4UUJB 2IAMA 4CADB 5MP6L 1G6RH 1EFXB 1KG0A 1JTTA 3PWUB 5CSBA 1JF1B 4OCSH 2F58L 4L9LA 4OZ4A 2FWOA 1FZKB 3ARRA 5D2NB 3CH1B 1D9KC 4LLYB 3V4VL 5LJYH 4NWUL 4JDTH 4XXCC 4JN2A 4G8FA 2H8PA 5HYJA 3R8BB 2XT1B 4BSWA 4BK5A 4JM2C 4YXLH 2X44D 3RWDB 2VXQL 1I85A 2VYRE 3L1OH 1MCBA 1QRND 5GJSH 2RIKA 2V17L 1NMCB 4F7MA 3RDTC 4LCWB 1CDGA 3RZCB 3BZ4B 4JFYA 2CRYA 1D6VL 3KJ6L 1KXVC 1ZS8B 2DB8A 3LQMA 1Z6JT 2P46B 3EYSL 2E6QA 5I8EB 1I8KA 2B1AH 4G7YL 8FABB 4IMKC 4EDWL 1SJXA 2D0GA 4LU5H 2XNAA 5DZLA 3QDME 4LLWB 3WV0A 2PXYD 3VG0L 3BKYL 1KJVA 3OJMB 5F6HJ 2VDPH 2PYEA 1ED3A 2AXJA 3GGWA 1NCDH 3IFOB 4JFQA 5TE6L 2XKNB 1DQJA 4JVWA 4Y89A 2YZ1A 4MD4B 1HOCA 4RMRA 3ZKMD 4ZSOB 2GJZA 4ERSH 4EN3B 1EO8H 2CK0L 4M7JL 5IMKB 1WVZA 1R3HB 1IEAA 5EA0H 1BBJB 4XNMB 3VW3L 3PV7A 1YNKH 5I1LA 3IU3B 4TUKH 3O3DA 2ICWA 4NRYB 5SV4A 4Q0XH 3E6FA 4KHTL 1NL0L 1T89C 4YBQD 5D6CA 4JFDB 1OAKL 5HY9A 1S78C 4X6FB 3HRPA 1JZ2A 4XPBH 1U8IB 3QEQB 1CD8A 3CIQA 4BFIB 3AAZB 2JJTC 2PO6A 3O2DH 5I74B 3WNMA 4GRLC 4RA0C 1XF3A 4GQ9H 1IGTB 1IAKB 4EI6B 3BD4A 4Q6IB 1A8JH 2AEIT 2WMPA 4JANB 2A77L 4OM1H 1Q9WB 3MO1A 4Y5VC 3SE4A 3BWAA 1B3JA 4UDUA 4YPJA 3TZVD 3B6SB 4WTWA 1QYGH 3UYPA 1NUNB 4QOKB 1RK1A 4V2BA 5DD5H 5FO9A 1GGIL 1QSEE 4CVUA 2GT9B 5C86A 4ZFFA 3NCFB 3TIDA 5HYSA 1JYVA 2BOBA 4HS3B 1OW0A 3QJHA 1T0MA 4MB4A 2OR7A 3BDYH 1N8ZA 3EJYD 2F8VA 5IJKA 4NGHL 7FABH 3EDFA 3WSQH 4PS4L 2MWCA 4JZOB 1S7QB 1KCLA 1FL5B 2HTKD 3MXWL 1SYVA 1CZ8L 2BFVL 2XTJB 4O5LH 4MX7A 4OUOA 1F8TL 2IPUG 2OTPA 4PG9B 3GHEL 5JIPA 4GAYA 3PE9A 4JM4L 4Y5XA 5KVFL 3TBTA 1XR8A 3VXPB 5FF6B 3D3VE 1RJYB 1KIPB 1LWRA 1E6OL 2RHEA 5DK0A 2DIBA 4ELMA 5DUBA 3DX6A 4V1DB 1S9YA 1DSFL 4FFWD 5F9JB 4FQQB 1AQDB 4RDQG 4Z7UE 3QBTB 1QHOA 4PJIA 3ARFA 5E6IC 4JQVC 2BHUA 4KJYA 3RTQD 4PP1D 4DKFH 1D5MB 5I66B 3N06B 5I8KL 2JIXD 3W0WD 4GLRI 1UQSB 1N59B 4K3DL 2R56H 2CUHA 5ICYB 3O8XC 4AIXA 4NHUB 1ZTXL 3MX0A 3BH9A 1INEL 3REWA 3SJVA 3IS1X 1WV7T 4H1LA 4YDKH 4FNLL 1UYWH 3NZ8B 2BVPB 3L3IB 4NN5B 1YEEH 1JGUH 4JO2H 1Z0NA 1TZGH 1A6ZB 4OIIL 1RK0B 43C9B 1PY4A 2GSIA 2YPLA 4Z7VE 5L7XL 1S9WB 3EAKA 5F9WC 4LSRH 2WANA 5EOTB 2J8UF 1AJ7L 4ZTPH 5CZKA 3U6RA 3KDMB 3C6SA 3L3GA 4BSVA 2QQNH 1ZEAL 2UZXB 3WCYA 1LO3H 2AJVL 5CWSB 4NO3A 2X1WL 2AABH 4HS6B 1VFOA 4OTXL 2NW2A 1Z9SA 2VKXA 2XWJB 1ZLSH 3GK8L 2MHAA 2GJ6B 5ID0B 2WUCH 4LNRB 4WGWB 3NCYP 4L8DB 1CR9H 3TV3H 5E6ZA 4ZUUA 1B4JL 4LMQI 3S35X 2XZQL 2DM4A 2ILLA 3FAWA 4ENED 2I60H 1AFVH 4GQPH 5IBUG 5IG7A 2WIMA 4PBWD 1O5DT 3I50L 1CGTA 2UWEF 4D9RE 4IJ3C 4Y4HA 1X5ZA 3DUUA 1RJCA 4B41A 4LASL 5DLML 4Q9RH 1A6UL 3VXUE 1OAZH 2FX7L 1JRHL 1F42A 1MREL 2DI8A 4I0PB 4NZUL 2VKWA 3WIIH 3QAZC 3ARBA 3SCMA 1F4YL 1YN6A 4QXUL 1ETZA 5IVNA 3OAYK 2YA1A 4JKWA 4PLKC 4ODTH 5AZ2L 5I0ZA 5DK2B 4J8RB 3T1FB 4LEOB 3RGVC 3CDGB 2O5YH 3IXTB 3C6LA 2WWMD 1XF2A 3CK0L 2WBKA 4YHZL 2GCYB 4Y19A 3QCUH 4YXHH 1QEWA 4LL9A 5D93B 3VWKB 4UBDC 1A7QL 2YMXH 2O61A 4G5ZL 3NZHH 5E5MA 1M7XA 4P4KB 4I3SL 3RL1B 3GSNB 2X4PA 5CZXD 3NIFF 2ATPB 5E9DA 5C7XH 2VWEC 3Q2CA 1Q94A 1P2CA 1ZANL 3B9VA 4XWOD 3C8HA 5T1KB 3TT1L 2NNAA 2IC2A 3MJ7B 4OBSA 5JNYB 3CFBA 3VXMA 3O45B 2APVA 2B4CC 2NY4B 4QTHA 2XWTB 1GAFH 4RGND 3DTXA 1UZ6E 1RHHA 4Y2DA 1BOYA 1QO3B 1EEUA 3HHRB 1NH6A 4LKXA 5E99L 3L5XL 1S5HB 2RB8A 3EDDA 5LCVH 3OKKB 4DZ8B 3DGCR 5ANMB 1ZKAA 3GUTA 4S0TD 1BBDL 2XZZA 1HKFA 1RV6X 1KJ2B 2H32B 1MJUL 1A7BA 4W68A 1E27A 5I1AA 3RZWA 1IAMA 4OQ1A 4AEFA 4H88L 3T8XA 4Q97A 4XP4H 3TPUB 5KG9A 4O9HL 5HYQA 2AEQL 4H1LH 5D7KE 4K3HA 3VDCA 5J6HA 5CMAB 2G60H 3TVMB 3IU4L 1CBVH 1PKOA 4QF1B 4XMKH 3VFSB 2R0ZH 5DD6B 1FC2D 1SMAA 3DX9A 3P4OA 4MJ5B 1GGCL 4LVEA 4L8SC 4F3FB 1OAUH 4X4ZA 2NXYD 3IDIB 2R0WH 4PJ7B 3G6DH 1G7JB 3MXVH 4P46C 3BISA 1TNMA 1TCRA 3HC0B 4NYLB 5EZOL 3HAEA 5IVZB 3O4LA 2MCG1 1VERA 5BRZA 1BD2B 1JGEA 3VGDA 5JTWA 4R97B 2HKFL 3OAYH 4F9LA 1UM4L 2DQHH 3MCLH 4OKVB 2Z91B 3VXUD 1JTPA 5BS0B 2XZCH 3TESA 3LCYA 4TSAH 4OD1L 1LNUA 4PREB 4L5FL 3OR7A 1KB5A 1LD9B 1NDMA 4NO0B 1RIUH 2LABA 4JJ5A 4C55A 2VQTA 3RWIA 1C5CH 3FQXB 4PRAA 1OPGL 1DL7H 1ZLVK 1G7HA 4NJ9H 1FNEA 2D4DA 5ERWB 3UZEA 3QUYD 5IW6B 4ZOBA 1IAOA 1S7XA 3FB8B 4QT5A 1ACYL 5D70L 5D7LE 3QRGH 3I9GL 5CUSL 3G9VA 5BVJA 3MMEB 1X5FA 2P5WD 2CDFA 1CFSB 1P7KA 4RBPK 2AQ1A 2FBOJ 5E1AB 3ARXA 2FO4A 4Q2ZA 2P5EB 4XMLH 5EOCL 2V2WA 2DLIA 4WFFE 3P9MA 3HE7A 4RCAA 2PTUA 1MJ8H 3QDJE 3EKCA 3T65A 3WBDA 1W72B 1ZA6A 4IS6B 3TO2B 2GITA 3GBML 5EULV 3BJ91 5CGMA 4EIGB 5A2LH 5D2NE 5JHDE 4M00A 1BFTA 2B1HH 3S37X 4PR5B 4HJ0D 3PP3H 4KROC 1IM3A 1A1NB 1RIHL 1EXUB 5J3HD 3HNVL 3ZSTA 1KJ3H 4DW2H 4JY4B 5IMLB 2Z8SA 1OCWH 2NY5C 1KNOB 1GC1L 3AMLA 1RZFL 1FBIH 4FZEL 2Y6SD 2Q76B 5KTEH 4APQB 4LRIA 4MJIA 2F8OA 3O9WB 5CEYA 2FD6L 5IQ7H 1C5BH 4IOIA 5ADPL 2J12B 4NO5B 4UINH 3QUZA 1P7HL 4EQ3A 3UTSD 3IDJB 2QL1A 2LFGA 3MUHL 2V9RA 4FTVD 1J1PH 2QQKH 1S7UA 4JO1L 4ZSOE 4W70A 4GKSB 4DGVL 3BVNA 5INDA 3QA3A 5DJ8B 1P1ZA 4KTEL 3LEXA 2X89D 5K9KA 4UOW0 1PFCA 4EBQL 1YECL 5FYJH 3DVGB 1KLFA 2YXMA 3MLWH 3MRRA 4PJDA 3O6ML 1NC4D 4KKAC 4L4VB 4NQDA 4IMKA 2IEPA 5D6DA 5F7MC 1ZLWK 1XZ0A 2BSSA 4C56B 2Z9TA 2ADFL 4LVOB 4KZDL 4PJGA 2NY6C 1HHIB 2X4OA 1BFOB 4HK3J 4XPAH 5H37H 5FGRA 4FQJH 3S9DB 2GTZB 1T21A 4JFDE 1AKJD 5AWNL 3D18B 4OZGA 1G6RB 5IW1B 1MIEH 3HS0B 4OGXL 5T5FL 1T83C 5IHUL 5F88B 4H8WL 4HLZG 4NNXB 3MV9D 4XNZC 1N5AB 5DJDA 5SV3A 1OTUC 4KI5F 1X4YA 1U92A 1HILA 5TGBB 2XPGB 2RR3A 5BO1H 2ESVE 5A2FA 1IC5H 1YPZA 2EYSA 3BX7C 4JDZB 4OZHB 1SJEB 3FT2B 3N1FC 3RWCA 3GO1H 2YUXA 5I1EH 4YR6A 3CSYB 5KW9H 4PB9L 3LQZA 1TMCB 4OCXL 3OL2A 4QOKE 3RX7A 1U8KA 3ZT6A 1E4KC 4QY8A 1VADB 1KEGH 3PWLB 5D7LD 2F9BT 1KB5H 3FTGB 4OCYH 5F1NA 4R0LC 1LP9B 1T89A 1MI5D 2ENSA 3MGTA 2BVOB 4GG8A 4PJGF 1W0VB 1MQKL 4U1JB 3EJJX 3HFML 2JJTA 4OZIE 5DEFA 2J8OA 2V2XB 2QTEA 4G9DA 4Y5YB 3QUML 2ARJQ 1CT8A 3KPOA 4LOUC 5DFVC 5EZJA 5FEBA 1BVKA 1U41A 4XVUD 2KPNA 4ZDHA 2AXHA 1PG7X 2YRPA 3V5HB 4IRZL 2X70B 5EBWB 2IAND 5JIKA 4PRHD 5DR5L 4LCWD 1RUAH 2BSED 1L0XA 5FIEA 5TFSH 3Q3GB 5EU5A 4KVCH 1LO4L 4I13B 5IK3B 4HH8A 5CZVL 4V1DE 4QWWC 3MNVB 3I6KA 1AXSB 4P0DA 4PRDB 3CLEL 1FVEB 1JUFA 3RVTD 2DN7A 1QP1A 4G7VH 2IH3B 3C08H 4BFBD 5DD1L 2XACC 2A6JA 3VFMB 5BV7L 5JORA 4EVNA 1VEMA 2AJSH 4B53A 3FKUS 3HA0A 2QSQA 5I75B 3VDAA 1TZIB 1MCCA 2XG5A 2VDNL 4EN3D 3QDAA 2IG2H 2YBRB 4ZUSB 4O58H 5GS2H 5C07B 5C0RL 1PYWA 2GSGA 3NCJL 2ZUQC 1KIQB 1WBXB 1EO7A 5E1HB 4UDTA 1LE9B 4XVJH 2DM2A 2IBZY 3CXDL 4GXVH 3NACL 3UC0H 4IRJA 1MFEL 3KPSB 4PGDA 1A4KB 5A16A 2OTWA 3UAJC 2ZSVB 5ESQA 1YA5A 1IZKA 4DZBB 3F7PC 3HPJB 1FRGL 3E6HA 1R5WB 3BESR 1V3JA 4BQ9A 5E6IA 5MEPA 3L3KA 1J88A 1T04B 4XP1L 2FNBA 1H3XA 2FCBA 2ZJSH 3S8WA 2VLJB 2XYCA 5D1QB 3TT3H 2CH8A 4QTIH 3UROR 3QEQD 1AGBA 4JAMB 2HT4C 1D5ZA 3O8XA 4UU9B 1JWSB 4ODVL 5GSRA 4LCIH 3EO0B 4NKOB 4FHBD 4QRUA 4OT1H 5CP7A 4PG2C 1CLZH 3TN0C 1NCAL 2GJ6E 4X6DB 1T0PB 1EGJL 1MPAL 1U8JB 2IAMB 3ELAT 3MV8A 4WW1A 2EYTA 5JMRA 1V5JA 2JK5B 4TVPE 3A6BH 4L9LB 4OZ4B 1LHZA 2FWOB 3PQYA 2D7NA 4JO4H 2IMNA 3A67L 4JHWH 4UAOB 4ZUTA 4JN2B 5CEZL 4G8FB 4BSWB 5EN2A 2J7LA 4Q7DA 5ISZA 5MENE 5DXWA 2FGWH 5IM7A 1A6WL 1N64H 2X09A 4XI5C 4OB5H 3BPOC 3VI4E 3QDGA 1AGFA 4JFYB 2XTJD 5CILH 5HI4C 5CKAA 4N68A 4XCFH 1I8KB 5C0IB 1C08A 2WIIA 5FYLD 1DEDA 1U3HB 2EDTA 1S7TA 1KJVB 5L8JB 2YWZA 2PYEB 3GGWB 5KSVA 4ZS7L 2YD9A 2F54A 3W9DB 1YJDL 1HOCB 3HZKA 1HQ4A 1J1OH 1YYLH 1TCMA 4R8WL 5KAQG 3P0GB 1CGVA 4FXKA 3TJEL 5D2LE 5IMMA 3ZT5A 2W9EH 3V6OC 4ONHB 4X7CC 1WICA 4GXUM 1IGMH 4LGSB 3RGVA 2PUQT 1DP0A 5I1LB 3O3DB 1JTOA 3RWEB 3QNZB 3BD3A 3LB6C 1M7IB 4O00A 4DFIA 3ALWA 2P7TA 3KPLA 3E6FB 3HI1B 4U7SA 4MJ2A 3LKRA 1A3RL 2W59A 4I77L 1WEJL 1X3DA 4YBLC 3QIWA 3RNQA 4OCRL 3ABZA 4M43L 4MVBD 2PO6B 5I19H 5DF0A 4OV5A 1BQHG 5DD0L 1JNHA 3JWNC 2CO7B 4QRRE 5J9PA 5JQ6H 4N90D 4PLJC 4Z5RB 2X4NA 3LIZH 3GNMH 3MO1B 5H94A 3SHSA 2EE9A 3BH8A 3BWAB 1ZT4A 4UDUB 5D1ZD 5I71B 2R0KL 4K7PH 2O5XL 5D71L 2BXZA 4P23A 5JHLH 2WAHA 1IKNC 4N1EA 4OF5A 2XTLA 4M9PA 4ZFFB 4LCCB 3TIDB 2BOBB 4O2EA 4YHKL 4R3SA 1KCVL 1T0MB 3WJLA 1NUDA 3P30L 1LO0L 1LDPL 2A0LC 5C0BD 1GZQB 1TJGL 1FYTB 3RBGA 4BJLA 2ARWA 1WBYB 2BSTB 1L9MA 4MMXC 1SHMA 1U6AH 2HKHH 1DQLL 1K6QL 4AT6A 3LDBB 5BS0E 1Y0LA 3CFEB 4TN9A 2EDBA 4I0PD 1A9EB 4PJEA 3RWFA 4GAYB 5ETUA 2IQ9L 5KZCB 3TBTB 1XR8B 5ITBH 3W2DL 3V0VA 4L8SA 2X4SA 3QWOA 2NY1B 2ITDA 3WS6C 5DK0B 1CGSH 4XWGL 4ELMB 5DUBB 1NCNA 1S9YB 2BNUA 1TPXB 1YEIH 4M8VA 2FX9H 4E9LA 4P46A 1ZHNB 4PJIB 3MLVL 3K2UH 3H9SE 3WXWL 1EH9A 3VWKD 3PGFH 1XIWA 3DXAA 4P4KD 5GS0C 4QO1A 4MLSA 3C2AH 2EDYA 3INUL 4LPXA 1A7RL 1AY1L 5T1KD 3BH9B 5DRZA 3SJVB 4PJEF 5T1DL 4BZYA 5GGTA 4H1LB 3U4BH 4F2MA 1GHFH 3UJIH 2NW3A 2ZCKH 1UADC 2DJUA 2E9JA 4HF5H 2AJ3A 4LAQH 1VEOA 1F5WA 4QCIB 3RPIB 2PW2A 1DE4A 3IAGC 2DQGL 1H15A 1MCDA 3BN3B 3MRCA 1TVHA 4UQ2B 4MD5A 4HK0A 1QBLH 3BXNA 5CP3A 4IM8A 2VDOL 3L3GB 4BSVB 5EU4A 4TSCH 2OR8A 5FM8A 1AXTH 3BRDA 2Y07L 3K7UA 3TH2T 4DGIL 3BPLC 1KACB 3SDDC 4NO3B 2PCPA 1CLOL 2D7TL 3SGDH 4S1QH 2LV4A 2NW2B 1EK3A 1MRCH 2P8MA 2MHAB 3T77B 4N8VG 3V8OA 4ZXBB 4LGPB 2Q20A 1IGFH 1V7ML 4LMQE 1BVLA 4ZOEA 2VZTA 5CD5D 4U6YA 1FDLL 4NQCA 5T33L 5CJ5A 5F3HB 3X14B 3DUUB 3VFTA 5J1AB 1W0YT 2FB4L 1H3PL 1AD0B 5JA9A 1DQML 3W82A 1ZGLB 5F7FA 3ARBB 3SCMB 4XBEH 3SGJA 1ETZB 5EUKA 5C6TH 4CNIB 5K9QG 5ALBL 3IFPA 3OG6B 2Q8BL 1BD2D 4OLVH 5GRVK 5GRWA 4C56E 2HVKA 4RGMB 3IXAB 4F58L 2DWDA 1IC7L 4QHUB 1XF2B 3VXRD 4XPTL 5GJTL 4WHDA 4Y19B 1M71B 4X4XA 4XPHL 2DICA 1DVFA 1QEWB 1XGPA 5C09D 2ATKA 4RISL 2ZZUT 3MV11 4KY1L 3VRIA 1TIUA 4E41E 4K8RD 2O61B 1I7ZB 2LTQB 5KJRL 2AXGA 3RVXD 4NJAL 3RVWC 3ULVL 2X4PB 5E9DB 2XQBH 4OZHE 1BM3H 1FV1A 1L7IH 4H25A 1AI1L 1P2CB 2APXA 1K5NA 4J4PD 4YC2B 3DROA 2NNAB 1BHGA 3QCTH 3CFBB 3VXMB 2BNRA 3OB8A 1KTRL 4QXTA 5JR1L 4P9MH 1XGYL 1LP9E 3CLFH 5EH1A 1SEQL 1CFQA 4GFTB 4PJBF 2EC9T 4LKXB 2P5ED 1EERB 4BZ2H 5DYOA 3SDCD 3BP7A 5DJ2B 3CVHA 1NDGA 3EO1A 4MXQC 4RGOL 3GUTB 1JPTH 3U2SA 4JVPA 2CMRL 3FOLB 3BKMH 3GSUB 4U1KB 2BDNH 5GRUL 2FSEA 3F6LA 3NOIA 3ARZA 3PHSA 4CVXB 1G9ML 4J2XA 12E8L 1E4KA 4ETYA 5FA3B 1INQA 3EYUH 4LVNB 3D85B 5GGTH 5HYQB 5J6HB 4R0LA 4ORZC 5FUZH 15C8H 4GAGL 3O9WD 2A6KB 3ILQC 2NY2B 4MA7L 3EJZC 4JQIH 5ACZB 2H26A 2FIKB 5F9OH 2VDLL 4H8WC 1R3LB 2GYSA 3LKSA 2VO5A 3U30C 3AB0B 1OAXH 2Y36H 1JHKL 4XP6H 5CP3H 4JFHE 1TCRB 3ZL4H 1EZVX 4W6WB 1JFQL 1YEFH 4OKDA 3O4LB 3WFEL 1KB9K 4MAUH 5E8NA 2Y1VA 4X6EA 4YHLL 4QHLA 4RMUA 5IFHL 5BRZB 2FJGA 2AK4A 5C07E 2Q3AA 4OLEA 2IPTH 4XH2A 5FKPA 4Z95L 3KLAA 1LEGB 3NMEA 1GXEA 1YC7A 2FBJL 3KPSE 1OARL 5LXGH 3FO0L 4L4VD 1LK2A 5AUMB 3OR7B 3LY6A 1KB5B 3LHPH 2AGJL 1NDMB 2WINA 3FB7A 1EV2E 2VUYA 5KVEH 3K0WA 3HR6A 1JZ5A 1XGQB 2V9TA 3RWIB 1MIML 1NUGA 5CD3B 1T7XA 2FL5B 4P2RA 4PRAB 2QSTA 5L9DH 1G7HB 3VFGH 1FNEB 5CINH 4I8DA 1S7XB 3DV4A 4GJTB 4K9EL 1OP5K 4QT5B 1S7VA 1T80A 4LQFL 1A7OL 5DQ9B 1NMBH 3RL2A 3WXVH 3IJHA 2B39A 4FS0A 2FO4B 1N6UA 5FGCB 5D9SA 3BOVA 3P0VL 5ID1A 2UZIL 4WCYL 4LDEB 3T0DA 4Z78B 4OM0L 1CDHA 3HE7B 4RMTA 3BFOA 4YWGL 3THML 2K3TA 1ZA6B 2GITB 4S10A 3MUGA 5AYUL 5BV7C 1ORQA 1INDL 3WLBB 3W11C 3RFZC 5F93C 1IM3B 1QPPA 2ED8A 3QIBC 3UTZA 1K8IA 2WLYA 5TE7L 4G6KH 4ZFZA 2O93L 3UZVB 4AL8H 1I4FB 1D7FA 1KENH 3W9EB 3LEVL 4PG2A 3C5JA 3FZUD 2B0SH 3HE6D 3ESVF 3QHZL 4U1NA 5MP6H 3TN0A 3KPQA 4HFUL 4MJIB 3ULUL 3IETA 2P44B 4IOIB 3LN4A 4WI6A 2WP3T 3CVHH 3NIDE 1DN2A 2APBA 2A74A 4NZDA 1RUML 1JGDB 4C57C 1KSRA 1D9KB 5IHZA 1J18A 3KYNB 3CH8A 1S7UB 4JM2B 2OQJA 4PRNA 2YD6A 2VAJA 1IQDA 3BVNB 5INDB 1D6VH 3QA3B 1P1ZB 3RDTB 2EZ0D 3LEXB 3EYSH 4WFEE 2BOCA 5K9KB 3LKPA 1EX0A 5KOMC 3U82B 4JFHD 2M1KA 3B2UC 3IGAA 5LQBH 3R06A 5DUML 4XCCH 3MRRB 4PJDB 1JWUA 4GT7A 1KELL 4NQDB 3VG0H 4KK9D 3C2SA 1CL7I 4LDLB 4PV9A 5B3JF 1EIBA 4WFHD 3CU1A 5IQ9A 3G5XA 5D7JA 1XZ0B 2BSSB 2VLRD 3RKPA 5C2BL 5T3ZE 3C60D 4R90H 2YKLL 4ISVA 3BZEA 1T21B 3DIFA 3SE3C 4AH2A 2KL6A 4MXVE 2CK0H 4OZGB 1BGXL 5I8OL 3IDMB 4MCYB 5CBEA 5DJDB 1I3VA 5ELIA 4XCYA 3WIFA 1MUJB 3MR9A 4PGZA 3VRLF 2YPVL 4YHPA 1OP5H 3O6FC 2EYSB 1YPZB 4OGAD 3UTTE 1U8MB 1UT9A 3V6OA 2VLJD 4F9PC 4YR6B 5D1QD 5HI5D 2DKSA 4KHTH 5I1KH 1MOEA 1NL0H 5E2TL 5JLZA 4M1GL 1U8KB 4QY8B 5DHYA 1OAKH 3H9ZA 3P73A 5F1NB 3MGOB 3QQ9C 3G6AB 1A02N 3UJTL 3QFJA 3MGTB 5IOPA 5DURB 4ZPVA 3B83A 4TYUA 5AG9A 3TYGH 2IAMD 1CICC 2HRLA 4QHNB 2A77H 3HRZA 4PJAB 3S88H 1FYTE 4GRLB 1GSMA 1FNGA 5J89A 4HWZB 4G9DB 1QNZH 2OMNA 3O6LL 2DQDH 3ROLA 3KPOB 5EZJB 4PYHA 4GMTH 4Y5VB 1BVKB 4ZDHB 4LRNL 4X9FA 5HYJD 4WU7A 4JY5H 5DQJB 1YNTA 1ZE3C 2RQ8A 5JZ7D 2IF7A 1IKNA 4X8JA 5B22A 2CKBB 1D6EA 2C3VB 4EDXA 2GUOA 4RMWA 1DQTA 3E2HC 3WKNA 4XB8A 1PJ9A 5C0AA 4HW6A 4PS4H 1JJUA 4PTTA 1YEDA 3I6KB 5I2IB 1A7NH 3AVEA 2VDQL 5EWIL 3D0LA 2BFVH 1QPXA 1Z5LB 2DQJL 4FQLH 1Z9MA 5GRJH 5JORB 2PYED 4HIXL 2DI7A 3QXDB 3GHEH 3LMJH 1D5BA 1HSBA 5F7NC 1F3RB 1F45A 3SOBH 4GS7C 1KPUA 2H6PB 4RWYH 4WFED 4UDTB 3LV3A 5MHSE 3RPKA 1FGNL 2BVEA 3KPRA 4DWHA 4Z7WB 3WS6A 3MACL 4WO4A 5ESQB 4PJFA 3DUHA 5I16B 4F7PA 3RKDD 5D5MB 4WEBL 2ZG1A 3TA3C 3VFPA 1FLTX 3E6HB 5I8KH 1DBBL 3B5GA 3L3DA 5E6IB 2CDGA 3IT8D 3L3KB 4NKDB 4W6XB 4K3DH 1FO0L 4DN3L 2BVYA 1U93A 3HNSH 3HPLB 1J8HA 1KV3A 3MRQA 4KQ4L 2QJDA 4N0CC 1CD9B 3MLTB 5LBSL 1AGBB 2PO6D 2MKWA 1D5ZB 1XGRB 3O8XB 4C54A 1T2JA 4QRUB 2AJZA 5F7DA 5GGSA 1MJ7H 4OIIH 4Z8FH 3LN9A 1GVIA 1PW3A 2DQIL 3MA7B 3MRDA 3MV8B 4CU6A 4PJFF 4WW1B 2EYTB 4NQVB 5K59E 4YHNA 1IEBA 3C5ZD 1AGDA 4P9HL 3PQYB 3QR2A 5DWUL 1E6JL 3P4NA 4YDVA 5FO8B 4ZUTB 5EZLA 5IHLB 1MY7A 5AAMA 5ITFA 1NC2D 3PWPA 3EYFA 1T2QL 3U46A 4L3EA 3T0EC 3VXNA 4I4WA 5ISZB 5IM7B 3IS0X 4MLIA 4ODHL 3QP3A 3NTCL 5DVMA 1B4JH 3STLA 4R26L 1IQWL 2XZQH 1AGFB 4OLUL 3GSQA 3OJ2C 1I75A 2FX8L 1L6XA 1WF5A 3GB7A 4OSUL 1VENA 1C08B 2VXSL 2WIIB 2CO6B 3I50H 2OTUA 2GW5A 2VN4A 5KZCD 3HKFA 2HT3C 5EO0A 3BI9X 5DLMH 2HWZL 2KDGA 5ILTL 1JRHH 2NY1D 5IBLD 4IJ3B 2F54B 3MRHA 3FB5A 5E9DE 4FQXD 3R1GH 4QXUH 3HZKB 5JPNA 2CJUL 2XIDA 5EIVA 2YUWA 4HV8A 5C0CA 4IDJL 3WS3A 3ARFD 2KZ1B 3QAZB 5IMMB 5F89A 4KDTC 4RDQF 1DDHA 3CK0H 4YHZH 3VXME 4HHAA 5IB3A 2X1OA 1YEKH 3UTPD 3ZE0E 3RGVB 3WDIA 4NZRL 5HVHC 4G3YL 2GK0A 1R3IL 3HTLX 1OF2B 2LE9A 1A7QH 3SKMA 4G5ZH 4QEGA 1C12A 2P7TB 3KPLB 2KZWA 3SJVD 3MLSL 5IEHA 4OAWB 3SDAC 3LKRB 4G6ML 3KHOA 2H2PD 1FN4B 2OLDA 3OKYA 5F6IC 3RNQB 2HTLD 3HC3L 3WHXA 4OV5B 2YPLD 1IGCL 2VXUH 1UXWA 1U0QA 5H35A 4M7ZB 1KIRA 2X4NB 3IJSA 5H94B 5TQ0L 4UB0H 3BH8B 1ZT4B 5E99H 3ALXA 3L5XH 3CFJA 4YZFF 2YD5A 2Y5EA 5C6PB 3B43A 4WHYG 2ZPKL 4B50A 1BBDH 3HUJF 5HI3C 2AEWA 3ZDZF 3G5ZA 2BCKA 4YBHA 3FCTB 5DFWH 1UWGL 4JRYE 5HDBF 4R3SB 4AY0A 4L8BA 1T66C 2EXWD 1F00I 1LGVA 5GS0H 3ULVC 3BT2L 4H88H 4O9HH 1WAAA 5IGXH 2AEQH 2OXGA 1I9RH 1U2CA 5FOBB 5BRZE 3MODH 4Y4HD 2BK8A 1B4RA 3ES6A 3ZYJA 1Y0LB 3D6GA 1XF1A 3RWFB 3SCMD 4KUCF 1PSKL 3ZYZA 3V0VB 4Y16B 4L8SB 3QWOB 4G6AC 4QRPB 1AIFB 1H3VA 3KXFD 4WVRA 2ITDB 1SY6L 2R0LH 3S36L 3WEXB 1EMTL 3C6LD 4P46B 4XPGH 4Y19D 4R96B 3FRUA 1TVDA 2HKFH 2ZOLA 1UM4H 1JHLL 5CGYC 3DXAB 1QG3A 1CLYL 2OSLA 1NFDB 4Y1AA 3PJSA 3U1SL 1SEBA 2XN9A 2VLKB 1NFIB 4PRIA 4OD1H 5E9DD 4L5FH 1DBML 1MCQA 1MJJB 1PKQA 3MRJB 1T1WA 1G7IB 1GRWA 1NSNH 5FGCE 3EOAA 4HUXB 4QKXB 3RY6A 2ZG3A 3ALPA 1ZT7B 4P5MB 3GMQB 4N9OB 3EUUA 3CDFA 3LEYH 2C4FT 3BN9D 3QUXC 1KTLB 2NW3B 4Y2DD 5F21B 3QUMA 3SQBA 4N5UA 3I9GH 4HEME 1H15B 1W2KT 5FO7A 5J1SC 3MRCB 1TVHB 2BVQB 3BDBA 4HK0B 5HHQB 4L1DA 1ZGLP 2D0FA 1KPRB 3QO0A 4FXGA 2PCPB 3WNNA 1CU4H 3QDHA 5E94B 5IF0A 1PDKA 3OXRA 4JO3L 1YY9D 2P8MB 3B9EA 5EORL 5GSVA 3KG5A 4WTXA 4L4JA 4XC1H 3QDMA 5FYJD 5TE4H 2EDQA 1DQDL 1BVLB 2VTFA 2BY2A 4U6YB 4NQCB 4KROB 1MH5A 4ZTOL 3BQUC 3QIBA 2AKRA 1K4DA 1QR1A 4FZEH 3I3BA 4FMKA 5F7EL 1S9VB 3AC0A 2CDEA 2YXFA 4K9EC 4M1CC 5DTFA 2A6DA 1AC6A 1A6PA 3VFTB 5TQ2H 2JJWA 2FD6H 3IDUA 1RHFA 2R2EA 5ADPH 3D69B 3OR6B 3V0WH 5IESL 3O4LD 3UTQA 1N5YH 4KVNL 3HR5A 3IFPB 5BRZD 1WC7B 4U3XA 1UH3A 4LCUB 2A1WH 2HVKB 2AI0L 4ZD3H 4JO1H 4Z7OE 3H7LA 1IAIM 5C0DA 5C0NC 1A1OA 4PB0L 1WFUA 1XGPB 2ATKB 4KTEH 2EEBA 5IB4A 3VRJB 4S1SH 1HXMA 3VRIB 3H7BA 4X7SH 1I3GL 4AG4L 1YECH 3X3GH 3O6MH 1QUNA 4MNGA 2HN7A 1AHWC 1D5IH 1FV1B 3CC5B 4YHML 4O51A 1NCUA 4LPWA 3ULUC 3QIUC 4S1DC 2BNRB 5AWNH 3TCXA 4LSQL 4QXTB 3L7FA 5J11C 4OGXH 5IHUH 5T5FH 1AO7D 2NY6B 1CFQB 1F4WL 4H8WH 1QSEA 4KMLB 3SE3A 3C5SA 4LHJB 3L6FA 5DYOB 5IKCB 4M1DL 5LKNA 2OL3L 1UXSA 2QHRH 4UTAL 3CVHB 4ONOA 1NDGB 4HWUA 4PJAE 3HE7D 4L3CA 4XNZB 1XGTA 1OSZA 2ZUXA 4LEXL 3U2SB 2VLME 1KIUA 1TITA 4NNPL 4PB9H 4KTDL 3DRQA 5HHOB 4YK4C 2VJXA 4F9PA 2FSEB 1IAII 1UJTA 2B2XL 2OK0H 1B6UA 3FFDA 1A0QL 3GJEA 4TUJB 5JDSA 3Q1SH 4KGLA 4HIEA 1OP3H 4DK6A 5E24E 4R0LB 1S8DA 4YFLF 5KS9B 1QFOA 3MOBH 5B39A 2FLBT 3AROA 4MJID 1LO2H 2UYLA 3D3VA 2Z93A 1MCWW 2KUTA 1F58L 3QUMH 1MY5A 1BX2A 2H26B 1U8PA 1KN4L 4G8EA 4M4RA 3QUZD 4C83A 5BMFL 4Z7UA 2GJJA 4IRZH 3RHWK 3K1DA 3QQ3B 2RBLA 4HBCH 2H2SC 3O2WL 4KRPD 4YH6A 3RHWF 4BUHA 4K7FA 5FFLA 5AYQA 4JQXC 4QHLB 3CDCA 4HUWB 2FJGB 1WK0A 4B7LA 2AK4B 2Z0BA 4LAJH 5KSUA 1FNFA 1K3IA 4FFZL 5CZVH 3WLWD 4ONGL 1FNSL 1HI6B 1NAKL 3ZKQD 2EYRA 5DRNB 2F5AL 1L0QA 4Z7WE 1SYSA 4Y4FC 1AE6L 2BC4B 5IB2A 1F02I 4H20H 4H0IA 4NQDD 1LK2B 5D5ME 5BV7H 3QI9C 2IFFL 1X5GA 2YS4A 2I07A 4XPFL 5DS8A 1SM3H 5T5NF 3G08A 1C16A 2VC2H 4YHIA 5E2UL 4ZAKA 4Z7VA 2BVUA 3O0RH 4Z7UF 3UJJL 2F19H 3T2OA 4NZTL 3ZKXC 4DOHE 5BQ7A 2YPKB 2Z31C 1VFUA 2Z4QA 3NCJH 5EO9B 4RQQA 4CDGC 1J8KA 1NCWL 1P53A 1CIUA 5FGSA 1H3UA 3JV4B 1QLFA 1JWMA 1MFEH 1KJMA 4NQEA 2ZUQB 4EKXA 3IJHB 1FRGH 5D9SB 5DMGC 1FFOA 2E6PA 5HGDA 5B8CC 3T0XA 5ID1B 3MFGB 3MV8E 3TA3A 1N0XH 3GMPA 3CSGA 3PQYE 3U9UA 3CZJA 2Y72A 3ECBA 4OCWL 1PD6A 4G80A 2LQRA 2X9WA 1ORQB 1MWAA 1WTGT 4IMLA 3RX8A 3UTZB 3SKOA 2VLMD 4ZFZB 3FT4A 4GO6B 4PJCE 1MPAH 5C0FB 1UKQA 3FN0L 3MROB 3C5JB 5TDPA 4U1NB 3TN0B 3LRSA 4YDJA 3KPQB 1GIGL 3NCYS 4Z7NF 3SKUD 3IETB 4XNYL 3LN4B 5LG1A 4NWTL 4YX2L 3DOSA 4KMTL 1DBKH 5CEZH 3BUYA 4AYFA 1CVRA 3BHBA 5JXAL 4TVSa 2F54E 1L7TL 5SX4I 1A6WH 4DTGL 2IFGA 4U31A 2OQJB 4PRNB 4MQTB 4XMPH 2OXHA 2GQHA 5DMIL 1IQDB 5IEKB 5A1AA 3F7QA 3O3EA 4GOSA 2BOCB 4UT6L 5DT1L 3LKPB 1OOAA 3BPOB 2A73A 4NM4L 1FZJA 4U1LA 1VGEL 4X6CB 1F6AB 3IGAB 1O7VA 4FOMA 5K9OB 3R06B 1LDSA 1JWUB 2X1QA 3V4UH 5EU3B 4PV9B 4ELKA 3MJ9A 3JBG7 3G5XB 5I15L 3H0TB 5KSBF 5JPMA 1WCBB 1VFAA 4J3SA 4DVBA 3UPRA 4JPIA 4ISVB 3BZEB 1WZ1L 2E9WA 4P9HC 4IRJD 1HIML 4WU5A 4NFDA 1X5HA 4KUZH 1JPSL 1OGAA 4MHHI 25C8H 4PJ5B 3PGDA 3WIFB 5E6ID 3MR9B 3T08A 4HS8L 4HLZH 2X05A 4KDTA 3QG7L 3QXWA 4JREC 1EHLH 3NPZB 4NOFA 3MLRL 4EOWL 1NKRA 4HIIB 2F5BH 2EIZA 3O8XD 3UBXI 4POUB 2HP4A 5DHYB 2YN5A 1A3RH 1T1YB 4I77H 2X4UA 1WEJH 3V4PH 3P73B 3S5LG 5CSGA 5AZEH 3QFJB 4M43H 4Z7QE 1QBBA 3V5KA 2K9UA 5IOPB 4ZPVB 3SDAA 5DD0H 2V5SA 2FH6A 4YBLB 1U8LB 2KQNA 2YR3A 4FRWA 3MV8D 3HMXA 3GM0A 3DUSA 1WFNA 4NP4L 3HRZB 3SO3C 5FM5O 3O3AA 4NM8L 4XHJC 4L4TD 1MFAL 1IM9A 3RVVC 2R0KH 1MHHA 4JR9L 3STZA 2DM7A 5D71H 3PQYD 3V6FA 3SDYL 1C1EH 4JFEA 2XQYK 3DBXB 3SDXE 5T3XL 1CG9B 2LU7A 2F53B 4BA8A 4OFPA 4WU7B 1MNUL 4P2OC 4ZUVA 4P48A 2VL4A 4X8JB 5JIIA 5ISZD 1B0RA 1D6EB 4YXKL 4YHKH 2GUOB 4EDXB 4CW1B 1KCVH 4JCMA 3JTTB 1LO0H 1A6VL 2PNDA 5DSCB 1LDPH 2EEAA 1CLCA 4MNQA 3QDGD 2NZ9D 1TJGH 4QRPE 5C0AB 4FA8A 2JCCF 2VZOA 5CJQL 4PTTB 1YEDB 3EFFA 4OLZL 3K4AA 3UPCA 1MWAH 1J12A 2N7AA 3D0LB 5AD0A 2C9AA 3NABL 1DQLH 1K6QH 1BWMA 3DXAE 2UUDK 3VH8G 1NFDE 5B4MC 1HSBB 2VLKE 1BJMA 2IQ9H 1NGYA 4J1UA 1NGXA 2PW1A 1BQHA 1KPUB 3BYYA 3VGGA 3V7AG 4XWGH 4KQ3H 4R9HA 2MOVA 4PLKD 3LV3B 3BMVA 5FUOL 4BKLB 4KDWA 1MVFA 3KPRB 1BVZA 1FZOB 1EFXA 1J1XL 3MLVH 5HGAB 2BHZA 3RGVD 3HI6L 3WXWH 3BAEL 3PWUA 3QDJA 5EC2A 3T04D 2CLVB 5HDQL 1FZKA 2AJXL 2OCFD 3R0NA 1UCTA 1JBJA 3P9WB 3TWCH 3L3DB 5D2NA 3CH1A 3ULSB 5JHDA 2CDGB 3E3QC 1PX3A 1X44A 2FR4A 3INUH 3GSXB 3HC4L 4MNHA 3LAFA 4WUKL 3MRQB 1A7RH 2GAZA 4TPRH 1AY1H 4N0YH 2OJZL 3QIWD 3MBXH 5I0DA 3GIZL 3CCHA 4WUUE 2A9ML 3RZCA 4ZNCD 4PUBL 1UVQA 4HUMB 1P4IL 3MJ9H 5F7DB 1NGPH 4A2LA 5DD3H 5GGSB 1CE6B 1ODAA 1EPFA 3EGSA 2NCMA 5IVXB 3CMOL 3QUXA 4P23D 3BRFA 4MDJA 1YQVL 3MRDB 2N56A 2DQGH 4LLWA 3IVKB 1RUKL 4AEEA 3QSKB 4YHNB 1DBJL 1IEBB 4NQCE 4PIRF 3O4OC 3IFOA 1X5XA 3MV7E 3P4NB 1MLCA 4YQXL 5ITFB 3QZWB 3HN3A 3RP1A 2IALA 5J13C 3EYFB 1CLOH 1NLBH 2D7TH 5IMKA 3IRZA 3SGEI 4L3EB 5I30H 3VXNB 4HKZB 4I4WB 3VJ6B 3EIFA 4XHQA 3ZKMC 1L9NA 2M8XA 3BPLB 3UDWC 3SDDB 1ROWA 3STLB 1CTNA 4V2CB 3GSQB 4RMSA 4U1GC 1W0WA 3OAZH 5C3LD 2CRMA 3UO1H 1VHPA 3U7YH 4KK6D 3HMXH 5CAYB 5DGRA 1H3PH 1A1MA 2BNQB 4BFIA 3AAZA 3VXOA 3MRHB 5J56B 3FB5B 2UUDH 4YBQC 4PJ8D 2ICWJ 1CGWA 1U3ZA 1CDJA 1IAKA 4P46D 5ALBH 4EI6A 4Q6IA 1HSAA 2ESVA 4HV8B 5C0CB 3WS3B 4CN6A 4YHYC 3B9DA 1WTLA 3T0BA 4U49A 1XIWD 5F89B 1IC7H 1DDHB 2J4WL 3MRLB 3B6SA 4HC1A 4MJ4A 1REIA 1A64A 4QOKA 4XAKD 35C8L 2GK0B 1FFNA 3SKMB 2GT9A 3WL9A 5L2KA 4DKDC 1C12B 4BH7B 2GFBB 3ULVH 4HS3A 4MGXA 1FG2B 1ORSB 5IEHB 5FV1L 1VA9A 3Q48A 3KYKL 1OLZA 4OZIA 3ETBF 2R8SH 2J5LC 1XR9B 5HHOE 4JZOA 1AHWA 4HZAA 1E0OB 1FL5A 4YHOL 5JR1H 1XGYH 3MZTA 5H35B 5LAXA 1KIRB 1JPST 3EOTH 4NUJB 3IJSB 5M94B 1NLDL 1K4CA 4MS8C 4OF0A 2YSSB 3CFJB 1AR2A 1OM3L 1QVOB 5KS9E 4MMZC 1E4XL 4RGOH 2CR3A 5FF6A 1RJYA 1KIPA 4MQXD 5JMOC 3FAXA 3RI5K 2J88H 4GAJL 3G5ZB 2BCKB 3QISA 3CDYA 3QHTC 5F9JA 1I3UA 1OSPH 4L8BB 3RI5F 2V7HB 1AQDA 3RAJL 3VGEA 4OLWL 5IBTH 3O2VH 5CCKL 3BUTA 2CD0A 4KROD 1D5MA 3GMLA 3NH7L 4FFWC 1RY7B 4UQ3A 4NKIL 1UQSA 3W81A 2QQLL 3GMMA 4MD0A 4GAGH 4MA8L 4JN1L 1A4JA 4YDIH 3RTQC 3ES6B 3VI3F 5MERB 3VFOA 4YNYB 3MFFB 4QRTA 1BQLH 1NBVL 3KS0J 1A6ZA 1JFQH 3QEGH 43C9A 3WFEH 2ICCA 1YYML 1YNLH 1OTSD 2C3WA 4YHLH 3KPPA 5FYLL 1JN6B 5EOTA 5GGQH 1DVFD 2ZOLB 3DSNA 3RIAK 2BSRA 4Z95H 5GGVY 1HNFA 1RURL 2OSLB 4LARL 4R2GD 3RIAF 3VG9C 2FBJH 3BMWA 1SEBB 2GY5A 2XN9B 4MZ2A 4W4OC 5AAWA 4PRIB 3UPAA 3H6JA 1I3RA 1PKQB 1T1WB 5CWSA 3QWRA 5SWZA 3D39A 4I2XE 4Y4FA 3EFDL 2R15A 4KKAD 1CCZA 3BSZH 2GJ6A 2IGFL 3O3BB 2D9QB 1IMHC 5ID0A 4LNRA 3OWEA 3VFWA 2BNRD 2VXTL 1RZIB 5E7FA 2MQ3A 2NY7H 1HH6B 2NY6D 3UEZA 4N9GA 4K9EH 2ZSWA 2WWKO 1CE1L 3QUMB 4HXBL 4MXWH 1T0NB 5I1GL 2Z31A 3RJDA 4ENEC 2DMBA 1OTUD 4HKBA 5D7SL 5MENA 4S11A 4WCYH 2O26U 3QO0B 3F58H 4KJPD 3D9AH 3U7WL 2NTFA 3FQWA 4YEEA 4YWGH 5B8CA 3T1FA 4FXGB 5C3TA 4O4YL 2MCPL 5HPMB 5AYUH 1TZHA 5GSVB 3SE9H 1INDH 4G8GA 2GCYA 4U1MA 3QDMB 3ESUF 3TM6A 1MAKA 5DJYA 5E8PB 5A2JH 5BV7B 3FN3A 5HHMB 2NY3C 3G5YA 1KGCE 3LRGA 3QIBB 2YD3A 3GSNA 1K4DB 1QR1B 3LEVH 3U7AA 3SQOL 5E08H 4HFUH 1D5XA 2A6DB 3AMKA 4LOUD 5DFVD 4F7TB 4WDIA 5D2LA 4X6CE 3V5DB 3WUZA 5JNYA 3UXFA 3UTQB 2XWTA 4K2UL 1Y6NR 4XWOC 2AK4D 5KVDL 1QO3A 3S96B 1H3GA 3OKKA 3VMOA 4DZ8A 5C0DB 3TBWA 3RJQB 5JW4Q 3QH3B 1OHQA 2D3VA 4QWWD 5IB4B 5FYKE 1HXMB 3VD5A 1KJ2A 3H7BB 1NMAL 2EH7L 4PJ5E 3A6CL 2VQ1A 4XX1E 2E27L 2VDMH 1KELH 4QRRA 4P2RD 4LCYB 4MNGB 2HN7B 3H2WA 5IFAL 1OAQL 1CGYA 5EBGA 3D0VA 4NN7C 5TF0A 5DGQA 3ARED 2B8OT 2YKLH 5JW4N 5K93A 1S9XA 3TVMA 5CFHA 5EU6B 1A6TA 3L7FB 4ZFOA 1BGXH 4OF3A 4UV7L 5I8OH 5L0QC 4QF1A 3VFSA 3QFJE 1FVDB 2A6IB 5DD6A 2GEEA 2BP3A 2VZ1A 4MWFB 5JW4M 3L6FB 2Q6WB 3UAJD 4F3FA 4U6HA 4FP8H 2YPVH 1JE6A 4C4KT 1UXSB 1FAKT 5GGUA 1OVZA 3WFHA 1H8NA 1OSZB 1TPXC 2D7PA 2DIJA 4QRQA 2J8HA 3QO1B 3K46A 4NYLA 5FCUL 3O6FB 1FH5H 1QSFE 5E2WH 3GMOB 3QHFL 2NXYC 1ND0A 4CJ0A 1P9MC 2C3HA 2F53E 1L6ZA 2HT4D 3FFDB 5I1HH 2UWEE 5L6YH 1LE5A 4RA3A 4OKVA 3GJEB 5C0JA 5DUPL 1RVFL 4HIEB 5IB5B 5BS0A 4JJHA 1S8DB 5EOCJ 1ES0A 1I7RB 4YGVB 5HHXL 4PRBA 3TN0D 4TVPH 4NO0A 2UYLB 1G7LB 1MSPA 1CFVH 3D3VB 2Z93B 1CICB 4N5EC 3ZE1E 3TH4T 1U8PB 2ZKHH 4G8EB 4JRXE 4FZ8L 5JXED 4KKCD 4C83B 4I5BA 2VZ3A 3KWWA 2DLTA 4PJ7F 3H9SA 5ESAB 3PHQA 3QEHA 3DARA 4G42A 4QHKJ 4P2OA 4JG1L 3MMEA 5F7KC 4BH8A 5IFJA 2FJFB 3PWJA 5E1AA 5KSUB 3OAUL 2MQCA 2BRRL 4XI5D 2EDKA 2VDQH 3L5WA 3NFSL 5HI4D 2X4TA 3FMGL 3F6IA 4FQPA 2DQJH 4PD4K 1CL7L 4IS6A 1HINL 4HIXH 5C9JA 1RJZA 5D7JD 1T7YA 5E0QA 3GSNH 3IDYC 5IVOA 2GHWB 5DS8B 4G9FE 3G08B 1C16B 4YHIB 4Z7VB 1IVLA 4PR5A 3WHE1 5BQ7B 1EXUA 1NQBA 2P24A 5IMLA 4RQQB 2JE8A 2YOCA 3ARDC 5CHNA 4HJ0C 4K8RL 1FGNH 1QLFB 1JWMB 4GS7B 5E5UB 1A3QA 1KJMB 4NQEB 1MLBB 3T4AB 4APQA 3QFDB 4G6JL 5E6YA 1KCSH 2JJUA 5IVXE 1NEZG 1FFOB 4FQ2H 4NOBA 2VDKL 4NO5A 1JGVL 5K9JL 1WJ3A 1HZHL 4RMVA 4DN3H 1EZVY 3TA3B 3LB6D 3ARTA 1X6NA 4KQ4H 3H9HA 3GMPB 2AV7A 1KJ2H 5M7QA 1SJVA 3FQUA 1DTUA 3QFJD 3U9UB 4XGZA 3U4EB 2FGZA 3ECBB 3DVNB 4G80B 4GKSA 1MWAB 1Q8MA 2DLFL 4N8CL 4IMLB 5HJ3A 4LSSH 4Z0XA 2WQRA 4KPHH 5DJ8A 3REVB 2DTML 4ZO6A 3SKOB 4D8PB 2YD1A 1OD7A 2CR6A 3FT4B 3MLYL 4GBXB 4ZNEE 4PLJD 1W72L 2B20A 2DTSA 4OZFG 3DVGA 1MFCH 5C08B 1N26A 2YK1H 2QADC 5TDPB 1DLFH 3P77B 2DQFB 3OKMA 4YDJB 1MCJA 1KN2L 2VH5H 4P9HH 2Q7YB 4E0RA 4C56A 5DWUH 4LPVA 1HHIA 5A40E 4OQTA 1KCRH 1QRKA 3BUYB 3ZZ1A 1HHKA 1MFDH 3BHBB 4TULL 5IW1A 1RZKC 1X9QA 2BNQE 5F88A 5C0AD 2BZDA 4OFIA 1QFPA 5F97E 4E41A 2M26A 3ZE2F 4ODXB 2A0LD 2AJUL 4NO2A 3NTCH 5KBNC 4NQTA 4N8PA 3T0EB 4R26H 4OZHA 4Z0BH 1SJEA 4GW1A 2FX8H 3UDWA 2JELH 3ARWA 1R5VB 4OSUH 3B4NA 1I1CA 4U1LB 1NCBH 1BZQK 1BPVA 3U0WL 1YEHL 1Q72L 2C5DC 3FTGA 3EOYG 4FABH 4M5YL 1LP9A 3KLSA 5ILTH 1ZT1A 3JWOL 3ZMRA 2BVOA 5JPMB 1VFAB 1W0VA 2CIIB 1E28B 1OB1B 4U1JA 4HMEA 4JPIB 2Y4SA 4K55A 4JFFA 1SVCP 3KPRD 1EFQA 4WO4D 4WU5B 4K94C 1MRFL 4KKBD 3WO3B 4WW2C 2X2YA 4D9QE 4Y5YA 4OJFH 4M3JA 1OGAB 2V5MA 3OKDB 4RZCB 3PGDB 4GLRH 1MEXL 1TJHL 2ORBL 4NZRH 3MOAH 4OZHF 1PX4A 1U36A 1J8HD 3V5HA 3R4DA 1A7PL 3S3JA 5GS0D 1G6RL 2DBLH 4JHAH 5HVHB 1OT2A 1ZHLA 2EIZB 4XVUC 4L8CA 3Q3GA 1F6FB 1C5DA 4KKLC 4QLRA 1LP9F 2QHLA 1TFHA 4JDTL 2HH0H 3V5KB 3HC3H 4LSDA 3VXQB 3SDAB 1NPUA 3ARUA 3MNVA 1IGCH 4U7KA 5A2KH 5BW7C 1J5OL 3S98A 4QXGL 3DUSB 4DCQB 5TQ0H 4XNXH 1OLLA 1MHHB 4UILL 5CJOH 3CUPB 3STZB 3TO4C 1WAAE 3N9GL 1IKFH 1RUPH 5J8OA 3RVTC 4WFGD 4JZJC 4JFEB 2B1AL 2ZPKH 3RA7H 1TTGA 4O02L 2BRQA 5FHBH 5I73C 3PWPD 3KLHC 4LU5L 1BEYL 4ZUVB 5C07A 1MAJA 4L3ED 1KIQA 1WBXA 1LE9A 3E0GA 3KPSA 1NCDL 1A4KA 3OPZL 1UWEH 4MNQB 4OCLC 5HYSG 1JMZA 2CRIA 4WJ5A 3EFFB 2HVJA 4LSPL 3RRQA 1KULA 1J9CT 1EAJA 5A3IC 5AG8A 5AD0B 4CBPA 4MDIA 3PV6B 4NPYA 4GW5A 1F3DH 4JAMA 4TUKL 3RY5A 3K81A 2W9LA 4PRIE 4UU9A 1N4XH 1NGYB 1HCFX 4Q0XL 4NKOA 3EO0A 3TNNA 1PKQE 5C0CD 1JNJA 1B2WH 3S36H 1SY6H 1IBGH 4X0KB 1WUNT 4AMKL 1ZA3B 4LKCA 1CXHA 4OQTH 4XPBL 4HWBA 4UV4L 4HULB 1U8JA 2OL3A 1MFBL 1CXKA 1NBZB 2JK5A 3BRGC 3QDJB 4WTZG 5EC2B 4XX1G 4GQ9L 5GZOC 2X4QA 3AU1B 2CLZB 3QWQB 3ZTNH 3BKJL 4D3CH 3U1SH 2AEPL 4OM1L 5JHDB 2FR4B 1F2QA 4MNHB 1Q0XL 2CQVA 1U8OA 2GAZB 3RVWD 2P45B 4W4OA 4OD2A 3CCHB 5DD5L 1QSVA 2EXYD 1UVQB 5SWSB 3TCLB 1CD1A 5DMYA 3EGSB 4DEPC 4QHMB 4KWUA 4JHZA 1URLA 5C0IA 3G04B 3LKQA 4X6DF 3QUXB 1HKLH 2VUOA 4URTB 4MDJB 1U3HA 3VGAC 2AXFA 7FABL 1V8HA 4KUCD 4EQ2A 4ONFH 1KYOK 2FEDC 3LRHA 5HHME 4A6YL 4N0UA 1GYAA 4MXQD 3W9DA 3N85L 5J0BA 3NAAL 4P59H 1MLCB 3MLXL 4O5LL 4PGCB 2IALB 5HXMA 2DQCL 3HNTL 4ONHA 3FFCE 2XFXA 3NN8B 3B8SA 5FA4B 3RWEA 1W0WB 4X5WA 3QNZA 1M7IA 2E7CA 3HI1A 3F5WA 2H45A 4GAFB 1E4WL 3NIDF 5C8JA 2HLAB 5CEXB 3ILQD 5IJVB 3BQUB 2BX5A 3EJZD 3FRPA 1A1MB 4NRXA 3VXOB 3WFDH 1OL0A 1P7QA 3WKMH 1HYRC 1N0LA 4MNGE 4HCRA 4OLYL 4MB5A 2R29H 4U6XB 1HSAB 4Z5RA 2ESVB 5I17A 3UTTA 1QQDB 1I1AC 3BEVA 3TJHD 2AI0H 3FO1A 4YDKL 1AR1C 1UYWL 4WEUD 3MRGA 5CJ8A 3GZKA 4Y1AD 1RMFH 4P4RA 1JGUL 2W07A 4JO2L 3S97C 2YC1B 2XN9D 5EU6E 4PRID 5D1ZC 1FFNB 1IGYA 2XOTA 3WL9B 5L2KB 4LCCA 4J3TA 4AG4H 2Z92A 4ZTPL 2VQUA 3L9RB 1SJHA 5CEZE 4M6ML 1X5JA 2IBGA 2DQEL 4MXVF 4YHMH 2ZUYA 4OZIB 1GZQA 1FYTA 2QQNL 3VFRA 3GI9H 5E95B 2ICES 4BUGA 1LO3L 1VDGA 4N8VB 4X9BA 1WBYA 2EECA 1AHWB 2BSTA 4X7TA 1FSKC 5LVEA 3HI5H 2AABL 2XRAH 4BQBA 1ZLSL 4L29A 5EB9A 5LAXB 5CS7A 1F4WH 1KCUL 3I2CH 3QIUB 1K4CB 3TV3L 1F2XK 3CFEA 4HWBH 5J11B 1A9EA 5KANI 4JPKH 4M1DH 2OL3H 4UTAH 2I9LA 1KBGL 3TBVB 3S4SG 1AFVL 1MCPH 1YEGL 3PHOB 2ZCLL 3QZWG 4LIQL 4WHYH 2DIAA 3O41A 1OAZL 1ZHNA 3QDMD 1B0WA 4AIZA 1I8LA 3WIIL 1Q9OA 4YK4B 4NCDA 5F96H 1P9MA 3LKOB 1AC0A 3W11D 2MJWA 3GMLB 2X7LB 3V7MA 4UQ3B 1A5FL 3GMMB 4MD0B 4ZOCA 2O5YL 2I27N 1A4JB 2P4AB 2GTWA 1KF9B 1ZV5A