1H3ZA

Solution structure of a pwwp domain from schizosaccharomyces pombe
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
b'SERVNYKPGMRVLTKMSGFPWWPSMVVTESKMTSVARKSKPKRAGTFYPVIFFPNKEYLWTGSDSLTPLTSEAISQFLEKPKPKTASLIKAYKMAQSTPDLDSLSVPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYPOTHETICAL 62.8 KDA PROTEIN C215.07C
publication title Structural Variation in Pwwp Domains
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Nuclear protein
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1h3zA00
3DB3A 4GY5A 2EQMA 3DLMA 3S3MA 2RHUA 3H6ZA 3M9QA 4BE1A 2K3XA 2O4XB 3ASKA 2R57A 1SSFA 4II1A 3PNWC 4E7IA 3OYKA 5J26A 2WACA 3H8ZA 5CIUA 3OQ5A 1XNIA 2LCCA 1WJSA 3E9FA 2R58A 5C6SA 3KUFA 4CRIA 3OYFA 3BDLA 3OYMA 2XDPA 4B9WA 1WJQA 3OS1A 3FEOA 1RI0A 2RJFA 3NTKA 4A4FA 3S3NA 3MEWA 3L2QA 4FL6A 2EFIA 4C5EA 2GFUA 2XK0A 4PLIA 2O4XA 3O8VA 3OYAA 2L8DA 2RHYA 4IUUA 3LGFA 1OI1A 3OYIA 3Q1JA 3OYEA 2G3RA 2X4XA 3OMGA 2E6NA 4OVAA 3L2VA 3MP1A 2BKDN 2EQJA 3MO8A 4C5GA 3OYDA 2VYTA 4E7HA 2PQWA 2GFAA 4Q5WA 4BACA 1MHNA 3C4SA 2BIVA 4X34A 2E5QA 3L2RA 4N4GA 3SD4A 1OZ3A 3LX7A 3DB4A 3OB9A 4A4HA 3ZEHA 3P8DA 4IUVA 3L2WA 4BD3A 2LDMA 2RJDA 3NTHA 4E7LA 4QQDA 4Z02A 5C0MA 3ME9A 1N27A 3OYCA 3MP6A 3PFSA 4PL6A 3MEAA 4E7KA 3OMCA 3PMTA 4QW2A 2RO0A 4A4EA 3E9GA 3OYNA 2GF7A 2MWOA 4UC4A 2X35A 4HCZA 3S6WA 4NS5A 3OYGA 2M16A 5KE3A 2BUDA 4FU6A 2EKOA 2R5AA 2RI2A 2R5MA 4IUPA 5FROA 3OYHA 1OZ2A 3QIIA 4PLLA 2MWPA 2YRVA 3LH0A 5IAYA 3LLRA 1H3ZA 4IUTA 2HQEA 2X4WA 2FHDA 4IURA 3OYJA 3OS0A 2IG0A 4IUQA 4QQ6A 3GOXA 2LVMA 2RHZA 2RHXA 5KH6A 2DIQA 3EAEA 5M9OA 2L3RA 4BDZA 2D9TA 4N4HA 4QQGA 4ZTJA 2QQRA 2QQSA 3CEYA 3OY9A 3FC3A 3LYIA 5D6WA 3L42A 4EDUA 2NLUA 2JTFA 3UWNA 4E7JA 3F70A 5KE2A 4IKFA 4LD6A 4A4GA 2JZ2A 3MP8A 5FRMA 4N4IA 3FDRA 2RI3A 5KCHA 4L59A 3QJ6A 3OYLA 2RI5A 3QBYA 5IN1A 3S3OA 3UT1A 2X4YA 2DAQA 3MEUA 3FLGA 4BE0A 1G5VA 2EQUA 2RHIA 3OS2A 2F5KA 2P0KA 2RJCA 4BDYA 3OYBA 1OYXA 2HQXA 2LRQA 2RJEA 5D6YA 3P8HA 2B8AA 2L89A 2LTOA 4QVZA 2CKKA 4RG2A 5KCOA 3MEVA 2K3YA 5FRNA 1WGSA 4B9XA 2M1HA 2DIGA 2EQKA 3QKJA 3PMIA 4BE2A 3OA6A 1KHCA 2M0OA 3LGLA 5J39A 3META 4C5IA 4ZTFA 4C5HA 5D6XA 3L2UA 1WJRA 3NTIA
chains in the Genus database with same CATH superfamily
2GQVA 4MZPA 4RTTA 1VQ5T 3INZA 5KYWA 5GAN7 3CPFA 3EGXB 4KUIA 5GAN2 1SSFA 1KD1U 3V8JA 2PU9B 2LCCA 3VS1A 1LPLA 4AG2C 1NEGA 1I5OB 3QPHA 5LJ3j 1ZSZB 2LX9A 3HFNA 4X9DA 2XK0A 4FIBA 3O8VA 2JM9A 1QCNA 3SFMA 1K9MC 3LWHA 2X4XA 2K2VA 2DRKA 4TVRA 2VUBA 3OYDA 3HKSA 3RDVA 1Q86R 4BACA 1MHNA 5GAMg 4GLKA 5IT9E 4ZGEB 4E7LA 3PGGA 1N27A 3A8MB 4M78B 2DVJA 4X1VA 4E7KA 3EFRA 4DOVA 3I5RA 1EZZB 2LQWA 4Y91A 3OYYA 4J7FA 1U06A 1KHIA 1W70A 2FPFA 3LH0A 4J6WA 2ATCB 4KULA 4M75E 1QQJA 3QYHB 4RTUA 3G4SA 1QKXA 2RHZA 2KYMA 1IHWA 2ZAEA 2O88A 2QQSA 4PJMA 4C0DC 2YWWA 3G1JA 3G6EQ 3UWNA 1N9RA 4K11A 1K73U 4A53A 2DD5A 1TU0B 4PJOG 1YFNA 2CP5A 3MJXA 3FB9A 5D6YA 3URGA 3EG9B 3QWYA 2K3YA 4C92G 1YITA 2QQ9A 5IHNA 3CPWS 4N0AC 3PMIA 2ZZDA 3SWNA 4EMGA 2VGMA 4BB7A 1GCQC 2GNCA 1D3BB 4LUEA 2OTLQ 2EQMA 1K4US 2K6DA 4BE1A 2OI3A 1YJWQ 1X6GA 1R0CB 3VRZA 3M0TA 4E7IA 1TXQA 3M56A 1WJSA 3T9NA 5A0LA 1VQ4T 4B9WA 3A8OB 3OSVA 1MGQA 3A5ZB 5GANj 2HSPA 1YP5A 1VIFA 4RCBA 5LJ3d 2F1LA 1VQ9A 1M2OA 4XK8E 3CBPA 1VQ9T 3RIRA 1G3SA 2HBWA 1YIJQ 1QCFA 2FL7A 4PFOA 4KGVB 1Y57A 4F7UB 1KQSP 3V7RA 2XDDA 1UGVA 1N9SA 3LX7A 3DB4A 3QDRB 2JS2A 2K7AA 4J5YA 3JCMQ 4JZ3A 2NYSA 1YWOA 2K4YA 4DBQA 2KEAA 2RD1A 3M59A 1MMAA 4J9HA 3CCEQ 4A4KA 1SKUB 5LJ3g 2Y4XA 2BTTA 4M75G 3H9NA 1AVZC 4ME7A 3M0QA 1YHQA 1D0XA 3NMZC 2HZYA 2VGNA 4DBRA 1KFZA 1O75A 4IIOA 1NYFA 4OMNA 4E7ZA 4M77C 3BFMA 3EH2A 4LD6A 3GNGA 3GLXA 5GAN5 2K5FA 4M7AF 1S1NA 3LH5A 1I07A 4C0ZA 2HD0A 4M7AB 3SDZA 1QW1A 2KK4A 3AT1B 2YRDA 5FLXE 5CKFA 1UGPB 5GAOm 2LNVA 3CC2Q 2DILA 1WQ7A 1GRIA 3X20B 2KVQG 2EYXA 1ZSGA 1GCPA 2F2XA 1K8AU 1ABQA 4AT1B 4KT0E 3CD6Q 1D0ZA 5J26A 1X2QA 3I55A 2DRMA 4CRIA 1Q7YR 1WHHA 2HBPA 1WIEA 4F14A 2NWMA 4RTVA 2DZCA 3VUBA 3LGFA 1M3CA 1YJ9Q 1B7TA 3ULRB 3MP1A 1WNLA 2BKDN 4LUDA 1D1AA 3JCMP 3GPLA 2PQWA 4RG8A 4LDYA 5GANg 4M7DC 2ZPHB 1CKAA 1KQSA 4KGZB 1YI2T 4A4EA 1AD5A 2PVGB 2DXTA 1GL5A 3QO3A 5KE3A 3ER0A 5FROA 5A0DA 2DPPB 1OZ2A 5GAOq 4AMCA 5CQYA 1K0XA 3CCMT 3JCMX 5GAMe 1GFCA 5CK9A 2CREA 5M9OA 1Q86C 2CZ7B 4OP0A 2ROLA 4J9IA 1T3SA 4XTVA 4N0AA 1B34A 2QDLA 1GCQA 2XHCA 2J05A 1VYTA 5GMKi 2EJFA 5KYNA 3WVDB 2FYKA 2KRNA 3NHNA 1BBZA 2FZGB 1M8MA 1AWJA 4AG1C 5D6XA 4M78E 3CMET 4OB1B 4XQ3A 2YLBA 2MYSA 3DLMA 4DA4A 3JB9G 2OTLA 3J80E 3ASKA 3TSWA 4ZN1A 2JVVA 3RR6A 2DM1A 1YJWA 3QXEB 4C8QC 3OYMA 3VS2A 3PIOA 3OS5A 5EG2A 2FB7A 3S3NA 4FYXB 2EW3A 3L1AA 2M0YA 1EX4A 1VQOQ 1KD1R 3CCRQ 3OYEA 2QA4T 2O01E 1B07A 2QGGA 2DA9A 3DKMA 2JUFA 4ELZC 1BCOA 2EQJA 1S72Q 1YIJA 4N4GA 4LD9K 1OZ3A 1ABOA 3OB9A 1VQ5Q 2X4JA 3E9GA 2RMOA 4HCZA 1VQNT 1VYUA 4LNPA 5FU7C 1VQ6Q 4XU3A 5FWBA 2EKOA 3I5SA 1BB9A 4M77A 1TUDA 1AZGB 1FWZA 2AKLA 2DE0X 1M8VA 5GAMf 2A08A 2CUDA 4OF1A 3RBBB 2K57A 2LQ8A 2AKKA 2CZ6B 1VQ8T 1QVGP 3LW5E 5LJ3e 1PD1A 1SG5A 4EDUA 2DL8A 2Y90A 2JTFA 1W2BP 1QCOA 2BE9B 4HVWA 1OU9A 1ZUUA 1VQLT 4M7DG 2X4YA 1PRLC 1NPPA 3OS2A 2FRYA 2CH4A 4CC4B 2MIOA 2J06A 1PKTA 3P8HA 4PFPA 1Z9QA 2RQTA 4WF2A 1TUCA 3GF5A 3MEVA 2ED0A 4M78G 3JB9J 2CS7A 1AT1B 4NOYA 2F69A 4F7UE 3CMAQ 2W0ZA 5CKDA 2RH2A 1K73R 4A63B 2QEXQ 3GIBA 5HK0A 2HSEB 3CCQQ 3NGPA 4JRKA 3TU4K 2L0AA 1VYVA 3UATA 4JDSA 3OYKA 2OX7A 1WDXA 5GAMh 3ZBDA 4DOWA 4C0GA 1BIBA 2RQRA 1M2VA 3OS1A 1UGSB 3QG1A 1UECA 1K9AA 3L2QA 2HKQB 1XQHA 1Q7YU 3A8HB 4DBHA 5CR2A 4RCCA 4M7DA 1OI1A 3CCVQ 3EFOB 4KBMB 1N8RU 2E6NA 1TWBA 4BY6B 3CCLA 4R0KA 1YJ9A 1X2KA 4RTZA 4ATOA 3CCLT 3TQ7P 2YSQA 2QTVA 2OTJT 4M7AE 4IUVA 2MPXC 3I56Q 5LJ5j 4J9FA 2NUPB 3R6OA 1M90U 2KAFA 4UC4A 1Q82U 1G8XA 4JJCA 1RAGB 2R5MA 3CCST 2RN8A 2JJ9A 5CAIA 5ECAA 1NZ9A 3PTAA 3GOXA 1M9SA 5KH6A 3CCUQ 1PRMC 5GANe 5LJ3f 3FC3A 2FEIA 4FW1A 1WHJA 3BE3A 2LZ6B 4V2SA 1U5SA 1QVGA 2DYBA 5FRMA 3FRNA 3RKYA 2HEQA 2RI3A 3A98A 4LDWA 2P4TA 4XU0A 2RI5A 4C92C 4M77D 2NUTB 4F7UG 1CSKA 4BDYA 1W2BA 1RACB 2VV5A 1X6OA 1ACMB 2K3BA 1WGSA 3CC4A 4IIMA 4MMKA 1JXOA 3OW2P 4C8QA 2LP5A 3LGLA 2CGHA 4DBFA 1KC8C 2NUZA 2DNUA 4M77F 5KYUB 2RHUA 2O4XB 3X24B 2MI6A 4HCKA 5I2MA 3OQ5A 3CC7Q 1WXBA 2R58A 5IHIA 1T0HA 2CP7A 3G7ZA 1M3BA 2A3LA 4J8OA 5FU6B 4LDXA 1K8AR 2KY9A 5LJ3h 1ZLMA 3PIPA 1QWEA 1TSFA 2RHYA 3JCMd 2EBPA 1XOVA 3CCRA 3C95A 2VYTA 3RESA 2PVDB 4J9EA 2AK5A 2E5QA 4JZ4A 1VQPQ 2E3HA 4M75C 1M5Q1 3NTHA 3NPFA 2M51A 1TG0A 5LJ5d 8ATCB 1VQKA 2GF7A 1VQKT 3OYHA 3V8KA 2EYQA 3PT9A 1M1KU 3MPUB 1VQ6A 1UEBA 4M7DD 1U1TA 5GJWB 3V7SA 1AEYA 5GAOn 1X6BA 4FW2A 2VB6A 3RMSA 1NLPC 5GAN8 5GANf 3RNJA 4QQGA 1IGQA 4HT8A 4FYWB 4ZGDB 2ABLA 4M7DF 2RK1A 3FDRA 1FMVA 3BDUA 1TOVA 1C0MA 3GNFB 5GAOr 3QZ5B 3VV0A 2HQXA 2LRQA 1YI2Q 2LTOA 4FCYA 1VQ7Q 2HMAA 3G4ST 4PJLA 3VS3A 1XTDA 3CCMQ 3CMAA 1N6AA 2HAXA 4C5IA 1IRXA 3UPUA 3GBQA 3V8LA 1LCKA 3VRYA 3OW2A 2JT4A 4AFQC 3JCMW 3SEMA 1O9SA 1WI7A 1KQSS 5C6SA 1MV0B 4ELYC 1UJ0A 2P4RA 1WJQA 4EMKC 1A0NB 5GANh 4BI8B 2JTMA 1YITT 2GFUA 5GMKm 2IIMA 1PCXA 3CXCA 1PD0A 2F2WA 4C8QD 4J6YA 3KXTA 2L8DA 1H92A 1K73C 3G71A 2V8IA 4JJDA 3X26B 1BU1A 4O5VA 4OVAA 3L2VA 3G71T 4WCIA 3MO8A 2K79A 1Q81U 4JRQA 1D09B 2BIVA 2DYIA 3L2WA 1OOTA 4BY6C 1M1GA 4C8QF 3I56A 2CH4W 3OYNA 2IPOB 3H41A 2EQIA 2L3QA 5J3BA 3FIFA 1VQMA 4PJOA 4KH0B 3QIIA 4JLGA 2DXBA 4AFSC 1VQMT 1MUZA 1H3ZA 4DEYA 4IURA 1QMCA 1IXDA 4FT4A 1Y96B 3REBB 1YJNQ 4C92A 2DIQA 2RQVA 4XU1A 2RF0A 5IHKA 3CCUA 4ZTJA 2KXDA 3JV3A 4OMMA 3HL8A 1MNDA 2KT8A 2JZ2A 2BE7D 3BW1A 2DZ9A 2K2MA 4JS4A 1RL2A 5KYWB 2PUKB 1QVPA 2AT1B 1RAHB 1YHQT 1JJ2P 1GBRA 3A1PA 1X01A 4OMOA 2EWNA 5IH2A 4D6WA 1RI9A 2I2LA 2XD0A 3M9QA 1VQ8Q 3HRUA 4O6JA 3MCAB 5GMKj 3VKIA 2FO0A 3H8ZA 4B6MA 1U3OA 1FMKA 3BDLA 3CC7A 3TSZA 3MEWA 2G6FX 3OBYA 4RTYA 4M75A 2AIRB 4ZGJB 1QP2A 3RUXA 2G3RA 3JCMc 4E6RA 1RAAB 2DLPA 5CKHA 2EVRA 3V7CA 3EG2A 2DKGA 4Q5WA 3P8DA 2LDMA 3M4GA 3I55T 1LVKA 3BY7A 1KK7A 2LT1A 1WX6A 2KGTA 2O31A 1R8OB 2MWOA 1N8RR 2LCLA 2M16A 2DBMA 5FW9A 1I81A 4FYVB 2V1QA 1VOMA 3HTRA 2IVWA 1HYOA 4RTXA 1WXTA 1K8AC 3VYGA 2D1XA 2DK3A 1ZSZC 2HQEA 5D7UA 4CC3A 1WPYA 2DL3A 4IUQA 2CSQA 3VYHB 2CT3A 1MV3A 2VXEA 4Z89A 2XG8D 1YCYA 1M90R 1G3TA 4HVVA 1Q82R 3LYIA 2YXYA 5D6WA 4J9BA 3U23A 2X51A 2NLUA 1H3HA 4R56A 2YUOA 3M0RA 1UHCA 3SWNB 1UGQB 2LC4A 1K0SA 5IN1A 2KDSA 4M78C 4PJOD 2KXCA 3D7SB 3THKA 3M54A 2HL5C 4LN2A 1OYXA 2RQWA 1UTIA 5HY6A 5KCOA 1NPRA 3HP9A 1AWWA 4C92D 1HJDA 2MMPA 1YNZA 3OSSC 4BE2A 2J7IA 2QI2A 3EHQA 1JJ2A 1KQ1A 4EMKA 2C0TA 3EGDA 2W10A 1I1JA 4PJOF 1JXMA 1PKSA 1AOJA 3QDFA 5EC7A 3G6EA 2EYZA 1PG5B 4ZN3A 2ZPFB 1FXXA 6AT1B 4C92F 2E5KA 1XNIA 2LNHB 3E9FA 2F5TX 5KYYA 2L3SA 5CO7A 4XTXA 1ARKA 5DY9A 1IB8A 2V1RA 1J3TA 4CC7A 1VIEA 2E1HA 2QASA 2I0NA 2QYZA 2LT4A 3Q1JA 3VUZA 4JLIA 2WSFE 1SSHA 4ZNXA 4BI3A 1WQWA 2OTLT 2PTKA 1NE8A 3E1SA 1YJWT 3VS7A 3VS4A 1QVGS 3WXMB 3PFSA 3MEAA 2LQNA 1W2BS 1V1CA 4M75D 5FWCA 1I0CA 1T3LA 1U1SA 2X4WA 3ZFJA 3FJPA 5CCAA 4M4ZA 2OAUA 3CCJQ 3EAEA 1YIJT 1YN8A 1IO6A 3JCMb 3M0UA 2QQAA 5HKCA 2DL7A 2DEUA 4M75F 1M1KR 1I5LA 3CCEA 2C06A 2D0QB 3MP8A 3CCET 4PNOA 2P84A 2E6ZA 1QP3A 5IXBA 3HHTB 1X75C 5GMKl 5A0GA 4E47A 5FRNA 3QJYA 1FYNA 2M1HA 2DIGA 1JBMA 4EPCA 1QVFP 4FM4B 4X9CA 1QLYA 2XICA 4FYYB 4JS5A 1PSEA 3DB3A 4RKUE 5KYXA 4OB2B 1PHTA 1SHFA 4FT2A 2VKNA 2QG9B 2XI9A 2RQUA 1M30A 3OYFA 2XDPA 3FEOA 1ZA1B 3HRSA 1I4K1 4D8KA 4M7AC 3CC2A 3EGXA 3JAME 3CC2T 5L23A 2YDLA 3VS5A 1KSWA 3OMGA 4C0DB 1NYGA 4XTWA 4E7HA 2CP2A 1ZSZA 1WHMA 3CD6A 1FX7A 1OU8A 3M0SA 2OAWA 3EG0A 1V29B 2DX1A 2MOXA 4XAXB 2RI2A 3OBWA 4PFZA 1Q81R 5IAYA 2PNIA 4IUTA 3VU3C 2EYYA 1B34B 2WSEE 1YWPA 3PE0A 3GP8A 1DJ7B 2LVMA 4M78A 2V8JA 1YJ9T 1NLOC 2VC8A 2GCXA 2FZKB 2XMFA 3OW2S 4D8DA 1Q7YC 2C0IA 5CKBA 1WHGA 4N4IA 5HK3A 2EAYA 2X9HA 2GGRA 4LDUA 3M5AA 1VQ4Q 2EJGA 2DAQA 3FLGA 4BI4A 3C0CA 2RJCA 1C6VX 2B8AA 3CXCS 1BI1A 2BZYA 4AFUC 1VQ9Q 2A36A 2KE9A 3OA6A 1M90C 1Q82C 3NTIA 3A8LB 3JB9D 1OPKA 4OMPA 1QVFA 3EG9A 1UGRB 1ZBXA 2WACA 5CIUA 2KQWA 3KUFA 1TH7A 2QGFB 2COZA 1ZA2B 3C12A 2EIFA 3A8GB 2CUBA 4XU2A 1D3BA 2GTOA 3CC4T 2EFIA 3RKXA 2KRMA 1E6GA 3QZ9B 3JB9F 1KC8U 3OYAA 2CT4A 4OMLA 2AHJB 1GXIE 2YUQA 2MK5A 1Y0MA 1QKWA 4M77B 1P92A 2EKHA 3TEEA 3SHWA 1NJIU 4LDVA 4A4HA 5IXFA 4JRPA 3ZEHA 1SPKA 2DTHA 3CXCP 1MMNA 3M4YA 2DO3A 3H0FA 1G83A 2KROA 3H0IA 4OGCA 2QK0A 1KQ2A 4PLLA 1X43A 4F7UA 2YRVA 1R77A 1VQOA 4M7AG 2AZSA 5GMKe 2FPDA 3OYJA 2CP3A 1VQOT 3CCRT 3QSUA 1RAFB 2LJ3A 4MDWA 1S72A 4PJOE 2D9TA 1AZEA 3CCJA 4OB0B 2MCNA 2CZ1B 1VQ5A 3CBMA 1G3WA 1T0JA 4XTUA 4QVCA 2XDBA 2E10A 1K9MU 2CSIA 4L59A 4J6XA 3JCMg 3QBYA 3I55Q 3MEUA 1G5VA 1G2BA 2RNAA 1D1CA 3J7AF 1KD1C 2EPDA 1X27A 5GAMd 1VQ6T 2RJEA 1ZHIA 2SEMA 2L89A 3P8BB 4RMOA 2CKKA 4RG2A 4DEXA 2MAMA 4M78D 2A0FB 2ED1A 2JS0A 2PUOB 1D0YA 1M2VB 5LJ5g 1AHJB 2YHTA 5J39A 1MMGA 4J9DA 2C0OA 2YUNA 4L6V5 4KGXB 1N5ZA 4M7AA 3S3MA 1M1KC 2GBQA 2K3XA 1SF9A 2JTEA 1ZUYA 4M7DB 4E7SA 2ZPIB 2JMCA 4M78F 1H8KA 2V26A 1ZQ1A 1RI0A 1W6XA 4MDXA 5CKEA 2J6FA 2A28A 2M9UA 1WLPB 4CI0C 3CMAT 4JJBA 4A54A 2RPNA 4L5GA 2QEXA 4JJNK 3KBGA 3MKDA 2LX7A 4QVDA 3CCQA 3M58A 2KT1A 2ZPGB 2QEXT 1UG1A 3CCQT 2L3PA 1BIAA 3FJ5A 1K1ZA 1WYXA 2P0PA 4XTYA 4PJJA 1RLPC 2DVEA 4CC2A 4FSSA 2ROTA 4PKCC 3LLRA 1Y71A 3CCVA 4JPBW 4EMHA 4QQ6A 1JJ2S 3CCVT 2K9GA 4ANJA 2YRCA 1PWTA 3NFCA 1M1FA 1BYMA 3CMEQ 2COYA 4OGEA 5GAN6 2DEQA 1R0BG 4J7IA 2OJ2A 4NL3A 2L5QA 3F70A 1TUGB 3I56T 4A4GA 4C8QB 2H3JA 3RERA 3HRTA 1RAIB 1Y07A 3REAB 2F5KA 2SRCA 1VQ4A 1Q81C 1UUEA 1VUBA 4HT9A 1V76A 4B9XA 3EG1A 2QQBA 3QKJA 3WVEB 2QA4Q 1M4ZA 3CCUT 3I9QA 4HCCA 2E64A 1JB0E 2XKOC 4GY5A 2HNIA 4F16A 4F7UF 2FVUA 2R57A 2HKNA 2KRSA 4HKEA 3PNWC 1M27C 5GMKh 2P0QA 5FU7B 1JO8A 1VQNQ 4EIKA 3CPWP 1MMDA 4C5EA 3M0PA 1CKBA 1SRLA 1BKBA 1D1BA 2DXCA 1IZ6A 5GAN4 4FSXA 3JCMV 2JW4A 2CDTA 4VUBA 4M7AD 1G3YA 4C5GA 2D0NA 1E7OA 2ZCFB 3TCJA 2K5LA 5I11A 1UHFA 2FPEA 4KRTA 3EHRA 4QT7A 2RJDA 4QQDA 3I35A 1QWFA 1VQLQ 4PL6A 3CC7T 3PMTA 1PSFA 2FZCB 1OX8A 4DQ2A 3S6WA 2X35A 4R55A 5I22A 4BUGA 2H8HA 1X69A 3JRZA 2MWPA 2ZPEB 1C1AA 5FU6C 2ZPBB 3CQTA 1GFDA 4JRIA 1YBYA 3TVTA 2RHXA 1HXDA 2Y4YA 1BCMA 3QUIA 5CVIA 2DBKA 1OQKA 2VVKA 4F04B 2QQRA 2EGEA 5DM7R 2BZ8A 1VQPA 5A2QE 2VASA 1U8RA 2M02A 1F1BB 2XIDA 1VQPT 4E7JA 5KE2A 3HPWA 3QJ6A 2JMAA 2KSSA 2DTOA 1KG1A 1WXUA 4Z88A 1KIKA 3OYBA 3UA6A 2O9SA 1JQQA 4LXCA 4QVZA 2J6OA 4M77E 1GBQA 1NBEB 5GANd 2JOYA 2EYWA 1HSQA 3E19A 2EGCA 2YT6A 3JCMe 1AWOA 2D8HA 3CCLQ 3H6ZA 1RADB 2OTJQ 3R6NA 1H641 2E4HA 1B3QA 2JXBA 1NM7A 3QWXX 1AWXA 1WHKA 4Y92A 1TTHB 2CZ0B 5DLOA 1YI2A 1Q86U 2RJFA 2CYZB 4A4FA 3CCSQ 5LJ5e 3M53A 2XU8A 3RMQA 1VQ7A 2DXUA 5GJVB 1VQ7T 2GTJA 3VS6A 2O9VA 3CCMA 1LJOA 3CPWA 1RAEB 2J6KA 2HQHA 5GAOp 4LE9A 4PJOB 3G6ET 3EH1A 3L2RA 2RK2A 1K76A 4JUVA 3L2ZA 3JB9I 1KC8R 4C92B 4QW2A 2BZXA 2RO0A 3EFOA 2E3IA 3OYGA 4KUDK 4NS5A 2BUDA 4IUPA 1SEMA 1NJIR 4HXJA 3HSBA 4PJNA 2VWFA 1ZBJA 1NEBA 3CC4Q 3OS0A 2IG0A 2NUPA 2WSCE 4J9GA 3C94A 4M7DE 4MMLA 1OPLA 3SB2A 1JRIA 2RM4A 1RABB 1RUWA 2HDAA 2CP6A 3CEYA 1TS9A 3M57A 5HCKA 3CMEA 1QVFS 3L42A 1WHLA 5GAN3 4IKFA 2QXFA 3IQLA 5AT1B 4MZTA 4WTOB 1UJYA 1W1FA 2DERA 2ESWA 7AT1B 2DJQA 4HA8A 4M77G 2EQUA 5AYFA 1WZOA 8AT1B 1YJNA 1Z9ZA 3QHSA 3O5ZA 3UF4A 1YJNT 1MNEA 2FG0A 4YTLA 2M0OA 4OMQA 1LOJA 2GQIA 2LMJA 2B86A 1K9MR 4ZTFA 2QA4A 2ENMA 4RTWA 4Z02A 3JCMf 2NUTA 2K5IA 2YLCA 4M75B 2ZGWA 1BK2A 1E6HA 2LJ0A 4II1A 1OULA 1UDLA 2FRWA 3EFSA 2CP0A 1XJWB 2A37A 2Z0WA 1VQKQ 2DJZA 3NTKA 5LJ5f 1YCSB 2D6FA 1VQNA 4C0FA 1W4SA 3UDCA 3N5BB 4MZMA 5KYUA 4GLMA 2O4XA 1FMWA 2A7YA 1M3AA 3AHUA 3M55A 2DL4A 4C8QE 1VQ8A 2GFAA 3PVQA 2KR3A 2E41A 4ESRA 4BD3A 3OYCA 2KMTA 3EG3A 2YUPA 3OMCA 3HFOA 4Y28E 1VQLA 2X3WD 2ECZA 4PK4A 2E12A 1I8FA 3JCMh 2DF6A 1Q95G 2KBTA 3G4SQ 3JSCA 2LQKA 3JCMJ 4HVUA 3E2UA 1BI0A 2L3RA 2VXFA 1RLQC 1PC0A 3CBOA 2QAZA 4N4HA 3CD6T 2RB6A 5LJ5h 2E65A 3KFVA 1NG2A 2LJ1A 5CQXA 4EMKB 4F17A 5KCHA 3EGDB 4RUGA 3UT1A 4BE0A 2RHIA 1UE9A 1YITQ 2JM8A 4J83A 4J9CA 3EGUA 2COWA 2EQKA 1JEGA 3ZL7C 1KHCA 1EFNA 3H0HA 3G71Q 3META 4AFZC 4C5HA 1HD3A 5KYYB 3L2UA 1SRMA 3PVLA 5LL6S 2DL5A 1OV3A 1WFWA 2PVOB 2EJ9A 2DETA 1N8RC 4OMFB 2DTIA 5GAMj 2OTJA 2E70A 2KI7A 1JU5C 2H3EB 5L8RE 5I2SA 3SWNC 1OEBA 2HL3A 2MF2A 2V8KA 4Z8AA 4FL6A 1UFFA 3MHXA 1UB4A 3QYGB 1VQMQ 2RA2A 4PLIA 5DLQE 3CCSA 2L2PA 2KYBA 4C8QG 9ATCB 3X28B 4IUUA 2KNBB 3OYIA 1IREB 1PNJA 4GBQA 5GAOl 2DMOA 1IHVA 3C4SA 4X34A 4NL2A 3SD4A 2DFUA 1BI3A 1WA7A 5C0MA 3ME9A 2QDYB 3MP6A 2F2VA 4PJOC 2O2OA 3VS0A 3X25B 2DD4A 2JN0A 4FU6A 3DLLA 2R5AA 1KJWA 1YHQQ 1OX9A 2EGAA 3JB9H 2AZVA 2FHDA 3LWIA 1ZUKA 1ZX6A 4QKUA 1PM3A 5I21A 4BDZA 1Y7XA 4HCBA 1LNXA 2D8JA 3J81E 3OY9A 2X3XD 4OB3B 1IGUA 4E2FB 1EIFA 4P5NA 3RKWA 1SHGA 2LCSA 1Y96A 4KH1B 3OYLA 3S3OA 1VA7A 1HK9A 5KYXB 4XTZA 2P0KA 1NJIC 3TREA 3VJPA 4ORZA 2HCKA 1BI2A 2JNGA 3UA7A 1S72T 3CCJT 2QTXA 2PZ1A 4C92E 1WJRA
chains in the Genus database with same CATH topology
2GQVA 2XKOC 2HNIA 4GY5A 4JRKA 4PJOF 4MZPA 3TU4K 1VQ5T 3INZA 4F7UF 3G6EA 5GAN7 2FVUA 3CPFA 2R57A 4KUIA 5GAN2 4HKEA 1SSFA 4ZN3A 1KD1U 4JDSA 3V8JA 2ZPFB 2PU9B 1FXXA 3PNWC 3OYKA 5GMKh 4C92F 1XNIA 2LCCA 2P0QA 3E9FA 3ZBDA 5GAMh 4DOWA 5FU7B 2F5TX 4C0GA 1BIBA 3OS1A 1UGSB 3QG1A 3QPHA 3L2QA 5LJ3j 1XQHA 5CO7A 2LX9A 3HFNA 4X9DA 4XTXA 5DY9A 4C5EA 2XK0A 1Q7YU 3A8HB 5CR2A 1BKBA 4FIBA 3O8VA 1VIEA 2E1HA 4RCCA 4M7DA 1OI1A 2LT4A 3Q1JA 2DXCA 1IZ6A 4JLIA 3SFMA 3VUZA 2WSFE 4FSXA 5GAN4 4KBMB 3JCMV 3LWHA 1K9MC 1N8RU 2X4XA 2K2VA 4VUBA 4M7AD 1G3YA 2E6NA 4TVRA 4BY6B 4C5GA 3CCLA 2VUBA 4BI3A 3HKSA 1WQWA 3OYDA 1YJ9A 2OTLT 4BACA 4ATOA 1MHNA 5GAMg 2ZCFB 1NE8A 4GLKA 3TCJA 3CCLT 2K5LA 2OTJT 3E1SA 5IT9E 4M7AE 1YJWT 4IUVA 4ZGEB 2RJDA 4E7LA 5LJ5j 4QQDA 1QVGS 4M7DF 3WXMB 3PGGA 1N27A 3A8MB 4M78B 3PFSA 3R6OA 4PL6A 3CC7T 3MEAA 4E7KA 3PMTA 1PSFA 4DQ2A 3EFRA 1M90U 2KAFA 4UC4A 3S6WA 2X35A 4DOVA 4R55A 1W2BS 1Q82U 4BUGA 4Y91A 3OYYA 4M75D 3CCST 2R5MA 4J7FA 3JRZA 5CAIA 1KHIA 2MWPA 2ZPEB 3LH0A 5FU6C 1U1SA 1NZ9A 2X4WA 2ZPBB 4J6WA 3ZFJA 3PTAA 3FJPA 4KULA 4JRIA 4M75E 1YBYA 3QYHB 5CCAA 3GOXA 1M9SA 2OAUA 2RHZA 2RHXA 5KH6A 1HXDA 3G4SA 3EAEA 2Y4YA 1YIJT 3QUIA 5CVIA 3JCMb 2QQAA 5GANe 2QQRA 5LJ3f 2QQSA 5HKCA 3FC3A 5DM7R 1VQPA 4C0DC 5A2QE 4M75F 1U8RA 2XIDA 1VQPT 3UWNA 4E7JA 1I5LA 1N9RA 4V2SA 5KE2A 3CCEA 1QVGA 2C06A 2D0QB 3MP8A 1K73U 4A53A 5FRMA 2DD5A 3FRNA 3HPWA 3RKYA 2RI3A 4LDWA 2P4TA 3QJ6A 2KSSA 2RI5A 4PNOA 4XU0A 2DTOA 4PJOG 4C92C 1KG1A 4M77D 2E6ZA 4F7UG 4BDYA 1W2BA 3FB9A 3OYBA 5D6YA 1QP3A 3HHTB 1X75C 2VV5A 1X6OA 4QVZA 3URGA 5GMKl 5A0GA 4E47A 2K3YA 4M77E 4C92G 1WGSA 1YITA 3CC4A 2QQ9A 5FRNA 3QJYA 4MMKA 5GANd 2JOYA 2DIGA 2M1HA 4N0AC 3CPWS 3PMIA 1JBMA 2ZZDA 3SWNA 4C8QA 3LGLA 4EPCA 4EMGA 4FM4B 3E19A 4X9CA 2VGMA 2XICA 2CGHA 4BB7A 1KC8C 1D3BB 4JS5A 1PSEA 3DB3A 2EQMA 4M77F 4RKUE 3JCMe 4OB2B 2RHUA 3H6ZA 4BE1A 2O4XB 1H641 3X24B 2MI6A 4FT2A 4E7IA 5I2MA 3M56A 3OQ5A 2XI9A 1WJSA 2R58A 3T9NA 3OYFA 5A0LA 1VQ4T 2CZ0B 2XDPA 3A8OB 3OSVA 4B9WA 1MGQA 3A5ZB 3FEOA 3G7ZA 2RJFA 5DLOA 5GANj 2CYZB 4A4FA 1YI2A 1Q86U 3HRSA 1I4K1 5LJ5e 3CCET 5FU6B 2A3LA 4J8OA 3M53A 2XU8A 1VIFA 3RMQA 1VQ7A 2DXUA 4RCBA 4M7AC 4LDXA 5LJ3d 2KY9A 5LJ3h 1VQ9A 3CC2A 4XK8E 1VQ7T 3JAME 3PIPA 3CBPA 3CCMA 2RHYA 1VQ9T 3CC2T 3RIRA 1LJOA 3JCMd 3CPWA 1G3SA 1XOVA 3OMGA 3CCRA 2FL7A 5GAOp 4C0DB 4PJOB 3C95A 2VYTA 4XTWA 3G6ET 4E7HA 3RESA 4F7UB 2PVDB 3V7RA 2RK2A 2XDDA 2E5QA 3L2RA 1N9SA 3LX7A 3DB4A 3QDRB 4J5YA 4JUVA 3JCMQ 3L2ZA 1FX7A 3JB9I 3CD6A 4M75C 2K4YA 1M5Q1 3NTHA 2RD1A 4C92B 3M59A 5LJ5d 4A4KA 4QW2A 1VQKA 2RO0A 5LJ3g 2GF7A 1V29B 2Y4XA 3OYGA 4KUDK 4NS5A 4XAXB 1VQKT 4M75G 2BUDA 3V8KA 3OYHA 2RI2A 4IUPA 2EYQA 3PT9A 3OBWA 1M1KU 1VQ6A 1UEBA 4M7DD 3HSBA 1U1TA 4ME7A 5IAYA 3V7SA 4IUTA 1YHQA 3VU3C 1B34B 2WSEE 5GAOn 3OS0A 2IG0A 3GP8A 3JB9J 1DJ7B 2LVMA 2WSCE 2VGNA 4M78A 3C94A 3RMSA 4MMLA 3SB2A 2V8JA 5GAN8 1O75A 1JRIA 1YJ9T 2RM4A 5GANf 4QQGA 2VC8A 4HT8A 2GCXA 3CEYA 3OW2S 3M57A 4M77C 3CMEA 1Q7YC 3L42A 1QVFS 4ZGDB 3BFMA 5GAN3 5CKBA 4LD6A 2QXFA 2RK1A 3GLXA 3GNGA 5GAN5 2K5FA 4IKFA 4MZTA 4N4IA 5HK3A 4M7AF 2EAYA 3FDRA 4LDUA 3M5AA 4M77G 2EJGA 4HA8A 3BDUA 2DAQA 3FLGA 4C0ZA 2EQUA 2HD0A 3GNFB 4M7AB 3SDZA 4BI4A 5GAOr 2RJCA 3QZ5B 1QW1A 2KK4A 3VV0A 2HQXA 2LRQA 5AYFA 2B8AA 2LTOA 3CXCS 5FLXE 1BI1A 5CKFA 1YJNA 1UGPB 3QHSA 3G4ST 5GAOm 2LNVA 1XTDA 1YJNT 1WQ7A 3OA6A 4YTLA 3CMAA 2M0OA 1N6AA 1LOJA 1M90C 2HAXA 4ZTFA 4C5IA 3X20B 2QA4A 1Q82C 3UPUA 2KVQG 3JCMf 3NTIA 3A8LB 4Z02A 2K5IA 2YLCA 3JB9D 4M75B 3V8LA 1K8AU 3OW2A 3JCMW 1QVFA 2ZGWA 4KT0E 4M7DE 1O9SA 4II1A 1UGRB 1ZBXA 5J26A 2WACA 5CIUA 3EFSA 1KQSS 2KQWA 3I55A 5C6SA 4ELYC 3KUFA 4CRIA 1TH7A 3C12A 1WJQA 2EIFA 4EMKC 2DJZA 2HBPA 3NTKA 5LJ5f 3A8GB 4XU2A 2D6FA 1VQNA 4C0FA 1D3BA 5GANh 1W4SA 4BI8B 2EFIA 2JTMA 2GFUA 3N5BB 3RKXA 3UDCA 5GMKm 3CC4T 1YITT 4MZMA 3QZ9B 3JB9F 3CXCA 1KC8U 2O4XA 4C8QD 2DZCA 3OYAA 4J6YA 3KXTA 2L8DA 3VUBA 3LGFA 1K73C 2A7YA 2AHJB 1GXIE 3G71A 2V8IA 3AHUA 3X26B 3M55A 4O5VA 4OVAA 3MP1A 1WNLA 2BKDN 3MO8A 3L2VA 4C8QE 4M77B 3G71T 3JCMP 1P92A 1VQ8A 3TEEA 3GPLA 2PQWA 2GFAA 4RG8A 1Q81U 1NJIU 4JRQA 2BIVA 4LDVA 2E41A 4A4HA 4JRPA 3ZEHA 3L2WA 2DTHA 4LDYA 4BD3A 3OYCA 2KMTA 4BY6C 1M1GA 5GANg 4M7DC 3M4YA 2ZPHB 4C8QF 3OMCA 3I56A 1KQSA 2DO3A 1YI2T 3HFOA 4A4EA 4Y28E 3OYNA 1VQLA 2PVGB 2DXTA 3QO3A 5KE3A 1VQMA 3ER0A 3FIFA 4OGCA 5J3BA 5FROA 5A0DA 1KQ2A 2DPPB 1OZ2A 2E12A 3QIIA 4PLLA 5GAOq 4JLGA 1I8FA 2DXBA 3JCMh 4F7UA 2YRVA 1VQMT 1VQOA 5CQYA 3CCMT 4M7AG 1H3ZA 4IURA 5GMKe 3JSCA 2LQKA 5GAMe 3JCMX 3OYJA 4FT4A 3JCMJ 1Y96B 1VQOT 3CCRT 4C92A 3QSUA 5CK9A 2DIQA 4MDWA 1BI0A 2L3RA 2VXFA 5M9OA 1S72A 4PJOE 4XU1A 2D9TA 3CBOA 3CCJA 1Q86C 4N4HA 4OB0B 3CCUA 4ZTJA 2CZ7B 4OP0A 3CD6T 2RB6A 2CZ1B 5LJ5h 3HL8A 1VQ5A 3CBMA 4XTVA 1G3WA 4N0AA 2E65A 2JZ2A 4XTUA 1B34A 5CQXA 2E10A 4QVCA 2XDBA 4EMKB 1K9MU 5KCHA 4L59A 4J6XA 3JCMg 3QBYA 3UT1A 3BW1A 2XHCA 3MEUA 4BE0A 1G5VA 2DZ9A 2RHIA 3J7AF 4JS4A 1KD1C 1RL2A 5GMKi 5GAMd 2PUKB 1QVPA 2RJEA 1ZHIA 2EJFA 1VQ6T 2L89A 4J83A 2FYKA 3P8BB 3WVDB 4RMOA 1YHQT 2CKKA 4RG2A 2MAMA 4M78D 2EQKA 2PUOB 1X01A 1KHCA 5LJ5g 1AHJB 2EWNA 2YHTA 5J39A 4D6WA 3META 4C5HA 5D6XA 4M78E 4L6V5 3L2UA 3CMET 2I2LA 4OB1B 5LL6S 2XD0A 4XQ3A 4M7AA 2YLBA 3DLMA 4DA4A 3S3MA 3JB9G 2PVOB 3M9QA 2EJ9A 3HRUA 4O6JA 1M1KC 2K3XA 2OTLA 3J80E 3ASKA 1N8RC 3MCAB 4OMFB 2JVVA 2DTIA 4ZN1A 5GMKj 4M7DB 5GAMj 2OTJA 2ZPIB 2E70A 1YJWA 3VKIA 3H8ZA 4M78F 3QXEB 5L8RE 1ZQ1A 5I2SA 3BDLA 3SWNC 4C8QC 3OYMA 3CC7A 1RI0A 2MF2A 3PIOA 3OS5A 2V8KA 5EG2A 4MDXA 2FB7A 3S3NA 3MEWA 3MHXA 4FL6A 1UB4A 5CKEA 2M9UA 3QYGB 3OBYA 2RA2A 3L1AA 4M75A 4PLIA 5DLQE 3CCSA 4C8QG 4ZGJB 4CI0C 3X28B 1QP2A 3CMAT 4IUUA 3RUXA 3OYIA 1IREB 3OYEA 2QA4T 4A54A 2G3RA 4L5GA 3JCMc 2QEXA 2O01E 4JJNK 3KBGA 3DKMA 3CCQA 2JUFA 4ELZC 2EQJA 2ZPGB 3M58A 4QVDA 5GAOl 2QEXT 1YIJA 5CKHA 3V7CA 2DKGA 4Q5WA 3CCQT 3C4SA 4X34A 4NL2A 4N4GA 3SD4A 4LD9K 1OZ3A 3OB9A 1BI3A 1BIAA 3P8DA 2LDMA 3M4GA 3I55T 5C0MA 3ME9A 3BY7A 2QDYB 3MP6A 2P0PA 4PJOC 4XTYA 2LT1A 2X4JA 3X25B 2DD4A 3E9GA 1R8OB 2MWOA 2JN0A 4HCZA 1VQNT 2LCLA 5FU7C 2M16A 1I81A 2DVEA 4FU6A 2EKOA 2R5AA 4XU3A 2IVWA 4M77A 3DLLA 4PKCC 1K8AC 3VYGA 3JB9H 2DK3A 1FWZA 3LLRA 1M8VA 2HQEA 5GAMf 2FHDA 1Y71A 3LWIA 3CCVA 4EMHA 1WPYA 4OF1A 2K57A 4IUQA 2LQ8A 4QQ6A 1JJ2S 3CCVT 3VYHB 5I21A 2CZ6B 4BDZA 1VQ8T 2VXEA 2XG8D 3NFCA 1Y7XA 1YCYA 1M1FA 4HCBA 1G3TA 1BYMA 4OGEA 1LNXA 5GAN6 3J81E 3LW5E 2DEQA 3OY9A 3LYIA 5LJ3e 4J7IA 5D6WA 4OB3B 4EDUA 1EIFA 4NL3A 2Y90A 2NLUA 2JTFA 2L5QA 4P5NA 3F70A 4R56A 3I56T 3RKWA 4A4GA 3SWNB 2H3JA 1UGQB 4C8QB 2LC4A 1VQLT 1Y96A 3OYLA 5IN1A 2KDSA 4M78C 3S3OA 3RERA 2X4YA 4M7DG 4PJOD 3HRTA 1NPPA 1HK9A 3OS2A 1Y07A 2F5KA 3M54A 2P0KA 4XTZA 1VQ4A 1OYXA 1Q81C 1NJIC 3TREA 3P8HA 5HY6A 3VJPA 1VUBA 4WF2A 5KCOA 4HT9A 3GF5A 3MEVA 1NPRA 3HP9A 1BI2A 4M78G 2CS7A 2JNGA 4NOYA 2F69A 4B9XA 4C92D 2MMPA 4F7UE 2QQBA 3QKJA 3OSSC 1S72T 3WVEB 4PJOA 5CKDA 4BE2A 2RH2A 3CCJT 2QI2A 1JJ2A 1M4ZA 3CCUT 1KQ1A 4EMKA 2QTXA 4C92E 4HCCA 1WJRA 2E64A 3GIBA 1JB0E 5HK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DB3 A;  4GY5 A;  2EQM A;  3DLM A;  3S3M A;  2RHU A;  3H6Z A;  3M9Q A;  4BE1 A;  2K3X A;  2O4X B;  3ASK A;  2R57 A;  1SSF A;  4II1 A;  3PNW C;  4E7I A;  3OYK A;  5J26 A;  2WAC A;  3H8Z A;  5CIU A;  3OQ5 A;  1XNI A;  2LCC A;  1WJS A;  3E9F A;  2R58 A;  5C6S A;  3KUF A;  4CRI A;  3OYF A;  3BDL A;  3OYM A;  2XDP A;  4B9W A;  1WJQ A;  3OS1 A;  3FEO A;  1RI0 A;  2RJF A;  3NTK A;  4A4F A;  3S3N A;  3MEW A;  3L2Q A;  4FL6 A;  2EFI A;  4C5E A;  2GFU A;  2XK0 A;  4PLI A;  2O4X A;  3O8V A;  3OYA A;  2L8D A;  2RHY A;  4IUU A;  3LGF A;  1OI1 A;  3OYI A;  3Q1J A;  3OYE A;  2G3R A;  2X4X A;  3OMG A;  2E6N A;  4OVA A;  3L2V A;  3MP1 A;  2BKD N;  2EQJ A;  3MO8 A;  4C5G A;  3OYD A;  2VYT A;  4E7H A;  2PQW A;  2GFA A;  4Q5W A;  4BAC A;  1MHN A;  3C4S A;  2BIV A;  4X34 A;  2E5Q A;  3L2R A;  4N4G A;  3SD4 A;  1OZ3 A;  3LX7 A;  3DB4 A;  3OB9 A;  4A4H A;  3ZEH A;  3P8D A;  4IUV A;  3L2W A;  4BD3 A;  2LDM A;  2RJD A;  3NTH A;  4E7L A;  4QQD A;  4Z02 A;  5C0M A;  3ME9 A;  1N27 A;  3OYC A;  3MP6 A;  3PFS A;  4PL6 A;  3MEA A;  4E7K A;  3OMC A;  3PMT A;  4QW2 A;  2RO0 A;  4A4E A;  3E9G A;  3OYN A;  2GF7 A;  2MWO A;  4UC4 A;  2X35 A;  4HCZ A;  3S6W A;  4NS5 A;  3OYG A;  2M16 A;  5KE3 A;  2BUD A;  4FU6 A;  2EKO A;  2R5A A;  2RI2 A;  2R5M A;  4IUP A;  5FRO A;  3OYH A;  1OZ2 A;  3QII A;  4PLL A;  2MWP A;  2YRV A;  3LH0 A;  5IAY A;  3LLR A;  1H3Z A;  4IUT A;  2HQE A;  2X4W A;  2FHD A;  4IUR A;  3OYJ A;  3OS0 A;  2IG0 A;  4IUQ A;  4QQ6 A;  3GOX A;  2LVM A;  2RHZ A;  2RHX A;  5KH6 A;  2DIQ A;  3EAE A;  5M9O A;  2L3R A;  4BDZ A;  2D9T A;  4N4H A;  4QQG A;  4ZTJ A;  2QQR A;  2QQS A;  3CEY A;  3OY9 A;  3FC3 A;  3LYI A;  5D6W A;  3L42 A;  4EDU A;  2NLU A;  2JTF A;  3UWN A;  4E7J A;  3F70 A;  5KE2 A;  4IKF A;  4LD6 A;  4A4G A;  2JZ2 A;  3MP8 A;  5FRM A;  4N4I A;  3FDR A;  2RI3 A;  5KCH A;  4L59 A;  3QJ6 A;  3OYL A;  2RI5 A;  3QBY A;  5IN1 A;  3S3O A;  3UT1 A;  2X4Y A;  2DAQ A;  3MEU A;  3FLG A;  4BE0 A;  1G5V A;  2EQU A;  2RHI A;  3OS2 A;  2F5K A;  2P0K A;  2RJC A;  4BDY A;  3OYB A;  1OYX A;  2HQX A;  2LRQ A;  2RJE A;  5D6Y A;  3P8H A;  2B8A A;  2L89 A;  2LTO A;  4QVZ A;  2CKK A;  4RG2 A;  5KCO A;  3MEV A;  2K3Y A;  5FRN A;  1WGS A;  4B9X A;  2M1H A;  2DIG A;  2EQK A;  3QKJ A;  3PMI A;  4BE2 A;  3OA6 A;  1KHC A;  2M0O A;  3LGL A;  5J39 A;  3MET A;  4C5I A;  4ZTF A;  4C5H A;  5D6X A;  3L2U A;  1WJR A;  3NTI A; 
#chains in the Genus database with same CATH topology
 2GQV A;  4MZP A;  4RTT A;  1VQ5 T;  3INZ A;  5KYW A;  5GAN 7;  3CPF A;  3EGX B;  4KUI A;  5GAN 2;  1SSF A;  1KD1 U;  3V8J A;  2PU9 B;  2LCC A;  3VS1 A;  1LPL A;  4AG2 C;  1NEG A;  1I5O B;  3QPH A;  5LJ3 j;  1ZSZ B;  2LX9 A;  3HFN A;  4X9D A;  2XK0 A;  4FIB A;  3O8V A;  2JM9 A;  1QCN A;  3SFM A;  1K9M C;  3LWH A;  2X4X A;  2K2V A;  2DRK A;  4TVR A;  2VUB A;  3OYD A;  3HKS A;  3RDV A;  1Q86 R;  4BAC A;  1MHN A;  5GAM g;  4GLK A;  5IT9 E;  4ZGE B;  4E7L A;  3PGG A;  1N27 A;  3A8M B;  4M78 B;  2DVJ A;  4X1V A;  4E7K A;  3EFR A;  4DOV A;  3I5R A;  1EZZ B;  2LQW A;  4Y91 A;  3OYY A;  4J7F A;  1U06 A;  1KHI A;  1W70 A;  2FPF A;  3LH0 A;  4J6W A;  2ATC B;  4KUL A;  4M75 E;  1QQJ A;  3QYH B;  4RTU A;  3G4S A;  1QKX A;  2RHZ A;  2KYM A;  1IHW A;  2ZAE A;  2O88 A;  2QQS A;  4PJM A;  4C0D C;  2YWW A;  3G1J A;  3G6E Q;  3UWN A;  1N9R A;  4K11 A;  1K73 U;  4A53 A;  2DD5 A;  1TU0 B;  4PJO G;  1YFN A;  2CP5 A;  3MJX A;  3FB9 A;  5D6Y A;  3URG A;  3EG9 B;  3QWY A;  2K3Y A;  4C92 G;  1YIT A;  2QQ9 A;  5IHN A;  3CPW S;  4N0A C;  3PMI A;  2ZZD A;  3SWN A;  4EMG A;  2VGM A;  4BB7 A;  1GCQ C;  2GNC A;  1D3B B;  4LUE A;  2OTL Q;  2EQM A;  1K4U S;  2K6D A;  4BE1 A;  2OI3 A;  1YJW Q;  1X6G A;  1R0C B;  3VRZ A;  3M0T A;  4E7I A;  1TXQ A;  3M56 A;  1WJS A;  3T9N A;  5A0L A;  1VQ4 T;  4B9W A;  3A8O B;  3OSV A;  1MGQ A;  3A5Z B;  5GAN j;  2HSP A;  1YP5 A;  1VIF A;  4RCB A;  5LJ3 d;  2F1L A;  1VQ9 A;  1M2O A;  4XK8 E;  3CBP A;  1VQ9 T;  3RIR A;  1G3S A;  2HBW A;  1YIJ Q;  1QCF A;  2FL7 A;  4PFO A;  4KGV B;  1Y57 A;  4F7U B;  1KQS P;  3V7R A;  2XDD A;  1UGV A;  1N9S A;  3LX7 A;  3DB4 A;  3QDR B;  2JS2 A;  2K7A A;  4J5Y A;  3JCM Q;  4JZ3 A;  2NYS A;  1YWO A;  2K4Y A;  4DBQ A;  2KEA A;  2RD1 A;  3M59 A;  1MMA A;  4J9H A;  3CCE Q;  4A4K A;  1SKU B;  5LJ3 g;  2Y4X A;  2BTT A;  4M75 G;  3H9N A;  1AVZ C;  4ME7 A;  3M0Q A;  1YHQ A;  1D0X A;  3NMZ C;  2HZY A;  2VGN A;  4DBR A;  1KFZ A;  1O75 A;  4IIO A;  1NYF A;  4OMN A;  4E7Z A;  4M77 C;  3BFM A;  3EH2 A;  4LD6 A;  3GNG A;  3GLX A;  5GAN 5;  2K5F A;  4M7A F;  1S1N A;  3LH5 A;  1I07 A;  4C0Z A;  2HD0 A;  4M7A B;  3SDZ A;  1QW1 A;  2KK4 A;  3AT1 B;  2YRD A;  5FLX E;  5CKF A;  1UGP B;  5GAO m;  2LNV A;  3CC2 Q;  2DIL A;  1WQ7 A;  1GRI A;  3X20 B;  2KVQ G;  2EYX A;  1ZSG A;  1GCP A;  2F2X A;  1K8A U;  1ABQ A;  4AT1 B;  4KT0 E;  3CD6 Q;  1D0Z A;  5J26 A;  1X2Q A;  3I55 A;  2DRM A;  4CRI A;  1Q7Y R;  1WHH A;  2HBP A;  1WIE A;  4F14 A;  2NWM A;  4RTV A;  2DZC A;  3VUB A;  3LGF A;  1M3C A;  1YJ9 Q;  1B7T A;  3ULR B;  3MP1 A;  1WNL A;  2BKD N;  4LUD A;  1D1A A;  3JCM P;  3GPL A;  2PQW A;  4RG8 A;  4LDY A;  5GAN g;  4M7D C;  2ZPH B;  1CKA A;  1KQS A;  4KGZ B;  1YI2 T;  4A4E A;  1AD5 A;  2PVG B;  2DXT A;  1GL5 A;  3QO3 A;  5KE3 A;  3ER0 A;  5FRO A;  5A0D A;  2DPP B;  1OZ2 A;  5GAO q;  4AMC A;  5CQY A;  1K0X A;  3CCM T;  3JCM X;  5GAM e;  1GFC A;  5CK9 A;  2CRE A;  5M9O A;  1Q86 C;  2CZ7 B;  4OP0 A;  2ROL A;  4J9I A;  1T3S A;  4XTV A;  4N0A A;  1B34 A;  2QDL A;  1GCQ A;  2XHC A;  2J05 A;  1VYT A;  5GMK i;  2EJF A;  5KYN A;  3WVD B;  2FYK A;  2KRN A;  3NHN A;  1BBZ A;  2FZG B;  1M8M A;  1AWJ A;  4AG1 C;  5D6X A;  4M78 E;  3CME T;  4OB1 B;  4XQ3 A;  2YLB A;  2MYS A;  3DLM A;  4DA4 A;  3JB9 G;  2OTL A;  3J80 E;  3ASK A;  3TSW A;  4ZN1 A;  2JVV A;  3RR6 A;  2DM1 A;  1YJW A;  3QXE B;  4C8Q C;  3OYM A;  3VS2 A;  3PIO A;  3OS5 A;  5EG2 A;  2FB7 A;  3S3N A;  4FYX B;  2EW3 A;  3L1A A;  2M0Y A;  1EX4 A;  1VQO Q;  1KD1 R;  3CCR Q;  3OYE A;  2QA4 T;  2O01 E;  1B07 A;  2QGG A;  2DA9 A;  3DKM A;  2JUF A;  4ELZ C;  1BCO A;  2EQJ A;  1S72 Q;  1YIJ A;  4N4G A;  4LD9 K;  1OZ3 A;  1ABO A;  3OB9 A;  1VQ5 Q;  2X4J A;  3E9G A;  2RMO A;  4HCZ A;  1VQN T;  1VYU A;  4LNP A;  5FU7 C;  1VQ6 Q;  4XU3 A;  5FWB A;  2EKO A;  3I5S A;  1BB9 A;  4M77 A;  1TUD A;  1AZG B;  1FWZ A;  2AKL A;  2DE0 X;  1M8V A;  5GAM f;  2A08 A;  2CUD A;  4OF1 A;  3RBB B;  2K57 A;  2LQ8 A;  2AKK A;  2CZ6 B;  1VQ8 T;  1QVG P;  3LW5 E;  5LJ3 e;  1PD1 A;  1SG5 A;  4EDU A;  2DL8 A;  2Y90 A;  2JTF A;  1W2B P;  1QCO A;  2BE9 B;  4HVW A;  1OU9 A;  1ZUU A;  1VQL T;  4M7D G;  2X4Y A;  1PRL C;  1NPP A;  3OS2 A;  2FRY A;  2CH4 A;  4CC4 B;  2MIO A;  2J06 A;  1PKT A;  3P8H A;  4PFP A;  1Z9Q A;  2RQT A;  4WF2 A;  1TUC A;  3GF5 A;  3MEV A;  2ED0 A;  4M78 G;  3JB9 J;  2CS7 A;  1AT1 B;  4NOY A;  2F69 A;  4F7U E;  3CMA Q;  2W0Z A;  5CKD A;  2RH2 A;  1K73 R;  4A63 B;  2QEX Q;  3GIB A;  5HK0 A;  2HSE B;  3CCQ Q;  3NGP A;  4JRK A;  3TU4 K;  2L0A A;  1VYV A;  3UAT A;  4JDS A;  3OYK A;  2OX7 A;  1WDX A;  5GAM h;  3ZBD A;  4DOW A;  4C0G A;  1BIB A;  2RQR A;  1M2V A;  3OS1 A;  1UGS B;  3QG1 A;  1UEC A;  1K9A A;  3L2Q A;  2HKQ B;  1XQH A;  1Q7Y U;  3A8H B;  4DBH A;  5CR2 A;  4RCC A;  4M7D A;  1OI1 A;  3CCV Q;  3EFO B;  4KBM B;  1N8R U;  2E6N A;  1TWB A;  4BY6 B;  3CCL A;  4R0K A;  1YJ9 A;  1X2K A;  4RTZ A;  4ATO A;  3CCL T;  3TQ7 P;  2YSQ A;  2QTV A;  2OTJ T;  4M7A E;  4IUV A;  2MPX C;  3I56 Q;  5LJ5 j;  4J9F A;  2NUP B;  3R6O A;  1M90 U;  2KAF A;  4UC4 A;  1Q82 U;  1G8X A;  4JJC A;  1RAG B;  2R5M A;  3CCS T;  2RN8 A;  2JJ9 A;  5CAI A;  5ECA A;  1NZ9 A;  3PTA A;  3GOX A;  1M9S A;  5KH6 A;  3CCU Q;  1PRM C;  5GAN e;  5LJ3 f;  3FC3 A;  2FEI A;  4FW1 A;  1WHJ A;  3BE3 A;  2LZ6 B;  4V2S A;  1U5S A;  1QVG A;  2DYB A;  5FRM A;  3FRN A;  3RKY A;  2HEQ A;  2RI3 A;  3A98 A;  4LDW A;  2P4T A;  4XU0 A;  2RI5 A;  4C92 C;  4M77 D;  2NUT B;  4F7U G;  1CSK A;  4BDY A;  1W2B A;  1RAC B;  2VV5 A;  1X6O A;  1ACM B;  2K3B A;  1WGS A;  3CC4 A;  4IIM A;  4MMK A;  1JXO A;  3OW2 P;  4C8Q A;  2LP5 A;  3LGL A;  2CGH A;  4DBF A;  1KC8 C;  2NUZ A;  2DNU A;  4M77 F;  5KYU B;  2RHU A;  2O4X B;  3X24 B;  2MI6 A;  4HCK A;  5I2M A;  3OQ5 A;  3CC7 Q;  1WXB A;  2R58 A;  5IHI A;  1T0H A;  2CP7 A;  3G7Z A;  1M3B A;  2A3L A;  4J8O A;  5FU6 B;  4LDX A;  1K8A R;  2KY9 A;  5LJ3 h;  1ZLM A;  3PIP A;  1QWE A;  1TSF A;  2RHY A;  3JCM d;  2EBP A;  1XOV A;  3CCR A;  3C95 A;  2VYT A;  3RES A;  2PVD B;  4J9E A;  2AK5 A;  2E5Q A;  4JZ4 A;  1VQP Q;  2E3H A;  4M75 C;  1M5Q 1;  3NTH A;  3NPF A;  2M51 A;  1TG0 A;  5LJ5 d;  8ATC B;  1VQK A;  2GF7 A;  1VQK T;  3OYH A;  3V8K A;  2EYQ A;  3PT9 A;  1M1K U;  3MPU B;  1VQ6 A;  1UEB A;  4M7D D;  1U1T A;  5GJW B;  3V7S A;  1AEY A;  5GAO n;  1X6B A;  4FW2 A;  2VB6 A;  3RMS A;  1NLP C;  5GAN 8;  5GAN f;  3RNJ A;  4QQG A;  1IGQ A;  4HT8 A;  4FYW B;  4ZGD B;  2ABL A;  4M7D F;  2RK1 A;  3FDR A;  1FMV A;  3BDU A;  1TOV A;  1C0M A;  3GNF B;  5GAO r;  3QZ5 B;  3VV0 A;  2HQX A;  2LRQ A;  1YI2 Q;  2LTO A;  4FCY A;  1VQ7 Q;  2HMA A;  3G4S T;  4PJL A;  3VS3 A;  1XTD A;  3CCM Q;  3CMA A;  1N6A A;  2HAX A;  4C5I A;  1IRX A;  3UPU A;  3GBQ A;  3V8L A;  1LCK A;  3VRY A;  3OW2 A;  2JT4 A;  4AFQ C;  3JCM W;  3SEM A;  1O9S A;  1WI7 A;  1KQS S;  5C6S A;  1MV0 B;  4ELY C;  1UJ0 A;  2P4R A;  1WJQ A;  4EMK C;  1A0N B;  5GAN h;  4BI8 B;  2JTM A;  1YIT T;  2GFU A;  5GMK m;  2IIM A;  1PCX A;  3CXC A;  1PD0 A;  2F2W A;  4C8Q D;  4J6Y A;  3KXT A;  2L8D A;  1H92 A;  1K73 C;  3G71 A;  2V8I A;  4JJD A;  3X26 B;  1BU1 A;  4O5V A;  4OVA A;  3L2V A;  3G71 T;  4WCI A;  3MO8 A;  2K79 A;  1Q81 U;  4JRQ A;  1D09 B;  2BIV A;  2DYI A;  3L2W A;  1OOT A;  4BY6 C;  1M1G A;  4C8Q F;  3I56 A;  2CH4 W;  3OYN A;  2IPO B;  3H41 A;  2EQI A;  2L3Q A;  5J3B A;  3FIF A;  1VQM A;  4PJO A;  4KH0 B;  3QII A;  4JLG A;  2DXB A;  4AFS C;  1VQM T;  1MUZ A;  1H3Z A;  4DEY A;  4IUR A;  1QMC A;  1IXD A;  4FT4 A;  1Y96 B;  3REB B;  1YJN Q;  4C92 A;  2DIQ A;  2RQV A;  4XU1 A;  2RF0 A;  5IHK A;  3CCU A;  4ZTJ A;  2KXD A;  3JV3 A;  4OMM A;  3HL8 A;  1MND A;  2KT8 A;  2JZ2 A;  2BE7 D;  3BW1 A;  2DZ9 A;  2K2M A;  4JS4 A;  1RL2 A;  5KYW B;  2PUK B;  1QVP A;  2AT1 B;  1RAH B;  1YHQ T;  1JJ2 P;  1GBR A;  3A1P A;  1X01 A;  4OMO A;  2EWN A;  5IH2 A;  4D6W A;  1RI9 A;  2I2L A;  2XD0 A;  3M9Q A;  1VQ8 Q;  3HRU A;  4O6J A;  3MCA B;  5GMK j;  3VKI A;  2FO0 A;  3H8Z A;  4B6M A;  1U3O A;  1FMK A;  3BDL A;  3CC7 A;  3TSZ A;  3MEW A;  2G6F X;  3OBY A;  4RTY A;  4M75 A;  2AIR B;  4ZGJ B;  1QP2 A;  3RUX A;  2G3R A;  3JCM c;  4E6R A;  1RAA B;  2DLP A;  5CKH A;  2EVR A;  3V7C A;  3EG2 A;  2DKG A;  4Q5W A;  3P8D A;  2LDM A;  3M4G A;  3I55 T;  1LVK A;  3BY7 A;  1KK7 A;  2LT1 A;  1WX6 A;  2KGT A;  2O31 A;  1R8O B;  2MWO A;  1N8R R;  2LCL A;  2M16 A;  2DBM A;  5FW9 A;  1I81 A;  4FYV B;  2V1Q A;  1VOM A;  3HTR A;  2IVW A;  1HYO A;  4RTX A;  1WXT A;  1K8A C;  3VYG A;  2D1X A;  2DK3 A;  1ZSZ C;  2HQE A;  5D7U A;  4CC3 A;  1WPY A;  2DL3 A;  4IUQ A;  2CSQ A;  3VYH B;  2CT3 A;  1MV3 A;  2VXE A;  4Z89 A;  2XG8 D;  1YCY A;  1M90 R;  1G3T A;  4HVV A;  1Q82 R;  3LYI A;  2YXY A;  5D6W A;  4J9B A;  3U23 A;  2X51 A;  2NLU A;  1H3H A;  4R56 A;  2YUO A;  3M0R A;  1UHC A;  3SWN B;  1UGQ B;  2LC4 A;  1K0S A;  5IN1 A;  2KDS A;  4M78 C;  4PJO D;  2KXC A;  3D7S B;  3THK A;  3M54 A;  2HL5 C;  4LN2 A;  1OYX A;  2RQW A;  1UTI A;  5HY6 A;  5KCO A;  1NPR A;  3HP9 A;  1AWW A;  4C92 D;  1HJD A;  2MMP A;  1YNZ A;  3OSS C;  4BE2 A;  2J7I A;  2QI2 A;  3EHQ A;  1JJ2 A;  1KQ1 A;  4EMK A;  2C0T A;  3EGD A;  2W10 A;  1I1J A;  4PJO F;  1JXM A;  1PKS A;  1AOJ A;  3QDF A;  5EC7 A;  3G6E A;  2EYZ A;  1PG5 B;  4ZN3 A;  2ZPF B;  1FXX A;  6AT1 B;  4C92 F;  2E5K A;  1XNI A;  2LNH B;  3E9F A;  2F5T X;  5KYY A;  2L3S A;  5CO7 A;  4XTX A;  1ARK A;  5DY9 A;  1IB8 A;  2V1R A;  1J3T A;  4CC7 A;  1VIE A;  2E1H A;  2QAS A;  2I0N A;  2QYZ A;  2LT4 A;  3Q1J A;  3VUZ A;  4JLI A;  2WSF E;  1SSH A;  4ZNX A;  4BI3 A;  1WQW A;  2OTL T;  2PTK A;  1NE8 A;  3E1S A;  1YJW T;  3VS7 A;  3VS4 A;  1QVG S;  3WXM B;  3PFS A;  3MEA A;  2LQN A;  1W2B S;  1V1C A;  4M75 D;  5FWC A;  1I0C A;  1T3L A;  1U1S A;  2X4W A;  3ZFJ A;  3FJP A;  5CCA A;  4M4Z A;  2OAU A;  3CCJ Q;  3EAE A;  1YIJ T;  1YN8 A;  1IO6 A;  3JCM b;  3M0U A;  2QQA A;  5HKC A;  2DL7 A;  2DEU A;  4M75 F;  1M1K R;  1I5L A;  3CCE A;  2C06 A;  2D0Q B;  3MP8 A;  3CCE T;  4PNO A;  2P84 A;  2E6Z A;  1QP3 A;  5IXB A;  3HHT B;  1X75 C;  5GMK l;  5A0G A;  4E47 A;  5FRN A;  3QJY A;  1FYN A;  2M1H A;  2DIG A;  1JBM A;  4EPC A;  1QVF P;  4FM4 B;  4X9C A;  1QLY A;  2XIC A;  4FYY B;  4JS5 A;  1PSE A;  3DB3 A;  4RKU E;  5KYX A;  4OB2 B;  1PHT A;  1SHF A;  4FT2 A;  2VKN A;  2QG9 B;  2XI9 A;  2RQU A;  1M30 A;  3OYF A;  2XDP A;  3FEO A;  1ZA1 B;  3HRS A;  1I4K 1;  4D8K A;  4M7A C;  3CC2 A;  3EGX A;  3JAM E;  3CC2 T;  5L23 A;  2YDL A;  3VS5 A;  1KSW A;  3OMG A;  4C0D B;  1NYG A;  4XTW A;  4E7H A;  2CP2 A;  1ZSZ A;  1WHM A;  3CD6 A;  1FX7 A;  1OU8 A;  3M0S A;  2OAW A;  3EG0 A;  1V29 B;  2DX1 A;  2MOX A;  4XAX B;  2RI2 A;  3OBW A;  4PFZ A;  1Q81 R;  5IAY A;  2PNI A;  4IUT A;  3VU3 C;  2EYY A;  1B34 B;  2WSE E;  1YWP A;  3PE0 A;  3GP8 A;  1DJ7 B;  2LVM A;  4M78 A;  2V8J A;  1YJ9 T;  1NLO C;  2VC8 A;  2GCX A;  2FZK B;  2XMF A;  3OW2 S;  4D8D A;  1Q7Y C;  2C0I A;  5CKB A;  1WHG A;  4N4I A;  5HK3 A;  2EAY A;  2X9H A;  2GGR A;  4LDU A;  3M5A A;  1VQ4 Q;  2EJG A;  2DAQ A;  3FLG A;  4BI4 A;  3C0C A;  2RJC A;  1C6V X;  2B8A A;  3CXC S;  1BI1 A;  2BZY A;  4AFU C;  1VQ9 Q;  2A36 A;  2KE9 A;  3OA6 A;  1M90 C;  1Q82 C;  3NTI A;  3A8L B;  3JB9 D;  1OPK A;  4OMP A;  1QVF A;  3EG9 A;  1UGR B;  1ZBX A;  2WAC A;  5CIU A;  2KQW A;  3KUF A;  1TH7 A;  2QGF B;  2COZ A;  1ZA2 B;  3C12 A;  2EIF A;  3A8G B;  2CUB A;  4XU2 A;  1D3B A;  2GTO A;  3CC4 T;  2EFI A;  3RKX A;  2KRM A;  1E6G A;  3QZ9 B;  3JB9 F;  1KC8 U;  3OYA A;  2CT4 A;  4OML A;  2AHJ B;  1GXI E;  2YUQ A;  2MK5 A;  1Y0M A;  1QKW A;  4M77 B;  1P92 A;  2EKH A;  3TEE A;  3SHW A;  1NJI U;  4LDV A;  4A4H A;  5IXF A;  4JRP A;  3ZEH A;  1SPK A;  2DTH A;  3CXC P;  1MMN A;  3M4Y A;  2DO3 A;  3H0F A;  1G83 A;  2KRO A;  3H0I A;  4OGC A;  2QK0 A;  1KQ2 A;  4PLL A;  1X43 A;  4F7U A;  2YRV A;  1R77 A;  1VQO A;  4M7A G;  2AZS A;  5GMK e;  2FPD A;  3OYJ A;  2CP3 A;  1VQO T;  3CCR T;  3QSU A;  1RAF B;  2LJ3 A;  4MDW A;  1S72 A;  4PJO E;  2D9T A;  1AZE A;  3CCJ A;  4OB0 B;  2MCN A;  2CZ1 B;  1VQ5 A;  3CBM A;  1G3W A;  1T0J A;  4XTU A;  4QVC A;  2XDB A;  2E10 A;  1K9M U;  2CSI A;  4L59 A;  4J6X A;  3JCM g;  3QBY A;  3I55 Q;  3MEU A;  1G5V A;  1G2B A;  2RNA A;  1D1C A;  3J7A F;  1KD1 C;  2EPD A;  1X27 A;  5GAM d;  1VQ6 T;  2RJE A;  1ZHI A;  2SEM A;  2L89 A;  3P8B B;  4RMO A;  2CKK A;  4RG2 A;  4DEX A;  2MAM A;  4M78 D;  2A0F B;  2ED1 A;  2JS0 A;  2PUO B;  1D0Y A;  1M2V B;  5LJ5 g;  1AHJ B;  2YHT A;  5J39 A;  1MMG A;  4J9D A;  2C0O A;  2YUN A;  4L6V 5;  4KGX B;  1N5Z A;  4M7A A;  3S3M A;  1M1K C;  2GBQ A;  2K3X A;  1SF9 A;  2JTE A;  1ZUY A;  4M7D B;  4E7S A;  2ZPI B;  2JMC A;  4M78 F;  1H8K A;  2V26 A;  1ZQ1 A;  1RI0 A;  1W6X A;  4MDX A;  5CKE A;  2J6F A;  2A28 A;  2M9U A;  1WLP B;  4CI0 C;  3CMA T;  4JJB A;  4A54 A;  2RPN A;  4L5G A;  2QEX A;  4JJN K;  3KBG A;  3MKD A;  2LX7 A;  4QVD A;  3CCQ A;  3M58 A;  2KT1 A;  2ZPG B;  2QEX T;  1UG1 A;  3CCQ T;  2L3P A;  1BIA A;  3FJ5 A;  1K1Z A;  1WYX A;  2P0P A;  4XTY A;  4PJJ A;  1RLP C;  2DVE A;  4CC2 A;  4FSS A;  2ROT A;  4PKC C;  3LLR A;  1Y71 A;  3CCV A;  4JPB W;  4EMH A;  4QQ6 A;  1JJ2 S;  3CCV T;  2K9G A;  4ANJ A;  2YRC A;  1PWT A;  3NFC A;  1M1F A;  1BYM A;  3CME Q;  2COY A;  4OGE A;  5GAN 6;  2DEQ A;  1R0B G;  4J7I A;  2OJ2 A;  4NL3 A;  2L5Q A;  3F70 A;  1TUG B;  3I56 T;  4A4G A;  4C8Q B;  2H3J A;  3RER A;  3HRT A;  1RAI B;  1Y07 A;  3REA B;  2F5K A;  2SRC A;  1VQ4 A;  1Q81 C;  1UUE A;  1VUB A;  4HT9 A;  1V76 A;  4B9X A;  3EG1 A;  2QQB A;  3QKJ A;  3WVE B;  2QA4 Q;  1M4Z A;  3CCU T;  3I9Q A;  4HCC A;  2E64 A;  1JB0 E;  2XKO C;  4GY5 A;  2HNI A;  4F16 A;  4F7U F;  2FVU A;  2R57 A;  2HKN A;  2KRS A;  4HKE A;  3PNW C;  1M27 C;  5GMK h;  2P0Q A;  5FU7 B;  1JO8 A;  1VQN Q;  4EIK A;  3CPW P;  1MMD A;  4C5E A;  3M0P A;  1CKB A;  1SRL A;  1BKB A;  1D1B A;  2DXC A;  1IZ6 A;  5GAN 4;  4FSX A;  3JCM V;  2JW4 A;  2CDT A;  4VUB A;  4M7A D;  1G3Y A;  4C5G A;  2D0N A;  1E7O A;  2ZCF B;  3TCJ A;  2K5L A;  5I11 A;  1UHF A;  2FPE A;  4KRT A;  3EHR A;  4QT7 A;  2RJD A;  4QQD A;  3I35 A;  1QWF A;  1VQL Q;  4PL6 A;  3CC7 T;  3PMT A;  1PSF A;  2FZC B;  1OX8 A;  4DQ2 A;  3S6W A;  2X35 A;  4R55 A;  5I22 A;  4BUG A;  2H8H A;  1X69 A;  3JRZ A;  2MWP A;  2ZPE B;  1C1A A;  5FU6 C;  2ZPB B;  3CQT A;  1GFD A;  4JRI A;  1YBY A;  3TVT A;  2RHX A;  1HXD A;  2Y4Y A;  1BCM A;  3QUI A;  5CVI A;  2DBK A;  1OQK A;  2VVK A;  4F04 B;  2QQR A;  2EGE A;  5DM7 R;  2BZ8 A;  1VQP A;  5A2Q E;  2VAS A;  1U8R A;  2M02 A;  1F1B B;  2XID A;  1VQP T;  4E7J A;  5KE2 A;  3HPW A;  3QJ6 A;  2JMA A;  2KSS A;  2DTO A;  1KG1 A;  1WXU A;  4Z88 A;  1KIK A;  3OYB A;  3UA6 A;  2O9S A;  1JQQ A;  4LXC A;  4QVZ A;  2J6O A;  4M77 E;  1GBQ A;  1NBE B;  5GAN d;  2JOY A;  2EYW A;  1HSQ A;  3E19 A;  2EGC A;  2YT6 A;  3JCM e;  1AWO A;  2D8H A;  3CCL Q;  3H6Z A;  1RAD B;  2OTJ Q;  3R6N A;  1H64 1;  2E4H A;  1B3Q A;  2JXB A;  1NM7 A;  3QWX X;  1AWX A;  1WHK A;  4Y92 A;  1TTH B;  2CZ0 B;  5DLO A;  1YI2 A;  1Q86 U;  2RJF A;  2CYZ B;  4A4F A;  3CCS Q;  5LJ5 e;  3M53 A;  2XU8 A;  3RMQ A;  1VQ7 A;  2DXU A;  5GJV B;  1VQ7 T;  2GTJ A;  3VS6 A;  2O9V A;  3CCM A;  1LJO A;  3CPW A;  1RAE B;  2J6K A;  2HQH A;  5GAO p;  4LE9 A;  4PJO B;  3G6E T;  3EH1 A;  3L2R A;  2RK2 A;  1K76 A;  4JUV A;  3L2Z A;  3JB9 I;  1KC8 R;  4C92 B;  4QW2 A;  2BZX A;  2RO0 A;  3EFO A;  2E3I A;  3OYG A;  4KUD K;  4NS5 A;  2BUD A;  4IUP A;  1SEM A;  1NJI R;  4HXJ A;  3HSB A;  4PJN A;  2VWF A;  1ZBJ A;  1NEB A;  3CC4 Q;  3OS0 A;  2IG0 A;  2NUP A;  2WSC E;  4J9G A;  3C94 A;  4M7D E;  4MML A;  1OPL A;  3SB2 A;  1JRI A;  2RM4 A;  1RAB B;  1RUW A;  2HDA A;  2CP6 A;  3CEY A;  1TS9 A;  3M57 A;  5HCK A;  3CME A;  1QVF S;  3L42 A;  1WHL A;  5GAN 3;  4IKF A;  2QXF A;  3IQL A;  5AT1 B;  4MZT A;  4WTO B;  1UJY A;  1W1F A;  2DER A;  2ESW A;  7AT1 B;  2DJQ A;  4HA8 A;  4M77 G;  2EQU A;  5AYF A;  1WZO A;  8AT1 B;  1YJN A;  1Z9Z A;  3QHS A;  3O5Z A;  3UF4 A;  1YJN T;  1MNE A;  2FG0 A;  4YTL A;  2M0O A;  4OMQ A;  1LOJ A;  2GQI A;  2LMJ A;  2B86 A;  1K9M R;  4ZTF A;  2QA4 A;  2ENM A;  4RTW A;  4Z02 A;  3JCM f;  2NUT A;  2K5I A;  2YLC A;  4M75 B;  2ZGW A;  1BK2 A;  1E6H A;  2LJ0 A;  4II1 A;  1OUL A;  1UDL A;  2FRW A;  3EFS A;  2CP0 A;  1XJW B;  2A37 A;  2Z0W A;  1VQK Q;  2DJZ A;  3NTK A;  5LJ5 f;  1YCS B;  2D6F A;  1VQN A;  4C0F A;  1W4S A;  3UDC A;  3N5B B;  4MZM A;  5KYU A;  4GLM A;  2O4X A;  1FMW A;  2A7Y A;  1M3A A;  3AHU A;  3M55 A;  2DL4 A;  4C8Q E;  1VQ8 A;  2GFA A;  3PVQ A;  2KR3 A;  2E41 A;  4ESR A;  4BD3 A;  3OYC A;  2KMT A;  3EG3 A;  2YUP A;  3OMC A;  3HFO A;  4Y28 E;  1VQL A;  2X3W D;  2ECZ A;  4PK4 A;  2E12 A;  1I8F A;  3JCM h;  2DF6 A;  1Q95 G;  2KBT A;  3G4S Q;  3JSC A;  2LQK A;  3JCM J;  4HVU A;  3E2U A;  1BI0 A;  2L3R A;  2VXF A;  1RLQ C;  1PC0 A;  3CBO A;  2QAZ A;  4N4H A;  3CD6 T;  2RB6 A;  5LJ5 h;  2E65 A;  3KFV A;  1NG2 A;  2LJ1 A;  5CQX A;  4EMK B;  4F17 A;  5KCH A;  3EGD B;  4RUG A;  3UT1 A;  4BE0 A;  2RHI A;  1UE9 A;  1YIT Q;  2JM8 A;  4J83 A;  4J9C A;  3EGU A;  2COW A;  2EQK A;  1JEG A;  3ZL7 C;  1KHC A;  1EFN A;  3H0H A;  3G71 Q;  3MET A;  4AFZ C;  4C5H A;  1HD3 A;  5KYY B;  3L2U A;  1SRM A;  3PVL A;  5LL6 S;  2DL5 A;  1OV3 A;  1WFW A;  2PVO B;  2EJ9 A;  2DET A;  1N8R C;  4OMF B;  2DTI A;  5GAM j;  2OTJ A;  2E70 A;  2KI7 A;  1JU5 C;  2H3E B;  5L8R E;  5I2S A;  3SWN C;  1OEB A;  2HL3 A;  2MF2 A;  2V8K A;  4Z8A A;  4FL6 A;  1UFF A;  3MHX A;  1UB4 A;  3QYG B;  1VQM Q;  2RA2 A;  4PLI A;  5DLQ E;  3CCS A;  2L2P A;  2KYB A;  4C8Q G;  9ATC B;  3X28 B;  4IUU A;  2KNB B;  3OYI A;  1IRE B;  1PNJ A;  4GBQ A;  5GAO l;  2DMO A;  1IHV A;  3C4S A;  4X34 A;  4NL2 A;  3SD4 A;  2DFU A;  1BI3 A;  1WA7 A;  5C0M A;  3ME9 A;  2QDY B;  3MP6 A;  2F2V A;  4PJO C;  2O2O A;  3VS0 A;  3X25 B;  2DD4 A;  2JN0 A;  4FU6 A;  3DLL A;  2R5A A;  1KJW A;  1YHQ Q;  1OX9 A;  2EGA A;  3JB9 H;  2AZV A;  2FHD A;  3LWI A;  1ZUK A;  1ZX6 A;  4QKU A;  1PM3 A;  5I21 A;  4BDZ A;  1Y7X A;  4HCB A;  1LNX A;  2D8J A;  3J81 E;  3OY9 A;  2X3X D;  4OB3 B;  1IGU A;  4E2F B;  1EIF A;  4P5N A;  3RKW A;  1SHG A;  2LCS A;  1Y96 A;  4KH1 B;  3OYL A;  3S3O A;  1VA7 A;  1HK9 A;  5KYX B;  4XTZ A;  2P0K A;  1NJI C;  3TRE A;  3VJP A;  4ORZ A;  2HCK A;  1BI2 A;  2JNG A;  3UA7 A;  1S72 T;  3CCJ T;  2QTX A;  2PZ1 A;  4C92 E;  1WJR A; 
#chains in the Genus database with same CATH homology
 2GQV A;  2XKO C;  2HNI A;  4GY5 A;  4JRK A;  4PJO F;  4MZP A;  3TU4 K;  1VQ5 T;  3INZ A;  4F7U F;  3G6E A;  5GAN 7;  2FVU A;  3CPF A;  2R57 A;  4KUI A;  5GAN 2;  4HKE A;  1SSF A;  4ZN3 A;  1KD1 U;  4JDS A;  3V8J A;  2ZPF B;  2PU9 B;  1FXX A;  3PNW C;  3OYK A;  5GMK h;  4C92 F;  1XNI A;  2LCC A;  2P0Q A;  3E9F A;  3ZBD A;  5GAM h;  4DOW A;  5FU7 B;  2F5T X;  4C0G A;  1BIB A;  3OS1 A;  1UGS B;  3QG1 A;  3QPH A;  3L2Q A;  5LJ3 j;  1XQH A;  5CO7 A;  2LX9 A;  3HFN A;  4X9D A;  4XTX A;  5DY9 A;  4C5E A;  2XK0 A;  1Q7Y U;  3A8H B;  5CR2 A;  1BKB A;  4FIB A;  3O8V A;  1VIE A;  2E1H A;  4RCC A;  4M7D A;  1OI1 A;  2LT4 A;  3Q1J A;  2DXC A;  1IZ6 A;  4JLI A;  3SFM A;  3VUZ A;  2WSF E;  4FSX A;  5GAN 4;  4KBM B;  3JCM V;  3LWH A;  1K9M C;  1N8R U;  2X4X A;  2K2V A;  4VUB A;  4M7A D;  1G3Y A;  2E6N A;  4TVR A;  4BY6 B;  4C5G A;  3CCL A;  2VUB A;  4BI3 A;  3HKS A;  1WQW A;  3OYD A;  1YJ9 A;  2OTL T;  4BAC A;  4ATO A;  1MHN A;  5GAM g;  2ZCF B;  1NE8 A;  4GLK A;  3TCJ A;  3CCL T;  2K5L A;  2OTJ T;  3E1S A;  5IT9 E;  4M7A E;  1YJW T;  4IUV A;  4ZGE B;  2RJD A;  4E7L A;  5LJ5 j;  4QQD A;  1QVG S;  4M7D F;  3WXM B;  3PGG A;  1N27 A;  3A8M B;  4M78 B;  3PFS A;  3R6O A;  4PL6 A;  3CC7 T;  3MEA A;  4E7K A;  3PMT A;  1PSF A;  4DQ2 A;  3EFR A;  1M90 U;  2KAF A;  4UC4 A;  3S6W A;  2X35 A;  4DOV A;  4R55 A;  1W2B S;  1Q82 U;  4BUG A;  4Y91 A;  3OYY A;  4M75 D;  3CCS T;  2R5M A;  4J7F A;  3JRZ A;  5CAI A;  1KHI A;  2MWP A;  2ZPE B;  3LH0 A;  5FU6 C;  1U1S A;  1NZ9 A;  2X4W A;  2ZPB B;  4J6W A;  3ZFJ A;  3PTA A;  3FJP A;  4KUL A;  4JRI A;  4M75 E;  1YBY A;  3QYH B;  5CCA A;  3GOX A;  1M9S A;  2OAU A;  2RHZ A;  2RHX A;  5KH6 A;  1HXD A;  3G4S A;  3EAE A;  2Y4Y A;  1YIJ T;  3QUI A;  5CVI A;  3JCM b;  2QQA A;  5GAN e;  2QQR A;  5LJ3 f;  2QQS A;  5HKC A;  3FC3 A;  5DM7 R;  1VQP A;  4C0D C;  5A2Q E;  4M75 F;  1U8R A;  2XID A;  1VQP T;  3UWN A;  4E7J A;  1I5L A;  1N9R A;  4V2S A;  5KE2 A;  3CCE A;  1QVG A;  2C06 A;  2D0Q B;  3MP8 A;  1K73 U;  4A53 A;  5FRM A;  2DD5 A;  3FRN A;  3HPW A;  3RKY A;  2RI3 A;  4LDW A;  2P4T A;  3QJ6 A;  2KSS A;  2RI5 A;  4PNO A;  4XU0 A;  2DTO A;  4PJO G;  4C92 C;  1KG1 A;  4M77 D;  2E6Z A;  4F7U G;  4BDY A;  1W2B A;  3FB9 A;  3OYB A;  5D6Y A;  1QP3 A;  3HHT B;  1X75 C;  2VV5 A;  1X6O A;  4QVZ A;  3URG A;  5GMK l;  5A0G A;  4E47 A;  2K3Y A;  4M77 E;  4C92 G;  1WGS A;  1YIT A;  3CC4 A;  2QQ9 A;  5FRN A;  3QJY A;  4MMK A;  5GAN d;  2JOY A;  2DIG A;  2M1H A;  4N0A C;  3CPW S;  3PMI A;  1JBM A;  2ZZD A;  3SWN A;  4C8Q A;  3LGL A;  4EPC A;  4EMG A;  4FM4 B;  3E19 A;  4X9C A;  2VGM A;  2XIC A;  2CGH A;  4BB7 A;  1KC8 C;  1D3B B;  4JS5 A;  1PSE A;  3DB3 A;  2EQM A;  4M77 F;  4RKU E;  3JCM e;  4OB2 B;  2RHU A;  3H6Z A;  4BE1 A;  2O4X B;  1H64 1;  3X24 B;  2MI6 A;  4FT2 A;  4E7I A;  5I2M A;  3M56 A;  3OQ5 A;  2XI9 A;  1WJS A;  2R58 A;  3T9N A;  3OYF A;  5A0L A;  1VQ4 T;  2CZ0 B;  2XDP A;  3A8O B;  3OSV A;  4B9W A;  1MGQ A;  3A5Z B;  3FEO A;  3G7Z A;  2RJF A;  5DLO A;  5GAN j;  2CYZ B;  4A4F A;  1YI2 A;  1Q86 U;  3HRS A;  1I4K 1;  5LJ5 e;  3CCE T;  5FU6 B;  2A3L A;  4J8O A;  3M53 A;  2XU8 A;  1VIF A;  3RMQ A;  1VQ7 A;  2DXU A;  4RCB A;  4M7A C;  4LDX A;  5LJ3 d;  2KY9 A;  5LJ3 h;  1VQ9 A;  3CC2 A;  4XK8 E;  1VQ7 T;  3JAM E;  3PIP A;  3CBP A;  3CCM A;  2RHY A;  1VQ9 T;  3CC2 T;  3RIR A;  1LJO A;  3JCM d;  3CPW A;  1G3S A;  1XOV A;  3OMG A;  3CCR A;  2FL7 A;  5GAO p;  4C0D B;  4PJO B;  3C95 A;  2VYT A;  4XTW A;  3G6E T;  4E7H A;  3RES A;  4F7U B;  2PVD B;  3V7R A;  2RK2 A;  2XDD A;  2E5Q A;  3L2R A;  1N9S A;  3LX7 A;  3DB4 A;  3QDR B;  4J5Y A;  4JUV A;  3JCM Q;  3L2Z A;  1FX7 A;  3JB9 I;  3CD6 A;  4M75 C;  2K4Y A;  1M5Q 1;  3NTH A;  2RD1 A;  4C92 B;  3M59 A;  5LJ5 d;  4A4K A;  4QW2 A;  1VQK A;  2RO0 A;  5LJ3 g;  2GF7 A;  1V29 B;  2Y4X A;  3OYG A;  4KUD K;  4NS5 A;  4XAX B;  1VQK T;  4M75 G;  2BUD A;  3V8K A;  3OYH A;  2RI2 A;  4IUP A;  2EYQ A;  3PT9 A;  3OBW A;  1M1K U;  1VQ6 A;  1UEB A;  4M7D D;  3HSB A;  1U1T A;  4ME7 A;  5IAY A;  3V7S A;  4IUT A;  1YHQ A;  3VU3 C;  1B34 B;  2WSE E;  5GAO n;  3OS0 A;  2IG0 A;  3GP8 A;  3JB9 J;  1DJ7 B;  2LVM A;  2WSC E;  2VGN A;  4M78 A;  3C94 A;  3RMS A;  4MML A;  3SB2 A;  2V8J A;  5GAN 8;  1O75 A;  1JRI A;  1YJ9 T;  2RM4 A;  5GAN f;  4QQG A;  2VC8 A;  4HT8 A;  2GCX A;  3CEY A;  3OW2 S;  3M57 A;  4M77 C;  3CME A;  1Q7Y C;  3L42 A;  1QVF S;  4ZGD B;  3BFM A;  5GAN 3;  5CKB A;  4LD6 A;  2QXF A;  2RK1 A;  3GLX A;  3GNG A;  5GAN 5;  2K5F A;  4IKF A;  4MZT A;  4N4I A;  5HK3 A;  4M7A F;  2EAY A;  3FDR A;  4LDU A;  3M5A A;  4M77 G;  2EJG A;  4HA8 A;  3BDU A;  2DAQ A;  3FLG A;  4C0Z A;  2EQU A;  2HD0 A;  3GNF B;  4M7A B;  3SDZ A;  4BI4 A;  5GAO r;  2RJC A;  3QZ5 B;  1QW1 A;  2KK4 A;  3VV0 A;  2HQX A;  2LRQ A;  5AYF A;  2B8A A;  2LTO A;  3CXC S;  5FLX E;  1BI1 A;  5CKF A;  1YJN A;  1UGP B;  3QHS A;  3G4S T;  5GAO m;  2LNV A;  1XTD A;  1YJN T;  1WQ7 A;  3OA6 A;  4YTL A;  3CMA A;  2M0O A;  1N6A A;  1LOJ A;  1M90 C;  2HAX A;  4ZTF A;  4C5I A;  3X20 B;  2QA4 A;  1Q82 C;  3UPU A;  2KVQ G;  3JCM f;  3NTI A;  3A8L B;  4Z02 A;  2K5I A;  2YLC A;  3JB9 D;  4M75 B;  3V8L A;  1K8A U;  3OW2 A;  3JCM W;  1QVF A;  2ZGW A;  4KT0 E;  4M7D E;  1O9S A;  4II1 A;  1UGR B;  1ZBX A;  5J26 A;  2WAC A;  5CIU A;  3EFS A;  1KQS S;  2KQW A;  3I55 A;  5C6S A;  4ELY C;  3KUF A;  4CRI A;  1TH7 A;  3C12 A;  1WJQ A;  2EIF A;  4EMK C;  2DJZ A;  2HBP A;  3NTK A;  5LJ5 f;  3A8G B;  4XU2 A;  2D6F A;  1VQN A;  4C0F A;  1D3B A;  5GAN h;  1W4S A;  4BI8 B;  2EFI A;  2JTM A;  2GFU A;  3N5B B;  3RKX A;  3UDC A;  5GMK m;  3CC4 T;  1YIT T;  4MZM A;  3QZ9 B;  3JB9 F;  3CXC A;  1KC8 U;  2O4X A;  4C8Q D;  2DZC A;  3OYA A;  4J6Y A;  3KXT A;  2L8D A;  3VUB A;  3LGF A;  1K73 C;  2A7Y A;  2AHJ B;  1GXI E;  3G71 A;  2V8I A;  3AHU A;  3X26 B;  3M55 A;  4O5V A;  4OVA A;  3MP1 A;  1WNL A;  2BKD N;  3MO8 A;  3L2V A;  4C8Q E;  4M77 B;  3G71 T;  3JCM P;  1P92 A;  1VQ8 A;  3TEE A;  3GPL A;  2PQW A;  2GFA A;  4RG8 A;  1Q81 U;  1NJI U;  4JRQ A;  2BIV A;  4LDV A;  2E41 A;  4A4H A;  4JRP A;  3ZEH A;  3L2W A;  2DTH A;  4LDY A;  4BD3 A;  3OYC A;  2KMT A;  4BY6 C;  1M1G A;  5GAN g;  4M7D C;  3M4Y A;  2ZPH B;  4C8Q F;  3OMC A;  3I56 A;  1KQS A;  2DO3 A;  1YI2 T;  3HFO A;  4A4E A;  4Y28 E;  3OYN A;  1VQL A;  2PVG B;  2DXT A;  3QO3 A;  5KE3 A;  1VQM A;  3ER0 A;  3FIF A;  4OGC A;  5J3B A;  5FRO A;  5A0D A;  1KQ2 A;  2DPP B;  1OZ2 A;  2E12 A;  3QII A;  4PLL A;  5GAO q;  4JLG A;  1I8F A;  2DXB A;  3JCM h;  4F7U A;  2YRV A;  1VQM T;  1VQO A;  5CQY A;  3CCM T;  4M7A G;  1H3Z A;  4IUR A;  5GMK e;  3JSC A;  2LQK A;  5GAM e;  3JCM X;  3OYJ A;  4FT4 A;  3JCM J;  1Y96 B;  1VQO T;  3CCR T;  4C92 A;  3QSU A;  5CK9 A;  2DIQ A;  4MDW A;  1BI0 A;  2L3R A;  2VXF A;  5M9O A;  1S72 A;  4PJO E;  4XU1 A;  2D9T A;  3CBO A;  3CCJ A;  1Q86 C;  4N4H A;  4OB0 B;  3CCU A;  4ZTJ A;  2CZ7 B;  4OP0 A;  3CD6 T;  2RB6 A;  2CZ1 B;  5LJ5 h;  3HL8 A;  1VQ5 A;  3CBM A;  4XTV A;  1G3W A;  4N0A A;  2E65 A;  2JZ2 A;  4XTU A;  1B34 A;  5CQX A;  2E10 A;  4QVC A;  2XDB A;  4EMK B;  1K9M U;  5KCH A;  4L59 A;  4J6X A;  3JCM g;  3QBY A;  3UT1 A;  3BW1 A;  2XHC A;  3MEU A;  4BE0 A;  1G5V A;  2DZ9 A;  2RHI A;  3J7A F;  4JS4 A;  1KD1 C;  1RL2 A;  5GMK i;  5GAM d;  2PUK B;  1QVP A;  2RJE A;  1ZHI A;  2EJF A;  1VQ6 T;  2L89 A;  4J83 A;  2FYK A;  3P8B B;  3WVD B;  4RMO A;  1YHQ T;  2CKK A;  4RG2 A;  2MAM A;  4M78 D;  2EQK A;  2PUO B;  1X01 A;  1KHC A;  5LJ5 g;  1AHJ B;  2EWN A;  2YHT A;  5J39 A;  4D6W A;  3MET A;  4C5H A;  5D6X A;  4M78 E;  4L6V 5;  3L2U A;  3CME T;  2I2L A;  4OB1 B;  5LL6 S;  2XD0 A;  4XQ3 A;  4M7A A;  2YLB A;  3DLM A;  4DA4 A;  3S3M A;  3JB9 G;  2PVO B;  3M9Q A;  2EJ9 A;  3HRU A;  4O6J A;  1M1K C;  2K3X A;  2OTL A;  3J80 E;  3ASK A;  1N8R C;  3MCA B;  4OMF B;  2JVV A;  2DTI A;  4ZN1 A;  5GMK j;  4M7D B;  5GAM j;  2OTJ A;  2ZPI B;  2E70 A;  1YJW A;  3VKI A;  3H8Z A;  4M78 F;  3QXE B;  5L8R E;  1ZQ1 A;  5I2S A;  3BDL A;  3SWN C;  4C8Q C;  3OYM A;  3CC7 A;  1RI0 A;  2MF2 A;  3PIO A;  3OS5 A;  2V8K A;  5EG2 A;  4MDX A;  2FB7 A;  3S3N A;  3MEW A;  3MHX A;  4FL6 A;  1UB4 A;  5CKE A;  2M9U A;  3QYG B;  3OBY A;  2RA2 A;  3L1A A;  4M75 A;  4PLI A;  5DLQ E;  3CCS A;  4C8Q G;  4ZGJ B;  4CI0 C;  3X28 B;  1QP2 A;  3CMA T;  4IUU A;  3RUX A;  3OYI A;  1IRE B;  3OYE A;  2QA4 T;  4A54 A;  2G3R A;  4L5G A;  3JCM c;  2QEX A;  2O01 E;  4JJN K;  3KBG A;  3DKM A;  3CCQ A;  2JUF A;  4ELZ C;  2EQJ A;  2ZPG B;  3M58 A;  4QVD A;  5GAO l;  2QEX T;  1YIJ A;  5CKH A;  3V7C A;  2DKG A;  4Q5W A;  3CCQ T;  3C4S A;  4X34 A;  4NL2 A;  4N4G A;  3SD4 A;  4LD9 K;  1OZ3 A;  3OB9 A;  1BI3 A;  1BIA A;  3P8D A;  2LDM A;  3M4G A;  3I55 T;  5C0M A;  3ME9 A;  3BY7 A;  2QDY B;  3MP6 A;  2P0P A;  4PJO C;  4XTY A;  2LT1 A;  2X4J A;  3X25 B;  2DD4 A;  3E9G A;  1R8O B;  2MWO A;  2JN0 A;  4HCZ A;  1VQN T;  2LCL A;  5FU7 C;  2M16 A;  1I81 A;  2DVE A;  4FU6 A;  2EKO A;  2R5A A;  4XU3 A;  2IVW A;  4M77 A;  3DLL A;  4PKC C;  1K8A C;  3VYG A;  3JB9 H;  2DK3 A;  1FWZ A;  3LLR A;  1M8V A;  2HQE A;  5GAM f;  2FHD A;  1Y71 A;  3LWI A;  3CCV A;  4EMH A;  1WPY A;  4OF1 A;  2K57 A;  4IUQ A;  2LQ8 A;  4QQ6 A;  1JJ2 S;  3CCV T;  3VYH B;  5I21 A;  2CZ6 B;  4BDZ A;  1VQ8 T;  2VXE A;  2XG8 D;  3NFC A;  1Y7X A;  1YCY A;  1M1F A;  4HCB A;  1G3T A;  1BYM A;  4OGE A;  1LNX A;  5GAN 6;  3J81 E;  3LW5 E;  2DEQ A;  3OY9 A;  3LYI A;  5LJ3 e;  4J7I A;  5D6W A;  4OB3 B;  4EDU A;  1EIF A;  4NL3 A;  2Y90 A;  2NLU A;  2JTF A;  2L5Q A;  4P5N A;  3F70 A;  4R56 A;  3I56 T;  3RKW A;  4A4G A;  3SWN B;  2H3J A;  1UGQ B;  4C8Q B;  2LC4 A;  1VQL T;  1Y96 A;  3OYL A;  5IN1 A;  2KDS A;  4M78 C;  3S3O A;  3RER A;  2X4Y A;  4M7D G;  4PJO D;  3HRT A;  1NPP A;  1HK9 A;  3OS2 A;  1Y07 A;  2F5K A;  3M54 A;  2P0K A;  4XTZ A;  1VQ4 A;  1OYX A;  1Q81 C;  1NJI C;  3TRE A;  3P8H A;  5HY6 A;  3VJP A;  1VUB A;  4WF2 A;  5KCO A;  4HT9 A;  3GF5 A;  3MEV A;  1NPR A;  3HP9 A;  1BI2 A;  4M78 G;  2CS7 A;  2JNG A;  4NOY A;  2F69 A;  4B9X A;  4C92 D;  2MMP A;  4F7U E;  2QQB A;  3QKJ A;  3OSS C;  1S72 T;  3WVE B;  4PJO A;  5CKD A;  4BE2 A;  2RH2 A;  3CCJ T;  2QI2 A;  1JJ2 A;  1M4Z A;  3CCU T;  1KQ1 A;  4EMK A;  2QTX A;  4C92 E;  4HCC A;  1WJR A;  2E64 A;  3GIB A;  1JB0 E;  5HK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...