1H3ZA

Solution structure of a pwwp domain from schizosaccharomyces pombe
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
SERVNYKPGMRVLTKMSGFPWWPSMVVTESKMTSVARKSKPKRAGTFYPVIFFPNKEYLWTGSDSLTPLTSEAISQFLEKPKPKTASLIKAYKMAQSTPDLDSLSVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Variation in Pwwp Domains
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Nuclear protein
molecule keywords HYPOTHETICAL 62.8 KDA PROTEIN C215.07C
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1h3zA00
2LVMA 4LD6A 3OS2A 3S3OA 2RHZA 4QVZA 2FHDA 2DIQA 3FEOA 2G3RA 3DLMA 3E9GA 4GY5A 2O4XB 3OY9A 1RI0A 2M16A 5J39A 1OZ3A 2NLUA 2R58A 5D6WA 3OYLA 3OYKA 3P8DA 3ME9A 2XDPA 2L89A 2MWPA 4PLLA 3L2VA 2PQWA 3FC3A 2EQKA 2GF7A 2XK0A 3OYMA 2EKOA 1WGSA 3L2WA 5FRMA 3OMCA 3H8ZA 2CKKA 4II1A 4C5GA 2M1HA 2R5AA 3QKJA 4L59A 3NTIA 4QW2A 2M0OA 2R57A 1OYXA 4E7JA 1WJRA 2P0KA 2X4XA 4N4IA 4Z02A 3OS0A 5KE3A 3NTKA 5C6SA 2VYTA 4EDUA 2BIVA 4NS5A 3OYEA 2D9TA 3GOXA 4C5HA 1XNIA 2E5QA 2K3XA 2R5MA 3PMTA 2EQUA 4Q5WA 2RI2A 4BE0A 3OYDA 5KE2A 4IUPA 1MHNA 2RI3A 2RHYA 3S3NA 3F70A 2IG0A 4E7HA 4PL6A 3MP8A 2RJEA 3PNWC 4UC4A 2L8DA 5KH6A 2GFAA 2BKDN 4IUVA 3OS1A 2WACA 3LLRA 2RHUA 3L2QA 3ZEHA 3MP1A 2BUDA 3MEAA 4A4FA 4B9WA 4ZTFA 1OI1A 3C4SA 5FRNA 2QQRA 4C5IA 3O8VA 2LTOA 5IN1A 3UWNA 4A4GA 3Q1JA 4QQGA 3QBYA 5KCOA 2JTFA 4PLIA 5M9OA 3OYHA 2L3RA 3DB3A 1N27A 2HQXA 3OYAA 3E9FA 2RJCA 3MEWA 4E7KA 4E7IA 2LRQA 3MP6A 3OMGA 3MEVA 5C0MA 4BD3A 3FLGA 4E7LA 4QQDA 5D6XA 4BE1A 3LH0A 3OB9A 2RHIA 2MWOA 4QQ6A 3QIIA 1KHCA 3M9QA 3OYNA 3H6ZA 4BDZA 2QQSA 3EAEA 2X4WA 1SSFA 5CIUA 2X35A 4IURA 4OVAA 3UT1A 5KCHA 3SD4A 2JZ2A 4A4EA 1G5VA 4IUUA 3MO8A 1OZ2A 4IUTA 5J26A 3NTHA 4C5EA 3L2UA 4CRIA 3OA6A 3L2RA 2RHXA 3ASKA 4BACA 3LX7A 2YRVA 2DIGA 3P8HA 2EFIA 4N4HA 2F5KA 3BDLA 2HQEA 5D6YA 3OQ5A 3KUFA 2RO0A 4RG2A 2DAQA 3LYIA 4FU6A 2RJDA 3S6WA 3OYBA 2X4YA 3FDRA 3S3MA 5FROA 4BE2A 1WJSA 3LGLA 4IUQA 2B8AA 2E6NA 1WJQA 4A4HA 2EQJA 5IAYA 2LCCA 3OYIA 4BDYA 2RJFA 4ZTJA 3LGFA 1H3ZA 2O4XA 2K3YA 3OYJA 4FL6A 3OYCA 3CEYA 3MEUA 3L42A 2RI5A 3META 4HCZA 4B9XA 3OYFA 2EQMA 3QJ6A 3PMIA 3OYGA 4IKFA 2LDMA 3PFSA 4N4GA 2GFUA 3DB4A 4X34A
chains in the Genus database with same CATH superfamily
4LD6A 4V2SA 3S3OA 4ELZC 1VQLA 5IHNA 4LD9K 4ZNXA 2M16A 2NLUA 2R58A 2NUZA 1CSKA 2WSCE 4EPCA 2FEIA 5I2MA 1QCOA 4JJCA 1D1BA 4A63B 4F7UG 3GLXA 3CC2A 1K9MR 1RAIB 5CKDA 2PNIA 2JT4A 2HQHA 1GRIA 5IH2A 1JQQA 1B7TA 2GBQA 1RABB 3CCUQ 4MDWA 4C92D 3QZ9B 1SPKA 1ZUUA 1M90U 5CR2A 3E1SA 4BE0A 5LJ3e 5KE2A 4E47A 4KT0E 4KULA 4C92A 5I2SA 4AFZC 1K9MC 2BKDN 2DYIA 4PJNA 2RHUA 3CCRQ 3EH2A 1MGQA 4E7SA 2RQUA 1OI1A 2YUNA 2QQRA 1K73C 4C5IA 2QA4A 3Q1JA 3QBYA 1IHWA 4BI3A 2L3RA 3REBB 1KD1R 3E9FA 3EHRA 3I5SA 4E7KA 2ENMA 1JJ2A 2YLBA 4HCCA 2ATCB 3C0CA 3CCEA 1TTHB 4J9GA 3LH0A 3CC4T 1VQ7Q 3QIIA 1KHCA 2QASA 2Y4XA 2L3PA 1MNEA 1K0SA 4HA8A 5KCHA 1M90R 4RKUE 1QQJA 4IUTA 4C92C 1K4US 1VQ4T 2CZ0B 4XAXB 4BI8B 3FJPA 2QQBA 3S6WA 2A28A 3OYIA 2E3HA 5LJ3g 3G6EQ 4PJLA 3L42A 1M5Q1 4IKFA 2D8JA 2E1HA 2XMFA 4N4GA 3VYHB 3X20B 4CC3A 3H0FA 1N9RA 1YWPA 2CUBA 3EG2A 3SDZA 2NUPA 1BYMA 1TU0B 3RUXA 4LNPA 3TU4K 2G3RA 3DLMA 2A08A 1EX4A 4LXCA 3G1JA 1QVFA 1TXQA 2MMPA 1VQMQ 4CI0C 3CCMA 2LNVA 4BY6B 3OMCA 3CCQQ 2CKKA 4L59A 2X4XA 2KNBB 2OAWA 2X3XD 3I56T 1X2QA 4PJOC 4NS5A 4M75F 1UGVA 2O2OA 3RDVA 4MZMA 1S1NA 4OMFB 2VUBA 1D1CA 5KYNA 5FU7B 5D7UA 3OS1A 1M3CA 1JXMA 4KGZB 4YTLA 1VQ9T 2AKLA 2K5FA 3UDCA 2KRSA 4RTTA 1BI3A 1QWFA 3OYHA 3JB9D 1N27A 1KJWA 1I1JA 3SB2A 1OULA 2D6FA 3G7ZA 1RACB 4QVDA 1VQNA 3M5AA 4QQ6A 1AWWA 5GAN3 4CC2A 2DL8A 2DPPB 1FMKA 3OSSC 3L2UA 4O6JA 2BE7D 2LX7A 2ZPGB 2M51A 5A0GA 3CMAT 2FZCB 4NOYA 2HMAA 4J83A 1MNDA 2I2LA 4LE9A 3CC7T 1AOJA 3VS3A 3OYBA 2VASA 2X4YA 5I22A 1BU1A 1EFNA 2JNGA 1JEGA 5IHIA 3CMAQ 3OYCA 3MEUA 2RI5A 1KG1A 1BIAA 1CKAA 3CCRA 2GFUA 4C92G 3DB4A 1VQ6A 5GJVB 1QW1A 2FB7A 2I0NA 3M0RA 4GBQA 2K5IA 4JRQA 2CYZB 2L2PA 3A8HB 2CH4W 2DXUA 1QVGA 3PE0A 1PHTA 2MF2A 2RD1A 3X25B 2CREA 1NEGA 3LWIA 5L8RE 3REAB 2KROA 3OS0A 1YIJQ 2FPDA 4M78A 4EDUA 2ZPEB 3CCLA 2C0IA 1BB9A 5I21A 1KFZA 1YIJT 3SHWA 3JCMe 3H41A 5FU6C 1WHJA 1E6HA 2O88A 3CXCA 3JCMg 5FU6B 2KR3A 3C4SA 4DEYA 1GCQA 1QCFA 2FO0A 1WHKA 2EWNA 1Y96B 2ROLA 2P4RA 4J6YA 2JTFA 3M57A 1MV0B 1Z9ZA 1WXUA 2KGTA 2M0YA 4OGCA 3CMEQ 1X69A 5C0MA 4OB3B 4QQDA 3G4SA 4C0GA 3CPWA 3OB9A 4M7AG 2ZCFB 2LQNA 4OVAA 5GAOp 3SD4A 2Y90A 1K76A 3NTHA 4M75G 4AFUC 1NG2A 4C8QF 1UGPB 2IIMA 1XOVA 3GP8A 1YITT 2E41A 4HT8A 2VXFA 5LJ3d 1R0BG 4BY6C 5LJ5g 2DAQA 4FU6A 1IXDA 3RMSA 5GANf 1YJWA 2EQIA 1H3ZA 1NJIR 3MJXA 2W0ZA 3JB9J 1WFWA 1VQ6Q 5FLXE 3CCVQ 2LDMA 1HK9A 3HKSA 2NUPB 4M7DG 2HBWA 1H3HA 3G4ST 1R8OB 3PIPA 3C95A 5GAOr 1X6BA 3OYLA 4ESRA 1JJ2S 1Q82C 2EGCA 1U1TA 1ZHIA 2EKOA 1KD1U 4J5YA 1NBEB 2K7AA 3JB9G 2OJ2A 3T9NA 3FRNA 1WI7A 2DZ9A 3RESA 1YJWT 1NJIU 5KYXB 3VJPA 1M1KU 3OYEA 1KQ2A 5HK0A 1BBZA 2RH2A 1UB4A 5FWBA 5GAN6 4MMLA 1MHNA 4JS4A 1C6VX 1D0XA 2LQWA 3RERA 2QGGA 4PL6A 2L3SA 3VS1A 4OB2B 5KH6A 2SEMA 4X9CA 3INZA 3LLRA 4QVCA 2P0PA 3L2QA 4RCCA 4L6V5 4E2FB 4XTVA 1SRLA 5GAMj 3EFOB 4QQGA 2FPFA 4C0DC 2MOXA 4KH0B 5GMKi 2YDLA 5GMKh 2GTOA 4J7FA 4N0AC 4C92F 2HDAA 1Q81U 4M78D 1PD0A 5CKEA 2RK1A 5D6XA 4HVUA 5A0LA 1ARKA 2AKKA 1ZSZC 2E65A 1PM3A 3I56Q 2DX1A 2DL5A 3RR6A 1G3WA 5KYUA 1IRXA 1VQNT 5GAMf 2FPEA 4L5GA 3BDLA 4O5VA 3OW2P 1I07A 3M0UA 2B8AA 5CQXA 3JCMX 2EIFA 4BDYA 1ZUKA 4MZTA 2RJFA 4LDUA 1YI2Q 2VC8A 2CZ1B 3CEYA 1LVKA 5CKHA 1UUEA 3NHNA 4KH1B 3G71A 1M4ZA 1PWTA 1ACMB 2LJ1A 4M7AC 4J9EA 4XU0A 1YHQQ 4OP0A 1M2VB 3WVDB 4EIKA 2YHTA 1YFNA 3JCMP 4JPBW 2VGNA 1SEMA 4EMHA 2GF7A 1IO6A 4C8QC 3EGDA 3G4SQ 1VQNQ 2W10A 4F16A 4LUEA 2DTOA 3BE3A 4II1A 1M27C 2M1HA 2EJ9A 1VQMA 2ECZA 2QTXA 4M77G 2QG9B 3M58A 1N8RR 2QDYB 3VRYA 3R6OA 1P92A 2VXEA 2MK5A 2D9TA 3CC7A 3PGGA 5KYYA 3G71T 2QDLA 5CCAA 2DVJA 3I35A 3VUZA 3S3NA 2A36A 2K4YA 3JCMd 1KK7A 1YJWQ 4DOWA 3VKIA 1W4SA 5KYWB 4M7DF 2C06A 5KYWA 1W6XA 3JCMW 2RQWA 2DF6A 3UWNA 4NL3A 1RLPC 5GAN4 1WHHA 1KC8C 3CCSA 2DJQA 1Q7YR 2M9UA 2DERA 1YN8A 4XTXA 3MP6A 3AHUA 3TEEA 3V8JA 2O01E 1TWBA 2LQKA 4BE1A 2HSPA 3M9QA 4D8DA 4EMKB 1M9SA 1K8AR 3OYNA 2ABLA 3BFMA 1VQ4Q 2WSFE 3GNGA 3HFOA 1OV3A 3HRSA 4F7UF 2AZVA 5GAN5 2A37A 3NFCA 2J6FA 5I11A 1JU5C 2K79A 1FYNA 2HQEA 2LZ6B 1E7OA 2AZSA 4FT2A 1GXIE 2OX7A 4Z88A 2EYXA 3RKWA 1QVFP 2DRKA 3JB9F 3QWXX 4JDSA 5KYUB 1FMVA 3N5BB 4HCZA 2EQMA 3JCMJ 1QMCA 3VUBA 2RN8A 4FYVB 3PFSA 2QTVA 4LN2A 5GANj 2E10A 3OBWA 2JOYA 2LX9A 2EVRA 4C0FA 3OY9A 4X1VA 4M75D 3CMEA 2P4TA 4HT9A 4HXJA 1OU8A 3CC2Q 2CP7A 1KQSP 1ZLMA 1H641 2CP3A 2NYSA 1QLYA 1K73R 2DETA 1M2OA 2NWMA 3CCJT 1ZSZB 2XDBA 2P0KA 4OF1A 1HYOA 3HTRA 3KFVA 1UEBA 4J8OA 2P84A 4FSSA 2P0QA 2D0QB 1U3OA 5GAOm 1U06A 3EG0A 3OYYA 1NLPC 3QYHB 1OPKA 2KRMA 1X75C 4E7HA 3EFSA 4IUVA 2BE9B 2XU8A 1RL2A 3RNJA 1TSFA 3CCMQ 2EAYA 1TUDA 4FT4A 3CCSQ 2LCLA 1ZA1B 4J7IA 2X51A 5LJ5h 2DBMA 4E7IA 1PNJA 3C94A 3QDRB 3L1AA 3CD6T 2J06A 1FX7A 2QQAA 1BCMA 2RHIA 6AT1B 2E3IA 1OX8A 3WVEB 4F04B 5J3BA 1SSFA 1D3BB 2JZ2A 2PVOB 3KXTA 1OZ2A 2FZKB 3PVQA 1QWEA 2DIGA 2EFIA 3EFRA 1NYFA 4M7DC 1HD3A 3QSUA 1KC8R 1AWJA 1RAEB 2RJDA 1GFDA 2LT4A 4BE2A 1VYVA 1WJQA 2EQJA 5GAOl 4XTYA 3OYJA 1RAAB 2A3LA 2PUOB 5GANd 2DNUA 4AFSC 2QEXQ 2QA4T 2D0NA 2B86A 2VKNA 5GAMh 1BCOA 3M0SA 1PG5B 5ECAA 2FHDA 1YJ9A 1YI2T 1W70A 2CP5A 2J05A 3CBOA 2GQIA 1IGUA 2NUTB 3CPWP 3EHQA 5CVIA 1UFFA 3FJ5A 1G8XA 2RA2A 4F17A 5FW9A 4RMOA 3NTIA 4IIOA 1VQ4A 2M0OA 2X3WD 2KT1A 1WIEA 2CP2A 4N4IA 3CC2T 4Z89A 2QGFB 2K2MA 1D0YA 2HEQA 4K11A 2EQUA 3THKA 2XDDA 3OYDA 2RHYA 3ER0A 5CKFA 3M55A 4N0AA 2DK3A 2L0AA 3JRZA 4B9WA 1VQ6T 4RTWA 4ORZA 1W2BS 3CCRT 4A4GA 2SRCA 5M9OA 4JUVA 4OB0B 2CP0A 2RK2A 2DE0X 3QO3A 2OTJA 3OBYA 2YRCA 3A8LB 3FLGA 2KYMA 1B07A 4R0KA 1M8MA 1G3YA 2KYBA 2V8JA 1VOMA 1M1GA 1VA7A 1NEBA 1D3BA 2JTMA 2DD4A 2K9GA 2LMJA 3EGXB 4M77A 4RTXA 5GAMe 2F5KA 3TREA 1VQKQ 3KUFA 2RNAA 1N6AA 1JO8A 1LCKA 4ME7A 2ED0A 2YRDA 2LCCA 5LJ5d 2E4HA 2KXCA 4R55A 3CBPA 1VQPQ 2FYKA 2G6FX 1JBMA 4KGXB 1YJNA 5GAOn 1LOJA 1FWZA 2EJFA 1YI2A 3FEOA 4GY5A 3E9GA 1EZZB 2DYBA 2JTEA 5D6WA 1GCQC 4PJOA 2XDPA 2EBPA 3FC3A 4M78E 1TH7A 1AD5A 4M77D 4ZGDB 2CUDA 2MI6A 4F7UB 3M56A 2EYWA 2YUQA 4NL2A 4OMPA 2F1LA 3CCLT 3M0TA 2RPNA 4RG8A 3JSCA 1UGQB 2DXBA 2ZPFB 2E5QA 9ATCB 3U23A 1I5LA 3PMTA 1WYXA 1K9AA 3QHSA 3CCUA 3VS4A 1X27A 1B34B 1WQWA 1KC8U 4ZGJB 4GLMA 1ZUYA 1AVZC 1WPYA 5FRNA 2ZPHB 2COZA 3ZBDA 3QPHA 1SF9A 4JZ3A 2IVWA 4E6RA 2E12A 5HY6A 2AK5A 4M75B 4XU1A 3QZ5B 1MUZA 1UDLA 2EYZA 3CC4A 1X6GA 1QKXA 3GIBA 1GFCA 2QI2A 2F5TX 1GBRA 4AG2C 3CQTA 2FG0A 2X4WA 3FIFA 5EG2A 3URGA 4DQ2A 2JJ9A 1ZQ1A 4OMNA 3JCMV 2KSSA 3LX7A 1H92A 1K73U 1Q82R 2Z0WA 4ATOA 2PU9B 3CCJA 3CD6Q 1C0MA 5IAYA 5DLOA 2FL7A 4FL6A 1GCPA 3L2ZA 2FRWA 5HK3A 3CCEQ 1UGRB 5GJWB 5IHKA 3CCVT 1QVPA 1M90C 4M7DA 2EGAA 2CH4A 2RB6A 4JS5A 1I4K1 2EW3A 1OOTA 2XICA 2BTTA 2MWPA 4PLLA 3PIOA 1QKWA 1Y0MA 3CCJQ 1OU9A 2L5QA 5IXFA 2OI3A 3M0PA 3CXCP 2RQRA 1V76A 2YLCA 3NTKA 3SWNC 2KE9A 3J7AF 1YCYA 4Y91A 1RAGB 2CZ6B 1PKTA 1WNLA 2CSQA 2CSIA 2RM4A 4M7AA 2DXCA 2DFUA 1VQ9A 1WA7A 4MDXA 2ZPBB 4M7DD 3A8MB 1GL5A 2GFAA 1AEYA 4WTOB 4DEXA 3TSZA 2QA4Q 1K8AC 2DL4A 2EGEA 1PD1A 2MIOA 4BUGA 1YJ9Q 4JRKA 4HCKA 4ZGEB 1V29B 4C8QD 3OMGA 1KQ1A 1ZBJA 3MEVA 2V26A 1BI1A 2M02A 4BDZA 2QQSA 2E6ZA 4AMCA 1NJIC 1IHVA 2DILA 2JMAA 4M78G 2KQWA 1G3SA 3EG9B 4GLKA 3WXMB 2XD0A 3QXEB 4E7ZA 4RG2A 3HFNA 3S3MA 2X4JA 5GAN8 1M2VA 4DBFA 3H0IA 2EPDA 2QEXT 3E2UA 5CQYA 1RI9A 1VQ5Q 1A0NB 4XQ3A 1AT1B 4PK4A 2RHZA 2LQ8A 3DLLA 3A8GB 2D8HA 1G83A 2XKOC 1T0JA 1VUBA 2HNIA 3LW5E 2JM8A 4AFQC 1AHJB 2X9HA 3EG1A 1WXTA 2V8IA 3H8ZA 4J9CA 3QKJA 2BZYA 3CCMT 2R57A 3CMAA 1Q86U 3EG3A 2VYTA 5GAMd 3M54A 2MCNA 2NUTA 2EJGA 4C8QE 2WSEE 3V8KA 3X28B 2DD5A 2YUPA 1WX6A 4EMKC 2RI2A 3CPWS 2VWFA 2YUOA 2L8DA 4KRTA 4A4FA 4ANJA 2DRMA 4MZPA 3FB9A 2VV5A 2KDSA 2C0OA 3X26B 4M75E 5KCOA 1YBYA 1I8FA 3VYGA 1N8RC 1O9SA 4J6WA 1N9SA 3G6ET 2LRQA 1HJDA 3P8BB 2HCKA 1QVFS 4XU3A 4JRPA 3J81E 1YJ9T 4IIMA 2K57A 3MHXA 4PJMA 1TOVA 4KUIA 3D7SB 4CRIA 5GMKe 2CT3A 1SSHA 1Q86C 1UE9A 1YITA 1VQ8T 1PRLC 4M77C 4QKUA 3HHTB 4DBHA 1WJSA 1I5OB 3CXCS 2HKQB 4C92B 1AZEA 4JJBA 1YIJA 1D0ZA 4B9XA 1QVGP 2F2WA 2KRNA 3PT9A 2PTKA 2YSQA 1T3LA 1Q81R 1O75A 1WZOA 4QVZA 5DY9A 2DIQA 2F2XA 2VB6A 4M75A 2O4XB 3BY7A 3OSVA 3G71Q 3P8DA 3ME9A 2L3QA 2COWA 2YWWA 2PQWA 4PFOA 1WHGA 3TQ7P 1WGSA 3UPUA 4M78F 4WF2A 4C5GA 1CKBA 4J9FA 2FRYA 1R77A 1WJRA 1DJ7B 4JLGA 2EKHA 1EIFA 4OB1B 5AYFA 4J9DA 1RAFB 4M7AD 1JJ2P 4DBRA 2A7YA 1Q7YC 1MMNA 1X43A 4A54A 2RQTA 3MP8A 2JMCA 4A53A 1MMGA 1B34A 3ZFJA 2BUDA 4ZTFA 2JW4A 1VQOA 1OQKA 5IN1A 2LTOA 1M8VA 2DL7A 2HQXA 5FU7C 2OTJT 2E64A 3R6NA 2EYQA 2COYA 1YITQ 2DEQA 3TCJA 2DJZA 4KGVB 1QVGS 3PTAA 4A4EA 1YNZA 2GQVA 5EC7A 1G5VA 1ZA2B 2AT1B 2QQ9A 5CK9A 1RAHB 1VQ8A 1Y07A 2HL5C 1UG1A 4P5NA 2RMOA 2RO0A 5DM7R 3EH1A 3LGFA 2YXYA 1WQ7A 1M1KR 2KXDA 2ZGWA 4Y28E 3CCLQ 1YP5A 4X34A 1SHGA 1VQLT 3G6EA 2DMOA 3I9QA 5GMKj 5J39A 4RCBA 4X9DA 2XHCA 1OEBA 1T3SA 1AWOA 3EGUA 2MAMA 1M1KC 2LC4A 1VQLQ 4HVWA 5LJ3h 4QW2A 1VQ5T 4E7JA 2GCXA 1U8RA 1KD1C 3I55A 4LDXA 4PJOG 3GOXA 4C5HA 1XNIA 1PSFA 3SWNB 3CC4Q 1VQ7T 1LJOA 1F1BB 4JLIA 1VIFA 1Y71A 4IUPA 3I5RA 3F70A 4FYWB 2HD0A 3SEMA 1HSQA 1M30A 1ZSGA 3LH5A 3QUIA 2WACA 1XTDA 1D09B 1IREB 4XTUA 4HCBA 2KK4A 2FVUA 2K2VA 4FCYA 3O8VA 4A4KA 1TS9A 1YWOA 2XI9A 1ABOA 3AT1B 3HRTA 1K9MU 3GF5A 3UF4A 2JVVA 3MEWA 2VVKA 4XTWA 3J80E 4PJJA 4AT1B 4PJOD 1S72T 4AG1C 3OW2A 3I56A 1MMDA 5CAIA 1BIBA 4LDYA 3M4YA 3CCET 4IURA 3UT1A 4IUUA 2DTHA 3X24B 1G2BA 4Z8AA 1I81A 1N5ZA 1BK2A 3P8HA 4LDVA 1AZGB 1XJWB 2DBKA 5LJ3j 1VQKT 3QDFA 3V8LA 3TSWA 2YT6A 4FW2A 4HVVA 5IT9E 2O9SA 2OTLA 1RADB 2O4XA 1H8KA 3JCMb 4CC4B 3A8OB 3OYFA 3OYGA 4J9BA 1Y7XA 4M7DB 3NPFA 2HSEB 1VQOT 1NPPA 1JB0E 1SHFA 1NZ9A 1OZ3A 4JZ4A 4LUDA 4B6MA 1MV3A 5KYXA 3V7RA 4C8QA 3HL8A 4MMKA 1PCXA 3EFOA 2KMTA 4J9HA 2PZ1A 2CT4A 4J9IA 1R0CB 3IQLA 2ZZDA 4RTVA 1Q82U 2BIVA 4D6WA 1SG5A 2R5MA 1K8AU 3NGPA 1M3AA 2BZXA 2RI3A 4M77E 1KQSS 1NPRA 1U5SA 5LJ3f 4R56A 3DKMA 2H3JA 2HBPA 4C8QG 5LL6S 5LJ5f 4M7AE 2ZAEA 3PVLA 2F2VA 4C8QB 5GANg 2JM9A 3UA6A 1UTIA 1TUGB 4XTZA 3DB3A 3TVTA 2A0FB 3VS7A 3OYAA 4DA4A 2RJCA 2BZ8A 3GBQA 4OMQA 2DXTA 4VUBA 4RTYA 3UA7A 4PJOB 4E7LA 2XG8D 4F7UA 3CCST 2GGRA 4OMMA 5AT1B 3H6ZA 1YHQT 3M59A 2HL3A 4C0DB 3I55T 3KBGA 3MO8A 1RUWA 4C5EA 5J26A 3EGXA 1BKBA 4M77B 5GANh 1LNXA 3L2RA 2KVQG 1NM7A 2JS0A 2YRVA 3JV3A 1W2BP 2KBTA 2CP6A 1K1ZA 2RF0A 4WCIA 4A4HA 4PFZA 2GNCA 1JXOA 4PJOF 4BI4A 1KQSA 3C12A 2K3BA 1FMWA 1OX9A 7AT1B 3MKDA 2LVMA 2KT8A 1C1AA 4M78C 2ZPIB 2DTIA 3CCVA 1VQPA 2ED1A 3OYKA 3JAME 4M78B 2L89A 3JCMc 4OMOA 2ESWA 2XK0A 3OYMA 3ZL7C 2GTJA 3O5ZA 1Y96A 2R5AA 5GAOq 3JCMh 2LNHB 1HXDA 2AHJB 1OYXA 2DO3A 4Z02A 2XIDA 4DBQA 5C6SA 4ZN3A 4F14A 1WHMA 1M3BA 4CC7A 3RKXA 3QG1A 8AT1B 2FZGB 2HKNA 4UC4A 1KIKA 1QCNA 1VIEA 4OMLA 1TG0A 3ZEHA 1QP3A 1UJ0A 3EGDB 1YJNQ 2LT1A 4PLIA 5GAN2 4ELYC 1D1AA 3A98A 2HZYA 1PC0A 3RIRA 1IZ6A 4BD3A 2DL3A 2V8KA 4FSXA 1RLQC 3VS6A 3EAEA 4RUGA 5DLQE 2X35A 4FYXB 1YCSB 2V1RA 3OA6A 1S72Q 3HPWA 5GAN7 3UATA 4N4HA 1ABQA 1MMAA 4M7AB 5GMKl 5D6YA 3VS2A 1OPLA 3LYIA 1VQ5A 2JXBA 5FROA 2H8HA 1G3TA 1U1SA 4FM4B 4XU2A 3META 3HSBA 3JCMf 2CS7A 2LCSA 1Q7YU 1IB8A 3RKYA 4Y92A 1VQPT 3OS2A 3RMQA 4JRIA 1WLPB 1X01A 4LDWA 4HKEA 4JJDA 4BB7A 5LJ5j 2H3EB 2D1XA 2MYSA 1VYTA 3V7CA 4M7AF 3GPLA 1X6OA 1UGSB 1KHIA 3NMZC 4RTZA 1VQMT 2IPOB 1UJYA 2EQKA 5FWCA 2J6KA 3L2WA 5FRMA 3OW2S 2J6OA 2J7IA 5HCKA 1PKSA 1UECA 4D8KA 3VV0A 1K0XA 2OAUA 5KE3A 2AIRB 4C0ZA 1E6GA 2PUKB 3GNFB 1VYUA 3QYGB 3CBMA 4KBMB 3CCUT 2OTLT 2LP5A 1YJNT 4M7DE 2RJEA 3PNWC 1PRMC 2DVEA 4M75C 1IGQA 2QAZA 2VGMA 4JJNK 1VQ9Q 1VQKA 3A5ZB 1SRMA 1BI0A 3E19A 2OTJQ 1WXBA 1SKUB 1UHCA 1NYGA 3VS0A 1Y57A 2CDTA 1WDXA 5A0DA 1S72A 4XK8E 2QYZA 3CPFA 5A2QE 3RBBB 5CIUA 5CO7A 1Q81C 2KAFA 5GAMg 3CCQT 3ASKA 4BACA 1T0HA 4PFPA 4RTUA 4PNOA 2QK0A 1V1CA 5IXBA 1AWXA 2F69A 2HAXA 4ZTJA 1Z9QA 2LJ0A 3V7SA 3QJ6A 2JN0A 3ULRB 3CD6A 4FYYB 4EMGA 2C0TA 1GBQA 2Y4YA 3VS5A 2KI7A 2OTLQ 2K6DA 3H0HA 2DLPA 2E5KA 2DA9A 2PVGB 1ZSZA 3HP9A 1B3QA 2JUFA 1RI0A 3CMET 1Q86R 1ZX6A 3L2VA 3A1PA 3JB9I 4PJOE 4EMKA 1YHQA 2JS2A 4C92E 3I55Q 4FW1A 3M4GA 5CKBA 4TVRA 3VRZA 2DEUA 3SWNA 1I0CA 1QP2A 3VU3C 4ZN1A 2CZ7B 2KY9A 1JRIA 2K3XA 4DOVA 4F7UE 3SFMA 4Q5WA 3CC7Q 5GMKm 2DM1A 5LJ5e 2IG0A 2DKGA 4J6XA 2EYYA 3BDUA 2RQVA 1UHFA 1Q95G 1WHLA 3MP1A 3MEAA 3QWYA 1X2KA 4OGEA 4PKCC 3OS5A 3BW1A 4M4ZA 2PVDB 2KEAA 1PSEA 1NLOC 3EG9A 1BI2A 3MCAB 4QT7A 2V1QA 4FIBA 3JB9H 2ROTA 2QXFA 2K5LA 2MWOA 3LWHA 3CCQA 1VQ8Q 5KYYB 4M77F 1TUCA 1W1FA 5HKCA 1NE8A 2MPXC 2O9VA 2RHXA 1VQ7A 1FXXA 1W2BA 1J3TA 1LPLA 2DZCA 3OQ5A 3QJYA 3JCMQ 4KUDK 2QEXA 1N8RU 2LJ3A 3FDRA 4IUQA 3LGLA 3MPUB 3M53A 2E6NA 1M1FA 1ZBXA 2E70A 2K3YA 3HRUA 3M0QA 5L23A 2O31A 5GANe 3PMIA 1VQOQ 1KSWA 8ATCB 1XQHA 2CGHA 3H9NA
chains in the Genus database with same CATH topology
4LD6A 4V2SA 3S3OA 4ELZC 1VQOT 1M90C 1VQLA 4M7DA 4XU0A 4OP0A 2RB6A 4LD9K 1NPPA 3WVDB 1JB0E 4JS5A 1I4K1 1NZ9A 2M16A 1OZ3A 2NLUA 2R58A 2XICA 2YHTA 3JCMP 2WSCE 4EPCA 2VGNA 2MWPA 4PLLA 3V7RA 4EMHA 3PIOA 4C8QA 2GF7A 3HL8A 4C8QC 5I2MA 4MMKA 2DTOA 4F7UG 4II1A 2L5QA 3GLXA 2M1HA 2KMTA 3CC2A 2EJ9A 1VQMA 2QTXA 4M77G 5CKDA 2ZZDA 2YLCA 3M58A 3NTKA 3SWNC 1Q82U 2QDYB 3J7AF 1YCYA 2BIVA 3R6OA 4Y91A 1P92A 2VXEA 2CZ6B 3CC7A 2D9TA 3PGGA 4MDWA 4C92D 4D6WA 2R5MA 1K8AU 3QZ9B 1M90U 1WNLA 3G71T 5CCAA 5CR2A 2RM4A 3E1SA 4M7AA 2DXCA 5LJ3e 4BE0A 1VQ9A 5KE2A 3VUZA 4KT0E 2RI3A 4M77E 4KULA 4E47A 2K4YA 3S3NA 1KQSS 2ZPBB 1NPRA 4C92A 4R56A 5LJ3f 4M7DD 3DKMA 5I2SA 3JCMd 4DOWA 3A8MB 1K9MC 2GFAA 3VKIA 2BKDN 2H3JA 2HBPA 4C8QG 1W4SA 5LL6S 5LJ5f 2RHUA 4M7AE 4M7DF 1MGQA 2C06A 1K8AC 1OI1A 4C8QB 3JCMW 5GANg 2QQRA 1K73C 4C5IA 3UWNA 2QA4A 3Q1JA 4NL3A 3QBYA 4BUGA 4XTZA 4BI3A 5GAN4 4JRKA 2L3RA 1KC8C 3DB3A 3OYAA 3E9FA 3CCSA 4DA4A 2M9UA 2RJCA 1V29B 4ZGEB 4XTXA 4E7KA 1JJ2A 4C8QD 4VUBA 2DXTA 2YLBA 3MP6A 3OMGA 1KQ1A 4HCCA 3TEEA 3AHUA 3V8JA 2O01E 3MEVA 3CCEA 4PJOB 2LQKA 4E7LA 2XG8D 4F7UA 3CCST 3LH0A 3CC4T 4BE1A 1BI1A 3QIIA 1KHCA 3M9QA 4EMKB 1M9SA 3OYNA 2Y4XA 3H6ZA 4BDZA 2QQSA 2E6ZA 3BFMA 1YHQT 3M59A 2WSFE 1NJIC 4HA8A 3GNGA 3HFOA 4C0DB 5KCHA 3HRSA 4F7UF 3KBGA 4RKUE 3I55T 5GAN5 4M78G 3MO8A 2KQWA 1G3SA 4GLKA 4IUTA 5J26A 4M77B 1BKBA 2CZ0B 4C5EA 3WXMB 4C92C 3NFCA 1LNXA 5GANh 1VQ4T 3L2RA 4XAXB 4BI8B 2XD0A 2KVQG 3QXEB 2YRVA 3FJPA 2HQEA 2QQBA 4FT2A 1GXIE 4RG2A 3HFNA 3RKWA 3S6WA 3S3MA 3JB9F 2X4JA 3OYIA 4JDSA 4A4HA 5GAN8 5LJ3g 4PJOF 4BI4A 3N5BB 2QEXT 1KQSA 3L42A 4HCZA 3C12A 2EQMA 3JCMJ 1M5Q1 5CQYA 3VUBA 4IKFA 3PFSA 2E1HA 4N4GA 3VYHB 3X20B 4XQ3A 5GANj 1N9RA 2E10A 2LVMA 3SDZA 2RHZA 3OBWA 2LQ8A 1BYMA 2JOYA 3DLLA 3RUXA 3TU4K 3A8GB 2G3RA 3DLMA 2ZPIB 2LX9A 4M78C 1QVFA 2DTIA 4C0FA 2MMPA 2XKOC 3OY9A 4M75D 3CMEA 1VUBA 3CCVA 1VQPA 4CI0C 2HNIA 3LW5E 3JAME 3OYKA 2P4TA 4M78B 2L89A 3JCMc 4HT9A 3CCMA 2XK0A 3OYMA 2LNVA 1AHJB 4BY6B 1H641 1Y96A 3OMCA 2V8IA 3H8ZA 2CKKA 2R5AA 3QKJA 4L59A 5GAOq 3JCMh 3CCMT 3CCJT 1HXDA 2AHJB 2R57A 1OYXA 2XDBA 2DO3A 2X4XA 2P0KA 4Z02A 3CMAA 4OF1A 1Q86U 2XIDA 5C6SA 2VYTA 4ZN3A 1UEBA 4J8OA 3M54A 4C8QE 5GAMd 2EJGA 3I56T 4PJOC 4NS5A 2P0QA 4M75F 2WSEE 2D0QB 3RKXA 3V8KA 3X28B 3QG1A 5GAOm 2DD5A 3CPWS 4MZMA 2RI2A 4EMKC 4OMFB 2VUBA 3OYYA 3QYHB 1X75C 4E7HA 3EFSA 4UC4A 2L8DA 5FU7B 4IUVA 3OS1A 2XU8A 1VIEA 4YTLA 1VQ9T 1RL2A 3ZEHA 2K5FA 4A4FA 2EAYA 3UDCA 4MZPA 1QP3A 3FB9A 2VV5A 4FT4A 2KDSA 1BI3A 3X26B 4M75E 5KCOA 2LCLA 2LT1A 4PLIA 3OYHA 4J7IA 1YBYA 1I8FA 3JB9D 5GAN2 1N27A 4ELYC 3VYGA 3SB2A 1N8RC 1O9SA 4J6WA 1N9SA 5LJ5h 3G6ET 4E7IA 2LRQA 2D6FA 3C94A 3G7ZA 3QDRB 4MDXA 3P8BB 3L1AA 3CD6T 3RIRA 1IZ6A 4BD3A 1QVFS 4XU3A 1FX7A 2QQAA 4QVDA 2V8KA 4JRPA 3M5AA 4FSXA 1VQNA 2RHIA 4QQ6A 3J81E 1YJ9T 5GAN3 3EAEA 2DPPB 2K57A 3WVEB 3MHXA 1SSFA 5DLQE 5J3BA 2X35A 1D3BB 4KUIA 2JZ2A 2PVOB 3KXTA 3OSSC 1OZ2A 3L2UA 4O6JA 4CRIA 3OA6A 2ZPGB 5GMKe 5A0GA 3HPWA 3CMAT 1Q86C 5GAN7 4NOYA 1YITA 2DIGA 3EFRA 2EFIA 4M77C 4N4HA 1VQ8T 4J83A 4M7AB 5GMKl 5D6YA 4M7DC 2I2LA 3QSUA 3CC7T 1VQ5A 3HHTB 3LYIA 2RJDA 2LT4A 2X4YA 3OYBA 5FROA 4BE2A 1WJSA 1G3TA 2JNGA 1WJQA 1U1SA 2EQJA 4FM4B 5GAOl 4XTYA 3CXCS 4C92B 3OYJA 3OYCA 3MEUA 4XU2A 2A3LA 2RI5A 3META 4B9XA 1YIJA 1KG1A 2PUOB 1BIAA 5GANd 3CCRA 3HSBA 3JCMf 2CS7A 3PT9A 2QA4T 2GFUA 4C92G 3DB4A 1Q7YU 3RKYA 5GAMh 1VQ6A 1VQPT 1QW1A 3OS2A 3RMQA 1O75A 2FB7A 1X01A 4JRIA 4LDWA 4HKEA 2FHDA 4QVZA 5DY9A 1YI2T 1YJ9A 2DIQA 4BB7A 5LJ5j 4M75A 3CBOA 2O4XB 3BY7A 2K5IA 3OSVA 4JRQA 2CYZB 3A8HB 3V7CA 3P8DA 3ME9A 4M7AF 3GPLA 1X6OA 1UGSB 1KHIA 5CVIA 2PQWA 1VQMT 2DXUA 2EQKA 1QVGA 1WGSA 3L2WA 3UPUA 2RA2A 5FRMA 3OW2S 2MF2A 2RD1A 4M78F 3X25B 4WF2A 4C5GA 4RMOA 3LWIA 5L8RE 3NTIA 1VQ4A 2M0OA 3VV0A 1WJRA 1DJ7B 2OAUA 4JLGA 4N4IA 3OS0A 1EIFA 5KE3A 4C0ZA 4OB1B 2PUKB 4M78A 4EDUA 3CC2T 2ZPEB 5AYFA 3GNFB 3CCLA 4M7AD 3QYGB 2EQUA 3CBMA 5I21A 4KBMB 2XDDA 2A7YA 3OYDA 3CCUT 1Q7YC 2OTLT 2RHYA 3ER0A 5CKFA 1YJNT 4M7DE 4A54A 3M55A 4N0AA 1YIJT 3MP8A 2RJEA 3PNWC 2DK3A 3JCMe 4A53A 5FU6C 2DVEA 4M75C 1B34A 3ZFJA 2BUDA 2VGMA 3JRZA 4B9WA 4ZTFA 1VQ6T 3CXCA 4JJNK 1VQOA 3JCMg 5FU6B 1W2BS 3C4SA 1VQKA 4PJOD 3CCRT 2LTOA 2EWNA 5IN1A 4A4GA 1Y96B 3A5ZB 1M8VA 4J6YA 2JTFA 3M57A 5M9OA 1BI0A 4JUVA 3E19A 2HQXA 4OB0B 5FU7C 4OGCA 2RK2A 2OTJT 3QO3A 2OTJA 3OBYA 5C0MA 2E64A 3A8LB 3FLGA 4OB3B 4QQDA 5A0DA 3G4SA 4C0GA 1S72A 2EYQA 4XK8E 3OB9A 3CPWA 2ZCFB 4M7AG 3CPFA 2DEQA 5A2QE 3TCJA 1G3YA 2V8JA 5CIUA 2DJZA 4OVAA 1M1GA 5CO7A 5GAOp 3SD4A 2Y90A 3PTAA 4A4EA 2GQVA 2KAFA 1Q81C 5GAMg 1G5VA 1D3BA 2JTMA 3NTHA 3CCQT 4M75G 2QQ9A 5CK9A 2DD4A 3ASKA 4C8QF 4BACA 1UGPB 4M77A 1XOVA 3GP8A 1VQ8A 1Y07A 5GAMe 1YITT 2E41A 2F5KA 4HT8A 2VXFA 3TREA 5LJ3d 4P5NA 3KUFA 4PNOA 2RO0A 4BY6C 5LJ5g 2DAQA 1N6AA 4FU6A 3RMSA 5DM7R 4ME7A 2F69A 5GANf 1YJWA 2HAXA 1H3ZA 2LCCA 4ZTJA 3LGFA 5LJ5d 1WQ7A 3JB9J 3V7SA 3QJ6A 2ZGWA 5FLXE 2JN0A 3CBPA 4R55A 2LDMA 4Y28E 1HK9A 3HKSA 3CD6A 4EMGA 4M7DG 2FYKA 4X34A 1JBMA 1VQLT 1YJNA 5GAOn 3G4ST 1LOJA 1FWZA 1R8OB 2EJFA 3G6EA 2Y4YA 1YI2A 3PIPA 3C95A 3FEOA 5GAOr 4GY5A 2PVGB 3E9GA 3HP9A 5GMKj 2JUFA 1RI0A 3OYLA 5J39A 3CMET 4RCBA 4X9DA 5D6WA 4PJOA 2XHCA 2XDPA 1JJ2S 3L2VA 3FC3A 2MAMA 3JB9I 1M1KC 4PJOE 2LC4A 1TH7A 4M78E 1Q82C 4M77D 4EMKA 1U1TA 1ZHIA 4ZGDB 1YHQA 2EKOA 5LJ3h 1KD1U 2MI6A 4J5YA 3M56A 4F7UB 4NL2A 4C92E 4QW2A 3JB9G 1VQ5T 3CCLT 3T9NA 3M4GA 3FRNA 4E7JA 5CKBA 2GCXA 2DZ9A 3RESA 1YJWT 1U8RA 1KD1C 3I55A 1NJIU 4RG8A 3JSCA 4TVRA 4LDXA 4PJOG 3SWNA 1UGQB 1QP2A 2DXBA 3VJPA 3VU3C 4ZN1A 1M1KU 2CZ7B 3OYEA 2ZPFB 2KY9A 3GOXA 1JRIA 1XNIA 4C5HA 1PSFA 2E5QA 2K3XA 3SWNB 1VQ7T 1KQ2A 4DOVA 1I5LA 1LJOA 3PMTA 3SFMA 4F7UE 2RH2A 1UB4A 5HK0A 5GAN6 4MMLA 4Q5WA 4JLIA 1VIFA 1Y71A 5GMKm 3QHSA 4IUPA 1MHNA 3CCUA 4JS4A 5LJ5e 3F70A 2HD0A 2IG0A 3RERA 4PL6A 1QVGS 1B34B 1WQWA 2DKGA 4OB2B 5KH6A 4J6XA 1KC8U 3BDUA 3QUIA 4X9CA 2WACA 3INZA 3LLRA 2P0PA 4QVCA 1XTDA 4RCCA 4ZGJB 3L2QA 3MP1A 3MEAA 1IREB 4L6V5 4XTUA 4HCBA 2KK4A 1WPYA 2FVUA 2K2VA 5FRNA 4OGEA 4XTVA 2ZPHB 3O8VA 4A4KA 4PKCC 5GAMj 3ZBDA 4QQGA 2XI9A 3OS5A 3BW1A 3QPHA 4C0DC 2IVWA 3HRTA 2PVDB 2E12A 3GF5A 5HY6A 5GMKi 1K9MU 1PSEA 5GMKh 2JVVA 3MEWA 1BI2A 3MCAB 4J7FA 4M75B 4XTWA 4N0AC 3J80E 4XU1A 4FIBA 4C92F 1Q81U 4M78D 3QZ5B 1S72T 3JB9H 3OW2A 3I56A 5CKEA 3GIBA 3CC4A 2RK1A 5D6XA 5A0LA 2QXFA 2QI2A 5CAIA 2K5LA 2MWOA 3LWHA 3CCQA 2F5TX 1BIBA 2E65A 4M77F 4LDYA 2X4WA 3M4YA 3FIFA 5EG2A 4IURA 3URGA 4DQ2A 3CCET 3UT1A 1G3WA 4IUUA 2DTHA 1VQNT 5HKCA 5GAMf 1ZQ1A 3X24B 1NE8A 2RHXA 4L5GA 1VQ7A 3JCMV 1FXXA 1W2BA 1I81A 2KSSA 3LX7A 3P8HA 4LDVA 3BDLA 4O5VA 2DZCA 3OQ5A 3QJYA 3JCMQ 4KUDK 2QEXA 1K73U 1N8RU 4ATOA 2PU9B 3FDRA 5LJ3j 3CCJA 4IUQA 3LGLA 1VQKT 3V8LA 2B8AA 5CQXA 3M53A 2E6NA 3JCMX 5IAYA 2EIFA 4BDYA 4MZTA 2RJFA 5IT9E 4LDUA 1M1FA 1ZBXA 5DLOA 2VC8A 2OTLA 2CZ1B 2E70A 2K3YA 2O4XA 2FL7A 3HRUA 4FL6A 3CEYA 5CKHA 3L2ZA 5HK3A 3A8OB 5GANe 3JCMb 3OYFA 3OYGA 3PMIA 1UGRB 3G71A 1M4ZA 1XQHA 1Y7XA 4M7AC 4M7DB 3CCVT 2CGHA 1QVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVM A;  4LD6 A;  3OS2 A;  3S3O A;  2RHZ A;  4QVZ A;  2FHD A;  2DIQ A;  3FEO A;  2G3R A;  3DLM A;  3E9G A;  4GY5 A;  2O4X B;  3OY9 A;  1RI0 A;  2M16 A;  5J39 A;  1OZ3 A;  2NLU A;  2R58 A;  5D6W A;  3OYL A;  3OYK A;  3P8D A;  3ME9 A;  2XDP A;  2L89 A;  2MWP A;  4PLL A;  3L2V A;  2PQW A;  3FC3 A;  2EQK A;  2GF7 A;  2XK0 A;  3OYM A;  2EKO A;  1WGS A;  3L2W A;  5FRM A;  3OMC A;  3H8Z A;  2CKK A;  4II1 A;  4C5G A;  2M1H A;  2R5A A;  3QKJ A;  4L59 A;  3NTI A;  4QW2 A;  2M0O A;  2R57 A;  1OYX A;  4E7J A;  1WJR A;  2P0K A;  2X4X A;  4N4I A;  4Z02 A;  3OS0 A;  5KE3 A;  3NTK A;  5C6S A;  2VYT A;  4EDU A;  2BIV A;  4NS5 A;  3OYE A;  2D9T A;  3GOX A;  4C5H A;  1XNI A;  2E5Q A;  2K3X A;  2R5M A;  3PMT A;  2EQU A;  4Q5W A;  2RI2 A;  4BE0 A;  3OYD A;  5KE2 A;  4IUP A;  1MHN A;  2RI3 A;  2RHY A;  3S3N A;  3F70 A;  2IG0 A;  4E7H A;  4PL6 A;  3MP8 A;  2RJE A;  3PNW C;  4UC4 A;  2L8D A;  5KH6 A;  2GFA A;  2BKD N;  4IUV A;  3OS1 A;  2WAC A;  3LLR A;  2RHU A;  3L2Q A;  3ZEH A;  3MP1 A;  2BUD A;  3MEA A;  4A4F A;  4B9W A;  4ZTF A;  1OI1 A;  3C4S A;  5FRN A;  2QQR A;  4C5I A;  3O8V A;  2LTO A;  5IN1 A;  3UWN A;  4A4G A;  3Q1J A;  4QQG A;  3QBY A;  5KCO A;  2JTF A;  4PLI A;  5M9O A;  3OYH A;  2L3R A;  3DB3 A;  1N27 A;  2HQX A;  3OYA A;  3E9F A;  2RJC A;  3MEW A;  4E7K A;  4E7I A;  2LRQ A;  3MP6 A;  3OMG A;  3MEV A;  5C0M A;  4BD3 A;  3FLG A;  4E7L A;  4QQD A;  5D6X A;  4BE1 A;  3LH0 A;  3OB9 A;  2RHI A;  2MWO A;  4QQ6 A;  3QII A;  1KHC A;  3M9Q A;  3OYN A;  3H6Z A;  4BDZ A;  2QQS A;  3EAE A;  2X4W A;  1SSF A;  5CIU A;  2X35 A;  4IUR A;  4OVA A;  3UT1 A;  5KCH A;  3SD4 A;  2JZ2 A;  4A4E A;  1G5V A;  4IUU A;  3MO8 A;  1OZ2 A;  4IUT A;  5J26 A;  3NTH A;  4C5E A;  3L2U A;  4CRI A;  3OA6 A;  3L2R A;  2RHX A;  3ASK A;  4BAC A;  3LX7 A;  2YRV A;  2DIG A;  3P8H A;  2EFI A;  4N4H A;  2F5K A;  3BDL A;  2HQE A;  5D6Y A;  3OQ5 A;  3KUF A;  2RO0 A;  4RG2 A;  2DAQ A;  3LYI A;  4FU6 A;  2RJD A;  3S6W A;  3OYB A;  2X4Y A;  3FDR A;  3S3M A;  5FRO A;  4BE2 A;  1WJS A;  3LGL A;  4IUQ A;  2B8A A;  2E6N A;  1WJQ A;  4A4H A;  2EQJ A;  5IAY A;  2LCC A;  3OYI A;  4BDY A;  2RJF A;  4ZTJ A;  3LGF A;  1H3Z A;  2O4X A;  2K3Y A;  3OYJ A;  4FL6 A;  3OYC A;  3CEY A;  3MEU A;  3L42 A;  2RI5 A;  3MET A;  4HCZ A;  4B9X A;  3OYF A;  2EQM A;  3QJ6 A;  3PMI A;  3OYG A;  4IKF A;  2LDM A;  3PFS A;  4N4G A;  2GFU A;  3DB4 A;  4X34 A; 
#chains in the Genus database with same CATH topology
 4LD6 A;  4V2S A;  3S3O A;  4ELZ C;  1VQL A;  5IHN A;  4LD9 K;  4ZNX A;  2M16 A;  2NLU A;  2R58 A;  2NUZ A;  1CSK A;  2WSC E;  4EPC A;  2FEI A;  5I2M A;  1QCO A;  4JJC A;  1D1B A;  4A63 B;  4F7U G;  3GLX A;  3CC2 A;  1K9M R;  1RAI B;  5CKD A;  2PNI A;  2JT4 A;  2HQH A;  1GRI A;  5IH2 A;  1JQQ A;  1B7T A;  2GBQ A;  1RAB B;  3CCU Q;  4MDW A;  4C92 D;  3QZ9 B;  1SPK A;  1ZUU A;  1M90 U;  5CR2 A;  3E1S A;  4BE0 A;  5LJ3 e;  5KE2 A;  4E47 A;  4KT0 E;  4KUL A;  4C92 A;  5I2S A;  4AFZ C;  1K9M C;  2BKD N;  2DYI A;  4PJN A;  2RHU A;  3CCR Q;  3EH2 A;  1MGQ A;  4E7S A;  2RQU A;  1OI1 A;  2YUN A;  2QQR A;  1K73 C;  4C5I A;  2QA4 A;  3Q1J A;  3QBY A;  1IHW A;  4BI3 A;  2L3R A;  3REB B;  1KD1 R;  3E9F A;  3EHR A;  3I5S A;  4E7K A;  2ENM A;  1JJ2 A;  2YLB A;  4HCC A;  2ATC B;  3C0C A;  3CCE A;  1TTH B;  4J9G A;  3LH0 A;  3CC4 T;  1VQ7 Q;  3QII A;  1KHC A;  2QAS A;  2Y4X A;  2L3P A;  1MNE A;  1K0S A;  4HA8 A;  5KCH A;  1M90 R;  4RKU E;  1QQJ A;  4IUT A;  4C92 C;  1K4U S;  1VQ4 T;  2CZ0 B;  4XAX B;  4BI8 B;  3FJP A;  2QQB A;  3S6W A;  2A28 A;  3OYI A;  2E3H A;  5LJ3 g;  3G6E Q;  4PJL A;  3L42 A;  1M5Q 1;  4IKF A;  2D8J A;  2E1H A;  2XMF A;  4N4G A;  3VYH B;  3X20 B;  4CC3 A;  3H0F A;  1N9R A;  1YWP A;  2CUB A;  3EG2 A;  3SDZ A;  2NUP A;  1BYM A;  1TU0 B;  3RUX A;  4LNP A;  3TU4 K;  2G3R A;  3DLM A;  2A08 A;  1EX4 A;  4LXC A;  3G1J A;  1QVF A;  1TXQ A;  2MMP A;  1VQM Q;  4CI0 C;  3CCM A;  2LNV A;  4BY6 B;  3OMC A;  3CCQ Q;  2CKK A;  4L59 A;  2X4X A;  2KNB B;  2OAW A;  2X3X D;  3I56 T;  1X2Q A;  4PJO C;  4NS5 A;  4M75 F;  1UGV A;  2O2O A;  3RDV A;  4MZM A;  1S1N A;  4OMF B;  2VUB A;  1D1C A;  5KYN A;  5FU7 B;  5D7U A;  3OS1 A;  1M3C A;  1JXM A;  4KGZ B;  4YTL A;  1VQ9 T;  2AKL A;  2K5F A;  3UDC A;  2KRS A;  4RTT A;  1BI3 A;  1QWF A;  3OYH A;  3JB9 D;  1N27 A;  1KJW A;  1I1J A;  3SB2 A;  1OUL A;  2D6F A;  3G7Z A;  1RAC B;  4QVD A;  1VQN A;  3M5A A;  4QQ6 A;  1AWW A;  5GAN 3;  4CC2 A;  2DL8 A;  2DPP B;  1FMK A;  3OSS C;  3L2U A;  4O6J A;  2BE7 D;  2LX7 A;  2ZPG B;  2M51 A;  5A0G A;  3CMA T;  2FZC B;  4NOY A;  2HMA A;  4J83 A;  1MND A;  2I2L A;  4LE9 A;  3CC7 T;  1AOJ A;  3VS3 A;  3OYB A;  2VAS A;  2X4Y A;  5I22 A;  1BU1 A;  1EFN A;  2JNG A;  1JEG A;  5IHI A;  3CMA Q;  3OYC A;  3MEU A;  2RI5 A;  1KG1 A;  1BIA A;  1CKA A;  3CCR A;  2GFU A;  4C92 G;  3DB4 A;  1VQ6 A;  5GJV B;  1QW1 A;  2FB7 A;  2I0N A;  3M0R A;  4GBQ A;  2K5I A;  4JRQ A;  2CYZ B;  2L2P A;  3A8H B;  2CH4 W;  2DXU A;  1QVG A;  3PE0 A;  1PHT A;  2MF2 A;  2RD1 A;  3X25 B;  2CRE A;  1NEG A;  3LWI A;  5L8R E;  3REA B;  2KRO A;  3OS0 A;  1YIJ Q;  2FPD A;  4M78 A;  4EDU A;  2ZPE B;  3CCL A;  2C0I A;  1BB9 A;  5I21 A;  1KFZ A;  1YIJ T;  3SHW A;  3JCM e;  3H41 A;  5FU6 C;  1WHJ A;  1E6H A;  2O88 A;  3CXC A;  3JCM g;  5FU6 B;  2KR3 A;  3C4S A;  4DEY A;  1GCQ A;  1QCF A;  2FO0 A;  1WHK A;  2EWN A;  1Y96 B;  2ROL A;  2P4R A;  4J6Y A;  2JTF A;  3M57 A;  1MV0 B;  1Z9Z A;  1WXU A;  2KGT A;  2M0Y A;  4OGC A;  3CME Q;  1X69 A;  5C0M A;  4OB3 B;  4QQD A;  3G4S A;  4C0G A;  3CPW A;  3OB9 A;  4M7A G;  2ZCF B;  2LQN A;  4OVA A;  5GAO p;  3SD4 A;  2Y90 A;  1K76 A;  3NTH A;  4M75 G;  4AFU C;  1NG2 A;  4C8Q F;  1UGP B;  2IIM A;  1XOV A;  3GP8 A;  1YIT T;  2E41 A;  4HT8 A;  2VXF A;  5LJ3 d;  1R0B G;  4BY6 C;  5LJ5 g;  2DAQ A;  4FU6 A;  1IXD A;  3RMS A;  5GAN f;  1YJW A;  2EQI A;  1H3Z A;  1NJI R;  3MJX A;  2W0Z A;  3JB9 J;  1WFW A;  1VQ6 Q;  5FLX E;  3CCV Q;  2LDM A;  1HK9 A;  3HKS A;  2NUP B;  4M7D G;  2HBW A;  1H3H A;  3G4S T;  1R8O B;  3PIP A;  3C95 A;  5GAO r;  1X6B A;  3OYL A;  4ESR A;  1JJ2 S;  1Q82 C;  2EGC A;  1U1T A;  1ZHI A;  2EKO A;  1KD1 U;  4J5Y A;  1NBE B;  2K7A A;  3JB9 G;  2OJ2 A;  3T9N A;  3FRN A;  1WI7 A;  2DZ9 A;  3RES A;  1YJW T;  1NJI U;  5KYX B;  3VJP A;  1M1K U;  3OYE A;  1KQ2 A;  5HK0 A;  1BBZ A;  2RH2 A;  1UB4 A;  5FWB A;  5GAN 6;  4MML A;  1MHN A;  4JS4 A;  1C6V X;  1D0X A;  2LQW A;  3RER A;  2QGG A;  4PL6 A;  2L3S A;  3VS1 A;  4OB2 B;  5KH6 A;  2SEM A;  4X9C A;  3INZ A;  3LLR A;  4QVC A;  2P0P A;  3L2Q A;  4RCC A;  4L6V 5;  4E2F B;  4XTV A;  1SRL A;  5GAM j;  3EFO B;  4QQG A;  2FPF A;  4C0D C;  2MOX A;  4KH0 B;  5GMK i;  2YDL A;  5GMK h;  2GTO A;  4J7F A;  4N0A C;  4C92 F;  2HDA A;  1Q81 U;  4M78 D;  1PD0 A;  5CKE A;  2RK1 A;  5D6X A;  4HVU A;  5A0L A;  1ARK A;  2AKK A;  1ZSZ C;  2E65 A;  1PM3 A;  3I56 Q;  2DX1 A;  2DL5 A;  3RR6 A;  1G3W A;  5KYU A;  1IRX A;  1VQN T;  5GAM f;  2FPE A;  4L5G A;  3BDL A;  4O5V A;  3OW2 P;  1I07 A;  3M0U A;  2B8A A;  5CQX A;  3JCM X;  2EIF A;  4BDY A;  1ZUK A;  4MZT A;  2RJF A;  4LDU A;  1YI2 Q;  2VC8 A;  2CZ1 B;  3CEY A;  1LVK A;  5CKH A;  1UUE A;  3NHN A;  4KH1 B;  3G71 A;  1M4Z A;  1PWT A;  1ACM B;  2LJ1 A;  4M7A C;  4J9E A;  4XU0 A;  1YHQ Q;  4OP0 A;  1M2V B;  3WVD B;  4EIK A;  2YHT A;  1YFN A;  3JCM P;  4JPB W;  2VGN A;  1SEM A;  4EMH A;  2GF7 A;  1IO6 A;  4C8Q C;  3EGD A;  3G4S Q;  1VQN Q;  2W10 A;  4F16 A;  4LUE A;  2DTO A;  3BE3 A;  4II1 A;  1M27 C;  2M1H A;  2EJ9 A;  1VQM A;  2ECZ A;  2QTX A;  4M77 G;  2QG9 B;  3M58 A;  1N8R R;  2QDY B;  3VRY A;  3R6O A;  1P92 A;  2VXE A;  2MK5 A;  2D9T A;  3CC7 A;  3PGG A;  5KYY A;  3G71 T;  2QDL A;  5CCA A;  2DVJ A;  3I35 A;  3VUZ A;  3S3N A;  2A36 A;  2K4Y A;  3JCM d;  1KK7 A;  1YJW Q;  4DOW A;  3VKI A;  1W4S A;  5KYW B;  4M7D F;  2C06 A;  5KYW A;  1W6X A;  3JCM W;  2RQW A;  2DF6 A;  3UWN A;  4NL3 A;  1RLP C;  5GAN 4;  1WHH A;  1KC8 C;  3CCS A;  2DJQ A;  1Q7Y R;  2M9U A;  2DER A;  1YN8 A;  4XTX A;  3MP6 A;  3AHU A;  3TEE A;  3V8J A;  2O01 E;  1TWB A;  2LQK A;  4BE1 A;  2HSP A;  3M9Q A;  4D8D A;  4EMK B;  1M9S A;  1K8A R;  3OYN A;  2ABL A;  3BFM A;  1VQ4 Q;  2WSF E;  3GNG A;  3HFO A;  1OV3 A;  3HRS A;  4F7U F;  2AZV A;  5GAN 5;  2A37 A;  3NFC A;  2J6F A;  5I11 A;  1JU5 C;  2K79 A;  1FYN A;  2HQE A;  2LZ6 B;  1E7O A;  2AZS A;  4FT2 A;  1GXI E;  2OX7 A;  4Z88 A;  2EYX A;  3RKW A;  1QVF P;  2DRK A;  3JB9 F;  3QWX X;  4JDS A;  5KYU B;  1FMV A;  3N5B B;  4HCZ A;  2EQM A;  3JCM J;  1QMC A;  3VUB A;  2RN8 A;  4FYV B;  3PFS A;  2QTV A;  4LN2 A;  5GAN j;  2E10 A;  3OBW A;  2JOY A;  2LX9 A;  2EVR A;  4C0F A;  3OY9 A;  4X1V A;  4M75 D;  3CME A;  2P4T A;  4HT9 A;  4HXJ A;  1OU8 A;  3CC2 Q;  2CP7 A;  1KQS P;  1ZLM A;  1H64 1;  2CP3 A;  2NYS A;  1QLY A;  1K73 R;  2DET A;  1M2O A;  2NWM A;  3CCJ T;  1ZSZ B;  2XDB A;  2P0K A;  4OF1 A;  1HYO A;  3HTR A;  3KFV A;  1UEB A;  4J8O A;  2P84 A;  4FSS A;  2P0Q A;  2D0Q B;  1U3O A;  5GAO m;  1U06 A;  3EG0 A;  3OYY A;  1NLP C;  3QYH B;  1OPK A;  2KRM A;  1X75 C;  4E7H A;  3EFS A;  4IUV A;  2BE9 B;  2XU8 A;  1RL2 A;  3RNJ A;  1TSF A;  3CCM Q;  2EAY A;  1TUD A;  4FT4 A;  3CCS Q;  2LCL A;  1ZA1 B;  4J7I A;  2X51 A;  5LJ5 h;  2DBM A;  4E7I A;  1PNJ A;  3C94 A;  3QDR B;  3L1A A;  3CD6 T;  2J06 A;  1FX7 A;  2QQA A;  1BCM A;  2RHI A;  6AT1 B;  2E3I A;  1OX8 A;  3WVE B;  4F04 B;  5J3B A;  1SSF A;  1D3B B;  2JZ2 A;  2PVO B;  3KXT A;  1OZ2 A;  2FZK B;  3PVQ A;  1QWE A;  2DIG A;  2EFI A;  3EFR A;  1NYF A;  4M7D C;  1HD3 A;  3QSU A;  1KC8 R;  1AWJ A;  1RAE B;  2RJD A;  1GFD A;  2LT4 A;  4BE2 A;  1VYV A;  1WJQ A;  2EQJ A;  5GAO l;  4XTY A;  3OYJ A;  1RAA B;  2A3L A;  2PUO B;  5GAN d;  2DNU A;  4AFS C;  2QEX Q;  2QA4 T;  2D0N A;  2B86 A;  2VKN A;  5GAM h;  1BCO A;  3M0S A;  1PG5 B;  5ECA A;  2FHD A;  1YJ9 A;  1YI2 T;  1W70 A;  2CP5 A;  2J05 A;  3CBO A;  2GQI A;  1IGU A;  2NUT B;  3CPW P;  3EHQ A;  5CVI A;  1UFF A;  3FJ5 A;  1G8X A;  2RA2 A;  4F17 A;  5FW9 A;  4RMO A;  3NTI A;  4IIO A;  1VQ4 A;  2M0O A;  2X3W D;  2KT1 A;  1WIE A;  2CP2 A;  4N4I A;  3CC2 T;  4Z89 A;  2QGF B;  2K2M A;  1D0Y A;  2HEQ A;  4K11 A;  2EQU A;  3THK A;  2XDD A;  3OYD A;  2RHY A;  3ER0 A;  5CKF A;  3M55 A;  4N0A A;  2DK3 A;  2L0A A;  3JRZ A;  4B9W A;  1VQ6 T;  4RTW A;  4ORZ A;  1W2B S;  3CCR T;  4A4G A;  2SRC A;  5M9O A;  4JUV A;  4OB0 B;  2CP0 A;  2RK2 A;  2DE0 X;  3QO3 A;  2OTJ A;  3OBY A;  2YRC A;  3A8L B;  3FLG A;  2KYM A;  1B07 A;  4R0K A;  1M8M A;  1G3Y A;  2KYB A;  2V8J A;  1VOM A;  1M1G A;  1VA7 A;  1NEB A;  1D3B A;  2JTM A;  2DD4 A;  2K9G A;  2LMJ A;  3EGX B;  4M77 A;  4RTX A;  5GAM e;  2F5K A;  3TRE A;  1VQK Q;  3KUF A;  2RNA A;  1N6A A;  1JO8 A;  1LCK A;  4ME7 A;  2ED0 A;  2YRD A;  2LCC A;  5LJ5 d;  2E4H A;  2KXC A;  4R55 A;  3CBP A;  1VQP Q;  2FYK A;  2G6F X;  1JBM A;  4KGX B;  1YJN A;  5GAO n;  1LOJ A;  1FWZ A;  2EJF A;  1YI2 A;  3FEO A;  4GY5 A;  3E9G A;  1EZZ B;  2DYB A;  2JTE A;  5D6W A;  1GCQ C;  4PJO A;  2XDP A;  2EBP A;  3FC3 A;  4M78 E;  1TH7 A;  1AD5 A;  4M77 D;  4ZGD B;  2CUD A;  2MI6 A;  4F7U B;  3M56 A;  2EYW A;  2YUQ A;  4NL2 A;  4OMP A;  2F1L A;  3CCL T;  3M0T A;  2RPN A;  4RG8 A;  3JSC A;  1UGQ B;  2DXB A;  2ZPF B;  2E5Q A;  9ATC B;  3U23 A;  1I5L A;  3PMT A;  1WYX A;  1K9A A;  3QHS A;  3CCU A;  3VS4 A;  1X27 A;  1B34 B;  1WQW A;  1KC8 U;  4ZGJ B;  4GLM A;  1ZUY A;  1AVZ C;  1WPY A;  5FRN A;  2ZPH B;  2COZ A;  3ZBD A;  3QPH A;  1SF9 A;  4JZ3 A;  2IVW A;  4E6R A;  2E12 A;  5HY6 A;  2AK5 A;  4M75 B;  4XU1 A;  3QZ5 B;  1MUZ A;  1UDL A;  2EYZ A;  3CC4 A;  1X6G A;  1QKX A;  3GIB A;  1GFC A;  2QI2 A;  2F5T X;  1GBR A;  4AG2 C;  3CQT A;  2FG0 A;  2X4W A;  3FIF A;  5EG2 A;  3URG A;  4DQ2 A;  2JJ9 A;  1ZQ1 A;  4OMN A;  3JCM V;  2KSS A;  3LX7 A;  1H92 A;  1K73 U;  1Q82 R;  2Z0W A;  4ATO A;  2PU9 B;  3CCJ A;  3CD6 Q;  1C0M A;  5IAY A;  5DLO A;  2FL7 A;  4FL6 A;  1GCP A;  3L2Z A;  2FRW A;  5HK3 A;  3CCE Q;  1UGR B;  5GJW B;  5IHK A;  3CCV T;  1QVP A;  1M90 C;  4M7D A;  2EGA A;  2CH4 A;  2RB6 A;  4JS5 A;  1I4K 1;  2EW3 A;  1OOT A;  2XIC A;  2BTT A;  2MWP A;  4PLL A;  3PIO A;  1QKW A;  1Y0M A;  3CCJ Q;  1OU9 A;  2L5Q A;  5IXF A;  2OI3 A;  3M0P A;  3CXC P;  2RQR A;  1V76 A;  2YLC A;  3NTK A;  3SWN C;  2KE9 A;  3J7A F;  1YCY A;  4Y91 A;  1RAG B;  2CZ6 B;  1PKT A;  1WNL A;  2CSQ A;  2CSI A;  2RM4 A;  4M7A A;  2DXC A;  2DFU A;  1VQ9 A;  1WA7 A;  4MDX A;  2ZPB B;  4M7D D;  3A8M B;  1GL5 A;  2GFA A;  1AEY A;  4WTO B;  4DEX A;  3TSZ A;  2QA4 Q;  1K8A C;  2DL4 A;  2EGE A;  1PD1 A;  2MIO A;  4BUG A;  1YJ9 Q;  4JRK A;  4HCK A;  4ZGE B;  1V29 B;  4C8Q D;  3OMG A;  1KQ1 A;  1ZBJ A;  3MEV A;  2V26 A;  1BI1 A;  2M02 A;  4BDZ A;  2QQS A;  2E6Z A;  4AMC A;  1NJI C;  1IHV A;  2DIL A;  2JMA A;  4M78 G;  2KQW A;  1G3S A;  3EG9 B;  4GLK A;  3WXM B;  2XD0 A;  3QXE B;  4E7Z A;  4RG2 A;  3HFN A;  3S3M A;  2X4J A;  5GAN 8;  1M2V A;  4DBF A;  3H0I A;  2EPD A;  2QEX T;  3E2U A;  5CQY A;  1RI9 A;  1VQ5 Q;  1A0N B;  4XQ3 A;  1AT1 B;  4PK4 A;  2RHZ A;  2LQ8 A;  3DLL A;  3A8G B;  2D8H A;  1G83 A;  2XKO C;  1T0J A;  1VUB A;  2HNI A;  3LW5 E;  2JM8 A;  4AFQ C;  1AHJ B;  2X9H A;  3EG1 A;  1WXT A;  2V8I A;  3H8Z A;  4J9C A;  3QKJ A;  2BZY A;  3CCM T;  2R57 A;  3CMA A;  1Q86 U;  3EG3 A;  2VYT A;  5GAM d;  3M54 A;  2MCN A;  2NUT A;  2EJG A;  4C8Q E;  2WSE E;  3V8K A;  3X28 B;  2DD5 A;  2YUP A;  1WX6 A;  4EMK C;  2RI2 A;  3CPW S;  2VWF A;  2YUO A;  2L8D A;  4KRT A;  4A4F A;  4ANJ A;  2DRM A;  4MZP A;  3FB9 A;  2VV5 A;  2KDS A;  2C0O A;  3X26 B;  4M75 E;  5KCO A;  1YBY A;  1I8F A;  3VYG A;  1N8R C;  1O9S A;  4J6W A;  1N9S A;  3G6E T;  2LRQ A;  1HJD A;  3P8B B;  2HCK A;  1QVF S;  4XU3 A;  4JRP A;  3J81 E;  1YJ9 T;  4IIM A;  2K57 A;  3MHX A;  4PJM A;  1TOV A;  4KUI A;  3D7S B;  4CRI A;  5GMK e;  2CT3 A;  1SSH A;  1Q86 C;  1UE9 A;  1YIT A;  1VQ8 T;  1PRL C;  4M77 C;  4QKU A;  3HHT B;  4DBH A;  1WJS A;  1I5O B;  3CXC S;  2HKQ B;  4C92 B;  1AZE A;  4JJB A;  1YIJ A;  1D0Z A;  4B9X A;  1QVG P;  2F2W A;  2KRN A;  3PT9 A;  2PTK A;  2YSQ A;  1T3L A;  1Q81 R;  1O75 A;  1WZO A;  4QVZ A;  5DY9 A;  2DIQ A;  2F2X A;  2VB6 A;  4M75 A;  2O4X B;  3BY7 A;  3OSV A;  3G71 Q;  3P8D A;  3ME9 A;  2L3Q A;  2COW A;  2YWW A;  2PQW A;  4PFO A;  1WHG A;  3TQ7 P;  1WGS A;  3UPU A;  4M78 F;  4WF2 A;  4C5G A;  1CKB A;  4J9F A;  2FRY A;  1R77 A;  1WJR A;  1DJ7 B;  4JLG A;  2EKH A;  1EIF A;  4OB1 B;  5AYF A;  4J9D A;  1RAF B;  4M7A D;  1JJ2 P;  4DBR A;  2A7Y A;  1Q7Y C;  1MMN A;  1X43 A;  4A54 A;  2RQT A;  3MP8 A;  2JMC A;  4A53 A;  1MMG A;  1B34 A;  3ZFJ A;  2BUD A;  4ZTF A;  2JW4 A;  1VQO A;  1OQK A;  5IN1 A;  2LTO A;  1M8V A;  2DL7 A;  2HQX A;  5FU7 C;  2OTJ T;  2E64 A;  3R6N A;  2EYQ A;  2COY A;  1YIT Q;  2DEQ A;  3TCJ A;  2DJZ A;  4KGV B;  1QVG S;  3PTA A;  4A4E A;  1YNZ A;  2GQV A;  5EC7 A;  1G5V A;  1ZA2 B;  2AT1 B;  2QQ9 A;  5CK9 A;  1RAH B;  1VQ8 A;  1Y07 A;  2HL5 C;  1UG1 A;  4P5N A;  2RMO A;  2RO0 A;  5DM7 R;  3EH1 A;  3LGF A;  2YXY A;  1WQ7 A;  1M1K R;  2KXD A;  2ZGW A;  4Y28 E;  3CCL Q;  1YP5 A;  4X34 A;  1SHG A;  1VQL T;  3G6E A;  2DMO A;  3I9Q A;  5GMK j;  5J39 A;  4RCB A;  4X9D A;  2XHC A;  1OEB A;  1T3S A;  1AWO A;  3EGU A;  2MAM A;  1M1K C;  2LC4 A;  1VQL Q;  4HVW A;  5LJ3 h;  4QW2 A;  1VQ5 T;  4E7J A;  2GCX A;  1U8R A;  1KD1 C;  3I55 A;  4LDX A;  4PJO G;  3GOX A;  4C5H A;  1XNI A;  1PSF A;  3SWN B;  3CC4 Q;  1VQ7 T;  1LJO A;  1F1B B;  4JLI A;  1VIF A;  1Y71 A;  4IUP A;  3I5R A;  3F70 A;  4FYW B;  2HD0 A;  3SEM A;  1HSQ A;  1M30 A;  1ZSG A;  3LH5 A;  3QUI A;  2WAC A;  1XTD A;  1D09 B;  1IRE B;  4XTU A;  4HCB A;  2KK4 A;  2FVU A;  2K2V A;  4FCY A;  3O8V A;  4A4K A;  1TS9 A;  1YWO A;  2XI9 A;  1ABO A;  3AT1 B;  3HRT A;  1K9M U;  3GF5 A;  3UF4 A;  2JVV A;  3MEW A;  2VVK A;  4XTW A;  3J80 E;  4PJJ A;  4AT1 B;  4PJO D;  1S72 T;  4AG1 C;  3OW2 A;  3I56 A;  1MMD A;  5CAI A;  1BIB A;  4LDY A;  3M4Y A;  3CCE T;  4IUR A;  3UT1 A;  4IUU A;  2DTH A;  3X24 B;  1G2B A;  4Z8A A;  1I81 A;  1N5Z A;  1BK2 A;  3P8H A;  4LDV A;  1AZG B;  1XJW B;  2DBK A;  5LJ3 j;  1VQK T;  3QDF A;  3V8L A;  3TSW A;  2YT6 A;  4FW2 A;  4HVV A;  5IT9 E;  2O9S A;  2OTL A;  1RAD B;  2O4X A;  1H8K A;  3JCM b;  4CC4 B;  3A8O B;  3OYF A;  3OYG A;  4J9B A;  1Y7X A;  4M7D B;  3NPF A;  2HSE B;  1VQO T;  1NPP A;  1JB0 E;  1SHF A;  1NZ9 A;  1OZ3 A;  4JZ4 A;  4LUD A;  4B6M A;  1MV3 A;  5KYX A;  3V7R A;  4C8Q A;  3HL8 A;  4MMK A;  1PCX A;  3EFO A;  2KMT A;  4J9H A;  2PZ1 A;  2CT4 A;  4J9I A;  1R0C B;  3IQL A;  2ZZD A;  4RTV A;  1Q82 U;  2BIV A;  4D6W A;  1SG5 A;  2R5M A;  1K8A U;  3NGP A;  1M3A A;  2BZX A;  2RI3 A;  4M77 E;  1KQS S;  1NPR A;  1U5S A;  5LJ3 f;  4R56 A;  3DKM A;  2H3J A;  2HBP A;  4C8Q G;  5LL6 S;  5LJ5 f;  4M7A E;  2ZAE A;  3PVL A;  2F2V A;  4C8Q B;  5GAN g;  2JM9 A;  3UA6 A;  1UTI A;  1TUG B;  4XTZ A;  3DB3 A;  3TVT A;  2A0F B;  3VS7 A;  3OYA A;  4DA4 A;  2RJC A;  2BZ8 A;  3GBQ A;  4OMQ A;  2DXT A;  4VUB A;  4RTY A;  3UA7 A;  4PJO B;  4E7L A;  2XG8 D;  4F7U A;  3CCS T;  2GGR A;  4OMM A;  5AT1 B;  3H6Z A;  1YHQ T;  3M59 A;  2HL3 A;  4C0D B;  3I55 T;  3KBG A;  3MO8 A;  1RUW A;  4C5E A;  5J26 A;  3EGX A;  1BKB A;  4M77 B;  5GAN h;  1LNX A;  3L2R A;  2KVQ G;  1NM7 A;  2JS0 A;  2YRV A;  3JV3 A;  1W2B P;  2KBT A;  2CP6 A;  1K1Z A;  2RF0 A;  4WCI A;  4A4H A;  4PFZ A;  2GNC A;  1JXO A;  4PJO F;  4BI4 A;  1KQS A;  3C12 A;  2K3B A;  1FMW A;  1OX9 A;  7AT1 B;  3MKD A;  2LVM A;  2KT8 A;  1C1A A;  4M78 C;  2ZPI B;  2DTI A;  3CCV A;  1VQP A;  2ED1 A;  3OYK A;  3JAM E;  4M78 B;  2L89 A;  3JCM c;  4OMO A;  2ESW A;  2XK0 A;  3OYM A;  3ZL7 C;  2GTJ A;  3O5Z A;  1Y96 A;  2R5A A;  5GAO q;  3JCM h;  2LNH B;  1HXD A;  2AHJ B;  1OYX A;  2DO3 A;  4Z02 A;  2XID A;  4DBQ A;  5C6S A;  4ZN3 A;  4F14 A;  1WHM A;  1M3B A;  4CC7 A;  3RKX A;  3QG1 A;  8AT1 B;  2FZG B;  2HKN A;  4UC4 A;  1KIK A;  1QCN A;  1VIE A;  4OML A;  1TG0 A;  3ZEH A;  1QP3 A;  1UJ0 A;  3EGD B;  1YJN Q;  2LT1 A;  4PLI A;  5GAN 2;  4ELY C;  1D1A A;  3A98 A;  2HZY A;  1PC0 A;  3RIR A;  1IZ6 A;  4BD3 A;  2DL3 A;  2V8K A;  4FSX A;  1RLQ C;  3VS6 A;  3EAE A;  4RUG A;  5DLQ E;  2X35 A;  4FYX B;  1YCS B;  2V1R A;  3OA6 A;  1S72 Q;  3HPW A;  5GAN 7;  3UAT A;  4N4H A;  1ABQ A;  1MMA A;  4M7A B;  5GMK l;  5D6Y A;  3VS2 A;  1OPL A;  3LYI A;  1VQ5 A;  2JXB A;  5FRO A;  2H8H A;  1G3T A;  1U1S A;  4FM4 B;  4XU2 A;  3MET A;  3HSB A;  3JCM f;  2CS7 A;  2LCS A;  1Q7Y U;  1IB8 A;  3RKY A;  4Y92 A;  1VQP T;  3OS2 A;  3RMQ A;  4JRI A;  1WLP B;  1X01 A;  4LDW A;  4HKE A;  4JJD A;  4BB7 A;  5LJ5 j;  2H3E B;  2D1X A;  2MYS A;  1VYT A;  3V7C A;  4M7A F;  3GPL A;  1X6O A;  1UGS B;  1KHI A;  3NMZ C;  4RTZ A;  1VQM T;  2IPO B;  1UJY A;  2EQK A;  5FWC A;  2J6K A;  3L2W A;  5FRM A;  3OW2 S;  2J6O A;  2J7I A;  5HCK A;  1PKS A;  1UEC A;  4D8K A;  3VV0 A;  1K0X A;  2OAU A;  5KE3 A;  2AIR B;  4C0Z A;  1E6G A;  2PUK B;  3GNF B;  1VYU A;  3QYG B;  3CBM A;  4KBM B;  3CCU T;  2OTL T;  2LP5 A;  1YJN T;  4M7D E;  2RJE A;  3PNW C;  1PRM C;  2DVE A;  4M75 C;  1IGQ A;  2QAZ A;  2VGM A;  4JJN K;  1VQ9 Q;  1VQK A;  3A5Z B;  1SRM A;  1BI0 A;  3E19 A;  2OTJ Q;  1WXB A;  1SKU B;  1UHC A;  1NYG A;  3VS0 A;  1Y57 A;  2CDT A;  1WDX A;  5A0D A;  1S72 A;  4XK8 E;  2QYZ A;  3CPF A;  5A2Q E;  3RBB B;  5CIU A;  5CO7 A;  1Q81 C;  2KAF A;  5GAM g;  3CCQ T;  3ASK A;  4BAC A;  1T0H A;  4PFP A;  4RTU A;  4PNO A;  2QK0 A;  1V1C A;  5IXB A;  1AWX A;  2F69 A;  2HAX A;  4ZTJ A;  1Z9Q A;  2LJ0 A;  3V7S A;  3QJ6 A;  2JN0 A;  3ULR B;  3CD6 A;  4FYY B;  4EMG A;  2C0T A;  1GBQ A;  2Y4Y A;  3VS5 A;  2KI7 A;  2OTL Q;  2K6D A;  3H0H A;  2DLP A;  2E5K A;  2DA9 A;  2PVG B;  1ZSZ A;  3HP9 A;  1B3Q A;  2JUF A;  1RI0 A;  3CME T;  1Q86 R;  1ZX6 A;  3L2V A;  3A1P A;  3JB9 I;  4PJO E;  4EMK A;  1YHQ A;  2JS2 A;  4C92 E;  3I55 Q;  4FW1 A;  3M4G A;  5CKB A;  4TVR A;  3VRZ A;  2DEU A;  3SWN A;  1I0C A;  1QP2 A;  3VU3 C;  4ZN1 A;  2CZ7 B;  2KY9 A;  1JRI A;  2K3X A;  4DOV A;  4F7U E;  3SFM A;  4Q5W A;  3CC7 Q;  5GMK m;  2DM1 A;  5LJ5 e;  2IG0 A;  2DKG A;  4J6X A;  2EYY A;  3BDU A;  2RQV A;  1UHF A;  1Q95 G;  1WHL A;  3MP1 A;  3MEA A;  3QWY A;  1X2K A;  4OGE A;  4PKC C;  3OS5 A;  3BW1 A;  4M4Z A;  2PVD B;  2KEA A;  1PSE A;  1NLO C;  3EG9 A;  1BI2 A;  3MCA B;  4QT7 A;  2V1Q A;  4FIB A;  3JB9 H;  2ROT A;  2QXF A;  2K5L A;  2MWO A;  3LWH A;  3CCQ A;  1VQ8 Q;  5KYY B;  4M77 F;  1TUC A;  1W1F A;  5HKC A;  1NE8 A;  2MPX C;  2O9V A;  2RHX A;  1VQ7 A;  1FXX A;  1W2B A;  1J3T A;  1LPL A;  2DZC A;  3OQ5 A;  3QJY A;  3JCM Q;  4KUD K;  2QEX A;  1N8R U;  2LJ3 A;  3FDR A;  4IUQ A;  3LGL A;  3MPU B;  3M53 A;  2E6N A;  1M1F A;  1ZBX A;  2E70 A;  2K3Y A;  3HRU A;  3M0Q A;  5L23 A;  2O31 A;  5GAN e;  3PMI A;  1VQO Q;  1KSW A;  8ATC B;  1XQH A;  2CGH A;  3H9N A; 
#chains in the Genus database with same CATH homology
 4LD6 A;  4V2S A;  3S3O A;  4ELZ C;  1VQO T;  1M90 C;  1VQL A;  4M7D A;  4XU0 A;  4OP0 A;  2RB6 A;  4LD9 K;  1NPP A;  3WVD B;  1JB0 E;  4JS5 A;  1I4K 1;  1NZ9 A;  2M16 A;  1OZ3 A;  2NLU A;  2R58 A;  2XIC A;  2YHT A;  3JCM P;  2WSC E;  4EPC A;  2VGN A;  2MWP A;  4PLL A;  3V7R A;  4EMH A;  3PIO A;  4C8Q A;  2GF7 A;  3HL8 A;  4C8Q C;  5I2M A;  4MMK A;  2DTO A;  4F7U G;  4II1 A;  2L5Q A;  3GLX A;  2M1H A;  2KMT A;  3CC2 A;  2EJ9 A;  1VQM A;  2QTX A;  4M77 G;  5CKD A;  2ZZD A;  2YLC A;  3M58 A;  3NTK A;  3SWN C;  1Q82 U;  2QDY B;  3J7A F;  1YCY A;  2BIV A;  3R6O A;  4Y91 A;  1P92 A;  2VXE A;  2CZ6 B;  3CC7 A;  2D9T A;  3PGG A;  4MDW A;  4C92 D;  4D6W A;  2R5M A;  1K8A U;  3QZ9 B;  1M90 U;  1WNL A;  3G71 T;  5CCA A;  5CR2 A;  2RM4 A;  3E1S A;  4M7A A;  2DXC A;  5LJ3 e;  4BE0 A;  1VQ9 A;  5KE2 A;  3VUZ A;  4KT0 E;  2RI3 A;  4M77 E;  4KUL A;  4E47 A;  2K4Y A;  3S3N A;  1KQS S;  2ZPB B;  1NPR A;  4C92 A;  4R56 A;  5LJ3 f;  4M7D D;  3DKM A;  5I2S A;  3JCM d;  4DOW A;  3A8M B;  1K9M C;  2GFA A;  3VKI A;  2BKD N;  2H3J A;  2HBP A;  4C8Q G;  1W4S A;  5LL6 S;  5LJ5 f;  2RHU A;  4M7A E;  4M7D F;  1MGQ A;  2C06 A;  1K8A C;  1OI1 A;  4C8Q B;  3JCM W;  5GAN g;  2QQR A;  1K73 C;  4C5I A;  3UWN A;  2QA4 A;  3Q1J A;  4NL3 A;  3QBY A;  4BUG A;  4XTZ A;  4BI3 A;  5GAN 4;  4JRK A;  2L3R A;  1KC8 C;  3DB3 A;  3OYA A;  3E9F A;  3CCS A;  4DA4 A;  2M9U A;  2RJC A;  1V29 B;  4ZGE B;  4XTX A;  4E7K A;  1JJ2 A;  4C8Q D;  4VUB A;  2DXT A;  2YLB A;  3MP6 A;  3OMG A;  1KQ1 A;  4HCC A;  3TEE A;  3AHU A;  3V8J A;  2O01 E;  3MEV A;  3CCE A;  4PJO B;  2LQK A;  4E7L A;  2XG8 D;  4F7U A;  3CCS T;  3LH0 A;  3CC4 T;  4BE1 A;  1BI1 A;  3QII A;  1KHC A;  3M9Q A;  4EMK B;  1M9S A;  3OYN A;  2Y4X A;  3H6Z A;  4BDZ A;  2QQS A;  2E6Z A;  3BFM A;  1YHQ T;  3M59 A;  2WSF E;  1NJI C;  4HA8 A;  3GNG A;  3HFO A;  4C0D B;  5KCH A;  3HRS A;  4F7U F;  3KBG A;  4RKU E;  3I55 T;  5GAN 5;  4M78 G;  3MO8 A;  2KQW A;  1G3S A;  4GLK A;  4IUT A;  5J26 A;  4M77 B;  1BKB A;  2CZ0 B;  4C5E A;  3WXM B;  4C92 C;  3NFC A;  1LNX A;  5GAN h;  1VQ4 T;  3L2R A;  4XAX B;  4BI8 B;  2XD0 A;  2KVQ G;  3QXE B;  2YRV A;  3FJP A;  2HQE A;  2QQB A;  4FT2 A;  1GXI E;  4RG2 A;  3HFN A;  3RKW A;  3S6W A;  3S3M A;  3JB9 F;  2X4J A;  3OYI A;  4JDS A;  4A4H A;  5GAN 8;  5LJ3 g;  4PJO F;  4BI4 A;  3N5B B;  2QEX T;  1KQS A;  3L42 A;  4HCZ A;  3C12 A;  2EQM A;  3JCM J;  1M5Q 1;  5CQY A;  3VUB A;  4IKF A;  3PFS A;  2E1H A;  4N4G A;  3VYH B;  3X20 B;  4XQ3 A;  5GAN j;  1N9R A;  2E10 A;  2LVM A;  3SDZ A;  2RHZ A;  3OBW A;  2LQ8 A;  1BYM A;  2JOY A;  3DLL A;  3RUX A;  3TU4 K;  3A8G B;  2G3R A;  3DLM A;  2ZPI B;  2LX9 A;  4M78 C;  1QVF A;  2DTI A;  4C0F A;  2MMP A;  2XKO C;  3OY9 A;  4M75 D;  3CME A;  1VUB A;  3CCV A;  1VQP A;  4CI0 C;  2HNI A;  3LW5 E;  3JAM E;  3OYK A;  2P4T A;  4M78 B;  2L89 A;  3JCM c;  4HT9 A;  3CCM A;  2XK0 A;  3OYM A;  2LNV A;  1AHJ B;  4BY6 B;  1H64 1;  1Y96 A;  3OMC A;  2V8I A;  3H8Z A;  2CKK A;  2R5A A;  3QKJ A;  4L59 A;  5GAO q;  3JCM h;  3CCM T;  3CCJ T;  1HXD A;  2AHJ B;  2R57 A;  1OYX A;  2XDB A;  2DO3 A;  2X4X A;  2P0K A;  4Z02 A;  3CMA A;  4OF1 A;  1Q86 U;  2XID A;  5C6S A;  2VYT A;  4ZN3 A;  1UEB A;  4J8O A;  3M54 A;  4C8Q E;  5GAM d;  2EJG A;  3I56 T;  4PJO C;  4NS5 A;  2P0Q A;  4M75 F;  2WSE E;  2D0Q B;  3RKX A;  3V8K A;  3X28 B;  3QG1 A;  5GAO m;  2DD5 A;  3CPW S;  4MZM A;  2RI2 A;  4EMK C;  4OMF B;  2VUB A;  3OYY A;  3QYH B;  1X75 C;  4E7H A;  3EFS A;  4UC4 A;  2L8D A;  5FU7 B;  4IUV A;  3OS1 A;  2XU8 A;  1VIE A;  4YTL A;  1VQ9 T;  1RL2 A;  3ZEH A;  2K5F A;  4A4F A;  2EAY A;  3UDC A;  4MZP A;  1QP3 A;  3FB9 A;  2VV5 A;  4FT4 A;  2KDS A;  1BI3 A;  3X26 B;  4M75 E;  5KCO A;  2LCL A;  2LT1 A;  4PLI A;  3OYH A;  4J7I A;  1YBY A;  1I8F A;  3JB9 D;  5GAN 2;  1N27 A;  4ELY C;  3VYG A;  3SB2 A;  1N8R C;  1O9S A;  4J6W A;  1N9S A;  5LJ5 h;  3G6E T;  4E7I A;  2LRQ A;  2D6F A;  3C94 A;  3G7Z A;  3QDR B;  4MDX A;  3P8B B;  3L1A A;  3CD6 T;  3RIR A;  1IZ6 A;  4BD3 A;  1QVF S;  4XU3 A;  1FX7 A;  2QQA A;  4QVD A;  2V8K A;  4JRP A;  3M5A A;  4FSX A;  1VQN A;  2RHI A;  4QQ6 A;  3J81 E;  1YJ9 T;  5GAN 3;  3EAE A;  2DPP B;  2K57 A;  3WVE B;  3MHX A;  1SSF A;  5DLQ E;  5J3B A;  2X35 A;  1D3B B;  4KUI A;  2JZ2 A;  2PVO B;  3KXT A;  3OSS C;  1OZ2 A;  3L2U A;  4O6J A;  4CRI A;  3OA6 A;  2ZPG B;  5GMK e;  5A0G A;  3HPW A;  3CMA T;  1Q86 C;  5GAN 7;  4NOY A;  1YIT A;  2DIG A;  3EFR A;  2EFI A;  4M77 C;  4N4H A;  1VQ8 T;  4J83 A;  4M7A B;  5GMK l;  5D6Y A;  4M7D C;  2I2L A;  3QSU A;  3CC7 T;  1VQ5 A;  3HHT B;  3LYI A;  2RJD A;  2LT4 A;  2X4Y A;  3OYB A;  5FRO A;  4BE2 A;  1WJS A;  1G3T A;  2JNG A;  1WJQ A;  1U1S A;  2EQJ A;  4FM4 B;  5GAO l;  4XTY A;  3CXC S;  4C92 B;  3OYJ A;  3OYC A;  3MEU A;  4XU2 A;  2A3L A;  2RI5 A;  3MET A;  4B9X A;  1YIJ A;  1KG1 A;  2PUO B;  1BIA A;  5GAN d;  3CCR A;  3HSB A;  3JCM f;  2CS7 A;  3PT9 A;  2QA4 T;  2GFU A;  4C92 G;  3DB4 A;  1Q7Y U;  3RKY A;  5GAM h;  1VQ6 A;  1VQP T;  1QW1 A;  3OS2 A;  3RMQ A;  1O75 A;  2FB7 A;  1X01 A;  4JRI A;  4LDW A;  4HKE A;  2FHD A;  4QVZ A;  5DY9 A;  1YI2 T;  1YJ9 A;  2DIQ A;  4BB7 A;  5LJ5 j;  4M75 A;  3CBO A;  2O4X B;  3BY7 A;  2K5I A;  3OSV A;  4JRQ A;  2CYZ B;  3A8H B;  3V7C A;  3P8D A;  3ME9 A;  4M7A F;  3GPL A;  1X6O A;  1UGS B;  1KHI A;  5CVI A;  2PQW A;  1VQM T;  2DXU A;  2EQK A;  1QVG A;  1WGS A;  3L2W A;  3UPU A;  2RA2 A;  5FRM A;  3OW2 S;  2MF2 A;  2RD1 A;  4M78 F;  3X25 B;  4WF2 A;  4C5G A;  4RMO A;  3LWI A;  5L8R E;  3NTI A;  1VQ4 A;  2M0O A;  3VV0 A;  1WJR A;  1DJ7 B;  2OAU A;  4JLG A;  4N4I A;  3OS0 A;  1EIF A;  5KE3 A;  4C0Z A;  4OB1 B;  2PUK B;  4M78 A;  4EDU A;  3CC2 T;  2ZPE B;  5AYF A;  3GNF B;  3CCL A;  4M7A D;  3QYG B;  2EQU A;  3CBM A;  5I21 A;  4KBM B;  2XDD A;  2A7Y A;  3OYD A;  3CCU T;  1Q7Y C;  2OTL T;  2RHY A;  3ER0 A;  5CKF A;  1YJN T;  4M7D E;  4A54 A;  3M55 A;  4N0A A;  1YIJ T;  3MP8 A;  2RJE A;  3PNW C;  2DK3 A;  3JCM e;  4A53 A;  5FU6 C;  2DVE A;  4M75 C;  1B34 A;  3ZFJ A;  2BUD A;  2VGM A;  3JRZ A;  4B9W A;  4ZTF A;  1VQ6 T;  3CXC A;  4JJN K;  1VQO A;  3JCM g;  5FU6 B;  1W2B S;  3C4S A;  1VQK A;  4PJO D;  3CCR T;  2LTO A;  2EWN A;  5IN1 A;  4A4G A;  1Y96 B;  3A5Z B;  1M8V A;  4J6Y A;  2JTF A;  3M57 A;  5M9O A;  1BI0 A;  4JUV A;  3E19 A;  2HQX A;  4OB0 B;  5FU7 C;  4OGC A;  2RK2 A;  2OTJ T;  3QO3 A;  2OTJ A;  3OBY A;  5C0M A;  2E64 A;  3A8L B;  3FLG A;  4OB3 B;  4QQD A;  5A0D A;  3G4S A;  4C0G A;  1S72 A;  2EYQ A;  4XK8 E;  3OB9 A;  3CPW A;  2ZCF B;  4M7A G;  3CPF A;  2DEQ A;  5A2Q E;  3TCJ A;  1G3Y A;  2V8J A;  5CIU A;  2DJZ A;  4OVA A;  1M1G A;  5CO7 A;  5GAO p;  3SD4 A;  2Y90 A;  3PTA A;  4A4E A;  2GQV A;  2KAF A;  1Q81 C;  5GAM g;  1G5V A;  1D3B A;  2JTM A;  3NTH A;  3CCQ T;  4M75 G;  2QQ9 A;  5CK9 A;  2DD4 A;  3ASK A;  4C8Q F;  4BAC A;  1UGP B;  4M77 A;  1XOV A;  3GP8 A;  1VQ8 A;  1Y07 A;  5GAM e;  1YIT T;  2E41 A;  2F5K A;  4HT8 A;  2VXF A;  3TRE A;  5LJ3 d;  4P5N A;  3KUF A;  4PNO A;  2RO0 A;  4BY6 C;  5LJ5 g;  2DAQ A;  1N6A A;  4FU6 A;  3RMS A;  5DM7 R;  4ME7 A;  2F69 A;  5GAN f;  1YJW A;  2HAX A;  1H3Z A;  2LCC A;  4ZTJ A;  3LGF A;  5LJ5 d;  1WQ7 A;  3JB9 J;  3V7S A;  3QJ6 A;  2ZGW A;  5FLX E;  2JN0 A;  3CBP A;  4R55 A;  2LDM A;  4Y28 E;  1HK9 A;  3HKS A;  3CD6 A;  4EMG A;  4M7D G;  2FYK A;  4X34 A;  1JBM A;  1VQL T;  1YJN A;  5GAO n;  3G4S T;  1LOJ A;  1FWZ A;  1R8O B;  2EJF A;  3G6E A;  2Y4Y A;  1YI2 A;  3PIP A;  3C95 A;  3FEO A;  5GAO r;  4GY5 A;  2PVG B;  3E9G A;  3HP9 A;  5GMK j;  2JUF A;  1RI0 A;  3OYL A;  5J39 A;  3CME T;  4RCB A;  4X9D A;  5D6W A;  4PJO A;  2XHC A;  2XDP A;  1JJ2 S;  3L2V A;  3FC3 A;  2MAM A;  3JB9 I;  1M1K C;  4PJO E;  2LC4 A;  1TH7 A;  4M78 E;  1Q82 C;  4M77 D;  4EMK A;  1U1T A;  1ZHI A;  4ZGD B;  1YHQ A;  2EKO A;  5LJ3 h;  1KD1 U;  2MI6 A;  4J5Y A;  3M56 A;  4F7U B;  4NL2 A;  4C92 E;  4QW2 A;  3JB9 G;  1VQ5 T;  3CCL T;  3T9N A;  3M4G A;  3FRN A;  4E7J A;  5CKB A;  2GCX A;  2DZ9 A;  3RES A;  1YJW T;  1U8R A;  1KD1 C;  3I55 A;  1NJI U;  4RG8 A;  3JSC A;  4TVR A;  4LDX A;  4PJO G;  3SWN A;  1UGQ B;  1QP2 A;  2DXB A;  3VJP A;  3VU3 C;  4ZN1 A;  1M1K U;  2CZ7 B;  3OYE A;  2ZPF B;  2KY9 A;  3GOX A;  1JRI A;  1XNI A;  4C5H A;  1PSF A;  2E5Q A;  2K3X A;  3SWN B;  1VQ7 T;  1KQ2 A;  4DOV A;  1I5L A;  1LJO A;  3PMT A;  3SFM A;  4F7U E;  2RH2 A;  1UB4 A;  5HK0 A;  5GAN 6;  4MML A;  4Q5W A;  4JLI A;  1VIF A;  1Y71 A;  5GMK m;  3QHS A;  4IUP A;  1MHN A;  3CCU A;  4JS4 A;  5LJ5 e;  3F70 A;  2HD0 A;  2IG0 A;  3RER A;  4PL6 A;  1QVG S;  1B34 B;  1WQW A;  2DKG A;  4OB2 B;  5KH6 A;  4J6X A;  1KC8 U;  3BDU A;  3QUI A;  4X9C A;  2WAC A;  3INZ A;  3LLR A;  2P0P A;  4QVC A;  1XTD A;  4RCC A;  4ZGJ B;  3L2Q A;  3MP1 A;  3MEA A;  1IRE B;  4L6V 5;  4XTU A;  4HCB A;  2KK4 A;  1WPY A;  2FVU A;  2K2V A;  5FRN A;  4OGE A;  4XTV A;  2ZPH B;  3O8V A;  4A4K A;  4PKC C;  5GAM j;  3ZBD A;  4QQG A;  2XI9 A;  3OS5 A;  3BW1 A;  3QPH A;  4C0D C;  2IVW A;  3HRT A;  2PVD B;  2E12 A;  3GF5 A;  5HY6 A;  5GMK i;  1K9M U;  1PSE A;  5GMK h;  2JVV A;  3MEW A;  1BI2 A;  3MCA B;  4J7F A;  4M75 B;  4XTW A;  4N0A C;  3J80 E;  4XU1 A;  4FIB A;  4C92 F;  1Q81 U;  4M78 D;  3QZ5 B;  1S72 T;  3JB9 H;  3OW2 A;  3I56 A;  5CKE A;  3GIB A;  3CC4 A;  2RK1 A;  5D6X A;  5A0L A;  2QXF A;  2QI2 A;  5CAI A;  2K5L A;  2MWO A;  3LWH A;  3CCQ A;  2F5T X;  1BIB A;  2E65 A;  4M77 F;  4LDY A;  2X4W A;  3M4Y A;  3FIF A;  5EG2 A;  4IUR A;  3URG A;  4DQ2 A;  3CCE T;  3UT1 A;  1G3W A;  4IUU A;  2DTH A;  1VQN T;  5HKC A;  5GAM f;  1ZQ1 A;  3X24 B;  1NE8 A;  2RHX A;  4L5G A;  1VQ7 A;  3JCM V;  1FXX A;  1W2B A;  1I81 A;  2KSS A;  3LX7 A;  3P8H A;  4LDV A;  3BDL A;  4O5V A;  2DZC A;  3OQ5 A;  3QJY A;  3JCM Q;  4KUD K;  2QEX A;  1K73 U;  1N8R U;  4ATO A;  2PU9 B;  3FDR A;  5LJ3 j;  3CCJ A;  4IUQ A;  3LGL A;  1VQK T;  3V8L A;  2B8A A;  5CQX A;  3M53 A;  2E6N A;  3JCM X;  5IAY A;  2EIF A;  4BDY A;  4MZT A;  2RJF A;  5IT9 E;  4LDU A;  1M1F A;  1ZBX A;  5DLO A;  2VC8 A;  2OTL A;  2CZ1 B;  2E70 A;  2K3Y A;  2O4X A;  2FL7 A;  3HRU A;  4FL6 A;  3CEY A;  5CKH A;  3L2Z A;  5HK3 A;  3A8O B;  5GAN e;  3JCM b;  3OYF A;  3OYG A;  3PMI A;  1UGR B;  3G71 A;  1M4Z A;  1XQH A;  1Y7X A;  4M7A C;  4M7D B;  3CCV T;  2CGH A;  1QVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...