1H3ZA

Solution structure of a pwwp domain from schizosaccharomyces pombe
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
SERVNYKPGMRVLTKMSGFPWWPSMVVTESKMTSVARKSKPKRAGTFYPVIFFPNKEYLWTGSDSLTPLTSEAISQFLEKPKPKTASLIKAYKMAQSTPDLDSLSVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Variation in Pwwp Domains
pubmed doi rcsb
molecule keywords HYPOTHETICAL 62.8 KDA PROTEIN C215.07C
source organism Schizosaccharomyces pombe
molecule tags Nuclear protein
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1h3zA00
5CIUA 2EQMA 2MWOA 2RJEA 2X4WA 3FLGA 3OYBA 4RG2A 4IUUA 5FROA 2DAQA 3PNWC 3OYGA 2K3XA 3C4SA 4N4IA 4LD6A 2RJFA 2LCCA 2RHIA 3NTKA 1KHCA 4BE0A 2RI5A 2L3RA 2WACA 2RHUA 3QBYA 3F70A 3S6WA 3LYIA 4N4GA 2RHXA 2LVMA 3QIIA 2R5AA 3OYMA 1WGSA 3QKJA 4HCZA 5D6WA 3OYIA 3MP8A 3OYAA 4C5IA 2X4XA 3LLRA 3OS1A 4IUPA 4EDUA 5M9OA 1WJSA 4C5GA 2XDPA 4GY5A 2R5MA 4B9XA 4Z02A 4BDZA 4Q5WA 3FDRA 2BIVA 3OYEA 3ME9A 3FC3A 4E7JA 3MP6A 3M9QA 2EQKA 2GFAA 5D6XA 4A4HA 5J39A 2CKKA 2EQUA 4L59A 4II1A 3OQ5A 2K3YA 4E7LA 3DB3A 3META 4E7KA 3MEAA 2RJCA 3DLMA 3PMTA 3DB4A 3OY9A 2FHDA 3PMIA 3H8ZA 2NLUA 3OMGA 4FU6A 3OMCA 2LDMA 3GOXA 3MEUA 1H3ZA 2RHYA 3OYFA 4BACA 4A4EA 3S3NA 4IURA 2QQRA 4OVAA 2F5KA 4QQDA 3L2WA 3S3MA 3BDLA 2E6NA 4PL6A 2DIGA 3L2QA 4IUQA 4A4GA 5KCOA 2EFIA 2IG0A 1MHNA 2LRQA 1WJQA 2E5QA 2QQSA 3ZEHA 3OYCA 2HQEA 2M1HA 2L8DA 3FEOA 3LH0A 5C6SA 2M0OA 3O8VA 5KE3A 3OYDA 5KE2A 3OA6A 3L2UA 3Q1JA 2X35A 3OYNA 2DIQA 2R58A 3LGFA 4PLIA 5KH6A 5FRMA 1XNIA 4BD3A 4CRIA 4QW2A 3OS2A 4E7HA 2X4YA 4FL6A 3S3OA 2B8AA 3E9FA 4PLLA 4NS5A 2RI3A 1OYXA 2BUDA 5KCHA 1RI0A 4ZTJA 3MP1A 3SD4A 4UC4A 3OYKA 3QJ6A 4BE2A 4IUVA 3CEYA 3MO8A 4C5EA 2JTFA 3OYHA 2EQJA 3OYLA 2LTOA 2O4XA 2PQWA 3EAEA 3NTHA 3LX7A 3P8DA 2L89A 4C5HA 3L2VA 2RI2A 2YRVA 3P8HA 4E7IA 5FRNA 2D9TA 4ZTFA 3MEVA 3LGLA 1OI1A 3L42A 2BKDN 4X34A 1WJRA 3OYJA 2JZ2A 5IN1A 5IAYA 2VYTA 3KUFA 2R57A 5J26A 3UT1A 3L2RA 4N4HA 4BDYA 2RHZA 2RJDA 2RO0A 3ASKA 4IUTA 3MEWA 3UWNA 4QQGA 3OS0A 3PFSA 5C0MA 1G5VA 2MWPA 2GFUA 3H6ZA 4QQ6A 3NTIA 3E9GA 4BE1A 2XK0A 1SSFA 3OB9A 1OZ2A 2EKOA 4A4FA 1OZ3A 2G3RA 2P0KA 2M16A 2GF7A 4QVZA 4IKFA 1N27A 5D6YA 2HQXA 4B9WA 2O4XB
chains in the Genus database with same CATH superfamily
3FLGA 2RK2A 5GAN3 3J80E 4JJBA 5I22A 2RHIA 2WACA 3CCVT 3M53A 2R5AA 2Y4YA 1WGSA 4HCZA 3SEMA 3BDUA 4A63B 3GIBA 2VGNA 3RMQA 2EBPA 3ME9A 1KIKA 2CP6A 3OSVA 1UEBA 3C0CA 2JT4A 4E7LA 1LVKA 2RA2A 2LC4A 4EMGA 1OX9A 4AT1B 5FLXE 1R0CB 1Y0MA 1K1ZA 3EH1A 4QQDA 3S3MA 3TSZA 1ZA2B 1CSKA 3V8KA 1QVFS 2MIOA 2FPFA 2EYXA 2QQSA 2YUQA 2DL5A 1I1JA 2DRMA 4KRTA 3I35A 4PJNA 2ZGWA 1XNIA 4PJOG 4OGCA 1XOVA 5HY6A 1VQNT 1TUGB 3GNGA 1AZEA 5GJWB 3R6OA 1RLQC 4GLMA 2DYBA 2VKNA 2ESWA 1OU9A 2EKHA 1WXTA 3NTHA 4X9DA 2LT4A 2DBMA 1FWZA 3CD6Q 1SF9A 4FYYB 3HKSA 1E6GA 2BKDN 3TREA 2H3EB 3THKA 4XAXB 4X34A 1I5LA 3CCQT 2K57A 1MV3A 5J26A 2QGGA 3JCMe 2RHZA 2RJDA 5HCKA 4PJLA 1D3BB 3SHWA 1UFFA 2OTJT 3H6ZA 3RERA 2EIFA 1Q81C 1X75C 2K5IA 3HRSA 4IKFA 3CD6A 9ATCB 1WZOA 2KT1A 3I5RA 1M3BA 4OMPA 4OMQA 1UJYA 4DQ2A 1GCPA 1X01A 4QVDA 3TEEA 3QWYA 4OB2B 3OW2P 3JCMf 3QG1A 3CCRQ 4M78B 1PSEA 5I2SA 1QKXA 3X25B 2EYQA 5CCAA 4TVRA 2ED0A 4A4HA 2HL3A 1TOVA 3VS5A 3MEAA 2E65A 2DEUA 2ROTA 3PMIA 2IVWA 2Y4XA 1W6XA 1D0XA 2KI7A 2F5KA 2HKQB 3G71A 3PTAA 2F2WA 4FYXB 4XTZA 4A4GA 2C0OA 3CCRA 3CQTA 5KE3A 1D09B 1RAAB 3LWIA 1B34B 3L2UA 5CKBA 1KFZA 2DIQA 4KULA 1C6VX 2NUZA 2YUPA 3EG9A 3TCJA 4XU0A 2XKOC 2AIRB 5IHNA 4M78A 1JXOA 2HQHA 4M77F 1QVFA 5GANd 2X4JA 1VYUA 5IHIA 2LTOA 4JS4A 2YWWA 1TXQA 3A8GB 3L2VA 1GXIE 3RESA 2QAZA 3OYJA 4KGXB 4DEYA 3UT1A 2DA9A 3V7CA 1KQSS 1YJNT 2ED1A 3OS0A 3PFSA 1K9MU 4MZTA 5CVIA 1KC8C 1VQ6Q 1UTIA 5GAN5 2JNGA 1Y71A 1VIFA 2DF6A 1YIJQ 2EQMA 3QXEB 2CH4A 2P0PA 1JRIA 5FROA 3HFOA 4BY6B 2RJFA 4ATOA 5GANg 2PNIA 1K4US 2EYZA 2JS0A 1QLYA 3RKXA 1NPRA 4J9EA 1QMCA 1D0YA 1M30A 1VQ6A 2YHTA 4C92G 3FC3A 3CXCP 4M78D 2QXFA 4M78C 1YIJA 5I21A 4QKUA 2SRCA 3M56A 1AEYA 3QZ5B 2KGTA 3EG1A 2FYKA 2NUPB 1W2BA 4LDUA 2JM8A 2QA4Q 1VQPT 3OW2S 2V8IA 1X6GA 1V1CA 4Y92A 5GMKh 4A4EA 4YTLA 4CC3A 2P4RA 3MJXA 4IUQA 4IIMA 1WJQA 2DNUA 3MHXA 2HKNA 2HBWA 1WFWA 4XU2A 4N0AA 1AOJA 2QTVA 3MCAB 4PKCC 1OYXA 2E10A 2KVQG 1T0HA 2QA4A 2KNBB 3G4ST 3EAEA 4HXJA 2YLBA 3CCET 5LJ3h 2NUPA 1OI1A 3HRTA 1WLPB 4JLGA 1QVPA 4PJJA 4M7AA 2I0NA 4JJCA 3WXMB 4LN2A 4M77E 1G83A 2ATCB 4J6WA 3CMEQ 1M3AA 4QQGA 1WA7A 3CCUT 3H9NA 3EG0A 4OF1A 2QQBA 4C0DB 3RKYA 3QWXX 4JZ3A 4QVZA 3C4SA 4LDYA 4RG2A 4M4ZA 3OBWA 2AZVA 2VUBA 4JJDA 3I56T 4DEXA 4RCBA 4DBRA 1BI0A 4M7DB 2CP2A 4J7FA 4P5NA 1VQ4Q 4BY6C 1VQ8Q 3CMEA 1N8RU 2R5MA 4NL2A 1HXDA 1Y57A 4N0AC 3SFMA 2DKGA 1AHJB 2LJ0A 1ABQA 3MP6A 4M77C 2FL7A 3VYGA 3M4GA 4L59A 1QKWA 2MMPA 4MDWA 4OMNA 4D8KA 2CT4A 3OY9A 1NPPA 3QSUA 1WIEA 1K8AU 1AZGB 4B6MA 4FSSA 1VQ8A 2DIGA 1QVGS 2NYSA 1VOMA 4M7AC 1ZBXA 2PVDB 2M1HA 3CXCS 1H3HA 1M90R 2J6OA 3QYGB 3M0PA 3X28B 4M75G 2BZYA 2E12A 3OW2A 3X24B 5CQXA 2FRYA 3S3OA 1PM3A 1E7OA 1VQLQ 2L5QA 1MMGA 2PQWA 2P0QA 1KHIA 2P4TA 1N5ZA 4FIBA 2HCKA 2LZ6B 1X2QA 1WJRA 2JZ2A 3OYYA 2CZ6B 3UWNA 3SB2A 1YHQQ 2MWPA 2AHJB 1VQLA 1VQ9Q 1NG2A 4QQ6A 4O5VA 3OB9A 4MMKA 4A4FA 2M16A 1N27A 1YITT 2MWOA 4XTXA 1YJ9T 2MAMA 1T3LA 3JB9G 4DBFA 1R77A 3VS4A 4JRQA 3FRNA 3V7SA 4WTOB 3EH2A 5KYYA 4M7DD 2VWFA 4JJNK 1YHQA 2L3PA 1WDXA 2EGAA 2KBTA 4LDXA 3SDZA 4F7UF 1YJWT 3NFCA 1IREB 1D1BA 3JCMV 3EGXA 1VUBA 4OMMA 3CCJQ 1G3WA 3JB9H 4C8QA 2DL4A 2QI2A 4PJOB 1SRMA 5DLQE 4FW2A 2EFIA 4PJMA 1K0SA 4M7DG 3VS3A 2VGMA 5KE2A 2R58A 3LGFA 3VRYA 1S1NA 4JZ4A 4QW2A 1B3QA 2KRMA 1TWBA 2KY9A 1X6OA 2JM9A 3LH5A 2PVOB 2EAYA 2ZPBB 3OBYA 4LUEA 4J83A 4CI0C 3CCSQ 2F5TX 1QVGA 4J9HA 1YFNA 4MDXA 4IUVA 3CCJA 4EMKB 5J3BA 4C8QE 2CSIA 3CXCA 2OTLT 1PD1A 3JAME 3ZL7C 3QO3A 1IGQA 1FMWA 3CC7Q 1M9SA 2DILA 3C94A 1BIAA 3VS6A 1AWOA 4RTUA 2DM1A 2ZPEB 2H3JA 1S72Q 2Z0WA 3UATA 3CCSA 2PUOB 2MPXC 4OGEA 1BKBA 3EHRA 3GPLA 3RBBB 3CC4T 1NE8A 1WI7A 1UDLA 4CC4B 2QGFB 1BIBA 4DBQA 1I4K1 1VQ5T 3CMAA 2X4WA 2LMJA 1VQMA 3PNWC 1U1TA 4C8QC 3J81E 4EMKA 5GANh 1U5SA 2EGEA 2K3BA 2JUFA 4KH1B 2DLPA 3VKIA 2QEXQ 1S72A 2LT1A 4PNOA 2DXBA 4C5GA 3QPHA 1X43A 4ZGJB 4GLKA 4Z02A 4OB3B 2XD0A 2BIVA 2L0AA 1WHJA 2XG8D 1Q81R 2EQUA 1PHTA 4LXCA 4KGZB 1BI1A 2OAUA 3CCLT 1IGUA 4OMOA 4WF2A 2M0YA 2MYSA 2QEXA 4J9FA 2RD1A 3RMSA 1U1SA 3ZEHA 4LD9K 4PJOD 4F7UE 1QCOA 3O8VA 5CO7A 1NJIR 4XU3A 4X1VA 1N8RC 6AT1B 2RNAA 2A7YA 2MI6A 4FM4B 2GQVA 1LOJA 2KE9A 4HA8A 4R0KA 3E19A 2HNIA 4ZTJA 3M54A 1EIFA 1WQWA 3MO8A 4HCKA 3QJYA 1K8AC 2LNVA 5A0DA 1QW1A 2DJZA 2KXDA 3MEVA 4EMKC 3PT9A 4DBHA 2KROA 1Q86R 1VYVA 2GTOA 3QYHB 1KQSP 4ORZA 1NM7A 1PC0A 3H0FA 1N9RA 4M78F 1FMVA 2W0ZA 3D7SB 4R56A 3E9GA 4J8OA 2XK0A 4RTZA 1UGVA 1RAGB 2V8KA 1WHLA 2E4HA 1KG1A 3H0HA 1MMNA 2CP7A 2QTXA 2V1RA 1D1AA 4ZN1A 4C92B 1IZ6A 5GAOq 1P92A 4KT0E 2YUNA 1H641 2XDBA 3FDRA 3OYEA 4CC7A 1Y7XA 1NBEB 1PKSA 1WNLA 2MK5A 1ZLMA 2CS7A 3SWNB 3BW1A 1Q7YR 3JRZA 3BE3A 4A54A 4RTYA 3G71Q 2QDLA 4CC2A 3L2WA 2Y90A 1KSWA 2KQWA 5GAN7 2FB7A 1RADB 3HFNA 2L8DA 3MKDA 1G8XA 2LQ8A 3A1PA 3RDVA 3OYNA 4PLIA 3VUZA 2A3LA 4ZGDB 5GAOn 1FXXA 3OS2A 1HSQA 1D3BA 3G1JA 5FU6B 1RAEB 1W1FA 5FW9A 5IXBA 2C06A 1U06A 5L23A 2BUDA 1YI2T 3HHTB 1LPLA 2CYZB 3VS2A 2DETA 4BE2A 1WHGA 2YLCA 3M0RA 2JTFA 3OYHA 4O6JA 3IQLA 2EPDA 4KUIA 1JBMA 1NLPC 2K5LA 2O31A 4ZGEB 1M1KR 2CH4W 2O9SA 1V29B 2GNCA 3A8LB 5HK0A 5GAMe 2D1XA 1VQ4T 2JTEA 3KUFA 2R57A 1VQOQ 1PRMC 3ASKA 4EPCA 1OPLA 1VQ7T 3EFOB 3BFMA 3VJPA 2VASA 1UHFA 1KD1R 1ZSZB 3QDRB 3AT1B 2FZKB 3I5SA 3REBB 4C0ZA 2RJEA 3OYBA 5L8RE 2A28A 1YBYA 2DL7A 3L1AA 3OYGA 2LCSA 4N4IA 4BUGA 4LD6A 4D6WA 5GAMf 1TS9A 3M0SA 1MV0B 4M7AF 3S6WA 1OPKA 1ZUUA 1VQOA 2A0FB 2E41A 3MP8A 4M78E 4V2SA 3I55Q 1RAFB 3VU3C 4C92D 2K5FA 1QWFA 1B34A 1U8RA 2XICA 4HCBA 3EGUA 1Z9ZA 1I81A 2E64A 4RG8A 2ZPIB 1FYNA 4PFOA 2MCNA 2ENMA 2HD0A 1SHFA 2KRNA 3OMGA 3JCMd 4BACA 2CGHA 1JXMA 2M51A 1UUEA 1ZA1B 3M55A 2D0NA 2QQRA 3I55A 3FB9A 4M75B 1K73R 2E1HA 2K9GA 3CCVA 1QVGP 3HPWA 5HKCA 2RQWA 1MHNA 4PFZA 1YP5A 3PIOA 2F2VA 2DZCA 2V26A 2J05A 4AG1C 3A98A 1VQKT 1PRLC 2DE0X 2RQRA 2DVJA 2LQWA 1VQ9T 5KCHA 2EGCA 1RI9A 1M90U 3JV3A 5FU7B 1KK7A 1G3YA 2DO3A 3LX7A 2L89A 1XQHA 1PSFA 5AT1B 4A53A 5GAOp 5GAMj 3A8HB 3M0UA 2PZ1A 5GAN4 2M9UA 3JCMg 5CKHA 1ARKA 3JB9J 3CCQQ 2YDLA 3CPWS 2DBKA 1VQNA 4PFPA 2C0TA 3N5BB 1V76A 1IB8A 2O88A 1JB0E 2LNHB 1OZ3A 2G3RA 2CP3A 1EFNA 2DXCA 3GNFB 4HVWA 1RAHB 1RACB 3CPFA 2K3XA 5GAMd 3QZ9B 1Y07A 2LCCA 2EVRA 2L3RA 3HRUA 1G2BA 2KR3A 2QYZA 1Q82R 3F70A 1Q95G 1NYGA 2KMTA 4RTVA 5D6WA 3OYAA 2CT3A 3FIFA 2X4XA 3CCQA 5IHKA 3OS1A 1I8FA 2K2VA 5EC7A 4KUDK 2QK0A 3JCMJ 2OTJA 4E47A 3P8BB 1IRXA 2CKKA 3OQ5A 3CCST 1KQSA 3DB3A 4M7AE 3RR6A 3PMTA 2DEQA 3KFVA 3OMCA 3C95A 3EG2A 3DLLA 2X9HA 4E7ZA 1ZBJA 1WXBA 5EG2A 3CC7T 1RLPC 2YT6A 3JCMQ 4M75D 2VVKA 3OYDA 5CKEA 5KYUB 2GBQA 4JDSA 1M4ZA 5KYXB 1S72T 1I0CA 5FRMA 4E7HA 4CRIA 3OSSC 2DTOA 1WPYA 2OAWA 1T3SA 1B7TA 2CUDA 2E6ZA 2FZGB 1RI0A 4BI3A 2GCXA 1M8MA 5A0LA 3CEYA 2L3SA 3VS0A 2KSSA 4ANJA 3P8DA 2F69A 4E7IA 4C8QF 1PNJA 3VV0A 3L42A 1E6HA 4LDWA 3G7ZA 4M7DA 3ER0A 2FVUA 5LL6S 4BDYA 1C0MA 4IUTA 1JO8A 1YWPA 2V8JA 4L6V5 3UPUA 2ZPHB 3A5ZB 1WHMA 3JCMc 1YJNQ 2FEIA 2GFUA 2EJ9A 5KYXA 1EZZB 2NUTB 1K0XA 2EW3A 2KT8A 3TVTA 3C12A 3JB9D 1D1CA 4M77G 4J9BA 1BK2A 3CCMQ 3VUBA 2CZ1B 1R8OB 4RTTA 2LCLA 3J7AF 1SHGA 1WQ7A 4ZN3A 1FX7A 4N4GA 2ZZDA 2JVVA 3U23A 4FCYA 3JCMb 2DL3A 3LLRA 4PJOF 2OJ2A 1YJNA 1BYMA 2G6FX 3E1SA 3TU4K 1YNZA 1JJ2S 5GJVB 2NWMA 4KGVB 4AFQC 4C0DC 2XIDA 3CCMA 2B86A 3ULRB 1YWOA 1OOTA 1J3TA 1YCYA 4AG2C 4HT9A 2CSQA 3INZA 1Q81U 2NUTA 1QP3A 3OYFA 2CUBA 1YCSB 2HSEB 5D7UA 3S3NA 4JLIA 4IIOA 4OVAA 2CP0A 1KJWA 5GMKm 3UF4A 4M7DC 1K9MC 2KEAA 3M59A 4J6XA 2W10A 2M0OA 1NEGA 1PD0A 1R0BG 2JMCA 1WHKA 1JEGA 1KQ2A 4J6YA 4NS5A 2RI3A 3EGDB 1NJIU 1BU1A 4F17A 5FWCA 1GFDA 1M2VB 3CD6T 2RQVA 1VQPA 5GAOm 4FT4A 2RI2A 3P8HA 2PU9B 2D9TA 4AFZC 3LGLA 3CBOA 3EFRA 1KQ1A 2ABLA 3CCEQ 4FSXA 2CZ7B 4RUGA 1OX8A 4EIKA 1CKBA 5C0MA 1Q86U 3EG3A 2GGRA 1M90C 5AYFA 1M27C 4JRKA 3NTIA 3CCUQ 8ATCB 1HJDA 4LDVA 1K8AR 5D6YA 3CMAQ 2HAXA 2O4XB 1VQMQ 3EGDA 4IUUA 1NLOC 1ZUKA 2JTMA 3R6NA 5KYNA 1M2VA 1N9SA 3CCEA 1M2OA 3G71T 1X2KA 2JW4A 2DD5A 2DRKA 4NOYA 3CCRT 3JSCA 4PJOA 2X3XD 3T9NA 1UE9A 1PG5B 2V1QA 4X9CA 1XTDA 3X20B 5DM7R 2BZ8A 4DA4A 5M9OA 1WJSA 1EX4A 4BDZA 2EQIA 4HKEA 3CCUA 2J06A 3REAB 3PVLA 5CKFA 1M3CA 3META 4PK4A 3DLMA 2E3HA 5GMKl 4PJOE 4KH0B 5GAN8 2LX7A 1X6BA 1JJ2A 2E6NA 2XMFA 2PUKB 3EHQA 5KCOA 1UGQB 1Q7YU 3FEOA 4JUVA 3WVDB 1GBRA 4F14A 1TG0A 1N6AA 3A8OB 2X4YA 4FL6A 3NGPA 3ZFJA 3QDFA 3E9FA 5GAOl 4UC4A 2IPOB 1RAIB 4AFSC 2A37A 2J6KA 5FRNA 3FJPA 2VXEA 2RMOA 4PJOC 2QG9B 1OU8A 4MZMA 3I55T 1M1KU 1GBQA 3M58A 3JCMh 4C8QG 2RO0A 3URGA 4C92F 2XHCA 1VQ6T 4RKUE 2DMOA 1YIJT 4BE1A 4ZNXA 2DK3A 5IT9E 5LJ5e 3OS5A 1AWWA 5CIUA 3ZBDA 1SKUB 2YRDA 1KD1U 4JRPA 1YITQ 3NTKA 4L5GA 3LWHA 5GANe 3LYIA 2LVMA 1YJ9Q 3OYIA 1UECA 1GFCA 2D8HA 2JMAA 2XDPA 4GY5A 4B9XA 3GLXA 1IXDA 1O75A 2J7IA 5J39A 2QA4T 1C1AA 5LJ5f 2K3YA 1BI3A 1BB9A 1OV3A 2QQAA 1YITA 1YJWQ 4FU6A 4QT7A 3NPFA 5KYWB 1H3ZA 1M1GA 1YJ9A 2QQ9A 2RF0A 5GANf 2A08A 4IURA 3CC2Q 2FPEA 3L2QA 1K76A 4J7IA 3KBGA 3OYCA 1KC8R 3LH0A 4E7SA 5GAMh 3OA6A 2YSQA 5CK9A 5IXFA 3M57A 4Y91A 4XTWA 1K73U 2BE9B 3JCMP 4FW1A 2DTIA 2B8AA 3JCMX 1OULA 4C0FA 2VXFA 2SEMA 2BE7D 1M1FA 3PE0A 2J6FA 1YJWA 4F7UG 3VS1A 3HP9A 2K79A 1ZQ1A 2K7AA 3E2UA 4XTVA 5A2QE 2HEQA 2AK5A 3CC2A 4OP0A 2YRVA 3G6EQ 1TUCA 1GL5A 2PTKA 2KRSA 3NMZC 2OTLQ 5CAIA 1F1BB 2M02A 4NL3A 4XQ3A 5KYWA 2KXCA 2RM4A 5IAYA 4C92A 3CMET 1M5Q1 1YN8A 4BI8B 3WVEB 4LUDA 3UA6A 2PVGB 3EFSA 3O5ZA 2MF2A 3EG9B 1W2BS 2EYWA 1G5VA 3GP8A 3TQ7P 3CPWP 1NJIC 1HK9A 5GAN2 2EKOA 2VC8A 2WSFE 4K11A 2GF7A 4HVVA 4ELZC 3G6EA 3CC4Q 5LJ5j 3SWNA 2OTLA 4WCIA 1VQ8T 1VQ5Q 4C92E 4BE0A 2RI5A 4LNPA 3QBYA 5GMKi 3QIIA 5GANj 2KYBA 4C5IA 4DOVA 1NZ9A 4OMFB 2CDTA 1PCXA 4M75F 1BI2A 1Q82U 1Q86C 1RABB 2FZCB 1I07A 4DOWA 1HD3A 2K4YA 5LJ5d 1U3OA 3CC4A 2E3IA 2XDDA 1GRIA 2AT1B 5ECAA 4J9GA 1VQ5A 2NLUA 4Z89A 2LDMA 2KDSA 1X69A 3CCLQ 3CCVQ 1H92A 4PL6A 2D0QB 4XTYA 4QVCA 1UGRB 2LRQA 2E5QA 4C92C 2QASA 2CREA 1UB4A 3PVQA 2ZPGB 2ZPFB 2DXUA 4BB7A 1M8VA 2X3WD 1GCQA 4JRIA 1VQLT 3EFOA 1SRLA 2HSPA 1RUWA 1SEMA 2DFUA 1ZUYA 3MP1A 1AWJA 1ZSZA 3QJ6A 1A0NB 2E5KA 2JOYA 4XU1A 4E2FB 3JB9I 1TTHB 3SWNC 3JB9F 3CCMT 2YRCA 3CCLA 5LJ5g 3L2ZA 1TSFA 1MGQA 1UGPB 1WX6A 2HL5C 4ZTFA 2O2OA 5GAOr 1MMDA 1Q7YC 5IN1A 2VYTA 3PIPA 1YHQT 3L2RA 1DJ7B 1WYXA 2QDYB 1SSHA 1VQNQ 2DXTA 2RH2A 2HMAA 4M77B 5FU6C 4Z88A 3BY7A 2ZAEA 5A0GA 1QP2A 3NHNA 2WSCE 4EMHA 1ZSGA 1FMKA 2FRWA 1W70A 4RCCA 2RHUA 4AFUC 3CBPA 4HCCA 4M7DF 1ZX6A 2P84A 4M7AB 2RHXA 4M75A 3OYMA 2JN0A 1M1KC 3UDCA 1JU5C 1BCOA 2YXYA 1OEBA 4IUPA 3M0QA 4GBQA 1NYFA 2D8JA 2JS2A 2ZCFB 4J9CA 2E70A 1GCQC 1Y96B 3GBQA 2OTJQ 4F16A 1JJ2P 4II1A 1ZSZC 2IIMA 3MPUB 3CCJT 4M78G 4RTWA 2C0IA 4M77A 2RJCA 4Z8AA 3H8ZA 1KD1C 5HK3A 4BI4A 3GOXA 4E6RA 4M75E 3RNJA 2JJ9A 3BDLA 2DD4A 3JCMW 1BCMA 2F1LA 4HT8A 2X35A 2EWNA 5KH6A 2DL8A 2O9VA 2F2XA 3UA7A 2JXBA 1JQQA 1BBZA 3OYKA 1Y96A 1WXUA 4OMLA 4C5EA 3CMAT 1AVZC 5GMKe 3QHSA 2AKKA 1VQMT 1YI2Q 3VRZA 1B07A 2LP5A 5GAMg 2CZ0B 4M75C 1K9MR 2VB6A 2DERA 1QCNA 1K73C 3RIRA 2A36A 1XJWB 3V8LA 1MNEA 2AZSA 2FG0A 1G3TA 1O9SA 2KYMA 1VQ7Q 4M77D 3DKMA 5FU7C 1ZHIA 1YI2A 4Y28E 4B9WA 5LJ3e 1RL2A 2DTHA 4OB1B 1UG1A 4XK8E 1PKTA 3M0TA 2QEXT 5CR2A 1QQJA 2MOXA 3QKJA 1VQ4A 2DJQA 4M7AD 2L2PA 4ESRA 1TH7A 5KYUA 4Q5WA 1VQ7A 4E7JA 2EQKA 2GFAA 4JS5A 1X27A 4E7KA 2EYYA 1VA7A 5LJ3f 4M7DE 4KBMB 4ELYC 3CPWA 4HVUA 2RQTA 1H8KA 2LJ3A 2D6FA 5DY9A 2RK1A 2FPDA 3QUIA 4F04B 1WHHA 2COWA 2IG0A 2RPNA 5KYYB 2O01E 4M7AG 5C6SA 1AD5A 4J5YA 2KK4A 3Q1JA 1Q82C 1I5OB 3V8JA 4BD3A 1MUZA 3V7RA 2LQNA 3AHUA 3RUXA 5I11A 2EJFA 4PLLA 4R55A 4J9IA 1VQKQ 3SD4A 1UGSB 2VV5A 3EGXB 1VYTA 4J9DA 3OYLA 1VQPQ 4JPBW 4LE9A 5GMKj 4FYVB 2LJ1A 2DVEA 1SPKA 4C8QB 1QWEA 4FYWB 4VUBA 7AT1B 1LJOA 1LCKA 1UHCA 2HDAA 1K9AA 3TSWA 2DX1A 2FO0A 4FT2A 1W4SA 4OB0B 2LX9A 2AKLA 2BTTA 1VQKA 2DYIA 1VIEA 2OI3A 4RMOA 1VQ9A 1CKAA 1OZ2A 1AT1B 2DPPB 2COZA 3G4SQ 2HZYA 2BZXA 2OX7A 5FWBA 5LJ3j 2DAQA 1TU0B 3LW5E 1KHCA 1N8RR 3CC2T 2XU8A 2GTJA 2XI9A 1PWTA 1SG5A 1IO6A 5CQYA 4EDUA 2ROLA 1D0ZA 1QVFP 2I2LA 3I9QA 2H8HA 3FJ5A 4AMCA 3VS7A 5D6XA 3M9QA 4C0GA 1IHWA 4RTXA 3G4SA 3PGGA 3H41A 5LJ3d 2DZ9A 2L3QA 3HTRA 3VYHB 1OQKA 3DB4A 4XTUA 2FHDA 3M4YA 2RQUA 1ACMB 2RB6A 4ME7A 3MEUA 2RHYA 3G6ET 4A4KA 3I56Q 1T0JA 2EJGA 2YUOA 1UJ0A 1NEBA 3A8MB 2WSEE 2K6DA 1MMAA 3HSBA 2HQEA 8AT1B 2X51A 4F7UB 2HBPA 2ECZA 3RKWA 1KC8U 1IHVA 1QCFA 3HL8A 5I2MA 2EQJA 5GAN6 2O4XA 5DLOA 1AWXA 3I56A 4C5HA 5LJ5h 1ABOA 2RN8A 5CKDA 5LJ3g 2CP5A 3CBMA 1HYOA 3H0IA 4C8QD 1Z9QA 4MMLA 3CC7A 1VQOT 3KXTA 4D8DA 1MNDA 2GQIA 4MZPA 1G3SA 3M5AA 1TUDA 4N4HA 2LQKA 3X26B 3MEWA 2KAFA 2K2MA 1W2BP 5IH2A 3GF5A 1SSFA 2COYA 1LNXA 4F7UA 2P0KA 2HQXA
chains in the Genus database with same CATH topology
2MWOA 5LJ5j 3SWNA 3FLGA 2RK2A 2OTLA 5GAN3 3J80E 3CPFA 4XTXA 2K3XA 5GAMd 1YJ9T 2MAMA 3JB9G 3QZ9B 1VQ8T 1Y07A 4C92E 2LCCA 2RHIA 4BE0A 2RI5A 2L3RA 2WACA 3HRUA 4JRQA 3QBYA 3F70A 3FRNA 5GMKi 3CCVT 3M53A 2KMTA 3QIIA 2R5AA 2Y4YA 1WGSA 4HCZA 3V7SA 5D6WA 5GANj 3OYAA 3FIFA 4C5IA 4DOVA 1NZ9A 4M7DD 2X4XA 4OMFB 3CCQA 4JJNK 4M75F 3OS1A 1YHQA 3BDUA 3GIBA 1I8FA 2K2VA 1BI2A 1Q82U 1Q86C 4KUDK 2VGNA 3RMQA 3ME9A 3JCMJ 4DOWA 3OSVA 2OTJA 4E47A 2K4YA 3P8BB 4F7UA 5LJ5d 4LDXA 3SDZA 4F7UF 1UEBA 2CKKA 3OQ5A 3CCST 3CC4A 1YJWT 1KQSA 3NFCA 1IREB 4E7LA 3DB3A 4M7AE 3JCMV 2XDDA 2RA2A 2LC4A 2DEQA 3PMTA 4EMGA 1VUBA 1VQ5A 2NLUA 3OMCA 2LDMA 5FLXE 3C95A 3DLLA 1G3WA 2KDSA 5FRMA 3JB9H 4C8QA 4M7DF 5EG2A 4QQDA 3CC7T 3S3MA 2QI2A 4PJOB 4PL6A 2D0QB 4XTYA 5DLQE 3V8KA 4QVCA 1QVFS 2EFIA 1UGRB 3JCMQ 2LRQA 2E5QA 4C92C 2QQSA 4M75D 3OYDA 4M7DG 1UB4A 2ZPGB 2VGMA 5CKEA 5KE2A 2ZPFB 2DXUA 2R58A 3LGFA 4JDSA 1M4ZA 2ZGWA 4BB7A 1S72T 1XNIA 4PJOG 4CRIA 4QW2A 3OSSC 4OGCA 2DTOA 1XOVA 5HY6A 4E7HA 1VQNT 4JRIA 1M8VA 2KY9A 1VQLT 1X6OA 1WPYA 2PVOB 2EAYA 3GNGA 2ZPBB 3OBYA 2E6ZA 4J83A 4CI0C 1RI0A 3R6OA 3MP1A 2F5TX 4BI3A 1QVGA 3QJ6A 2GCXA 4MDXA 4IUVA 5A0LA 3CEYA 3CCJA 2JOYA 4XU1A 4EMKB 5J3BA 4C8QE 3JB9I 3SWNC 2KSSA 3CXCA 2OTLT 3JB9F 3CCMT 3NTHA 4X9DA 3CCLA 2LT4A 3P8DA 4HCBA 1FWZA 5LJ5g 2F69A 4E7IA 4C8QF 3JAME 3L2ZA 3QO3A 3VV0A 1MGQA 1UGPB 4ZTFA 3HKSA 3L42A 1M9SA 2BKDN 4LDWA 3TREA 3C94A 5GAOr 1Q7YC 4XAXB 1BIAA 4X34A 3G7ZA 4M7DA 1I5LA 3ER0A 5IN1A 2VYTA 3PIPA 3CCQT 2K57A 1YHQT 2FVUA 5J26A 5LL6S 2ZPEB 3L2RA 1DJ7B 3JCMe 2QDYB 2RHZA 2RJDA 4BDYA 2H3JA 1D3BB 4IUTA 2V8JA 2DXTA 2RH2A 2ZPHB 3A5ZB 4L6V5 3CCSA 3UPUA 2PUOB 3JCMc 4M77B 2OTJT 5FU6C 4OGEA 1BKBA 2GFUA 3H6ZA 3GPLA 3RERA 2EIFA 1Q81C 3CC4T 2EJ9A 3BY7A 1NE8A 5A0GA 1X75C 1BIBA 1QP2A 2K5IA 1I4K1 3HRSA 3C12A 3JB9D 4IKFA 1VQ5T 3CD6A 3CMAA 4M77G 2WSCE 2X4WA 3VUBA 2CZ1B 1VQMA 4EMHA 1R8OB 3PNWC 2LCLA 3J7AF 1U1TA 4RCCA 4C8QC 3J81E 4EMKA 2RHUA 1WQ7A 4DQ2A 3CBPA 1X01A 4ZN3A 5GANh 4HCCA 1FX7A 4QVDA 4N4GA 4M7AB 2RHXA 2JVVA 2ZZDA 4M75A 4OB2B 3TEEA 2JN0A 2JUFA 3JCMb 3UDCA 3OYMA 1M1KC 3VKIA 3JCMf 1S72A 2LT1A 3LLRA 4PJOF 3QG1A 4PNOA 4IUPA 2DXBA 4C5GA 3QPHA 1YJNA 1BYMA 2ZCFB 1PSEA 4GLKA 4M78B 4Z02A 4ZGJB 2E70A 3E1SA 5I2SA 4OB3B 3TU4K 2XD0A 1Y96B 2BIVA 3X25B 2EYQA 5CCAA 1JJ2S 4TVRA 2XG8D 4A4HA 2EQUA 4II1A 4C0DC 2XIDA 3CCMA 3CCJT 4M78G 3MEAA 2E65A 2RJCA 4M77A 1BI1A 2OAUA 3PMIA 3H8ZA 1YCYA 3CCLT 2IVWA 1KD1C 4HT9A 2Y4XA 3INZA 4BI4A 5HK3A 3GOXA 1QP3A 4M75E 1Q81U 4WF2A 3OYFA 3S3NA 4JLIA 4OVAA 2F5KA 3G71A 2QEXA 3BDLA 3PTAA 5GMKm 4XTZA 2RD1A 2DD4A 4A4GA 3CCRA 3JCMW 3RMSA 4M7DC 1U1SA 3ZEHA 1K9MC 4LD9K 3M59A 4F7UE 4J6XA 4PJOD 5KE3A 3LWIA 2M0OA 3O8VA 5CO7A 4XU3A 1N8RC 1B34B 3L2UA 5CKBA 2X35A 4HT8A 2DIQA 2EWNA 5KH6A 2A7YA 2MI6A 4KULA 4FM4B 2GQVA 1LOJA 4HA8A 3TCJA 1KQ2A 3E19A 4XU0A 2XKOC 4J6YA 2HNIA 4NS5A 2RI3A 4ZTJA 1NJIU 3M54A 4M78A 1EIFA 1WQWA 3OYKA 4M77F 1QVFA 5GANd 1Y96A 3MO8A 3CD6T 2X4JA 4C5EA 3CMAT 3QJYA 5GMKe 1K8AC 2LTOA 3QHSA 4JS4A 1VQMT 1VQPA 2LNVA 5A0DA 1QW1A 3A8GB 5GAOm 4FT4A 3L2VA 2DJZA 2RI2A 1GXIE 3P8HA 2PU9B 2D9TA 3MEVA 3LGLA 3PT9A 4EMKC 5GAMg 3CBOA 2CZ0B 3EFRA 1KQ1A 4M75C 3RESA 4FSXA 3OYJA 3UT1A 3V7CA 1KQSS 1YJNT 3QYHB 2CZ7B 1K73C 3RIRA 3V8LA 3OS0A 3PFSA 5C0MA 1Q86U 1K9MU 4MZTA 5CVIA 1KC8C 1M90C 1N9RA 4M78F 5AYFA 4R56A 1G3TA 1O9SA 3NTIA 3E9GA 4J8OA 2XK0A 4JRKA 2JNGA 1Y71A 4M77D 3DKMA 1VIFA 5FU7C 1ZHIA 1YI2A 4LDVA 4Y28E 2V8KA 5D6YA 2HAXA 4B9WA 2O4XB 2EQMA 5LJ3e 3QXEB 1RL2A 2P0PA 1JRIA 4IUUA 2JTMA 5FROA 3HFOA 1KG1A 4BY6B 2DTHA 4OB1B 2RJFA 4XK8E 1N9SA 3CCEA 2QEXT 3G71T 4ATOA 5CR2A 5GANg 2DD5A 4NOYA 3CCRT 2QTXA 3JSCA 4PJOA 3T9NA 4ZN1A 3QKJA 4C92B 1IZ6A 5GAOq 1P92A 1VQ4A 4KT0E 4X9CA 4M7AD 3RKXA 1XTDA 3X20B 5DM7R 4DA4A 1NPRA 5M9OA 1H641 2XDBA 1WJSA 1TH7A 1VQ6A 2YHTA 4BDZA 4Q5WA 1VQ7A 3FDRA 4C92G 3OYEA 3FC3A 4HKEA 4M78D 3CCUA 2EQKA 2GFAA 4E7JA 2QXFA 4JS5A 4M78C 1YIJA 5I21A 1Y7XA 3M56A 5CKFA 3META 4E7KA 1WNLA 5LJ3f 4M7DE 3QZ5B 4KBMB 2FYKA 4ELYC 2CS7A 3DLMA 3SWNB 3BW1A 4LDUA 3CPWA 1W2BA 1VQPT 5GMKl 2D6FA 3JRZA 4PJOE 3OW2S 2V8IA 5DY9A 2RK1A 5GMKh 5GAN8 4A54A 4A4EA 4YTLA 3L2WA 1JJ2A 2Y90A 2E6NA 3QUIA 2KQWA 4IUQA 2PUKB 5KCOA 2IG0A 1UGQB 2FB7A 1WJQA 5GAN7 1Q7YU 2O01E 3HFNA 3FEOA 2L8DA 5C6SA 4JUVA 4M7AG 3MHXA 2LQ8A 4J5YA 2KK4A 3WVDB 3Q1JA 3OYNA 1Q82C 4PLIA 3V8JA 3VUZA 2A3LA 4ZGDB 5GAOn 1FXXA 4BD3A 4XU2A 3OS2A 4N0AA 1N6AA 1D3BA 2X4YA 3A8OB 4FL6A 3V7RA 5FU6B 3ZFJA 2C06A 3RUXA 3AHUA 2EJFA 3E9FA 4PLLA 3MCAB 4PKCC 1OYXA 2BUDA 2E10A 4R55A 2KVQG 1YI2T 5GAOl 3HHTB 3SD4A 2QA4A 4UC4A 1UGSB 2CYZB 2VV5A 4BE2A 2YLCA 3G4ST 2JTFA 3OYHA 4O6JA 3OYLA 3EAEA 2YLBA 4KUIA 5GMKj 1JBMA 4ZGEB 2K5LA 2DVEA 3CCET 4C8QB 1V29B 5FRNA 5LJ3h 3A8LB 4VUBA 5HK0A 1OI1A 3FJPA 1LJOA 3HRTA 2VXEA 4JLGA 5GAMe 4PJOC 1QVPA 1VQ4T 4M7AA 4FT2A 1W4SA 4MZMA 3I55T 3KUFA 1M1KU 3M58A 2R57A 3WXMB 3JCMh 4C8QG 4M77E 2RO0A 3ASKA 3URGA 4EPCA 4OB0B 4C92F 2XHCA 1VQ6T 4RKUE 4J6WA 1VQ7T 4QQGA 2LX9A 3BFMA 3CCUT 1VQKA 1VIEA 3VJPA 4RMOA 4OF1A 2QQBA 1YIJT 4BE1A 3QDRB 4C0DB 1VQ9A 1OZ2A 2DPPB 3RKYA 2DK3A 4QVZA 5IT9E 5LJ5e 3OS5A 3C4SA 4C0ZA 5CIUA 2RJEA 3ZBDA 3OYBA 5L8RE 4LDYA 1YBYA 4RG2A 5LJ3j 2DAQA 3L1AA 3OYGA 3OBWA 1KD1U 4N4IA 4BUGA 4LD6A 4JRPA 4D6WA 2VUBA 3LW5E 3NTKA 1KHCA 4L5GA 5GAMf 3I56T 4RCBA 3CC2T 2XU8A 1BI0A 3S6WA 2XI9A 3LYIA 5GANe 3LWHA 4M7AF 4J7FA 2LVMA 4P5NA 4M7DB 4BY6C 1VQOA 3OYIA 2E41A 3MP8A 4M78E 4V2SA 3CMEA 5CQYA 3VU3C 4C92D 4EDUA 2K5FA 1B34A 1U8RA 1N8RU 2XDPA 4GY5A 2R5MA 2XICA 4NL2A 1HXDA 4B9XA 4N0AC 3SFMA 3GLXA 2DKGA 1I81A 1AHJB 2I2LA 5GAN5 2E64A 4RG8A 3MP6A 3M9QA 4M77C 5D6XA 4C0GA 2ZPIB 1O75A 2FL7A 3PGGA 3VYGA 3M4GA 4L59A 5J39A 2MMPA 3G4SA 5LJ3d 5LJ5f 2DZ9A 2K3YA 1BI3A 2QA4T 4MDWA 3VYHB 2QQAA 2HD0A 4XTUA 3DB4A 3OY9A 1NPPA 2FHDA 1YITA 3QSUA 3M4YA 3OMGA 4FU6A 1K8AU 2RB6A 4ME7A 3MEUA 1H3ZA 3JCMd 2RHYA 4BACA 2CGHA 3G6ET 1M1GA 3M55A 2QQ9A 4A4KA 5GANf 1YJ9A 1VQ8A 2EJGA 2QQRA 4IURA 3A8MB 2WSEE 3I55A 3FB9A 4M75B 2DIGA 2E1HA 3L2QA 1QVGS 3CCVA 3HSBA 4M7AC 3HPWA 5HKCA 2PVDB 1MHNA 1ZBXA 4J7IA 3KBGA 3OYCA 2HQEA 2M1HA 3LH0A 3CXCS 5GAMh 3OA6A 3QYGB 3PIOA 3X28B 5CK9A 3M57A 2DZCA 4Y91A 4M75G 4XTWA 4F7UB 1K73U 2HBPA 1VQKT 2E12A 3JCMP 3OW2A 3X24B 3RKWA 5CQXA 2DTIA 3S3OA 2B8AA 3JCMX 1VQ9T 4C0FA 5KCHA 1KC8U 2VXFA 1M90U 1M1FA 5FU7B 1G3YA 1YJWA 4F7UG 2L5QA 3HP9A 3HL8A 1ZQ1A 2DO3A 2EQJA 4XTVA 5I2MA 5GAN6 2O4XA 2PQWA 5DLOA 5A2QE 2P0QA 3LX7A 3I56A 3CC2A 1KHIA 2L89A 4OP0A 4C5HA 5LJ5h 2YRVA 5CKDA 1XQHA 5LJ3g 2P4TA 3CBMA 5CAIA 4NL3A 4FIBA 1PSFA 4C8QD 3CC7A 4MMLA 4XQ3A 1VQOT 4A53A 3KXTA 5GAOp 1WJRA 5GAMj 2RM4A 2JZ2A 4C92A 3A8HB 4MZPA 5IAYA 3CMET 1M5Q1 1G3SA 2M9UA 3M5AA 3OYYA 3JCMg 5GAN4 4BI8B 4N4HA 5CKHA 3WVEB 2LQKA 2PVGB 3EFSA 2CZ6B 3X26B 3JB9J 2MF2A 3UWNA 3MEWA 2KAFA 3SB2A 3CPWS 1W2BS 1G5VA 3GP8A 2MWPA 2AHJB 1VQNA 1VQLA 1NJIC 1HK9A 3N5BB 4QQ6A 3GF5A 1SSFA 3OB9A 4O5VA 5GAN2 2VC8A 1LNXA 2WSFE 1JB0E 2EKOA 4MMKA 1OZ3A 2P0KA 2G3RA 2M16A 4A4FA 2DXCA 2GF7A 3GNFB 1N27A 2HQXA 4ELZC 1YITT 3G6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CIU A;  2EQM A;  2MWO A;  2RJE A;  2X4W A;  3FLG A;  3OYB A;  4RG2 A;  4IUU A;  5FRO A;  2DAQ A;  3PNW C;  3OYG A;  2K3X A;  3C4S A;  4N4I A;  4LD6 A;  2RJF A;  2LCC A;  2RHI A;  3NTK A;  1KHC A;  4BE0 A;  2RI5 A;  2L3R A;  2WAC A;  2RHU A;  3QBY A;  3F70 A;  3S6W A;  3LYI A;  4N4G A;  2RHX A;  2LVM A;  3QII A;  2R5A A;  3OYM A;  1WGS A;  3QKJ A;  4HCZ A;  5D6W A;  3OYI A;  3MP8 A;  3OYA A;  4C5I A;  2X4X A;  3LLR A;  3OS1 A;  4IUP A;  4EDU A;  5M9O A;  1WJS A;  4C5G A;  2XDP A;  4GY5 A;  2R5M A;  4B9X A;  4Z02 A;  4BDZ A;  4Q5W A;  3FDR A;  2BIV A;  3OYE A;  3ME9 A;  3FC3 A;  4E7J A;  3MP6 A;  3M9Q A;  2EQK A;  2GFA A;  5D6X A;  4A4H A;  5J39 A;  2CKK A;  2EQU A;  4L59 A;  4II1 A;  3OQ5 A;  2K3Y A;  4E7L A;  3DB3 A;  3MET A;  4E7K A;  3MEA A;  2RJC A;  3DLM A;  3PMT A;  3DB4 A;  3OY9 A;  2FHD A;  3PMI A;  3H8Z A;  2NLU A;  3OMG A;  4FU6 A;  3OMC A;  2LDM A;  3GOX A;  3MEU A;  1H3Z A;  2RHY A;  3OYF A;  4BAC A;  4A4E A;  3S3N A;  4IUR A;  2QQR A;  4OVA A;  2F5K A;  4QQD A;  3L2W A;  3S3M A;  3BDL A;  2E6N A;  4PL6 A;  2DIG A;  3L2Q A;  4IUQ A;  4A4G A;  5KCO A;  2EFI A;  2IG0 A;  1MHN A;  2LRQ A;  1WJQ A;  2E5Q A;  2QQS A;  3ZEH A;  3OYC A;  2HQE A;  2M1H A;  2L8D A;  3FEO A;  3LH0 A;  5C6S A;  2M0O A;  3O8V A;  5KE3 A;  3OYD A;  5KE2 A;  3OA6 A;  3L2U A;  3Q1J A;  2X35 A;  3OYN A;  2DIQ A;  2R58 A;  3LGF A;  4PLI A;  5KH6 A;  5FRM A;  1XNI A;  4BD3 A;  4CRI A;  4QW2 A;  3OS2 A;  4E7H A;  2X4Y A;  4FL6 A;  3S3O A;  2B8A A;  3E9F A;  4PLL A;  4NS5 A;  2RI3 A;  1OYX A;  2BUD A;  5KCH A;  1RI0 A;  4ZTJ A;  3MP1 A;  3SD4 A;  4UC4 A;  3OYK A;  3QJ6 A;  4BE2 A;  4IUV A;  3CEY A;  3MO8 A;  4C5E A;  2JTF A;  3OYH A;  2EQJ A;  3OYL A;  2LTO A;  2O4X A;  2PQW A;  3EAE A;  3NTH A;  3LX7 A;  3P8D A;  2L89 A;  4C5H A;  3L2V A;  2RI2 A;  2YRV A;  3P8H A;  4E7I A;  5FRN A;  2D9T A;  4ZTF A;  3MEV A;  3LGL A;  1OI1 A;  3L42 A;  2BKD N;  4X34 A;  1WJR A;  3OYJ A;  2JZ2 A;  5IN1 A;  5IAY A;  2VYT A;  3KUF A;  2R57 A;  5J26 A;  3UT1 A;  3L2R A;  4N4H A;  4BDY A;  2RHZ A;  2RJD A;  2RO0 A;  3ASK A;  4IUT A;  3MEW A;  3UWN A;  4QQG A;  3OS0 A;  3PFS A;  5C0M A;  1G5V A;  2MWP A;  2GFU A;  3H6Z A;  4QQ6 A;  3NTI A;  3E9G A;  4BE1 A;  2XK0 A;  1SSF A;  3OB9 A;  1OZ2 A;  2EKO A;  4A4F A;  1OZ3 A;  2G3R A;  2P0K A;  2M16 A;  2GF7 A;  4QVZ A;  4IKF A;  1N27 A;  5D6Y A;  2HQX A;  4B9W A;  2O4X B; 
#chains in the Genus database with same CATH topology
 3FLG A;  2RK2 A;  5GAN 3;  3J80 E;  4JJB A;  5I22 A;  2RHI A;  2WAC A;  3CCV T;  3M53 A;  2R5A A;  2Y4Y A;  1WGS A;  4HCZ A;  3SEM A;  3BDU A;  4A63 B;  3GIB A;  2VGN A;  3RMQ A;  2EBP A;  3ME9 A;  1KIK A;  2CP6 A;  3OSV A;  1UEB A;  3C0C A;  2JT4 A;  4E7L A;  1LVK A;  2RA2 A;  2LC4 A;  4EMG A;  1OX9 A;  4AT1 B;  5FLX E;  1R0C B;  1Y0M A;  1K1Z A;  3EH1 A;  4QQD A;  3S3M A;  3TSZ A;  1ZA2 B;  1CSK A;  3V8K A;  1QVF S;  2MIO A;  2FPF A;  2EYX A;  2QQS A;  2YUQ A;  2DL5 A;  1I1J A;  2DRM A;  4KRT A;  3I35 A;  4PJN A;  2ZGW A;  1XNI A;  4PJO G;  4OGC A;  1XOV A;  5HY6 A;  1VQN T;  1TUG B;  3GNG A;  1AZE A;  5GJW B;  3R6O A;  1RLQ C;  4GLM A;  2DYB A;  2VKN A;  2ESW A;  1OU9 A;  2EKH A;  1WXT A;  3NTH A;  4X9D A;  2LT4 A;  2DBM A;  1FWZ A;  3CD6 Q;  1SF9 A;  4FYY B;  3HKS A;  1E6G A;  2BKD N;  3TRE A;  2H3E B;  3THK A;  4XAX B;  4X34 A;  1I5L A;  3CCQ T;  2K57 A;  1MV3 A;  5J26 A;  2QGG A;  3JCM e;  2RHZ A;  2RJD A;  5HCK A;  4PJL A;  1D3B B;  3SHW A;  1UFF A;  2OTJ T;  3H6Z A;  3RER A;  2EIF A;  1Q81 C;  1X75 C;  2K5I A;  3HRS A;  4IKF A;  3CD6 A;  9ATC B;  1WZO A;  2KT1 A;  3I5R A;  1M3B A;  4OMP A;  4OMQ A;  1UJY A;  4DQ2 A;  1GCP A;  1X01 A;  4QVD A;  3TEE A;  3QWY A;  4OB2 B;  3OW2 P;  3JCM f;  3QG1 A;  3CCR Q;  4M78 B;  1PSE A;  5I2S A;  1QKX A;  3X25 B;  2EYQ A;  5CCA A;  4TVR A;  2ED0 A;  4A4H A;  2HL3 A;  1TOV A;  3VS5 A;  3MEA A;  2E65 A;  2DEU A;  2ROT A;  3PMI A;  2IVW A;  2Y4X A;  1W6X A;  1D0X A;  2KI7 A;  2F5K A;  2HKQ B;  3G71 A;  3PTA A;  2F2W A;  4FYX B;  4XTZ A;  4A4G A;  2C0O A;  3CCR A;  3CQT A;  5KE3 A;  1D09 B;  1RAA B;  3LWI A;  1B34 B;  3L2U A;  5CKB A;  1KFZ A;  2DIQ A;  4KUL A;  1C6V X;  2NUZ A;  2YUP A;  3EG9 A;  3TCJ A;  4XU0 A;  2XKO C;  2AIR B;  5IHN A;  4M78 A;  1JXO A;  2HQH A;  4M77 F;  1QVF A;  5GAN d;  2X4J A;  1VYU A;  5IHI A;  2LTO A;  4JS4 A;  2YWW A;  1TXQ A;  3A8G B;  3L2V A;  1GXI E;  3RES A;  2QAZ A;  3OYJ A;  4KGX B;  4DEY A;  3UT1 A;  2DA9 A;  3V7C A;  1KQS S;  1YJN T;  2ED1 A;  3OS0 A;  3PFS A;  1K9M U;  4MZT A;  5CVI A;  1KC8 C;  1VQ6 Q;  1UTI A;  5GAN 5;  2JNG A;  1Y71 A;  1VIF A;  2DF6 A;  1YIJ Q;  2EQM A;  3QXE B;  2CH4 A;  2P0P A;  1JRI A;  5FRO A;  3HFO A;  4BY6 B;  2RJF A;  4ATO A;  5GAN g;  2PNI A;  1K4U S;  2EYZ A;  2JS0 A;  1QLY A;  3RKX A;  1NPR A;  4J9E A;  1QMC A;  1D0Y A;  1M30 A;  1VQ6 A;  2YHT A;  4C92 G;  3FC3 A;  3CXC P;  4M78 D;  2QXF A;  4M78 C;  1YIJ A;  5I21 A;  4QKU A;  2SRC A;  3M56 A;  1AEY A;  3QZ5 B;  2KGT A;  3EG1 A;  2FYK A;  2NUP B;  1W2B A;  4LDU A;  2JM8 A;  2QA4 Q;  1VQP T;  3OW2 S;  2V8I A;  1X6G A;  1V1C A;  4Y92 A;  5GMK h;  4A4E A;  4YTL A;  4CC3 A;  2P4R A;  3MJX A;  4IUQ A;  4IIM A;  1WJQ A;  2DNU A;  3MHX A;  2HKN A;  2HBW A;  1WFW A;  4XU2 A;  4N0A A;  1AOJ A;  2QTV A;  3MCA B;  4PKC C;  1OYX A;  2E10 A;  2KVQ G;  1T0H A;  2QA4 A;  2KNB B;  3G4S T;  3EAE A;  4HXJ A;  2YLB A;  3CCE T;  5LJ3 h;  2NUP A;  1OI1 A;  3HRT A;  1WLP B;  4JLG A;  1QVP A;  4PJJ A;  4M7A A;  2I0N A;  4JJC A;  3WXM B;  4LN2 A;  4M77 E;  1G83 A;  2ATC B;  4J6W A;  3CME Q;  1M3A A;  4QQG A;  1WA7 A;  3CCU T;  3H9N A;  3EG0 A;  4OF1 A;  2QQB A;  4C0D B;  3RKY A;  3QWX X;  4JZ3 A;  4QVZ A;  3C4S A;  4LDY A;  4RG2 A;  4M4Z A;  3OBW A;  2AZV A;  2VUB A;  4JJD A;  3I56 T;  4DEX A;  4RCB A;  4DBR A;  1BI0 A;  4M7D B;  2CP2 A;  4J7F A;  4P5N A;  1VQ4 Q;  4BY6 C;  1VQ8 Q;  3CME A;  1N8R U;  2R5M A;  4NL2 A;  1HXD A;  1Y57 A;  4N0A C;  3SFM A;  2DKG A;  1AHJ B;  2LJ0 A;  1ABQ A;  3MP6 A;  4M77 C;  2FL7 A;  3VYG A;  3M4G A;  4L59 A;  1QKW A;  2MMP A;  4MDW A;  4OMN A;  4D8K A;  2CT4 A;  3OY9 A;  1NPP A;  3QSU A;  1WIE A;  1K8A U;  1AZG B;  4B6M A;  4FSS A;  1VQ8 A;  2DIG A;  1QVG S;  2NYS A;  1VOM A;  4M7A C;  1ZBX A;  2PVD B;  2M1H A;  3CXC S;  1H3H A;  1M90 R;  2J6O A;  3QYG B;  3M0P A;  3X28 B;  4M75 G;  2BZY A;  2E12 A;  3OW2 A;  3X24 B;  5CQX A;  2FRY A;  3S3O A;  1PM3 A;  1E7O A;  1VQL Q;  2L5Q A;  1MMG A;  2PQW A;  2P0Q A;  1KHI A;  2P4T A;  1N5Z A;  4FIB A;  2HCK A;  2LZ6 B;  1X2Q A;  1WJR A;  2JZ2 A;  3OYY A;  2CZ6 B;  3UWN A;  3SB2 A;  1YHQ Q;  2MWP A;  2AHJ B;  1VQL A;  1VQ9 Q;  1NG2 A;  4QQ6 A;  4O5V A;  3OB9 A;  4MMK A;  4A4F A;  2M16 A;  1N27 A;  1YIT T;  2MWO A;  4XTX A;  1YJ9 T;  2MAM A;  1T3L A;  3JB9 G;  4DBF A;  1R77 A;  3VS4 A;  4JRQ A;  3FRN A;  3V7S A;  4WTO B;  3EH2 A;  5KYY A;  4M7D D;  2VWF A;  4JJN K;  1YHQ A;  2L3P A;  1WDX A;  2EGA A;  2KBT A;  4LDX A;  3SDZ A;  4F7U F;  1YJW T;  3NFC A;  1IRE B;  1D1B A;  3JCM V;  3EGX A;  1VUB A;  4OMM A;  3CCJ Q;  1G3W A;  3JB9 H;  4C8Q A;  2DL4 A;  2QI2 A;  4PJO B;  1SRM A;  5DLQ E;  4FW2 A;  2EFI A;  4PJM A;  1K0S A;  4M7D G;  3VS3 A;  2VGM A;  5KE2 A;  2R58 A;  3LGF A;  3VRY A;  1S1N A;  4JZ4 A;  4QW2 A;  1B3Q A;  2KRM A;  1TWB A;  2KY9 A;  1X6O A;  2JM9 A;  3LH5 A;  2PVO B;  2EAY A;  2ZPB B;  3OBY A;  4LUE A;  4J83 A;  4CI0 C;  3CCS Q;  2F5T X;  1QVG A;  4J9H A;  1YFN A;  4MDX A;  4IUV A;  3CCJ A;  4EMK B;  5J3B A;  4C8Q E;  2CSI A;  3CXC A;  2OTL T;  1PD1 A;  3JAM E;  3ZL7 C;  3QO3 A;  1IGQ A;  1FMW A;  3CC7 Q;  1M9S A;  2DIL A;  3C94 A;  1BIA A;  3VS6 A;  1AWO A;  4RTU A;  2DM1 A;  2ZPE B;  2H3J A;  1S72 Q;  2Z0W A;  3UAT A;  3CCS A;  2PUO B;  2MPX C;  4OGE A;  1BKB A;  3EHR A;  3GPL A;  3RBB B;  3CC4 T;  1NE8 A;  1WI7 A;  1UDL A;  4CC4 B;  2QGF B;  1BIB A;  4DBQ A;  1I4K 1;  1VQ5 T;  3CMA A;  2X4W A;  2LMJ A;  1VQM A;  3PNW C;  1U1T A;  4C8Q C;  3J81 E;  4EMK A;  5GAN h;  1U5S A;  2EGE A;  2K3B A;  2JUF A;  4KH1 B;  2DLP A;  3VKI A;  2QEX Q;  1S72 A;  2LT1 A;  4PNO A;  2DXB A;  4C5G A;  3QPH A;  1X43 A;  4ZGJ B;  4GLK A;  4Z02 A;  4OB3 B;  2XD0 A;  2BIV A;  2L0A A;  1WHJ A;  2XG8 D;  1Q81 R;  2EQU A;  1PHT A;  4LXC A;  4KGZ B;  1BI1 A;  2OAU A;  3CCL T;  1IGU A;  4OMO A;  4WF2 A;  2M0Y A;  2MYS A;  2QEX A;  4J9F A;  2RD1 A;  3RMS A;  1U1S A;  3ZEH A;  4LD9 K;  4PJO D;  4F7U E;  1QCO A;  3O8V A;  5CO7 A;  1NJI R;  4XU3 A;  4X1V A;  1N8R C;  6AT1 B;  2RNA A;  2A7Y A;  2MI6 A;  4FM4 B;  2GQV A;  1LOJ A;  2KE9 A;  4HA8 A;  4R0K A;  3E19 A;  2HNI A;  4ZTJ A;  3M54 A;  1EIF A;  1WQW A;  3MO8 A;  4HCK A;  3QJY A;  1K8A C;  2LNV A;  5A0D A;  1QW1 A;  2DJZ A;  2KXD A;  3MEV A;  4EMK C;  3PT9 A;  4DBH A;  2KRO A;  1Q86 R;  1VYV A;  2GTO A;  3QYH B;  1KQS P;  4ORZ A;  1NM7 A;  1PC0 A;  3H0F A;  1N9R A;  4M78 F;  1FMV A;  2W0Z A;  3D7S B;  4R56 A;  3E9G A;  4J8O A;  2XK0 A;  4RTZ A;  1UGV A;  1RAG B;  2V8K A;  1WHL A;  2E4H A;  1KG1 A;  3H0H A;  1MMN A;  2CP7 A;  2QTX A;  2V1R A;  1D1A A;  4ZN1 A;  4C92 B;  1IZ6 A;  5GAO q;  1P92 A;  4KT0 E;  2YUN A;  1H64 1;  2XDB A;  3FDR A;  3OYE A;  4CC7 A;  1Y7X A;  1NBE B;  1PKS A;  1WNL A;  2MK5 A;  1ZLM A;  2CS7 A;  3SWN B;  3BW1 A;  1Q7Y R;  3JRZ A;  3BE3 A;  4A54 A;  4RTY A;  3G71 Q;  2QDL A;  4CC2 A;  3L2W A;  2Y90 A;  1KSW A;  2KQW A;  5GAN 7;  2FB7 A;  1RAD B;  3HFN A;  2L8D A;  3MKD A;  1G8X A;  2LQ8 A;  3A1P A;  3RDV A;  3OYN A;  4PLI A;  3VUZ A;  2A3L A;  4ZGD B;  5GAO n;  1FXX A;  3OS2 A;  1HSQ A;  1D3B A;  3G1J A;  5FU6 B;  1RAE B;  1W1F A;  5FW9 A;  5IXB A;  2C06 A;  1U06 A;  5L23 A;  2BUD A;  1YI2 T;  3HHT B;  1LPL A;  2CYZ B;  3VS2 A;  2DET A;  4BE2 A;  1WHG A;  2YLC A;  3M0R A;  2JTF A;  3OYH A;  4O6J A;  3IQL A;  2EPD A;  4KUI A;  1JBM A;  1NLP C;  2K5L A;  2O31 A;  4ZGE B;  1M1K R;  2CH4 W;  2O9S A;  1V29 B;  2GNC A;  3A8L B;  5HK0 A;  5GAM e;  2D1X A;  1VQ4 T;  2JTE A;  3KUF A;  2R57 A;  1VQO Q;  1PRM C;  3ASK A;  4EPC A;  1OPL A;  1VQ7 T;  3EFO B;  3BFM A;  3VJP A;  2VAS A;  1UHF A;  1KD1 R;  1ZSZ B;  3QDR B;  3AT1 B;  2FZK B;  3I5S A;  3REB B;  4C0Z A;  2RJE A;  3OYB A;  5L8R E;  2A28 A;  1YBY A;  2DL7 A;  3L1A A;  3OYG A;  2LCS A;  4N4I A;  4BUG A;  4LD6 A;  4D6W A;  5GAM f;  1TS9 A;  3M0S A;  1MV0 B;  4M7A F;  3S6W A;  1OPK A;  1ZUU A;  1VQO A;  2A0F B;  2E41 A;  3MP8 A;  4M78 E;  4V2S A;  3I55 Q;  1RAF B;  3VU3 C;  4C92 D;  2K5F A;  1QWF A;  1B34 A;  1U8R A;  2XIC A;  4HCB A;  3EGU A;  1Z9Z A;  1I81 A;  2E64 A;  4RG8 A;  2ZPI B;  1FYN A;  4PFO A;  2MCN A;  2ENM A;  2HD0 A;  1SHF A;  2KRN A;  3OMG A;  3JCM d;  4BAC A;  2CGH A;  1JXM A;  2M51 A;  1UUE A;  1ZA1 B;  3M55 A;  2D0N A;  2QQR A;  3I55 A;  3FB9 A;  4M75 B;  1K73 R;  2E1H A;  2K9G A;  3CCV A;  1QVG P;  3HPW A;  5HKC A;  2RQW A;  1MHN A;  4PFZ A;  1YP5 A;  3PIO A;  2F2V A;  2DZC A;  2V26 A;  2J05 A;  4AG1 C;  3A98 A;  1VQK T;  1PRL C;  2DE0 X;  2RQR A;  2DVJ A;  2LQW A;  1VQ9 T;  5KCH A;  2EGC A;  1RI9 A;  1M90 U;  3JV3 A;  5FU7 B;  1KK7 A;  1G3Y A;  2DO3 A;  3LX7 A;  2L89 A;  1XQH A;  1PSF A;  5AT1 B;  4A53 A;  5GAO p;  5GAM j;  3A8H B;  3M0U A;  2PZ1 A;  5GAN 4;  2M9U A;  3JCM g;  5CKH A;  1ARK A;  3JB9 J;  3CCQ Q;  2YDL A;  3CPW S;  2DBK A;  1VQN A;  4PFP A;  2C0T A;  3N5B B;  1V76 A;  1IB8 A;  2O88 A;  1JB0 E;  2LNH B;  1OZ3 A;  2G3R A;  2CP3 A;  1EFN A;  2DXC A;  3GNF B;  4HVW A;  1RAH B;  1RAC B;  3CPF A;  2K3X A;  5GAM d;  3QZ9 B;  1Y07 A;  2LCC A;  2EVR A;  2L3R A;  3HRU A;  1G2B A;  2KR3 A;  2QYZ A;  1Q82 R;  3F70 A;  1Q95 G;  1NYG A;  2KMT A;  4RTV A;  5D6W A;  3OYA A;  2CT3 A;  3FIF A;  2X4X A;  3CCQ A;  5IHK A;  3OS1 A;  1I8F A;  2K2V A;  5EC7 A;  4KUD K;  2QK0 A;  3JCM J;  2OTJ A;  4E47 A;  3P8B B;  1IRX A;  2CKK A;  3OQ5 A;  3CCS T;  1KQS A;  3DB3 A;  4M7A E;  3RR6 A;  3PMT A;  2DEQ A;  3KFV A;  3OMC A;  3C95 A;  3EG2 A;  3DLL A;  2X9H A;  4E7Z A;  1ZBJ A;  1WXB A;  5EG2 A;  3CC7 T;  1RLP C;  2YT6 A;  3JCM Q;  4M75 D;  2VVK A;  3OYD A;  5CKE A;  5KYU B;  2GBQ A;  4JDS A;  1M4Z A;  5KYX B;  1S72 T;  1I0C A;  5FRM A;  4E7H A;  4CRI A;  3OSS C;  2DTO A;  1WPY A;  2OAW A;  1T3S A;  1B7T A;  2CUD A;  2E6Z A;  2FZG B;  1RI0 A;  4BI3 A;  2GCX A;  1M8M A;  5A0L A;  3CEY A;  2L3S A;  3VS0 A;  2KSS A;  4ANJ A;  3P8D A;  2F69 A;  4E7I A;  4C8Q F;  1PNJ A;  3VV0 A;  3L42 A;  1E6H A;  4LDW A;  3G7Z A;  4M7D A;  3ER0 A;  2FVU A;  5LL6 S;  4BDY A;  1C0M A;  4IUT A;  1JO8 A;  1YWP A;  2V8J A;  4L6V 5;  3UPU A;  2ZPH B;  3A5Z B;  1WHM A;  3JCM c;  1YJN Q;  2FEI A;  2GFU A;  2EJ9 A;  5KYX A;  1EZZ B;  2NUT B;  1K0X A;  2EW3 A;  2KT8 A;  3TVT A;  3C12 A;  3JB9 D;  1D1C A;  4M77 G;  4J9B A;  1BK2 A;  3CCM Q;  3VUB A;  2CZ1 B;  1R8O B;  4RTT A;  2LCL A;  3J7A F;  1SHG A;  1WQ7 A;  4ZN3 A;  1FX7 A;  4N4G A;  2ZZD A;  2JVV A;  3U23 A;  4FCY A;  3JCM b;  2DL3 A;  3LLR A;  4PJO F;  2OJ2 A;  1YJN A;  1BYM A;  2G6F X;  3E1S A;  3TU4 K;  1YNZ A;  1JJ2 S;  5GJV B;  2NWM A;  4KGV B;  4AFQ C;  4C0D C;  2XID A;  3CCM A;  2B86 A;  3ULR B;  1YWO A;  1OOT A;  1J3T A;  1YCY A;  4AG2 C;  4HT9 A;  2CSQ A;  3INZ A;  1Q81 U;  2NUT A;  1QP3 A;  3OYF A;  2CUB A;  1YCS B;  2HSE B;  5D7U A;  3S3N A;  4JLI A;  4IIO A;  4OVA A;  2CP0 A;  1KJW A;  5GMK m;  3UF4 A;  4M7D C;  1K9M C;  2KEA A;  3M59 A;  4J6X A;  2W10 A;  2M0O A;  1NEG A;  1PD0 A;  1R0B G;  2JMC A;  1WHK A;  1JEG A;  1KQ2 A;  4J6Y A;  4NS5 A;  2RI3 A;  3EGD B;  1NJI U;  1BU1 A;  4F17 A;  5FWC A;  1GFD A;  1M2V B;  3CD6 T;  2RQV A;  1VQP A;  5GAO m;  4FT4 A;  2RI2 A;  3P8H A;  2PU9 B;  2D9T A;  4AFZ C;  3LGL A;  3CBO A;  3EFR A;  1KQ1 A;  2ABL A;  3CCE Q;  4FSX A;  2CZ7 B;  4RUG A;  1OX8 A;  4EIK A;  1CKB A;  5C0M A;  1Q86 U;  3EG3 A;  2GGR A;  1M90 C;  5AYF A;  1M27 C;  4JRK A;  3NTI A;  3CCU Q;  8ATC B;  1HJD A;  4LDV A;  1K8A R;  5D6Y A;  3CMA Q;  2HAX A;  2O4X B;  1VQM Q;  3EGD A;  4IUU A;  1NLO C;  1ZUK A;  2JTM A;  3R6N A;  5KYN A;  1M2V A;  1N9S A;  3CCE A;  1M2O A;  3G71 T;  1X2K A;  2JW4 A;  2DD5 A;  2DRK A;  4NOY A;  3CCR T;  3JSC A;  4PJO A;  2X3X D;  3T9N A;  1UE9 A;  1PG5 B;  2V1Q A;  4X9C A;  1XTD A;  3X20 B;  5DM7 R;  2BZ8 A;  4DA4 A;  5M9O A;  1WJS A;  1EX4 A;  4BDZ A;  2EQI A;  4HKE A;  3CCU A;  2J06 A;  3REA B;  3PVL A;  5CKF A;  1M3C A;  3MET A;  4PK4 A;  3DLM A;  2E3H A;  5GMK l;  4PJO E;  4KH0 B;  5GAN 8;  2LX7 A;  1X6B A;  1JJ2 A;  2E6N A;  2XMF A;  2PUK B;  3EHQ A;  5KCO A;  1UGQ B;  1Q7Y U;  3FEO A;  4JUV A;  3WVD B;  1GBR A;  4F14 A;  1TG0 A;  1N6A A;  3A8O B;  2X4Y A;  4FL6 A;  3NGP A;  3ZFJ A;  3QDF A;  3E9F A;  5GAO l;  4UC4 A;  2IPO B;  1RAI B;  4AFS C;  2A37 A;  2J6K A;  5FRN A;  3FJP A;  2VXE A;  2RMO A;  4PJO C;  2QG9 B;  1OU8 A;  4MZM A;  3I55 T;  1M1K U;  1GBQ A;  3M58 A;  3JCM h;  4C8Q G;  2RO0 A;  3URG A;  4C92 F;  2XHC A;  1VQ6 T;  4RKU E;  2DMO A;  1YIJ T;  4BE1 A;  4ZNX A;  2DK3 A;  5IT9 E;  5LJ5 e;  3OS5 A;  1AWW A;  5CIU A;  3ZBD A;  1SKU B;  2YRD A;  1KD1 U;  4JRP A;  1YIT Q;  3NTK A;  4L5G A;  3LWH A;  5GAN e;  3LYI A;  2LVM A;  1YJ9 Q;  3OYI A;  1UEC A;  1GFC A;  2D8H A;  2JMA A;  2XDP A;  4GY5 A;  4B9X A;  3GLX A;  1IXD A;  1O75 A;  2J7I A;  5J39 A;  2QA4 T;  1C1A A;  5LJ5 f;  2K3Y A;  1BI3 A;  1BB9 A;  1OV3 A;  2QQA A;  1YIT A;  1YJW Q;  4FU6 A;  4QT7 A;  3NPF A;  5KYW B;  1H3Z A;  1M1G A;  1YJ9 A;  2QQ9 A;  2RF0 A;  5GAN f;  2A08 A;  4IUR A;  3CC2 Q;  2FPE A;  3L2Q A;  1K76 A;  4J7I A;  3KBG A;  3OYC A;  1KC8 R;  3LH0 A;  4E7S A;  5GAM h;  3OA6 A;  2YSQ A;  5CK9 A;  5IXF A;  3M57 A;  4Y91 A;  4XTW A;  1K73 U;  2BE9 B;  3JCM P;  4FW1 A;  2DTI A;  2B8A A;  3JCM X;  1OUL A;  4C0F A;  2VXF A;  2SEM A;  2BE7 D;  1M1F A;  3PE0 A;  2J6F A;  1YJW A;  4F7U G;  3VS1 A;  3HP9 A;  2K79 A;  1ZQ1 A;  2K7A A;  3E2U A;  4XTV A;  5A2Q E;  2HEQ A;  2AK5 A;  3CC2 A;  4OP0 A;  2YRV A;  3G6E Q;  1TUC A;  1GL5 A;  2PTK A;  2KRS A;  3NMZ C;  2OTL Q;  5CAI A;  1F1B B;  2M02 A;  4NL3 A;  4XQ3 A;  5KYW A;  2KXC A;  2RM4 A;  5IAY A;  4C92 A;  3CME T;  1M5Q 1;  1YN8 A;  4BI8 B;  3WVE B;  4LUD A;  3UA6 A;  2PVG B;  3EFS A;  3O5Z A;  2MF2 A;  3EG9 B;  1W2B S;  2EYW A;  1G5V A;  3GP8 A;  3TQ7 P;  3CPW P;  1NJI C;  1HK9 A;  5GAN 2;  2EKO A;  2VC8 A;  2WSF E;  4K11 A;  2GF7 A;  4HVV A;  4ELZ C;  3G6E A;  3CC4 Q;  5LJ5 j;  3SWN A;  2OTL A;  4WCI A;  1VQ8 T;  1VQ5 Q;  4C92 E;  4BE0 A;  2RI5 A;  4LNP A;  3QBY A;  5GMK i;  3QII A;  5GAN j;  2KYB A;  4C5I A;  4DOV A;  1NZ9 A;  4OMF B;  2CDT A;  1PCX A;  4M75 F;  1BI2 A;  1Q82 U;  1Q86 C;  1RAB B;  2FZC B;  1I07 A;  4DOW A;  1HD3 A;  2K4Y A;  5LJ5 d;  1U3O A;  3CC4 A;  2E3I A;  2XDD A;  1GRI A;  2AT1 B;  5ECA A;  4J9G A;  1VQ5 A;  2NLU A;  4Z89 A;  2LDM A;  2KDS A;  1X69 A;  3CCL Q;  3CCV Q;  1H92 A;  4PL6 A;  2D0Q B;  4XTY A;  4QVC A;  1UGR B;  2LRQ A;  2E5Q A;  4C92 C;  2QAS A;  2CRE A;  1UB4 A;  3PVQ A;  2ZPG B;  2ZPF B;  2DXU A;  4BB7 A;  1M8V A;  2X3W D;  1GCQ A;  4JRI A;  1VQL T;  3EFO A;  1SRL A;  2HSP A;  1RUW A;  1SEM A;  2DFU A;  1ZUY A;  3MP1 A;  1AWJ A;  1ZSZ A;  3QJ6 A;  1A0N B;  2E5K A;  2JOY A;  4XU1 A;  4E2F B;  3JB9 I;  1TTH B;  3SWN C;  3JB9 F;  3CCM T;  2YRC A;  3CCL A;  5LJ5 g;  3L2Z A;  1TSF A;  1MGQ A;  1UGP B;  1WX6 A;  2HL5 C;  4ZTF A;  2O2O A;  5GAO r;  1MMD A;  1Q7Y C;  5IN1 A;  2VYT A;  3PIP A;  1YHQ T;  3L2R A;  1DJ7 B;  1WYX A;  2QDY B;  1SSH A;  1VQN Q;  2DXT A;  2RH2 A;  2HMA A;  4M77 B;  5FU6 C;  4Z88 A;  3BY7 A;  2ZAE A;  5A0G A;  1QP2 A;  3NHN A;  2WSC E;  4EMH A;  1ZSG A;  1FMK A;  2FRW A;  1W70 A;  4RCC A;  2RHU A;  4AFU C;  3CBP A;  4HCC A;  4M7D F;  1ZX6 A;  2P84 A;  4M7A B;  2RHX A;  4M75 A;  3OYM A;  2JN0 A;  1M1K C;  3UDC A;  1JU5 C;  1BCO A;  2YXY A;  1OEB A;  4IUP A;  3M0Q A;  4GBQ A;  1NYF A;  2D8J A;  2JS2 A;  2ZCF B;  4J9C A;  2E70 A;  1GCQ C;  1Y96 B;  3GBQ A;  2OTJ Q;  4F16 A;  1JJ2 P;  4II1 A;  1ZSZ C;  2IIM A;  3MPU B;  3CCJ T;  4M78 G;  4RTW A;  2C0I A;  4M77 A;  2RJC A;  4Z8A A;  3H8Z A;  1KD1 C;  5HK3 A;  4BI4 A;  3GOX A;  4E6R A;  4M75 E;  3RNJ A;  2JJ9 A;  3BDL A;  2DD4 A;  3JCM W;  1BCM A;  2F1L A;  4HT8 A;  2X35 A;  2EWN A;  5KH6 A;  2DL8 A;  2O9V A;  2F2X A;  3UA7 A;  2JXB A;  1JQQ A;  1BBZ A;  3OYK A;  1Y96 A;  1WXU A;  4OML A;  4C5E A;  3CMA T;  1AVZ C;  5GMK e;  3QHS A;  2AKK A;  1VQM T;  1YI2 Q;  3VRZ A;  1B07 A;  2LP5 A;  5GAM g;  2CZ0 B;  4M75 C;  1K9M R;  2VB6 A;  2DER A;  1QCN A;  1K73 C;  3RIR A;  2A36 A;  1XJW B;  3V8L A;  1MNE A;  2AZS A;  2FG0 A;  1G3T A;  1O9S A;  2KYM A;  1VQ7 Q;  4M77 D;  3DKM A;  5FU7 C;  1ZHI A;  1YI2 A;  4Y28 E;  4B9W A;  5LJ3 e;  1RL2 A;  2DTH A;  4OB1 B;  1UG1 A;  4XK8 E;  1PKT A;  3M0T A;  2QEX T;  5CR2 A;  1QQJ A;  2MOX A;  3QKJ A;  1VQ4 A;  2DJQ A;  4M7A D;  2L2P A;  4ESR A;  1TH7 A;  5KYU A;  4Q5W A;  1VQ7 A;  4E7J A;  2EQK A;  2GFA A;  4JS5 A;  1X27 A;  4E7K A;  2EYY A;  1VA7 A;  5LJ3 f;  4M7D E;  4KBM B;  4ELY C;  3CPW A;  4HVU A;  2RQT A;  1H8K A;  2LJ3 A;  2D6F A;  5DY9 A;  2RK1 A;  2FPD A;  3QUI A;  4F04 B;  1WHH A;  2COW A;  2IG0 A;  2RPN A;  5KYY B;  2O01 E;  4M7A G;  5C6S A;  1AD5 A;  4J5Y A;  2KK4 A;  3Q1J A;  1Q82 C;  1I5O B;  3V8J A;  4BD3 A;  1MUZ A;  3V7R A;  2LQN A;  3AHU A;  3RUX A;  5I11 A;  2EJF A;  4PLL A;  4R55 A;  4J9I A;  1VQK Q;  3SD4 A;  1UGS B;  2VV5 A;  3EGX B;  1VYT A;  4J9D A;  3OYL A;  1VQP Q;  4JPB W;  4LE9 A;  5GMK j;  4FYV B;  2LJ1 A;  2DVE A;  1SPK A;  4C8Q B;  1QWE A;  4FYW B;  4VUB A;  7AT1 B;  1LJO A;  1LCK A;  1UHC A;  2HDA A;  1K9A A;  3TSW A;  2DX1 A;  2FO0 A;  4FT2 A;  1W4S A;  4OB0 B;  2LX9 A;  2AKL A;  2BTT A;  1VQK A;  2DYI A;  1VIE A;  2OI3 A;  4RMO A;  1VQ9 A;  1CKA A;  1OZ2 A;  1AT1 B;  2DPP B;  2COZ A;  3G4S Q;  2HZY A;  2BZX A;  2OX7 A;  5FWB A;  5LJ3 j;  2DAQ A;  1TU0 B;  3LW5 E;  1KHC A;  1N8R R;  3CC2 T;  2XU8 A;  2GTJ A;  2XI9 A;  1PWT A;  1SG5 A;  1IO6 A;  5CQY A;  4EDU A;  2ROL A;  1D0Z A;  1QVF P;  2I2L A;  3I9Q A;  2H8H A;  3FJ5 A;  4AMC A;  3VS7 A;  5D6X A;  3M9Q A;  4C0G A;  1IHW A;  4RTX A;  3G4S A;  3PGG A;  3H41 A;  5LJ3 d;  2DZ9 A;  2L3Q A;  3HTR A;  3VYH B;  1OQK A;  3DB4 A;  4XTU A;  2FHD A;  3M4Y A;  2RQU A;  1ACM B;  2RB6 A;  4ME7 A;  3MEU A;  2RHY A;  3G6E T;  4A4K A;  3I56 Q;  1T0J A;  2EJG A;  2YUO A;  1UJ0 A;  1NEB A;  3A8M B;  2WSE E;  2K6D A;  1MMA A;  3HSB A;  2HQE A;  8AT1 B;  2X51 A;  4F7U B;  2HBP A;  2ECZ A;  3RKW A;  1KC8 U;  1IHV A;  1QCF A;  3HL8 A;  5I2M A;  2EQJ A;  5GAN 6;  2O4X A;  5DLO A;  1AWX A;  3I56 A;  4C5H A;  5LJ5 h;  1ABO A;  2RN8 A;  5CKD A;  5LJ3 g;  2CP5 A;  3CBM A;  1HYO A;  3H0I A;  4C8Q D;  1Z9Q A;  4MML A;  3CC7 A;  1VQO T;  3KXT A;  4D8D A;  1MND A;  2GQI A;  4MZP A;  1G3S A;  3M5A A;  1TUD A;  4N4H A;  2LQK A;  3X26 B;  3MEW A;  2KAF A;  2K2M A;  1W2B P;  5IH2 A;  3GF5 A;  1SSF A;  2COY A;  1LNX A;  4F7U A;  2P0K A;  2HQX A; 
#chains in the Genus database with same CATH homology
 2MWO A;  5LJ5 j;  3SWN A;  3FLG A;  2RK2 A;  2OTL A;  5GAN 3;  3J80 E;  3CPF A;  4XTX A;  2K3X A;  5GAM d;  1YJ9 T;  2MAM A;  3JB9 G;  3QZ9 B;  1VQ8 T;  1Y07 A;  4C92 E;  2LCC A;  2RHI A;  4BE0 A;  2RI5 A;  2L3R A;  2WAC A;  3HRU A;  4JRQ A;  3QBY A;  3F70 A;  3FRN A;  5GMK i;  3CCV T;  3M53 A;  2KMT A;  3QII A;  2R5A A;  2Y4Y A;  1WGS A;  4HCZ A;  3V7S A;  5D6W A;  5GAN j;  3OYA A;  3FIF A;  4C5I A;  4DOV A;  1NZ9 A;  4M7D D;  2X4X A;  4OMF B;  3CCQ A;  4JJN K;  4M75 F;  3OS1 A;  1YHQ A;  3BDU A;  3GIB A;  1I8F A;  2K2V A;  1BI2 A;  1Q82 U;  1Q86 C;  4KUD K;  2VGN A;  3RMQ A;  3ME9 A;  3JCM J;  4DOW A;  3OSV A;  2OTJ A;  4E47 A;  2K4Y A;  3P8B B;  4F7U A;  5LJ5 d;  4LDX A;  3SDZ A;  4F7U F;  1UEB A;  2CKK A;  3OQ5 A;  3CCS T;  3CC4 A;  1YJW T;  1KQS A;  3NFC A;  1IRE B;  4E7L A;  3DB3 A;  4M7A E;  3JCM V;  2XDD A;  2RA2 A;  2LC4 A;  2DEQ A;  3PMT A;  4EMG A;  1VUB A;  1VQ5 A;  2NLU A;  3OMC A;  2LDM A;  5FLX E;  3C95 A;  3DLL A;  1G3W A;  2KDS A;  5FRM A;  3JB9 H;  4C8Q A;  4M7D F;  5EG2 A;  4QQD A;  3CC7 T;  3S3M A;  2QI2 A;  4PJO B;  4PL6 A;  2D0Q B;  4XTY A;  5DLQ E;  3V8K A;  4QVC A;  1QVF S;  2EFI A;  1UGR B;  3JCM Q;  2LRQ A;  2E5Q A;  4C92 C;  2QQS A;  4M75 D;  3OYD A;  4M7D G;  1UB4 A;  2ZPG B;  2VGM A;  5CKE A;  5KE2 A;  2ZPF B;  2DXU A;  2R58 A;  3LGF A;  4JDS A;  1M4Z A;  2ZGW A;  4BB7 A;  1S72 T;  1XNI A;  4PJO G;  4CRI A;  4QW2 A;  3OSS C;  4OGC A;  2DTO A;  1XOV A;  5HY6 A;  4E7H A;  1VQN T;  4JRI A;  1M8V A;  2KY9 A;  1VQL T;  1X6O A;  1WPY A;  2PVO B;  2EAY A;  3GNG A;  2ZPB B;  3OBY A;  2E6Z A;  4J83 A;  4CI0 C;  1RI0 A;  3R6O A;  3MP1 A;  2F5T X;  4BI3 A;  1QVG A;  3QJ6 A;  2GCX A;  4MDX A;  4IUV A;  5A0L A;  3CEY A;  3CCJ A;  2JOY A;  4XU1 A;  4EMK B;  5J3B A;  4C8Q E;  3JB9 I;  3SWN C;  2KSS A;  3CXC A;  2OTL T;  3JB9 F;  3CCM T;  3NTH A;  4X9D A;  3CCL A;  2LT4 A;  3P8D A;  4HCB A;  1FWZ A;  5LJ5 g;  2F69 A;  4E7I A;  4C8Q F;  3JAM E;  3L2Z A;  3QO3 A;  3VV0 A;  1MGQ A;  1UGP B;  4ZTF A;  3HKS A;  3L42 A;  1M9S A;  2BKD N;  4LDW A;  3TRE A;  3C94 A;  5GAO r;  1Q7Y C;  4XAX B;  1BIA A;  4X34 A;  3G7Z A;  4M7D A;  1I5L A;  3ER0 A;  5IN1 A;  2VYT A;  3PIP A;  3CCQ T;  2K57 A;  1YHQ T;  2FVU A;  5J26 A;  5LL6 S;  2ZPE B;  3L2R A;  1DJ7 B;  3JCM e;  2QDY B;  2RHZ A;  2RJD A;  4BDY A;  2H3J A;  1D3B B;  4IUT A;  2V8J A;  2DXT A;  2RH2 A;  2ZPH B;  3A5Z B;  4L6V 5;  3CCS A;  3UPU A;  2PUO B;  3JCM c;  4M77 B;  2OTJ T;  5FU6 C;  4OGE A;  1BKB A;  2GFU A;  3H6Z A;  3GPL A;  3RER A;  2EIF A;  1Q81 C;  3CC4 T;  2EJ9 A;  3BY7 A;  1NE8 A;  5A0G A;  1X75 C;  1BIB A;  1QP2 A;  2K5I A;  1I4K 1;  3HRS A;  3C12 A;  3JB9 D;  4IKF A;  1VQ5 T;  3CD6 A;  3CMA A;  4M77 G;  2WSC E;  2X4W A;  3VUB A;  2CZ1 B;  1VQM A;  4EMH A;  1R8O B;  3PNW C;  2LCL A;  3J7A F;  1U1T A;  4RCC A;  4C8Q C;  3J81 E;  4EMK A;  2RHU A;  1WQ7 A;  4DQ2 A;  3CBP A;  1X01 A;  4ZN3 A;  5GAN h;  4HCC A;  1FX7 A;  4QVD A;  4N4G A;  4M7A B;  2RHX A;  2JVV A;  2ZZD A;  4M75 A;  4OB2 B;  3TEE A;  2JN0 A;  2JUF A;  3JCM b;  3UDC A;  3OYM A;  1M1K C;  3VKI A;  3JCM f;  1S72 A;  2LT1 A;  3LLR A;  4PJO F;  3QG1 A;  4PNO A;  4IUP A;  2DXB A;  4C5G A;  3QPH A;  1YJN A;  1BYM A;  2ZCF B;  1PSE A;  4GLK A;  4M78 B;  4Z02 A;  4ZGJ B;  2E70 A;  3E1S A;  5I2S A;  4OB3 B;  3TU4 K;  2XD0 A;  1Y96 B;  2BIV A;  3X25 B;  2EYQ A;  5CCA A;  1JJ2 S;  4TVR A;  2XG8 D;  4A4H A;  2EQU A;  4II1 A;  4C0D C;  2XID A;  3CCM A;  3CCJ T;  4M78 G;  3MEA A;  2E65 A;  2RJC A;  4M77 A;  1BI1 A;  2OAU A;  3PMI A;  3H8Z A;  1YCY A;  3CCL T;  2IVW A;  1KD1 C;  4HT9 A;  2Y4X A;  3INZ A;  4BI4 A;  5HK3 A;  3GOX A;  1QP3 A;  4M75 E;  1Q81 U;  4WF2 A;  3OYF A;  3S3N A;  4JLI A;  4OVA A;  2F5K A;  3G71 A;  2QEX A;  3BDL A;  3PTA A;  5GMK m;  4XTZ A;  2RD1 A;  2DD4 A;  4A4G A;  3CCR A;  3JCM W;  3RMS A;  4M7D C;  1U1S A;  3ZEH A;  1K9M C;  4LD9 K;  3M59 A;  4F7U E;  4J6X A;  4PJO D;  5KE3 A;  3LWI A;  2M0O A;  3O8V A;  5CO7 A;  4XU3 A;  1N8R C;  1B34 B;  3L2U A;  5CKB A;  2X35 A;  4HT8 A;  2DIQ A;  2EWN A;  5KH6 A;  2A7Y A;  2MI6 A;  4KUL A;  4FM4 B;  2GQV A;  1LOJ A;  4HA8 A;  3TCJ A;  1KQ2 A;  3E19 A;  4XU0 A;  2XKO C;  4J6Y A;  2HNI A;  4NS5 A;  2RI3 A;  4ZTJ A;  1NJI U;  3M54 A;  4M78 A;  1EIF A;  1WQW A;  3OYK A;  4M77 F;  1QVF A;  5GAN d;  1Y96 A;  3MO8 A;  3CD6 T;  2X4J A;  4C5E A;  3CMA T;  3QJY A;  5GMK e;  1K8A C;  2LTO A;  3QHS A;  4JS4 A;  1VQM T;  1VQP A;  2LNV A;  5A0D A;  1QW1 A;  3A8G B;  5GAO m;  4FT4 A;  3L2V A;  2DJZ A;  2RI2 A;  1GXI E;  3P8H A;  2PU9 B;  2D9T A;  3MEV A;  3LGL A;  3PT9 A;  4EMK C;  5GAM g;  3CBO A;  2CZ0 B;  3EFR A;  1KQ1 A;  4M75 C;  3RES A;  4FSX A;  3OYJ A;  3UT1 A;  3V7C A;  1KQS S;  1YJN T;  3QYH B;  2CZ7 B;  1K73 C;  3RIR A;  3V8L A;  3OS0 A;  3PFS A;  5C0M A;  1Q86 U;  1K9M U;  4MZT A;  5CVI A;  1KC8 C;  1M90 C;  1N9R A;  4M78 F;  5AYF A;  4R56 A;  1G3T A;  1O9S A;  3NTI A;  3E9G A;  4J8O A;  2XK0 A;  4JRK A;  2JNG A;  1Y71 A;  4M77 D;  3DKM A;  1VIF A;  5FU7 C;  1ZHI A;  1YI2 A;  4LDV A;  4Y28 E;  2V8K A;  5D6Y A;  2HAX A;  4B9W A;  2O4X B;  2EQM A;  5LJ3 e;  3QXE B;  1RL2 A;  2P0P A;  1JRI A;  4IUU A;  2JTM A;  5FRO A;  3HFO A;  1KG1 A;  4BY6 B;  2DTH A;  4OB1 B;  2RJF A;  4XK8 E;  1N9S A;  3CCE A;  2QEX T;  3G71 T;  4ATO A;  5CR2 A;  5GAN g;  2DD5 A;  4NOY A;  3CCR T;  2QTX A;  3JSC A;  4PJO A;  3T9N A;  4ZN1 A;  3QKJ A;  4C92 B;  1IZ6 A;  5GAO q;  1P92 A;  1VQ4 A;  4KT0 E;  4X9C A;  4M7A D;  3RKX A;  1XTD A;  3X20 B;  5DM7 R;  4DA4 A;  1NPR A;  5M9O A;  1H64 1;  2XDB A;  1WJS A;  1TH7 A;  1VQ6 A;  2YHT A;  4BDZ A;  4Q5W A;  1VQ7 A;  3FDR A;  4C92 G;  3OYE A;  3FC3 A;  4HKE A;  4M78 D;  3CCU A;  2EQK A;  2GFA A;  4E7J A;  2QXF A;  4JS5 A;  4M78 C;  1YIJ A;  5I21 A;  1Y7X A;  3M56 A;  5CKF A;  3MET A;  4E7K A;  1WNL A;  5LJ3 f;  4M7D E;  3QZ5 B;  4KBM B;  2FYK A;  4ELY C;  2CS7 A;  3DLM A;  3SWN B;  3BW1 A;  4LDU A;  3CPW A;  1W2B A;  1VQP T;  5GMK l;  2D6F A;  3JRZ A;  4PJO E;  3OW2 S;  2V8I A;  5DY9 A;  2RK1 A;  5GMK h;  5GAN 8;  4A54 A;  4A4E A;  4YTL A;  3L2W A;  1JJ2 A;  2Y90 A;  2E6N A;  3QUI A;  2KQW A;  4IUQ A;  2PUK B;  5KCO A;  2IG0 A;  1UGQ B;  2FB7 A;  1WJQ A;  5GAN 7;  1Q7Y U;  2O01 E;  3HFN A;  3FEO A;  2L8D A;  5C6S A;  4JUV A;  4M7A G;  3MHX A;  2LQ8 A;  4J5Y A;  2KK4 A;  3WVD B;  3Q1J A;  3OYN A;  1Q82 C;  4PLI A;  3V8J A;  3VUZ A;  2A3L A;  4ZGD B;  5GAO n;  1FXX A;  4BD3 A;  4XU2 A;  3OS2 A;  4N0A A;  1N6A A;  1D3B A;  2X4Y A;  3A8O B;  4FL6 A;  3V7R A;  5FU6 B;  3ZFJ A;  2C06 A;  3RUX A;  3AHU A;  2EJF A;  3E9F A;  4PLL A;  3MCA B;  4PKC C;  1OYX A;  2BUD A;  2E10 A;  4R55 A;  2KVQ G;  1YI2 T;  5GAO l;  3HHT B;  3SD4 A;  2QA4 A;  4UC4 A;  1UGS B;  2CYZ B;  2VV5 A;  4BE2 A;  2YLC A;  3G4S T;  2JTF A;  3OYH A;  4O6J A;  3OYL A;  3EAE A;  2YLB A;  4KUI A;  5GMK j;  1JBM A;  4ZGE B;  2K5L A;  2DVE A;  3CCE T;  4C8Q B;  1V29 B;  5FRN A;  5LJ3 h;  3A8L B;  4VUB A;  5HK0 A;  1OI1 A;  3FJP A;  1LJO A;  3HRT A;  2VXE A;  4JLG A;  5GAM e;  4PJO C;  1QVP A;  1VQ4 T;  4M7A A;  4FT2 A;  1W4S A;  4MZM A;  3I55 T;  3KUF A;  1M1K U;  3M58 A;  2R57 A;  3WXM B;  3JCM h;  4C8Q G;  4M77 E;  2RO0 A;  3ASK A;  3URG A;  4EPC A;  4OB0 B;  4C92 F;  2XHC A;  1VQ6 T;  4RKU E;  4J6W A;  1VQ7 T;  4QQG A;  2LX9 A;  3BFM A;  3CCU T;  1VQK A;  1VIE A;  3VJP A;  4RMO A;  4OF1 A;  2QQB A;  1YIJ T;  4BE1 A;  3QDR B;  4C0D B;  1VQ9 A;  1OZ2 A;  2DPP B;  3RKY A;  2DK3 A;  4QVZ A;  5IT9 E;  5LJ5 e;  3OS5 A;  3C4S A;  4C0Z A;  5CIU A;  2RJE A;  3ZBD A;  3OYB A;  5L8R E;  4LDY A;  1YBY A;  4RG2 A;  5LJ3 j;  2DAQ A;  3L1A A;  3OYG A;  3OBW A;  1KD1 U;  4N4I A;  4BUG A;  4LD6 A;  4JRP A;  4D6W A;  2VUB A;  3LW5 E;  3NTK A;  1KHC A;  4L5G A;  5GAM f;  3I56 T;  4RCB A;  3CC2 T;  2XU8 A;  1BI0 A;  3S6W A;  2XI9 A;  3LYI A;  5GAN e;  3LWH A;  4M7A F;  4J7F A;  2LVM A;  4P5N A;  4M7D B;  4BY6 C;  1VQO A;  3OYI A;  2E41 A;  3MP8 A;  4M78 E;  4V2S A;  3CME A;  5CQY A;  3VU3 C;  4C92 D;  4EDU A;  2K5F A;  1B34 A;  1U8R A;  1N8R U;  2XDP A;  4GY5 A;  2R5M A;  2XIC A;  4NL2 A;  1HXD A;  4B9X A;  4N0A C;  3SFM A;  3GLX A;  2DKG A;  1I81 A;  1AHJ B;  2I2L A;  5GAN 5;  2E64 A;  4RG8 A;  3MP6 A;  3M9Q A;  4M77 C;  5D6X A;  4C0G A;  2ZPI B;  1O75 A;  2FL7 A;  3PGG A;  3VYG A;  3M4G A;  4L59 A;  5J39 A;  2MMP A;  3G4S A;  5LJ3 d;  5LJ5 f;  2DZ9 A;  2K3Y A;  1BI3 A;  2QA4 T;  4MDW A;  3VYH B;  2QQA A;  2HD0 A;  4XTU A;  3DB4 A;  3OY9 A;  1NPP A;  2FHD A;  1YIT A;  3QSU A;  3M4Y A;  3OMG A;  4FU6 A;  1K8A U;  2RB6 A;  4ME7 A;  3MEU A;  1H3Z A;  3JCM d;  2RHY A;  4BAC A;  2CGH A;  3G6E T;  1M1G A;  3M55 A;  2QQ9 A;  4A4K A;  5GAN f;  1YJ9 A;  1VQ8 A;  2EJG A;  2QQR A;  4IUR A;  3A8M B;  2WSE E;  3I55 A;  3FB9 A;  4M75 B;  2DIG A;  2E1H A;  3L2Q A;  1QVG S;  3CCV A;  3HSB A;  4M7A C;  3HPW A;  5HKC A;  2PVD B;  1MHN A;  1ZBX A;  4J7I A;  3KBG A;  3OYC A;  2HQE A;  2M1H A;  3LH0 A;  3CXC S;  5GAM h;  3OA6 A;  3QYG B;  3PIO A;  3X28 B;  5CK9 A;  3M57 A;  2DZC A;  4Y91 A;  4M75 G;  4XTW A;  4F7U B;  1K73 U;  2HBP A;  1VQK T;  2E12 A;  3JCM P;  3OW2 A;  3X24 B;  3RKW A;  5CQX A;  2DTI A;  3S3O A;  2B8A A;  3JCM X;  1VQ9 T;  4C0F A;  5KCH A;  1KC8 U;  2VXF A;  1M90 U;  1M1F A;  5FU7 B;  1G3Y A;  1YJW A;  4F7U G;  2L5Q A;  3HP9 A;  3HL8 A;  1ZQ1 A;  2DO3 A;  2EQJ A;  4XTV A;  5I2M A;  5GAN 6;  2O4X A;  2PQW A;  5DLO A;  5A2Q E;  2P0Q A;  3LX7 A;  3I56 A;  3CC2 A;  1KHI A;  2L89 A;  4OP0 A;  4C5H A;  5LJ5 h;  2YRV A;  5CKD A;  1XQH A;  5LJ3 g;  2P4T A;  3CBM A;  5CAI A;  4NL3 A;  4FIB A;  1PSF A;  4C8Q D;  3CC7 A;  4MML A;  4XQ3 A;  1VQO T;  4A53 A;  3KXT A;  5GAO p;  1WJR A;  5GAM j;  2RM4 A;  2JZ2 A;  4C92 A;  3A8H B;  4MZP A;  5IAY A;  3CME T;  1M5Q 1;  1G3S A;  2M9U A;  3M5A A;  3OYY A;  3JCM g;  5GAN 4;  4BI8 B;  4N4H A;  5CKH A;  3WVE B;  2LQK A;  2PVG B;  3EFS A;  2CZ6 B;  3X26 B;  3JB9 J;  2MF2 A;  3UWN A;  3MEW A;  2KAF A;  3SB2 A;  3CPW S;  1W2B S;  1G5V A;  3GP8 A;  2MWP A;  2AHJ B;  1VQN A;  1VQL A;  1NJI C;  1HK9 A;  3N5B B;  4QQ6 A;  3GF5 A;  1SSF A;  3OB9 A;  4O5V A;  5GAN 2;  2VC8 A;  1LNX A;  2WSF E;  1JB0 E;  2EKO A;  4MMK A;  1OZ3 A;  2P0K A;  2G3R A;  2M16 A;  4A4F A;  2DXC A;  2GF7 A;  3GNF B;  1N27 A;  2HQX A;  4ELZ C;  1YIT T;  3G6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...