1H3ZA

Solution structure of a pwwp domain from schizosaccharomyces pombe
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
SERVNYKPGMRVLTKMSGFPWWPSMVVTESKMTSVARKSKPKRAGTFYPVIFFPNKEYLWTGSDSLTPLTSEAISQFLEKPKPKTASLIKAYKMAQSTPDLDSLSVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Variation in Pwwp Domains
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Nuclear protein
molecule keywords HYPOTHETICAL 62.8 KDA PROTEIN C215.07C
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1h3zA00
5D6WA 1WGSA 2RI2A 4E7LA 4ZTFA 1WJRA 3OB9A 3LX7A 2M16A 4C5HA 3O8VA 2HQXA 3QKJA 4BE0A 2LTOA 4X34A 2DIGA 2EFIA 2RHXA 3OYCA 4GY5A 2X4YA 1SSFA 5D6YA 2O4XA 4BACA 5D6XA 3MP1A 3OYGA 3OA6A 5FROA 4QQ6A 4BDZA 3PMTA 2EQJA 3BDLA 3LLRA 3LYIA 4IURA 5CIUA 2R57A 4CRIA 4E7JA 2RHZA 2EQMA 2M0OA 2VYTA 2PQWA 1WJQA 2X35A 2RJEA 2EQUA 3FLGA 3M9QA 3OMCA 4B9WA 4C5GA 5KCHA 2RI5A 3UWNA 3META 3QIIA 4IUUA 4N4IA 4Q5WA 5FRNA 3OYLA 4UC4A 3MEAA 3S6WA 5J26A 3ZEHA 5C6SA 3L2UA 4FL6A 5KH6A 2P0KA 2GFAA 5M9OA 3MEUA 2E6NA 5FRMA 2RJCA 4FU6A 4C5IA 2JZ2A 2RI3A 2YRVA 3OS1A 3OYAA 1MHNA 2L3RA 2EKOA 5IN1A 4QW2A 5IAYA 1OZ2A 3P8DA 3OYNA 2GFUA 2BKDN 3L2QA 1N27A 2R5AA 3EAEA 3FDRA 2RHYA 2LCCA 4PLIA 4PLLA 5KCOA 1OZ3A 4IKFA 2R58A 2DAQA 3OYFA 2LVMA 4BE2A 2QQRA 4BDYA 2F5KA 2BUDA 2LDMA 2IG0A 3DB4A 3L2RA 1WJSA 2MWPA 2G3RA 2E5QA 2B8AA 3KUFA 2DIQA 2GF7A 4QQGA 4E7KA 5C0MA 2XK0A 2D9TA 3OS2A 3C4SA 2CKKA 3MEVA 1G5VA 4LD6A 2RHUA 4N4HA 4A4FA 4E7HA 2RJFA 2L8DA 2JTFA 2LRQA 3DLMA 3DB3A 4A4EA 3OYHA 4RG2A 2NLUA 2MWOA 3CEYA 3NTHA 3NTKA 3LGLA 2O4XB 4ZTJA 3MO8A 4QVZA 3ASKA 3Q1JA 4NS5A 3QBYA 4OVAA 5KE3A 2XDPA 4A4GA 3GOXA 4A4HA 3ME9A 3OMGA 2K3YA 1RI0A 4HCZA 3OS0A 3OQ5A 3OYDA 3MP8A 3MP6A 3OYBA 3L2WA 3OY9A 3S3NA 3P8HA 2RO0A 4IUVA 2QQSA 2HQEA 2M1HA 3L42A 1OI1A 3S3OA 4EDUA 4Z02A 3OYIA 3L2VA 3LGFA 3UT1A 2EQKA 3OYEA 4B9XA 1KHCA 2X4XA 4II1A 4IUPA 4QQDA 2RJDA 2FHDA 3PMIA 3PFSA 2K3XA 2BIVA 2RHIA 4L59A 4N4GA 4C5EA 3QJ6A 4E7IA 1H3ZA 5KE2A 2R5MA 1XNIA 3LH0A 5J39A 3FC3A 3F70A 3MEWA 3NTIA 3PNWC 3FEOA 3OYMA 4PL6A 3SD4A 4BD3A 4BE1A 3S3MA 2L89A 3E9GA 2X4WA 3OYKA 1OYXA 4IUTA 3OYJA 3E9FA 2WACA 3H8ZA 3H6ZA 4IUQA
chains in the Genus database with same CATH superfamily
4RMOA 2E6ZA 1TWBA 1YP5A 1ZSZC 1HSQA 3V7SA 2A08A 2HKQB 3LLRA 3QSUA 3QHSA 3GIBA 2KRSA 1R8OB 1XOVA 1IRXA 5FRNA 1Y96A 3A98A 1WQ7A 5J26A 2RPNA 3CC2A 3CC2Q 1QKWA 2ZPIB 5KYXA 1VQ9T 4F04B 3I5RA 1F1BB 3I5SA 2FPFA 1MHNA 3U23A 3N5BB 5IHKA 1V76A 3CC7T 3A1PA 1YFNA 4X9CA 4PLIA 1JJ2S 5GAOn 4BDYA 1YITT 1TG0A 2HSPA 2J6FA 5CQXA 3RIRA 4DOVA 4LUDA 3CD6Q 5DLOA 3JCMP 4RG8A 2RB6A 1W2BA 1AWXA 2CP2A 2KBTA 3EGXB 2KK4A 4E47A 1Y07A 2JTFA 1N5ZA 1Q86C 2MWOA 3SDZA 1AHJB 1UJYA 2H3JA 4XTVA 3VS7A 1YIJA 1X01A 2J6KA 2QQAA 1MV3A 3A5ZB 3M4YA 1HK9A 2XD0A 5I2SA 5IHIA 2QQSA 3VKIA 3G4SQ 1TSFA 4EDUA 2E5KA 1WXTA 2KMTA 4XU1A 4AG1C 8AT1B 5GAMj 1VQOT 3CC4T 2MI6A 2EJGA 2MPXC 1BI3A 5GAN5 2EGCA 3V7RA 3JB9I 1NM7A 2W0ZA 4C8QE 9ATCB 3E9FA 1VQOQ 5GMKi 2ZPHB 2ROTA 3OB9A 2M16A 4LNPA 5D7UA 3WVDB 2DILA 1WZOA 3H0FA 4ZGJB 2MAMA 5FWBA 5A0GA 3TREA 2PQWA 1T0HA 4FW2A 1ZLMA 2K9GA 4JZ4A 2DXCA 2X3XD 4Q5WA 3I9QA 1NLPC 1PSFA 1TXQA 2EGEA 3ZL7C 3CPWA 5I2MA 2QEXQ 2QEXT 2NWMA 1VQLA 1QCNA 4AT1B 1MMAA 1G8XA 5KCOA 1KC8C 2ZPBB 4C8QA 4BE2A 1YCSB 1AVZC 2FRWA 1VQMQ 2QG9B 1BB9A 3QDRB 2PTKA 1QVPA 1C1AA 4QVDA 4M75G 5I21A 4HT9A 4E7HA 4HVWA 2P4RA 5LJ5f 4QVZA 3VV0A 3SWNB 1Q81C 2GGRA 3FRNA 4A54A 1QVGS 2YUQA 1VQ7T 3OMGA 4R56A 1VQ8T 2VC8A 2JTEA 1PKSA 1PHTA 3X24B 1I0CA 3QXEB 1UGPB 2A36A 4RUGA 1BI1A 2XG8D 1BYMA 3CXCP 3P8BB 4N4GA 4L59A 2R5MA 2HBWA 2DYIA 3I56Q 1J3TA 3O5ZA 2HEQA 1K9MU 2LJ3A 5FU7B 1OYXA 4XTZA 3OYJA 3TSZA 4J6YA 3CPFA 1YJWT 1LNXA 5KYWB 1NJIR 2HQXA 2KRMA 4FT4A 3CCMQ 3JAME 2QAZA 1Q7YC 2EQJA 1X6BA 4KUDK 3JB9F 3FLGA 2ZZDA 1BCMA 2PU9B 1VIEA 5CKBA 2RN8A 1K73R 4M78A 5L23A 4JS4A 2YHTA 2ZPGB 1QVFP 4D8KA 5IXBA 1S72Q 1QWFA 3CXCS 1KD1R 3FIFA 1OU8A 1R77A 4PJOC 1AWWA 1OZ3A 2A3LA 4FIBA 2JM8A 4BI4A 3L2RA 2IG0A 3PE0A 1Q7YR 3TU4K 3CCET 1H8KA 5DM7R 3RESA 1QCOA 4PKCC 2GNCA 1YNZA 2XK0A 1PWTA 1PNJA 3C4SA 4C92E 2J7IA 2DL3A 4PJOD 2PVOB 2BZ8A 1PCXA 2RM4A 2IPOB 1KIKA 4FYWB 3RNJA 1VQ7Q 1ZBXA 3GNGA 2AT1B 3GOXA 1KHIA 2RK1A 1GCQC 3PTAA 2DXTA 4KGXB 3MPUB 1VQ6Q 4M78G 1CKBA 3RBBB 2HL5C 3G4ST 3UF4A 1WLPB 2YT6A 3M4GA 4MMLA 5KYUB 4B9XA 3CC4A 1M8MA 4IUPA 1X6GA 4X9DA 2YDLA 3CBOA 2O9SA 3NGPA 1OX9A 5GAMe 1BBZA 2QYZA 1Q81R 3IQLA 3SD4A 1ABOA 2F2XA 2X51A 2F5TX 1RAFB 5GANe 3S3MA 3QWXX 1VQ4T 3CCRT 2SEMA 4LDYA 4M78D 4XTWA 5GAN6 1QCFA 5CK9A 2NUZA 3QDFA 3NFCA 5FROA 2FB7A 2CDTA 2RHZA 4M75B 1KQ2A 1AT1B 2DVEA 1JJ2A 2WSCE 4M78C 2MYSA 4M7DD 1PG5B 4M7AD 4OB0B 2QASA 4ATOA 4FL6A 5CKFA 4JRPA 2EVRA 2F1LA 2C06A 2RJCA 4FU6A 4KT0E 3CCST 4OMPA 1AZEA 4L6V5 3QZ5B 3C94A 2DO3A 1M1KC 2JUFA 5LJ3j 3OS5A 4M7DC 4HCCA 3CMAQ 1HXDA 2G6FX 4J9FA 4M77G 3DB4A 1I1JA 1IXDA 1EFNA 2E3IA 2HBPA 1M2VB 2CT3A 1JRIA 4XTXA 3JRZA 2D9TA 2JW4A 2X3WD 2CKKA 1GFCA 1MMNA 2QTXA 1G3SA 4DOWA 4FYVB 1KSWA 1VQKQ 4ORZA 3GF5A 1YI2A 1BIAA 5CVIA 4A4GA 4M78F 3REBB 5CKHA 1M1KR 3CXCA 3OYDA 1N9SA 1G83A 3M0RA 2RF0A 4BY6C 1K0XA 1E6GA 3M58A 4M4ZA 4IUVA 4B6MA 1NPRA 2CH4W 2K57A 3M0PA 1H92A 2CUDA 4J7FA 1SSHA 1NZ9A 5LJ5g 2DL4A 1UB4A 1EIFA 3OYEA 2V8KA 3J80E 1OEBA 4KH1B 4J9EA 3X25B 3LH5A 4KRTA 2KR3A 4C8QG 4AMCA 3KXTA 1OQKA 4C92G 1WJRA 4P5NA 4N0AA 4J6XA 1MMDA 2HZYA 3HRTA 1VIFA 2RD1A 1TOVA 4BACA 1VQ6A 4F14A 2KXDA 2V26A 2L3PA 4CRIA 3UA7A 3SWNA 3OMCA 3JB9H 4OMQA 3META 4X1VA 1M5Q1 3BDUA 4E7ZA 3MEAA 3RDVA 3CCQA 4ESRA 2LCSA 2JS2A 2ZPFB 5GAN4 4J9DA 5J3BA 3CPWP 4LDUA 3CCVQ 4M7DF 2JNGA 2CREA 1LVKA 4M77F 2ABLA 4C92B 4DA4A 3OYFA 2V8JA 2XKOC 1VQPT 1BU1A 1M8VA 1EX4A 4EMKA 3M59A 2A0FB 4KGZB 2MIOA 4MZPA 2DE0X 1G5VA 1JU5C 1PKTA 4HA8A 5GAOl 2DXBA 3JCMW 3NTHA 4A4KA 1YHQA 4FCYA 3WXMB 2GBQA 4A4HA 2YLCA 4HCZA 4PJOF 1AZGB 1YI2Q 2E1HA 3MP8A 4M78B 2DD5A 2CZ6B 3EGUA 4JZ3A 4NL3A 3GPLA 2HQHA 2NUTB 4DEXA 1VQPQ 2XIDA 3L2VA 1D0YA 4GLKA 1YWOA 3RKYA 1SG5A 2EJFA 1GBQA 1YI2T 2OTLA 1KHCA 4M75D 2LC4A 2DA9A 2QTVA 1VYUA 1IGQA 4E7IA 5HK3A 3JCMd 3LH0A 1N6AA 3MEWA 3VS5A 3OYMA 3D7SB 1RAGB 3EGDA 3QPHA 4ANJA 1NJIC 3JCMf 1VQKA 3H6ZA 2AZVA 3CCMA 2FO0A 3PVLA 1N8RU 1GFDA 4FM4B 4M75C 1XTDA 2XU8A 2FL7A 1PSEA 2EFIA 1SSFA 2O4XA 4A53A 4LDXA 1IO6A 2EYWA 2E65A 2EQMA 3NPFA 4F7UA 4B9WA 4C5GA 4XK8E 4EMGA 3HHTB 4IUUA 5GAMg 3AHUA 4XAXB 2DERA 2M0YA 1TUCA 3L2UA 1V29B 4J6WA 2GFAA 1YITA 4M7DG 5FRMA 2LP5A 4XQ3A 3CCSQ 3NHNA 5DLQE 2NYSA 1M90R 1VQ4A 3G7ZA 2P0QA 2KT8A 1N27A 2HNIA 3VS4A 3E1SA 8ATCB 2D0NA 2BUDA 2F2VA 2JN0A 2MF2A 2YLBA 1WJSA 2CH4A 1X27A 3PIOA 4CC2A 3QWYA 4M77D 2DKGA 2C0TA 2EWNA 2D8HA 1M3AA 2CP7A 3DB3A 3CCQQ 3CEYA 4BY6B 3ASKA 4PJOG 1I8FA 3OBYA 2FYKA 4DBQA 1KJWA 1YJWA 3M54A 4M78E 1Y96B 1R0BG 2IIMA 2YXYA 3A8LB 4FSSA 4JLIA 1G3TA 2BE7D 5GMKj 2L5QA 1RAAB 5CO7A 1K0SA 3BW1A 4PJLA 2OX7A 5GMKl 4N0AC 3UATA 1TH7A 4ZN3A 1KQSS 4MZMA 1JQQA 3UT1A 3CCJQ 1U1SA 3HRUA 4FSXA 3QUIA 1VQ6T 4MDWA 3CMAA 5A0DA 2BIVA 2RHIA 4ME7A 5GANj 2OAUA 4M77A 4LXCA 2DTHA 3RERA 2VGNA 2ED0A 2CP3A 1GCPA 4QT7A 1NJIU 1D0XA 2DEQA 5GAN3 1ZA2B 3SHWA 5I11A 3JCMh 3CCUA 1W70A 1CSKA 2GCXA 1VQLT 2Y4XA 3C12A 1VQNA 1UGRB 4C0DC 3QIIA 1QQJA 3OYLA 3ZEHA 1JEGA 1YCYA 2E70A 5LJ3e 1X43A 2D1XA 1OZ2A 2GFUA 3BE3A 1WHGA 2QGFB 3G6EQ 1RAIB 2FG0A 1PM3A 2DZCA 4PLLA 4IKFA 4BUGA 1U5SA 3CBMA 2QQRA 3EH2A 1Q86R 1VQ5A 1VQ8Q 2GQVA 3LWHA 2VXFA 2CUBA 2HDAA 4JDSA 2FZKB 3VUBA 4AG2C 5LJ5e 1VQLQ 1M9SA 5KYXB 1YIJQ 4F17A 1PD0A 3OSVA 4J9BA 1ABQA 5KYUA 3EGDB 3VS3A 4RG2A 3LGLA 1SHFA 2EGAA 1VQ8A 3HTRA 5KE3A 1VQ7A 1N8RR 4F7UG 1RAEB 2ZAEA 5KYYA 4HT8A 3OQ5A 1VOMA 3EG1A 5A0LA 1JB0E 4M7DA 1UFFA 1P92A 1N9RA 3L42A 3RKXA 3H9NA 3SFMA 4C0GA 5GMKe 2ZCFB 1Q81U 1V1CA 4WF2A 1B07A 4PFOA 5ECAA 3TQ7P 1NYGA 5LJ3d 3JB9D 2PUOB 4KBMB 3JCMQ 5IT9E 1KFZA 3PNWC 4HVVA 3OYKA 1U8RA 2DZ9A 1D3BB 2KVQG 5I22A 4M7AC 1YJWQ 3LX7A 4Z89A 2D8JA 5CKDA 3OYCA 4L5GA 3CCEQ 4OMOA 2RQTA 1K9AA 3PVQA 1BI2A 1KK7A 4BDZA 3PMTA 3BDLA 1K9MC 4IURA 2E3HA 4KGVB 1Q7YU 4E7KA 2OAWA 2VUBA 4XTYA 2KE9A 1YJ9T 5GJVB 1SKUB 5FW9A 2COYA 2P4TA 4OMFB 1KC8U 5CR2A 2LX7A 3OS1A 2L3RA 1HJDA 3VS2A 4EIKA 2O01E 1ACMB 3R6OA 3L2QA 4M75F 1RACB 1K73U 5GAN8 3INZA 5FWCA 5CAIA 2FRYA 2YWWA 1W4SA 2MWPA 2G3RA 2B8AA 4XTUA 3CC2T 1ZA1B 1PD1A 2RA2A 3T9NA 1SRMA 3SWNC 3MEVA 2X4JA 3EG0A 4LD6A 2M51A 1W2BS 2ATCB 1MUZA 2YRCA 3FB9A 3CD6T 2KEAA 2AIRB 4C0DB 4OGCA 1MMGA 4JLGA 2V1RA 1UHFA 4JJCA 2H3EB 2K7AA 2BZYA 2F2WA 5GAMd 2Y90A 2NUPA 1G3YA 4LN2A 2GTOA 3M0QA 1MNDA 1TS9A 3TEEA 3ER0A 2BTTA 2DJQA 3PGGA 4IUQA 5M9OA 4E7LA 1K8AR 1Q82C 3E2UA 2LZ6B 4GY5A 2OTLQ 3H0IA 1WHJA 1UECA 5CIUA 5GANg 2QI2A 2VV5A 5HK0A 1IGUA 1JJ2P 4ZGEB 2EQUA 2K4YA 3UWNA 3A8MB 3JCMc 4UC4A 2DRMA 2PNIA 1M90U 1B34B 3M56A 3GLXA 4RTVA 1FWZA 1Y57A 3JCMe 3VRZA 2DX1A 1UE9A 2DD4A 2R5AA 1YJNQ 3URGA 1VQ5T 2DK3A 4OMMA 1M1KU 2KNBB 2LCCA 1M3CA 3A8HB 2F5KA 3OBWA 2RMOA 2OTJA 2E5QA 2K2MA 1I81A 2GF7A 3RMQA 5C0MA 1VQ9Q 3M0UA 2DL8A 6AT1B 4OB2B 1IHWA 2QEXA 3HKSA 3CCRA 2HCKA 1M2OA 1TUDA 4HKEA 2XDDA 2YUNA 4HCKA 3G71A 3THKA 3HPWA 1RAHB 1YN8A 4OMLA 2I0NA 2MMPA 4PJOE 2PZ1A 3OS0A 1D0ZA 1M27C 3CMEQ 3A8OB 2O2OA 1JXMA 3OY9A 2DFUA 4C92A 2RO0A 3GNFB 1KQ1A 3X20B 1DJ7B 4Z02A 3LGFA 3HSBA 1WQWA 4II1A 4DEYA 2DYBA 2FHDA 5FLXE 4PJOB 2K3XA 2ZGWA 3CC7A 5IXFA 2JMAA 3NTIA 3A8GB 2XHCA 2L89A 2VASA 1RUWA 1M1GA 1Y7XA 2JMCA 3CCLT 2RI2A 1OPKA 4RTZA 1I4K1 1QKXA 4HXJA 3VS0A 1SPKA 2AKLA 3RKWA 4RCCA 4J7IA 3V8KA 3CCLQ 3PIPA 2COWA 2RJEA 1YJ9Q 1UGQB 3UA6A 5KCHA 1PRLC 2EPDA 4MDXA 1TTHB 4PJJA 3MCAB 2EQIA 2VXEA 1SHGA 2LNHB 1I5LA 2JZ2A 3OYAA 2AHJB 4M77C 1E6HA 4LD9K 1GCQA 1AEYA 1WIEA 3M5AA 3EAEA 2LNVA 1FX7A 1C6VX 2LQWA 1VQPA 2DAQA 1KD1U 1ZSZA 2ECZA 3CD6A 2QQBA 2XDBA 1WPYA 2HAXA 1R0CB 2DIQA 7AT1B 2HKNA 5HKCA 1LJOA 4M7AB 3OS2A 1UGVA 2LQKA 2V1QA 2ROLA 2ESWA 2NLUA 2KY9A 3CCRQ 2DETA 4OMNA 1BI0A 5IH2A 1ZSGA 3CMET 3M0SA 1AWOA 1RI0A 2DF6A 1K9MR 3L2WA 2KAFA 4FW1A 1XJWB 1YWPA 2LQNA 2FZCB 5LJ3f 2M02A 2DPPB 2OI3A 4M75A 3HFOA 3V8JA 2EQKA 1RLPC 4JJBA 1QP3A 4PJNA 4RKUE 4E7SA 3C0CA 2RNAA 2QDYB 1Z9ZA 2V8IA 1D1AA 5DY9A 5GAOq 1VQ5Q 2RH2A 2A37A 2CSIA 3LWIA 2RQUA 3S3OA 1UDLA 5L8RE 1JO8A 5CKEA 1ZUKA 1O75A 3R6NA 3REAB 2AK5A 2DIGA 4OB3B 5D6YA 3MP1A 3DLLA 1WXUA 3M53A 5LJ5d 1K8AU 1WHKA 2CS7A 2FVUA 3O8VA 5GAN2 2VYTA 2DTOA 2X35A 4BB7A 3HL8A 1N8RC 2L3QA 4RTUA 1NBEB 4OGEA 5C6SA 5FU6B 4J5YA 5HY6A 4JPBW 1BK2A 3VUZA 2DTIA 2K2VA 2MK5A 1QWEA 4DBHA 1QLYA 2BE9B 2LT4A 1ARKA 4PJOA 2EAYA 4J9HA 4CC4B 1BKBA 3ZBDA 4TVRA 3CCLA 1PC0A 3OYYA 1X2KA 2FZGB 4F7UE 4M7AE 2ED1A 4C92C 3CCVA 1D1BA 3EFOB 4QVCA 2GTJA 2RHUA 1H3HA 1U06A 2DM1A 2RQVA 2L8DA 4R55A 1VYVA 2O4XB 3MO8A 1BCOA 3CCEA 2RQWA 2P0PA 4NS5A 2RQRA 4M7AA 1RLQC 3TSWA 3CQTA 4C92D 4PK4A 2FPDA 4Y28E 3P8HA 1CKAA 2C0IA 3CCJA 2CYZB 5KYNA 3JV3A 4EMKC 3NMZC 1ZHIA 2X4XA 4XU2A 1U1TA 2O88A 5LL6S 4O6JA 1T3LA 1UTIA 5KYWA 3RMSA 1XNIA 1FMWA 3F70A 4AFQC 3EHQA 1M2VA 4EMHA 4MMKA 2HL3A 1S72A 1BIBA 2WACA 1WGSA 1WXBA 2A7YA 4IIMA 2EIFA 4D8DA 3SB2A 5GANf 3I55A 2OTJQ 3OYGA 1WI7A 1WNLA 2XI9A 2PVDB 1NPPA 4M7AG 1RABB 1AOJA 2E41A 4N4IA 4J9CA 2E10A 3S6WA 2QA4Q 3C95A 5CCAA 1GXIE 2E6NA 1JBMA 2JS0A 3X28B 1X6OA 4CC3A 3DKMA 1X75C 3G6EA 2AKKA 4WTOB 3OYNA 1VQ4Q 2EYYA 4RTXA 4Z88A 2D6FA 1QW1A 2YRDA 4R0KA 2FEIA 2D0QB 5GAOr 1IB8A 1UJ0A 1QVFA 4JUVA 2LVMA 4Y91A 1YITQ 2DVJA 2E4HA 3KUFA 5FU7C 2KQWA 1M90C 1MV0B 5LJ5j 3E19A 4CC7A 5LJ3h 2LJ1A 3RUXA 2LX9A 1WFWA 5GAOp 1WX6A 1YJ9A 3Q1JA 1VQMA 3QBYA 1VUBA 2F69A 1W2BP 2EJ9A 4KUIA 4MZTA 3FJPA 2K6DA 5LJ5h 1Q95G 5AT1B 2J6OA 2E64A 2KXCA 1RL2A 5GJWB 3JCMJ 3JCMg 5AYFA 4M77B 1E7OA 1G2BA 2Z0WA 4C5EA 3QJ6A 1GRIA 5KE2A 1M1FA 4F7UB 1A0NB 3H41A 1OPLA 3EG9B 3FEOA 4O5VA 4BE1A 2YUOA 1JXOA 3KBGA 4J83A 1KQSA 4Y92A 3G1JA 5D6WA 4YTLA 3CPWS 4C0ZA 2K5LA 1MNEA 3QKJA 4OF1A 1SF9A 1VQOA 1NE8A 1B34A 1K76A 2X4YA 1TU0B 4M7AF 2C0OA 4ZN1A 3OW2P 1Y0MA 3JCMX 4QQ6A 1K73C 4ELZC 3OA6A 1ZBJA 1WJQA 4XU3A 4J9GA 2OJ2A 2OTLT 2P0KA 3GP8A 3J7AF 2KDSA 2RI3A 1U3OA 2NUTA 3JB9G 1IZ6A 4BI8B 4JS5A 3VYHB 3EGXA 4HVUA 1H641 3HP9A 1GBRA 2KGTA 1S1NA 3X26B 4LDWA 2JJ9A 4F7UF 3ULRB 1Q82R 1X69A 2KT1A 4A4FA 3QYHB 1KG1A 2RJFA 2LRQA 3DLMA 2YUPA 1X2QA 3JSCA 3OYHA 3OW2S 4V2SA 4ZTJA 1WYXA 2O9VA 3GBQA 2XDPA 1OOTA 2DL7A 2K3YA 1FMVA 1VQMT 1OX8A 3CC7Q 1Q82U 2LJ0A 2QK0A 4LUEA 2JXBA 1OV3A 3L2ZA 1AD5A 1S72T 4AFZC 4M77E 2JTMA 4A63B 2M1HA 2QDLA 1OI1A 2CP6A 3QZ9B 4EPCA 2PUKB 1UHCA 2GQIA 4NOYA 4RCBA 1D1CA 2K3BA 1LCKA 3PMIA 4M7DB 1UGSB 4E2FB 3M55A 3EFSA 1SRLA 4BD3A 1WA7A 1VQKT 3CCQT 4IUTA 3TVTA 1MGQA 3OW2A 2KYMA 5CQYA 4RTYA 4ZTFA 4C8QB 5GAMh 2DXUA 4RTWA 2LTOA 4X34A 1B3QA 2QQ9A 2O31A 3JCMV 3H0HA 3I55T 1EZZB 2I2LA 2DEUA 1UEBA 3G6ET 4RTTA 2QXFA 3UDCA 4JJNK 2RI5A 2VWFA 3EG3A 3EG2A 3QO3A 1PRMC 1YHQQ 1FXXA 4IIOA 3MEUA 2CT4A 2YRVA 2EW3A 4EMKB 1HD3A 3I56T 3P8DA 4LE9A 1YHQT 2ENMA 2AZSA 2HD0A 1W6XA 2E12A 2SRCA 2QGGA 3VS1A 2A28A 3BY7A 3V8LA 1NLOC 1Y71A 5KYYB 1QVGP 1D09B 1NEGA 2DL5A 3HRSA 4AFUC 3UPUA 2JM9A 2MCNA 2WSEE 4C0FA 3M57A 3ME9A 4GBQA 3HFNA 1C0MA 2VKNA 3FJ5A 4AFSC 1QVGA 4LDVA 4PFPA 3JCMb 5GANh 2JT4A 2L2PA 1WHLA 2HQEA 4OP0A 5LJ3g 1VA7A 3CBPA 3OYIA 4JRQA 3MJXA 2VB6A 1SEMA 2RJDA 1WHHA 3EFOA 1VYTA 1HYOA 2YSQA 5GMKh 3CCSA 2CSQA 2EBPA 3FC3A 2W10A 1ZSZB 3OSSC 1H3ZA 2LQ8A 2JOYA 3QG1A 1M3BA 4XU0A 4DBRA 4PNOA 5GAMf 1KQSP 4BE0A 4Z8AA 2RHXA 4QKUA 4C8QF 3CCUT 5D6XA 1T3SA 1YIJT 4FT2A 2X9HA 4E7JA 1RI9A 2EYXA 4C92F 1I07A 3PT9A 2DJZA 1M30A 3EH1A 1K4US 4C5IA 1K1ZA 4PJMA 1LOJA 1UG1A 5IN1A 4QW2A 4E6RA 3G4SA 1VQ9A 5IAYA 3KFVA 1QP2A 3BFMA 4ELYC 1ZQ1A 1NG2A 3I56A 4DBFA 2R58A 4FYYB 5GMKm 3CMAT 4PFZA 3VS6A 1KD1C 2PVGB 4M75E 2M9UA 2DMOA 2L0AA 4QQGA 1T0JA 3CMEA 4JJDA 2Y4YA 4C8QC 4BI3A 3EG9A 2EKHA 1ZUYA 4GLMA 4CI0C 3VU3C 2RK2A 4A4EA 1IREB 2QA4A 2DBKA 2XMFA 3VJPA 3M0TA 4OVAA 3TCJA 5EG2A 3VYGA 3EFRA 1OU9A 3CCVT 3OYBA 3CCUQ 4C8QD 2KRNA 3S3NA 2CP5A 2H8HA 3MKDA 1VQNT 3VRYA 3SEMA 1I5OB 2HSEB 3I35A 4J9IA 1YJNA 2B86A 2DNUA 3CC4Q 2J06A 2KSSA 4QQDA 5HCKA 3ZFJA 4NL2A 1VQNQ 1G3WA 2JVVA 5J39A 3L1AA 4KULA 4WCIA 2CP0A 1FMKA 1GL5A 4PL6A 3LW5E 2BZXA 1K8AC 1IHVA 3H8ZA 2K5FA 1Z9QA 1FYNA 5A2QE 2NUPB 4C5HA 5GAOm 1LPLA 1UUEA 2DLPA 2VVKA 3I55Q 1NYFA 2CZ7B 1WHMA 5EC7A 4J8OA 3LYIA 2R57A 1QVFS 1AWJA 2M0OA 4HCBA 3M9QA 4VUBA 2KYBA 3CCJT 5KH6A 2KI7A 2DBMA 4OB1B 2P84A 2L3SA 2EKOA 3MHXA 2HMAA 2ZPEB 2BKDN 2IVWA 1Q86U 3FDRA 2XICA 2RHYA 3AT1B 4KH0B 2COZA 4JRIA 2EYQA 2K79A 1KC8R 3EHRA 1YBYA 2LDMA 3CCMT 4JRKA 2LT1A 2WSFE 2LMJA 1WDXA 1XQHA 2LCLA 1OULA 2CZ0B 1ZX6A 3RR6A 4N4HA 3QYGB 5IHNA 5GAN7 3V7CA 3NTKA 3JB9J 4DQ2A 1TUGB 2CGHA 2CZ1B 1ZUUA 4ZNXA 1M4ZA 2OTJT 3MP6A 5FU6C 1D3BA 1QMCA 4D6WA 2J05A 4FYXB 4ZGDB 5GANd 4K11A 2MOXA 2KROA 3G71T 2EYZA 2FPEA 1W1FA 1O9SA 3G71Q 3WVEB 1RADB 3PFSA 3QJYA 1B7TA 2K5IA 4M7DE 3J81E 2DRKA 3E9GA 1NEBA 2X4WA 2QA4T 1YJNT 2VGMA 4F16A
chains in the Genus database with same CATH topology
5D6WA 4C92G 4RMOA 4E7LA 2E6ZA 4YTLA 1WJRA 4P5NA 4N0AA 3CPWS 4C0ZA 2K5LA 1Q82C 4J6XA 3HRTA 3QKJA 4OF1A 1VQOA 1VIFA 1NE8A 1B34A 2X4YA 4GY5A 2RD1A 3V7SA 4BACA 4ZN1A 4M7AF 1VQ6A 3JCMX 4QQ6A 3LLRA 5CIUA 5GANg 2QI2A 2VV5A 5HK0A 3QSUA 4CRIA 1K73C 4ELZC 3OA6A 3QHSA 1WJQA 4ZGEB 4XU3A 2EQUA 3OMCA 2K4YA 3SWNA 3GIBA 3JB9H 3UWNA 1R8OB 3META 1XOVA 3A8MB 5FRNA 1Y96A 1M5Q1 3JCMc 3BDUA 4UC4A 1WQ7A 3MEAA 1M90U 1B34B 5J26A 3CCQA 2OTLT 3CC2A 2P0KA 3M56A 5GAN4 2ZPFB 3GLXA 2ZPIB 3GP8A 2KDSA 1VQ9T 3J7AF 1FWZA 2RI3A 5J3BA 1MHNA 3N5BB 4LDUA 3JCMe 3CC7T 3JB9G 4M7DF 1IZ6A 2JNGA 4BI8B 2DD4A 4JS5A 2R5AA 4M77F 3URGA 4C92B 1VQ5T 2DK3A 1M1KU 2LCCA 4X9CA 4PLIA 3VYHB 1JJ2S 1H641 3OYFA 4DA4A 3A8HB 5GAOn 4BDYA 2V8JA 2F5KA 2XKOC 3HP9A 1YITT 1VQPT 1M8VA 3OBWA 4EMKA 3X26B 2OTJA 4LDWA 2E5QA 3M59A 5CQXA 1I81A 2GF7A 3RIRA 4DOVA 4F7UF 3RMQA 5DLOA 3JCMP 4RG8A 4MZPA 5C0MA 2RB6A 1W2BA 4OB2B 2QEXA 1G5VA 4E47A 2KK4A 4A4FA 1Y07A 3QYHB 3HKSA 2RJFA 3CCRA 1KG1A 2LRQA 2JTFA 3DLMA 4HA8A 5GAOl 3JSCA 4HKEA 2DXBA 3OYHA 2XDDA 3NTHA 2MWOA 3OW2S 4A4KA 3JCMW 4ZTJA 3G71A 1YHQA 4V2SA 3SDZA 3HPWA 1AHJB 3WXMB 2H3JA 2XDPA 4XTVA 2MMPA 4A4HA 2YLCA 4PJOE 2K3YA 4HCZA 3OS0A 1VQMT 4PJOF 1YIJA 1X01A 2QQAA 2E1HA 3MP8A 4M78B 2DD5A 1Q82U 3A5ZB 3A8OB 2CZ6B 3M4YA 1HK9A 3L2ZA 3OY9A 1S72T 2XD0A 4NL3A 5I2SA 4C92A 2RO0A 3GNFB 4M77E 1KQ1A 2JTMA 2M1HA 2QQSA 3VKIA 3GPLA 3X20B 1DJ7B 1OI1A 4EDUA 4Z02A 2KMTA 2XIDA 4XU1A 3QZ9B 4GLKA 4EPCA 3L2VA 3LGFA 3RKYA 2PUKB 3HSBA 2EJFA 2OTLA 1WQWA 1YI2T 1KHCA 4NOYA 5GAMj 4M75D 4II1A 4RCBA 1VQOT 2LC4A 3CC4T 2MI6A 3PMIA 2FHDA 2EJGA 5FLXE 2K3XA 2ZGWA 3CC7A 4PJOB 1BI3A 4E7IA 5HK3A 4M7DB 5GAN5 3JCMd 1UGSB 3M55A 3LH0A 1N6AA 3EFSA 3MEWA 3V7RA 3NTIA 3OYMA 3A8GB 2XHCA 4BD3A 3JB9I 3QPHA 1NJIC 2L89A 4C8QE 1VQKT 3CCQT 4IUTA 3JCMf 3E9FA 1VQKA 1MGQA 3OW2A 3H6ZA 1M1GA 1Y7XA 5GMKi 5CQYA 3CCLT 2RI2A 3CCMA 4ZTFA 2ZPHB 3OB9A 1N8RU 4C8QB 4FM4B 2M16A 5GAMh 4M75C 3WVDB 1XTDA 2DXUA 1I4K1 2LTOA 2FL7A 2QQ9A 1PSEA 2EFIA 2XU8A 4X34A 3JCMV 3I55T 1SSFA 2O4XA 2I2LA 4A53A 4ZGJB 2MAMA 4LDXA 1UEBA 3RKWA 5A0GA 2E65A 4RCCA 3TREA 4J7IA 3G6ET 2EQMA 2QXFA 2PQWA 3V8KA 3PIPA 2RJEA 4B9WA 4C5GA 3UDCA 4F7UA 4JJNK 1UGQB 2RI5A 2DXCA 4XK8E 4EMGA 5KCHA 3HHTB 4IUUA 4Q5WA 5GAMg 3AHUA 4XAXB 3QO3A 4MDXA 3MCAB 3L2UA 1V29B 1PSFA 1FXXA 4J6WA 2GFAA 1YITA 2VXEA 3MEUA 3CPWA 4M7DG 5I2MA 5FRMA 1I5LA 4XQ3A 2JZ2A 3OYAA 2YRVA 2QEXT 4EMKB 1VQLA 2AHJB 4M77C 5DLQE 4LD9K 3I56T 3P8DA 1VQ4A 3G7ZA 2P0QA 1YHQT 3M5AA 1N27A 2HNIA 2LNVA 3EAEA 1FX7A 5KCOA 1KC8C 3E1SA 1VQPA 2ZPBB 2DAQA 4C8QA 4BE2A 2HD0A 1KD1U 3CD6A 2BUDA 2YLBA 2JN0A 2MF2A 2E12A 2QQBA 1WJSA 2XDBA 1WPYA 2HAXA 3PIOA 2DIQA 3QDRB 4M77D 2DKGA 1QVPA 3BY7A 3V8LA 5HKCA 1LJOA 4QVDA 1Y71A 4M75G 4M7AB 3OS2A 2LQKA 2EWNA 5I21A 4HT9A 4E7HA 3HRSA 3DB3A 3UPUA 5LJ5f 2NLUA 3CEYA 2WSEE 4BY6B 4QVZA 3ASKA 4PJOG 2KY9A 1I8FA 3VV0A 4C0FA 3OBYA 2FYKA 3M57A 3SWNB 1Q81C 3FRNA 4A54A 1QVGS 1BI0A 1VQ7T 3ME9A 1YJWA 3M54A 3HFNA 3OMGA 1Y96B 1RI0A 4M78E 4R56A 3CMET 2VC8A 1QVGA 1VQ8T 4LDVA 3A8LB 4JLIA 1G3TA 3L2WA 2KAFA 3JCMb 5GMKj 5GANh 2L5QA 5CO7A 3X24B 3QXEB 3BW1A 5LJ3f 2HQEA 5GMKl 4N0AC 1TH7A 1UGPB 2DPPB 4M75A 4OP0A 4ZN3A 5LJ3g 1KQSS 4MZMA 3CBPA 3OYIA 4JRQA 3HFOA 3UT1A 3V8JA 2EQKA 1U1SA 3HRUA 1BI1A 2XG8D 4FSXA 1BYMA 3QUIA 1VQ6T 4MDWA 3CMAA 5A0DA 1QP3A 2RJDA 3P8BB 4N4GA 4RKUE 2BIVA 2RHIA 4L59A 4ME7A 2R5MA 5GMKh 3CCSA 5GANj 3FC3A 2QDYB 2OAUA 2V8IA 4M77A 2DTHA 3RERA 2VGNA 5DY9A 3OSSC 5GAOq 1K9MU 1OYXA 5FU7B 2RH2A 4XTZA 3OYJA 1H3ZA 3LWIA 2LQ8A 2JOYA 3S3OA 3QG1A 1NJIU 4XU0A 4PNOA 2DEQA 5L8RE 5GAMf 5CKEA 1O75A 3CPFA 4J6YA 1LNXA 1YJWT 2HQXA 5GAN3 4BE0A 2DIGA 2RHXA 3CCUA 4FT4A 4OB3B 5D6YA 3JCMh 4C8QF 3CCUT 5D6XA 2GCXA 3MP1A 3JAME 3DLLA 3M53A 5LJ5d 1YIJT 1Q7YC 1VQLT 2EQJA 2Y4XA 1K8AU 4FT2A 4KUDK 3C12A 2CS7A 4E7JA 2FVUA 3O8VA 5GAN2 2VYTA 2DTOA 1VQNA 2X35A 1UGRB 4BB7A 3FLGA 4C0DC 3HL8A 4C92F 2ZZDA 1N8RC 3JB9F 3PT9A 3QIIA 2DJZA 2PU9B 1VIEA 5CKBA 3OYLA 3ZEHA 4OGEA 5C6SA 4M78A 5FU6B 4JS4A 2YHTA 2ZPGB 4J5YA 5HY6A 4C5IA 1YCYA 3VUZA 2DTIA 2E70A 1LOJA 5IN1A 2K2VA 4QW2A 5LJ3e 3G4SA 1VQ9A 5IAYA 1OZ2A 2GFUA 2LT4A 4PJOA 2EAYA 3CXCS 1QP2A 3BFMA 3FIFA 4ELYC 1BKBA 1ZQ1A 3I56A 2DZCA 4PLLA 4PJOC 1OZ3A 3ZBDA 2A3LA 4IKFA 2R58A 4TVRA 4BUGA 3CCLA 3CBMA 4FIBA 2QQRA 5GMKm 4BI4A 1VQ5A 3CMAT 2GQVA 2IG0A 3LWHA 2VXFA 3L2RA 4JDSA 3TU4K 3CCET 1KD1C 3VUBA 2PVGB 3OYYA 4M75E 2M9UA 4F7UE 5DM7R 3RESA 4M7AE 4PKCC 4QQGA 4C92C 5LJ5e 1M9SA 3CMEA 3CCVA 2XK0A 2Y4YA 3OSVA 3C4SA 4C8QC 4QVCA 2RHUA 4BI3A 4C92E 4CI0C 2L8DA 4R55A 3VU3C 2RK2A 4A4EA 4PJOD 1IREB 2PVOB 4RG2A 2QA4A 3LGLA 2O4XB 3MO8A 2RM4A 3CCEA 1VQ8A 2P0PA 3VJPA 4NS5A 5KE3A 4OVAA 1VQ7A 1ZBXA 3GNGA 4F7UG 3TCJA 3GOXA 5EG2A 1KHIA 3VYGA 2RK1A 4M7AA 4HT8A 4C92D 3OQ5A 3EFRA 3PTAA 2DXTA 5A0LA 3CCVT 3OYBA 1JB0E 4M78G 4Y28E 4C8QD 3S3NA 3P8HA 4M7DA 3G4ST 1P92A 1N9RA 1VQNT 3CCJA 2CYZB 3L42A 3RKXA 5GMKe 3SFMA 4C0GA 2ZCFB 1Q81U 4EMKC 3M4GA 4MMLA 1YJNA 4WF2A 1ZHIA 4B9XA 3CC4A 2KSSA 2X4XA 4XU2A 4IUPA 4X9DA 4QQDA 1KQSA 1U1TA 3CBOA 5LL6S 3ZFJA 4O6JA 4NL2A 5GAMe 3RMSA 5LJ3d 3JB9D 1G3WA 2PUOB 4KBMB 2JVVA 3JCMQ 1XNIA 5J39A 5IT9E 3L1AA 3F70A 4KULA 3PNWC 4PL6A 3LW5E 3SD4A 2F5TX 5GANe 3S3MA 4EMHA 1VQ4T 4MMKA 3OYKA 1U8RA 2DZ9A 1S72A 1BIBA 1K8AC 2WACA 3CCRT 3H8ZA 2K5FA 1D3BB 2KVQG 4LDYA 4M78D 1WGSA 5A2QE 4M7AC 2A7YA 4XTWA 3LX7A 4C5HA 5GAN6 5CKDA 5CK9A 5GAOm 3OYCA 4L5GA 2EIFA 3NFCA 3SB2A 5GANf 3I55A 2CZ7B 1BI2A 3OYGA 1WNLA 5FROA 4BDZA 3PMTA 2XI9A 3BDLA 2PVDB 2FB7A 3LYIA 4IURA 4J8OA 2R57A 1K9MC 1QVFS 2RHZA 2M0OA 1NPPA 1Q7YU 4M75B 4E7KA 2VUBA 4XTYA 4HCBA 3M9QA 1KQ2A 4VUBA 4M7AG 2DVEA 2E41A 1YJ9T 1JJ2A 4N4IA 2WSCE 3CCJT 4M78C 4M7DD 4M7AD 4OB0B 2E10A 2P4TA 3S6WA 4OMFB 4ATOA 4FL6A 5CKFA 3C95A 5KH6A 4JRPA 1KC8U 5M9OA 5CCAA 1GXIE 2C06A 2E6NA 2RJCA 1JBMA 4FU6A 3X28B 5CR2A 4OB1B 1X6OA 3OS1A 2L3RA 4KT0E 3CCST 2EKOA 3DKMA 3MHXA 1X75C 3G6EA 2ZPEB 4L6V5 3QZ5B 3OYNA 2BKDN 2IVWA 3C94A 2DO3A 1M1KC 2O01E 3R6OA 2JUFA 4M75F 3L2QA 5LJ3j 3FDRA 1Q86U 1QW1A 2D6FA 2XICA 2RHYA 1K73U 2D0QB 3OS5A 5GAN8 3INZA 5GAOr 4M7DC 4JRIA 5CAIA 4HCCA 1QVFA 2EYQA 4JUVA 2LVMA 1HXDA 1YBYA 1W4SA 4M77G 2LDMA 3DB4A 4Y91A 3CCMT 4JRKA 2MWPA 2LT1A 2G3RA 2WSFE 2B8AA 2HBPA 3KUFA 4XTUA 3CC2T 1XQHA 2LCLA 1JRIA 5FU7C 2KQWA 2RA2A 4XTXA 3JRZA 3T9NA 1M90C 2D9TA 3SWNC 2CZ0B 2CKKA 3MEVA 2X4JA 3E19A 4LD6A 4N4HA 2QTXA 5LJ5j 5LJ3h 1G3SA 4DOWA 1W2BS 3RUXA 3QYGB 5GAN7 2LX9A 3V7CA 3NTKA 5GAOp 3JB9J 1YJ9A 3Q1JA 1VQMA 3GF5A 1YI2A 3FB9A 4DQ2A 3CD6T 3QBYA 1BIAA 1VUBA 5CVIA 4A4GA 2F69A 2CGHA 4M78F 5CKHA 2CZ1B 4C0DB 3CXCA 4OGCA 1M4ZA 2EJ9A 4KUIA 1N9SA 4MZTA 3OYDA 3MP6A 4JLGA 2OTJT 3FJPA 5LJ5h 4BY6C 2E64A 3M58A 1D3BA 5FU6C 4IUVA 1NPRA 1RL2A 2K57A 4D6WA 3JCMJ 3JCMg 5AYFA 4J7FA 1NZ9A 4M77B 5LJ5g 4ZGDB 5GANd 1UB4A 1EIFA 3OYEA 2V8KA 3G71T 3J80E 1O9SA 3WVEB 5GAMd 2Y90A 3X25B 3PFSA 4C5EA 3QJ6A 1G3YA 5KE2A 1M1FA 3QJYA 4F7UB 4C8QG 2K5IA 3TEEA 1Q86C 3ER0A 3J81E 4M7DE 3FEOA 4O5VA 4BE1A 3E9GA 2X4WA 3KXTA 2QA4T 1YJNT 3KBGA 4J83A 2VGMA 3PGGA 4IUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D6W A;  1WGS A;  2RI2 A;  4E7L A;  4ZTF A;  1WJR A;  3OB9 A;  3LX7 A;  2M16 A;  4C5H A;  3O8V A;  2HQX A;  3QKJ A;  4BE0 A;  2LTO A;  4X34 A;  2DIG A;  2EFI A;  2RHX A;  3OYC A;  4GY5 A;  2X4Y A;  1SSF A;  5D6Y A;  2O4X A;  4BAC A;  5D6X A;  3MP1 A;  3OYG A;  3OA6 A;  5FRO A;  4QQ6 A;  4BDZ A;  3PMT A;  2EQJ A;  3BDL A;  3LLR A;  3LYI A;  4IUR A;  5CIU A;  2R57 A;  4CRI A;  4E7J A;  2RHZ A;  2EQM A;  2M0O A;  2VYT A;  2PQW A;  1WJQ A;  2X35 A;  2RJE A;  2EQU A;  3FLG A;  3M9Q A;  3OMC A;  4B9W A;  4C5G A;  5KCH A;  2RI5 A;  3UWN A;  3MET A;  3QII A;  4IUU A;  4N4I A;  4Q5W A;  5FRN A;  3OYL A;  4UC4 A;  3MEA A;  3S6W A;  5J26 A;  3ZEH A;  5C6S A;  3L2U A;  4FL6 A;  5KH6 A;  2P0K A;  2GFA A;  5M9O A;  3MEU A;  2E6N A;  5FRM A;  2RJC A;  4FU6 A;  4C5I A;  2JZ2 A;  2RI3 A;  2YRV A;  3OS1 A;  3OYA A;  1MHN A;  2L3R A;  2EKO A;  5IN1 A;  4QW2 A;  5IAY A;  1OZ2 A;  3P8D A;  3OYN A;  2GFU A;  2BKD N;  3L2Q A;  1N27 A;  2R5A A;  3EAE A;  3FDR A;  2RHY A;  2LCC A;  4PLI A;  4PLL A;  5KCO A;  1OZ3 A;  4IKF A;  2R58 A;  2DAQ A;  3OYF A;  2LVM A;  4BE2 A;  2QQR A;  4BDY A;  2F5K A;  2BUD A;  2LDM A;  2IG0 A;  3DB4 A;  3L2R A;  1WJS A;  2MWP A;  2G3R A;  2E5Q A;  2B8A A;  3KUF A;  2DIQ A;  2GF7 A;  4QQG A;  4E7K A;  5C0M A;  2XK0 A;  2D9T A;  3OS2 A;  3C4S A;  2CKK A;  3MEV A;  1G5V A;  4LD6 A;  2RHU A;  4N4H A;  4A4F A;  4E7H A;  2RJF A;  2L8D A;  2JTF A;  2LRQ A;  3DLM A;  3DB3 A;  4A4E A;  3OYH A;  4RG2 A;  2NLU A;  2MWO A;  3CEY A;  3NTH A;  3NTK A;  3LGL A;  2O4X B;  4ZTJ A;  3MO8 A;  4QVZ A;  3ASK A;  3Q1J A;  4NS5 A;  3QBY A;  4OVA A;  5KE3 A;  2XDP A;  4A4G A;  3GOX A;  4A4H A;  3ME9 A;  3OMG A;  2K3Y A;  1RI0 A;  4HCZ A;  3OS0 A;  3OQ5 A;  3OYD A;  3MP8 A;  3MP6 A;  3OYB A;  3L2W A;  3OY9 A;  3S3N A;  3P8H A;  2RO0 A;  4IUV A;  2QQS A;  2HQE A;  2M1H A;  3L42 A;  1OI1 A;  3S3O A;  4EDU A;  4Z02 A;  3OYI A;  3L2V A;  3LGF A;  3UT1 A;  2EQK A;  3OYE A;  4B9X A;  1KHC A;  2X4X A;  4II1 A;  4IUP A;  4QQD A;  2RJD A;  2FHD A;  3PMI A;  3PFS A;  2K3X A;  2BIV A;  2RHI A;  4L59 A;  4N4G A;  4C5E A;  3QJ6 A;  4E7I A;  1H3Z A;  5KE2 A;  2R5M A;  1XNI A;  3LH0 A;  5J39 A;  3FC3 A;  3F70 A;  3MEW A;  3NTI A;  3PNW C;  3FEO A;  3OYM A;  4PL6 A;  3SD4 A;  4BD3 A;  4BE1 A;  3S3M A;  2L89 A;  3E9G A;  2X4W A;  3OYK A;  1OYX A;  4IUT A;  3OYJ A;  3E9F A;  2WAC A;  3H8Z A;  3H6Z A;  4IUQ A; 
#chains in the Genus database with same CATH topology
 4RMO A;  2E6Z A;  1TWB A;  1YP5 A;  1ZSZ C;  1HSQ A;  3V7S A;  2A08 A;  2HKQ B;  3LLR A;  3QSU A;  3QHS A;  3GIB A;  2KRS A;  1R8O B;  1XOV A;  1IRX A;  5FRN A;  1Y96 A;  3A98 A;  1WQ7 A;  5J26 A;  2RPN A;  3CC2 A;  3CC2 Q;  1QKW A;  2ZPI B;  5KYX A;  1VQ9 T;  4F04 B;  3I5R A;  1F1B B;  3I5S A;  2FPF A;  1MHN A;  3U23 A;  3N5B B;  5IHK A;  1V76 A;  3CC7 T;  3A1P A;  1YFN A;  4X9C A;  4PLI A;  1JJ2 S;  5GAO n;  4BDY A;  1YIT T;  1TG0 A;  2HSP A;  2J6F A;  5CQX A;  3RIR A;  4DOV A;  4LUD A;  3CD6 Q;  5DLO A;  3JCM P;  4RG8 A;  2RB6 A;  1W2B A;  1AWX A;  2CP2 A;  2KBT A;  3EGX B;  2KK4 A;  4E47 A;  1Y07 A;  2JTF A;  1N5Z A;  1Q86 C;  2MWO A;  3SDZ A;  1AHJ B;  1UJY A;  2H3J A;  4XTV A;  3VS7 A;  1YIJ A;  1X01 A;  2J6K A;  2QQA A;  1MV3 A;  3A5Z B;  3M4Y A;  1HK9 A;  2XD0 A;  5I2S A;  5IHI A;  2QQS A;  3VKI A;  3G4S Q;  1TSF A;  4EDU A;  2E5K A;  1WXT A;  2KMT A;  4XU1 A;  4AG1 C;  8AT1 B;  5GAM j;  1VQO T;  3CC4 T;  2MI6 A;  2EJG A;  2MPX C;  1BI3 A;  5GAN 5;  2EGC A;  3V7R A;  3JB9 I;  1NM7 A;  2W0Z A;  4C8Q E;  9ATC B;  3E9F A;  1VQO Q;  5GMK i;  2ZPH B;  2ROT A;  3OB9 A;  2M16 A;  4LNP A;  5D7U A;  3WVD B;  2DIL A;  1WZO A;  3H0F A;  4ZGJ B;  2MAM A;  5FWB A;  5A0G A;  3TRE A;  2PQW A;  1T0H A;  4FW2 A;  1ZLM A;  2K9G A;  4JZ4 A;  2DXC A;  2X3X D;  4Q5W A;  3I9Q A;  1NLP C;  1PSF A;  1TXQ A;  2EGE A;  3ZL7 C;  3CPW A;  5I2M A;  2QEX Q;  2QEX T;  2NWM A;  1VQL A;  1QCN A;  4AT1 B;  1MMA A;  1G8X A;  5KCO A;  1KC8 C;  2ZPB B;  4C8Q A;  4BE2 A;  1YCS B;  1AVZ C;  2FRW A;  1VQM Q;  2QG9 B;  1BB9 A;  3QDR B;  2PTK A;  1QVP A;  1C1A A;  4QVD A;  4M75 G;  5I21 A;  4HT9 A;  4E7H A;  4HVW A;  2P4R A;  5LJ5 f;  4QVZ A;  3VV0 A;  3SWN B;  1Q81 C;  2GGR A;  3FRN A;  4A54 A;  1QVG S;  2YUQ A;  1VQ7 T;  3OMG A;  4R56 A;  1VQ8 T;  2VC8 A;  2JTE A;  1PKS A;  1PHT A;  3X24 B;  1I0C A;  3QXE B;  1UGP B;  2A36 A;  4RUG A;  1BI1 A;  2XG8 D;  1BYM A;  3CXC P;  3P8B B;  4N4G A;  4L59 A;  2R5M A;  2HBW A;  2DYI A;  3I56 Q;  1J3T A;  3O5Z A;  2HEQ A;  1K9M U;  2LJ3 A;  5FU7 B;  1OYX A;  4XTZ A;  3OYJ A;  3TSZ A;  4J6Y A;  3CPF A;  1YJW T;  1LNX A;  5KYW B;  1NJI R;  2HQX A;  2KRM A;  4FT4 A;  3CCM Q;  3JAM E;  2QAZ A;  1Q7Y C;  2EQJ A;  1X6B A;  4KUD K;  3JB9 F;  3FLG A;  2ZZD A;  1BCM A;  2PU9 B;  1VIE A;  5CKB A;  2RN8 A;  1K73 R;  4M78 A;  5L23 A;  4JS4 A;  2YHT A;  2ZPG B;  1QVF P;  4D8K A;  5IXB A;  1S72 Q;  1QWF A;  3CXC S;  1KD1 R;  3FIF A;  1OU8 A;  1R77 A;  4PJO C;  1AWW A;  1OZ3 A;  2A3L A;  4FIB A;  2JM8 A;  4BI4 A;  3L2R A;  2IG0 A;  3PE0 A;  1Q7Y R;  3TU4 K;  3CCE T;  1H8K A;  5DM7 R;  3RES A;  1QCO A;  4PKC C;  2GNC A;  1YNZ A;  2XK0 A;  1PWT A;  1PNJ A;  3C4S A;  4C92 E;  2J7I A;  2DL3 A;  4PJO D;  2PVO B;  2BZ8 A;  1PCX A;  2RM4 A;  2IPO B;  1KIK A;  4FYW B;  3RNJ A;  1VQ7 Q;  1ZBX A;  3GNG A;  2AT1 B;  3GOX A;  1KHI A;  2RK1 A;  1GCQ C;  3PTA A;  2DXT A;  4KGX B;  3MPU B;  1VQ6 Q;  4M78 G;  1CKB A;  3RBB B;  2HL5 C;  3G4S T;  3UF4 A;  1WLP B;  2YT6 A;  3M4G A;  4MML A;  5KYU B;  4B9X A;  3CC4 A;  1M8M A;  4IUP A;  1X6G A;  4X9D A;  2YDL A;  3CBO A;  2O9S A;  3NGP A;  1OX9 A;  5GAM e;  1BBZ A;  2QYZ A;  1Q81 R;  3IQL A;  3SD4 A;  1ABO A;  2F2X A;  2X51 A;  2F5T X;  1RAF B;  5GAN e;  3S3M A;  3QWX X;  1VQ4 T;  3CCR T;  2SEM A;  4LDY A;  4M78 D;  4XTW A;  5GAN 6;  1QCF A;  5CK9 A;  2NUZ A;  3QDF A;  3NFC A;  5FRO A;  2FB7 A;  2CDT A;  2RHZ A;  4M75 B;  1KQ2 A;  1AT1 B;  2DVE A;  1JJ2 A;  2WSC E;  4M78 C;  2MYS A;  4M7D D;  1PG5 B;  4M7A D;  4OB0 B;  2QAS A;  4ATO A;  4FL6 A;  5CKF A;  4JRP A;  2EVR A;  2F1L A;  2C06 A;  2RJC A;  4FU6 A;  4KT0 E;  3CCS T;  4OMP A;  1AZE A;  4L6V 5;  3QZ5 B;  3C94 A;  2DO3 A;  1M1K C;  2JUF A;  5LJ3 j;  3OS5 A;  4M7D C;  4HCC A;  3CMA Q;  1HXD A;  2G6F X;  4J9F A;  4M77 G;  3DB4 A;  1I1J A;  1IXD A;  1EFN A;  2E3I A;  2HBP A;  1M2V B;  2CT3 A;  1JRI A;  4XTX A;  3JRZ A;  2D9T A;  2JW4 A;  2X3W D;  2CKK A;  1GFC A;  1MMN A;  2QTX A;  1G3S A;  4DOW A;  4FYV B;  1KSW A;  1VQK Q;  4ORZ A;  3GF5 A;  1YI2 A;  1BIA A;  5CVI A;  4A4G A;  4M78 F;  3REB B;  5CKH A;  1M1K R;  3CXC A;  3OYD A;  1N9S A;  1G83 A;  3M0R A;  2RF0 A;  4BY6 C;  1K0X A;  1E6G A;  3M58 A;  4M4Z A;  4IUV A;  4B6M A;  1NPR A;  2CH4 W;  2K57 A;  3M0P A;  1H92 A;  2CUD A;  4J7F A;  1SSH A;  1NZ9 A;  5LJ5 g;  2DL4 A;  1UB4 A;  1EIF A;  3OYE A;  2V8K A;  3J80 E;  1OEB A;  4KH1 B;  4J9E A;  3X25 B;  3LH5 A;  4KRT A;  2KR3 A;  4C8Q G;  4AMC A;  3KXT A;  1OQK A;  4C92 G;  1WJR A;  4P5N A;  4N0A A;  4J6X A;  1MMD A;  2HZY A;  3HRT A;  1VIF A;  2RD1 A;  1TOV A;  4BAC A;  1VQ6 A;  4F14 A;  2KXD A;  2V26 A;  2L3P A;  4CRI A;  3UA7 A;  3SWN A;  3OMC A;  3JB9 H;  4OMQ A;  3MET A;  4X1V A;  1M5Q 1;  3BDU A;  4E7Z A;  3MEA A;  3RDV A;  3CCQ A;  4ESR A;  2LCS A;  2JS2 A;  2ZPF B;  5GAN 4;  4J9D A;  5J3B A;  3CPW P;  4LDU A;  3CCV Q;  4M7D F;  2JNG A;  2CRE A;  1LVK A;  4M77 F;  2ABL A;  4C92 B;  4DA4 A;  3OYF A;  2V8J A;  2XKO C;  1VQP T;  1BU1 A;  1M8V A;  1EX4 A;  4EMK A;  3M59 A;  2A0F B;  4KGZ B;  2MIO A;  4MZP A;  2DE0 X;  1G5V A;  1JU5 C;  1PKT A;  4HA8 A;  5GAO l;  2DXB A;  3JCM W;  3NTH A;  4A4K A;  1YHQ A;  4FCY A;  3WXM B;  2GBQ A;  4A4H A;  2YLC A;  4HCZ A;  4PJO F;  1AZG B;  1YI2 Q;  2E1H A;  3MP8 A;  4M78 B;  2DD5 A;  2CZ6 B;  3EGU A;  4JZ3 A;  4NL3 A;  3GPL A;  2HQH A;  2NUT B;  4DEX A;  1VQP Q;  2XID A;  3L2V A;  1D0Y A;  4GLK A;  1YWO A;  3RKY A;  1SG5 A;  2EJF A;  1GBQ A;  1YI2 T;  2OTL A;  1KHC A;  4M75 D;  2LC4 A;  2DA9 A;  2QTV A;  1VYU A;  1IGQ A;  4E7I A;  5HK3 A;  3JCM d;  3LH0 A;  1N6A A;  3MEW A;  3VS5 A;  3OYM A;  3D7S B;  1RAG B;  3EGD A;  3QPH A;  4ANJ A;  1NJI C;  3JCM f;  1VQK A;  3H6Z A;  2AZV A;  3CCM A;  2FO0 A;  3PVL A;  1N8R U;  1GFD A;  4FM4 B;  4M75 C;  1XTD A;  2XU8 A;  2FL7 A;  1PSE A;  2EFI A;  1SSF A;  2O4X A;  4A53 A;  4LDX A;  1IO6 A;  2EYW A;  2E65 A;  2EQM A;  3NPF A;  4F7U A;  4B9W A;  4C5G A;  4XK8 E;  4EMG A;  3HHT B;  4IUU A;  5GAM g;  3AHU A;  4XAX B;  2DER A;  2M0Y A;  1TUC A;  3L2U A;  1V29 B;  4J6W A;  2GFA A;  1YIT A;  4M7D G;  5FRM A;  2LP5 A;  4XQ3 A;  3CCS Q;  3NHN A;  5DLQ E;  2NYS A;  1M90 R;  1VQ4 A;  3G7Z A;  2P0Q A;  2KT8 A;  1N27 A;  2HNI A;  3VS4 A;  3E1S A;  8ATC B;  2D0N A;  2BUD A;  2F2V A;  2JN0 A;  2MF2 A;  2YLB A;  1WJS A;  2CH4 A;  1X27 A;  3PIO A;  4CC2 A;  3QWY A;  4M77 D;  2DKG A;  2C0T A;  2EWN A;  2D8H A;  1M3A A;  2CP7 A;  3DB3 A;  3CCQ Q;  3CEY A;  4BY6 B;  3ASK A;  4PJO G;  1I8F A;  3OBY A;  2FYK A;  4DBQ A;  1KJW A;  1YJW A;  3M54 A;  4M78 E;  1Y96 B;  1R0B G;  2IIM A;  2YXY A;  3A8L B;  4FSS A;  4JLI A;  1G3T A;  2BE7 D;  5GMK j;  2L5Q A;  1RAA B;  5CO7 A;  1K0S A;  3BW1 A;  4PJL A;  2OX7 A;  5GMK l;  4N0A C;  3UAT A;  1TH7 A;  4ZN3 A;  1KQS S;  4MZM A;  1JQQ A;  3UT1 A;  3CCJ Q;  1U1S A;  3HRU A;  4FSX A;  3QUI A;  1VQ6 T;  4MDW A;  3CMA A;  5A0D A;  2BIV A;  2RHI A;  4ME7 A;  5GAN j;  2OAU A;  4M77 A;  4LXC A;  2DTH A;  3RER A;  2VGN A;  2ED0 A;  2CP3 A;  1GCP A;  4QT7 A;  1NJI U;  1D0X A;  2DEQ A;  5GAN 3;  1ZA2 B;  3SHW A;  5I11 A;  3JCM h;  3CCU A;  1W70 A;  1CSK A;  2GCX A;  1VQL T;  2Y4X A;  3C12 A;  1VQN A;  1UGR B;  4C0D C;  3QII A;  1QQJ A;  3OYL A;  3ZEH A;  1JEG A;  1YCY A;  2E70 A;  5LJ3 e;  1X43 A;  2D1X A;  1OZ2 A;  2GFU A;  3BE3 A;  1WHG A;  2QGF B;  3G6E Q;  1RAI B;  2FG0 A;  1PM3 A;  2DZC A;  4PLL A;  4IKF A;  4BUG A;  1U5S A;  3CBM A;  2QQR A;  3EH2 A;  1Q86 R;  1VQ5 A;  1VQ8 Q;  2GQV A;  3LWH A;  2VXF A;  2CUB A;  2HDA A;  4JDS A;  2FZK B;  3VUB A;  4AG2 C;  5LJ5 e;  1VQL Q;  1M9S A;  5KYX B;  1YIJ Q;  4F17 A;  1PD0 A;  3OSV A;  4J9B A;  1ABQ A;  5KYU A;  3EGD B;  3VS3 A;  4RG2 A;  3LGL A;  1SHF A;  2EGA A;  1VQ8 A;  3HTR A;  5KE3 A;  1VQ7 A;  1N8R R;  4F7U G;  1RAE B;  2ZAE A;  5KYY A;  4HT8 A;  3OQ5 A;  1VOM A;  3EG1 A;  5A0L A;  1JB0 E;  4M7D A;  1UFF A;  1P92 A;  1N9R A;  3L42 A;  3RKX A;  3H9N A;  3SFM A;  4C0G A;  5GMK e;  2ZCF B;  1Q81 U;  1V1C A;  4WF2 A;  1B07 A;  4PFO A;  5ECA A;  3TQ7 P;  1NYG A;  5LJ3 d;  3JB9 D;  2PUO B;  4KBM B;  3JCM Q;  5IT9 E;  1KFZ A;  3PNW C;  4HVV A;  3OYK A;  1U8R A;  2DZ9 A;  1D3B B;  2KVQ G;  5I22 A;  4M7A C;  1YJW Q;  3LX7 A;  4Z89 A;  2D8J A;  5CKD A;  3OYC A;  4L5G A;  3CCE Q;  4OMO A;  2RQT A;  1K9A A;  3PVQ A;  1BI2 A;  1KK7 A;  4BDZ A;  3PMT A;  3BDL A;  1K9M C;  4IUR A;  2E3H A;  4KGV B;  1Q7Y U;  4E7K A;  2OAW A;  2VUB A;  4XTY A;  2KE9 A;  1YJ9 T;  5GJV B;  1SKU B;  5FW9 A;  2COY A;  2P4T A;  4OMF B;  1KC8 U;  5CR2 A;  2LX7 A;  3OS1 A;  2L3R A;  1HJD A;  3VS2 A;  4EIK A;  2O01 E;  1ACM B;  3R6O A;  3L2Q A;  4M75 F;  1RAC B;  1K73 U;  5GAN 8;  3INZ A;  5FWC A;  5CAI A;  2FRY A;  2YWW A;  1W4S A;  2MWP A;  2G3R A;  2B8A A;  4XTU A;  3CC2 T;  1ZA1 B;  1PD1 A;  2RA2 A;  3T9N A;  1SRM A;  3SWN C;  3MEV A;  2X4J A;  3EG0 A;  4LD6 A;  2M51 A;  1W2B S;  2ATC B;  1MUZ A;  2YRC A;  3FB9 A;  3CD6 T;  2KEA A;  2AIR B;  4C0D B;  4OGC A;  1MMG A;  4JLG A;  2V1R A;  1UHF A;  4JJC A;  2H3E B;  2K7A A;  2BZY A;  2F2W A;  5GAM d;  2Y90 A;  2NUP A;  1G3Y A;  4LN2 A;  2GTO A;  3M0Q A;  1MND A;  1TS9 A;  3TEE A;  3ER0 A;  2BTT A;  2DJQ A;  3PGG A;  4IUQ A;  5M9O A;  4E7L A;  1K8A R;  1Q82 C;  3E2U A;  2LZ6 B;  4GY5 A;  2OTL Q;  3H0I A;  1WHJ A;  1UEC A;  5CIU A;  5GAN g;  2QI2 A;  2VV5 A;  5HK0 A;  1IGU A;  1JJ2 P;  4ZGE B;  2EQU A;  2K4Y A;  3UWN A;  3A8M B;  3JCM c;  4UC4 A;  2DRM A;  2PNI A;  1M90 U;  1B34 B;  3M56 A;  3GLX A;  4RTV A;  1FWZ A;  1Y57 A;  3JCM e;  3VRZ A;  2DX1 A;  1UE9 A;  2DD4 A;  2R5A A;  1YJN Q;  3URG A;  1VQ5 T;  2DK3 A;  4OMM A;  1M1K U;  2KNB B;  2LCC A;  1M3C A;  3A8H B;  2F5K A;  3OBW A;  2RMO A;  2OTJ A;  2E5Q A;  2K2M A;  1I81 A;  2GF7 A;  3RMQ A;  5C0M A;  1VQ9 Q;  3M0U A;  2DL8 A;  6AT1 B;  4OB2 B;  1IHW A;  2QEX A;  3HKS A;  3CCR A;  2HCK A;  1M2O A;  1TUD A;  4HKE A;  2XDD A;  2YUN A;  4HCK A;  3G71 A;  3THK A;  3HPW A;  1RAH B;  1YN8 A;  4OML A;  2I0N A;  2MMP A;  4PJO E;  2PZ1 A;  3OS0 A;  1D0Z A;  1M27 C;  3CME Q;  3A8O B;  2O2O A;  1JXM A;  3OY9 A;  2DFU A;  4C92 A;  2RO0 A;  3GNF B;  1KQ1 A;  3X20 B;  1DJ7 B;  4Z02 A;  3LGF A;  3HSB A;  1WQW A;  4II1 A;  4DEY A;  2DYB A;  2FHD A;  5FLX E;  4PJO B;  2K3X A;  2ZGW A;  3CC7 A;  5IXF A;  2JMA A;  3NTI A;  3A8G B;  2XHC A;  2L89 A;  2VAS A;  1RUW A;  1M1G A;  1Y7X A;  2JMC A;  3CCL T;  2RI2 A;  1OPK A;  4RTZ A;  1I4K 1;  1QKX A;  4HXJ A;  3VS0 A;  1SPK A;  2AKL A;  3RKW A;  4RCC A;  4J7I A;  3V8K A;  3CCL Q;  3PIP A;  2COW A;  2RJE A;  1YJ9 Q;  1UGQ B;  3UA6 A;  5KCH A;  1PRL C;  2EPD A;  4MDX A;  1TTH B;  4PJJ A;  3MCA B;  2EQI A;  2VXE A;  1SHG A;  2LNH B;  1I5L A;  2JZ2 A;  3OYA A;  2AHJ B;  4M77 C;  1E6H A;  4LD9 K;  1GCQ A;  1AEY A;  1WIE A;  3M5A A;  3EAE A;  2LNV A;  1FX7 A;  1C6V X;  2LQW A;  1VQP A;  2DAQ A;  1KD1 U;  1ZSZ A;  2ECZ A;  3CD6 A;  2QQB A;  2XDB A;  1WPY A;  2HAX A;  1R0C B;  2DIQ A;  7AT1 B;  2HKN A;  5HKC A;  1LJO A;  4M7A B;  3OS2 A;  1UGV A;  2LQK A;  2V1Q A;  2ROL A;  2ESW A;  2NLU A;  2KY9 A;  3CCR Q;  2DET A;  4OMN A;  1BI0 A;  5IH2 A;  1ZSG A;  3CME T;  3M0S A;  1AWO A;  1RI0 A;  2DF6 A;  1K9M R;  3L2W A;  2KAF A;  4FW1 A;  1XJW B;  1YWP A;  2LQN A;  2FZC B;  5LJ3 f;  2M02 A;  2DPP B;  2OI3 A;  4M75 A;  3HFO A;  3V8J A;  2EQK A;  1RLP C;  4JJB A;  1QP3 A;  4PJN A;  4RKU E;  4E7S A;  3C0C A;  2RNA A;  2QDY B;  1Z9Z A;  2V8I A;  1D1A A;  5DY9 A;  5GAO q;  1VQ5 Q;  2RH2 A;  2A37 A;  2CSI A;  3LWI A;  2RQU A;  3S3O A;  1UDL A;  5L8R E;  1JO8 A;  5CKE A;  1ZUK A;  1O75 A;  3R6N A;  3REA B;  2AK5 A;  2DIG A;  4OB3 B;  5D6Y A;  3MP1 A;  3DLL A;  1WXU A;  3M53 A;  5LJ5 d;  1K8A U;  1WHK A;  2CS7 A;  2FVU A;  3O8V A;  5GAN 2;  2VYT A;  2DTO A;  2X35 A;  4BB7 A;  3HL8 A;  1N8R C;  2L3Q A;  4RTU A;  1NBE B;  4OGE A;  5C6S A;  5FU6 B;  4J5Y A;  5HY6 A;  4JPB W;  1BK2 A;  3VUZ A;  2DTI A;  2K2V A;  2MK5 A;  1QWE A;  4DBH A;  1QLY A;  2BE9 B;  2LT4 A;  1ARK A;  4PJO A;  2EAY A;  4J9H A;  4CC4 B;  1BKB A;  3ZBD A;  4TVR A;  3CCL A;  1PC0 A;  3OYY A;  1X2K A;  2FZG B;  4F7U E;  4M7A E;  2ED1 A;  4C92 C;  3CCV A;  1D1B A;  3EFO B;  4QVC A;  2GTJ A;  2RHU A;  1H3H A;  1U06 A;  2DM1 A;  2RQV A;  2L8D A;  4R55 A;  1VYV A;  2O4X B;  3MO8 A;  1BCO A;  3CCE A;  2RQW A;  2P0P A;  4NS5 A;  2RQR A;  4M7A A;  1RLQ C;  3TSW A;  3CQT A;  4C92 D;  4PK4 A;  2FPD A;  4Y28 E;  3P8H A;  1CKA A;  2C0I A;  3CCJ A;  2CYZ B;  5KYN A;  3JV3 A;  4EMK C;  3NMZ C;  1ZHI A;  2X4X A;  4XU2 A;  1U1T A;  2O88 A;  5LL6 S;  4O6J A;  1T3L A;  1UTI A;  5KYW A;  3RMS A;  1XNI A;  1FMW A;  3F70 A;  4AFQ C;  3EHQ A;  1M2V A;  4EMH A;  4MMK A;  2HL3 A;  1S72 A;  1BIB A;  2WAC A;  1WGS A;  1WXB A;  2A7Y A;  4IIM A;  2EIF A;  4D8D A;  3SB2 A;  5GAN f;  3I55 A;  2OTJ Q;  3OYG A;  1WI7 A;  1WNL A;  2XI9 A;  2PVD B;  1NPP A;  4M7A G;  1RAB B;  1AOJ A;  2E41 A;  4N4I A;  4J9C A;  2E10 A;  3S6W A;  2QA4 Q;  3C95 A;  5CCA A;  1GXI E;  2E6N A;  1JBM A;  2JS0 A;  3X28 B;  1X6O A;  4CC3 A;  3DKM A;  1X75 C;  3G6E A;  2AKK A;  4WTO B;  3OYN A;  1VQ4 Q;  2EYY A;  4RTX A;  4Z88 A;  2D6F A;  1QW1 A;  2YRD A;  4R0K A;  2FEI A;  2D0Q B;  5GAO r;  1IB8 A;  1UJ0 A;  1QVF A;  4JUV A;  2LVM A;  4Y91 A;  1YIT Q;  2DVJ A;  2E4H A;  3KUF A;  5FU7 C;  2KQW A;  1M90 C;  1MV0 B;  5LJ5 j;  3E19 A;  4CC7 A;  5LJ3 h;  2LJ1 A;  3RUX A;  2LX9 A;  1WFW A;  5GAO p;  1WX6 A;  1YJ9 A;  3Q1J A;  1VQM A;  3QBY A;  1VUB A;  2F69 A;  1W2B P;  2EJ9 A;  4KUI A;  4MZT A;  3FJP A;  2K6D A;  5LJ5 h;  1Q95 G;  5AT1 B;  2J6O A;  2E64 A;  2KXC A;  1RL2 A;  5GJW B;  3JCM J;  3JCM g;  5AYF A;  4M77 B;  1E7O A;  1G2B A;  2Z0W A;  4C5E A;  3QJ6 A;  1GRI A;  5KE2 A;  1M1F A;  4F7U B;  1A0N B;  3H41 A;  1OPL A;  3EG9 B;  3FEO A;  4O5V A;  4BE1 A;  2YUO A;  1JXO A;  3KBG A;  4J83 A;  1KQS A;  4Y92 A;  3G1J A;  5D6W A;  4YTL A;  3CPW S;  4C0Z A;  2K5L A;  1MNE A;  3QKJ A;  4OF1 A;  1SF9 A;  1VQO A;  1NE8 A;  1B34 A;  1K76 A;  2X4Y A;  1TU0 B;  4M7A F;  2C0O A;  4ZN1 A;  3OW2 P;  1Y0M A;  3JCM X;  4QQ6 A;  1K73 C;  4ELZ C;  3OA6 A;  1ZBJ A;  1WJQ A;  4XU3 A;  4J9G A;  2OJ2 A;  2OTL T;  2P0K A;  3GP8 A;  3J7A F;  2KDS A;  2RI3 A;  1U3O A;  2NUT A;  3JB9 G;  1IZ6 A;  4BI8 B;  4JS5 A;  3VYH B;  3EGX A;  4HVU A;  1H64 1;  3HP9 A;  1GBR A;  2KGT A;  1S1N A;  3X26 B;  4LDW A;  2JJ9 A;  4F7U F;  3ULR B;  1Q82 R;  1X69 A;  2KT1 A;  4A4F A;  3QYH B;  1KG1 A;  2RJF A;  2LRQ A;  3DLM A;  2YUP A;  1X2Q A;  3JSC A;  3OYH A;  3OW2 S;  4V2S A;  4ZTJ A;  1WYX A;  2O9V A;  3GBQ A;  2XDP A;  1OOT A;  2DL7 A;  2K3Y A;  1FMV A;  1VQM T;  1OX8 A;  3CC7 Q;  1Q82 U;  2LJ0 A;  2QK0 A;  4LUE A;  2JXB A;  1OV3 A;  3L2Z A;  1AD5 A;  1S72 T;  4AFZ C;  4M77 E;  2JTM A;  4A63 B;  2M1H A;  2QDL A;  1OI1 A;  2CP6 A;  3QZ9 B;  4EPC A;  2PUK B;  1UHC A;  2GQI A;  4NOY A;  4RCB A;  1D1C A;  2K3B A;  1LCK A;  3PMI A;  4M7D B;  1UGS B;  4E2F B;  3M55 A;  3EFS A;  1SRL A;  4BD3 A;  1WA7 A;  1VQK T;  3CCQ T;  4IUT A;  3TVT A;  1MGQ A;  3OW2 A;  2KYM A;  5CQY A;  4RTY A;  4ZTF A;  4C8Q B;  5GAM h;  2DXU A;  4RTW A;  2LTO A;  4X34 A;  1B3Q A;  2QQ9 A;  2O31 A;  3JCM V;  3H0H A;  3I55 T;  1EZZ B;  2I2L A;  2DEU A;  1UEB A;  3G6E T;  4RTT A;  2QXF A;  3UDC A;  4JJN K;  2RI5 A;  2VWF A;  3EG3 A;  3EG2 A;  3QO3 A;  1PRM C;  1YHQ Q;  1FXX A;  4IIO A;  3MEU A;  2CT4 A;  2YRV A;  2EW3 A;  4EMK B;  1HD3 A;  3I56 T;  3P8D A;  4LE9 A;  1YHQ T;  2ENM A;  2AZS A;  2HD0 A;  1W6X A;  2E12 A;  2SRC A;  2QGG A;  3VS1 A;  2A28 A;  3BY7 A;  3V8L A;  1NLO C;  1Y71 A;  5KYY B;  1QVG P;  1D09 B;  1NEG A;  2DL5 A;  3HRS A;  4AFU C;  3UPU A;  2JM9 A;  2MCN A;  2WSE E;  4C0F A;  3M57 A;  3ME9 A;  4GBQ A;  3HFN A;  1C0M A;  2VKN A;  3FJ5 A;  4AFS C;  1QVG A;  4LDV A;  4PFP A;  3JCM b;  5GAN h;  2JT4 A;  2L2P A;  1WHL A;  2HQE A;  4OP0 A;  5LJ3 g;  1VA7 A;  3CBP A;  3OYI A;  4JRQ A;  3MJX A;  2VB6 A;  1SEM A;  2RJD A;  1WHH A;  3EFO A;  1VYT A;  1HYO A;  2YSQ A;  5GMK h;  3CCS A;  2CSQ A;  2EBP A;  3FC3 A;  2W10 A;  1ZSZ B;  3OSS C;  1H3Z A;  2LQ8 A;  2JOY A;  3QG1 A;  1M3B A;  4XU0 A;  4DBR A;  4PNO A;  5GAM f;  1KQS P;  4BE0 A;  4Z8A A;  2RHX A;  4QKU A;  4C8Q F;  3CCU T;  5D6X A;  1T3S A;  1YIJ T;  4FT2 A;  2X9H A;  4E7J A;  1RI9 A;  2EYX A;  4C92 F;  1I07 A;  3PT9 A;  2DJZ A;  1M30 A;  3EH1 A;  1K4U S;  4C5I A;  1K1Z A;  4PJM A;  1LOJ A;  1UG1 A;  5IN1 A;  4QW2 A;  4E6R A;  3G4S A;  1VQ9 A;  5IAY A;  3KFV A;  1QP2 A;  3BFM A;  4ELY C;  1ZQ1 A;  1NG2 A;  3I56 A;  4DBF A;  2R58 A;  4FYY B;  5GMK m;  3CMA T;  4PFZ A;  3VS6 A;  1KD1 C;  2PVG B;  4M75 E;  2M9U A;  2DMO A;  2L0A A;  4QQG A;  1T0J A;  3CME A;  4JJD A;  2Y4Y A;  4C8Q C;  4BI3 A;  3EG9 A;  2EKH A;  1ZUY A;  4GLM A;  4CI0 C;  3VU3 C;  2RK2 A;  4A4E A;  1IRE B;  2QA4 A;  2DBK A;  2XMF A;  3VJP A;  3M0T A;  4OVA A;  3TCJ A;  5EG2 A;  3VYG A;  3EFR A;  1OU9 A;  3CCV T;  3OYB A;  3CCU Q;  4C8Q D;  2KRN A;  3S3N A;  2CP5 A;  2H8H A;  3MKD A;  1VQN T;  3VRY A;  3SEM A;  1I5O B;  2HSE B;  3I35 A;  4J9I A;  1YJN A;  2B86 A;  2DNU A;  3CC4 Q;  2J06 A;  2KSS A;  4QQD A;  5HCK A;  3ZFJ A;  4NL2 A;  1VQN Q;  1G3W A;  2JVV A;  5J39 A;  3L1A A;  4KUL A;  4WCI A;  2CP0 A;  1FMK A;  1GL5 A;  4PL6 A;  3LW5 E;  2BZX A;  1K8A C;  1IHV A;  3H8Z A;  2K5F A;  1Z9Q A;  1FYN A;  5A2Q E;  2NUP B;  4C5H A;  5GAO m;  1LPL A;  1UUE A;  2DLP A;  2VVK A;  3I55 Q;  1NYF A;  2CZ7 B;  1WHM A;  5EC7 A;  4J8O A;  3LYI A;  2R57 A;  1QVF S;  1AWJ A;  2M0O A;  4HCB A;  3M9Q A;  4VUB A;  2KYB A;  3CCJ T;  5KH6 A;  2KI7 A;  2DBM A;  4OB1 B;  2P84 A;  2L3S A;  2EKO A;  3MHX A;  2HMA A;  2ZPE B;  2BKD N;  2IVW A;  1Q86 U;  3FDR A;  2XIC A;  2RHY A;  3AT1 B;  4KH0 B;  2COZ A;  4JRI A;  2EYQ A;  2K79 A;  1KC8 R;  3EHR A;  1YBY A;  2LDM A;  3CCM T;  4JRK A;  2LT1 A;  2WSF E;  2LMJ A;  1WDX A;  1XQH A;  2LCL A;  1OUL A;  2CZ0 B;  1ZX6 A;  3RR6 A;  4N4H A;  3QYG B;  5IHN A;  5GAN 7;  3V7C A;  3NTK A;  3JB9 J;  4DQ2 A;  1TUG B;  2CGH A;  2CZ1 B;  1ZUU A;  4ZNX A;  1M4Z A;  2OTJ T;  3MP6 A;  5FU6 C;  1D3B A;  1QMC A;  4D6W A;  2J05 A;  4FYX B;  4ZGD B;  5GAN d;  4K11 A;  2MOX A;  2KRO A;  3G71 T;  2EYZ A;  2FPE A;  1W1F A;  1O9S A;  3G71 Q;  3WVE B;  1RAD B;  3PFS A;  3QJY A;  1B7T A;  2K5I A;  4M7D E;  3J81 E;  2DRK A;  3E9G A;  1NEB A;  2X4W A;  2QA4 T;  1YJN T;  2VGM A;  4F16 A; 
#chains in the Genus database with same CATH homology
 5D6W A;  4C92 G;  4RMO A;  4E7L A;  2E6Z A;  4YTL A;  1WJR A;  4P5N A;  4N0A A;  3CPW S;  4C0Z A;  2K5L A;  1Q82 C;  4J6X A;  3HRT A;  3QKJ A;  4OF1 A;  1VQO A;  1VIF A;  1NE8 A;  1B34 A;  2X4Y A;  4GY5 A;  2RD1 A;  3V7S A;  4BAC A;  4ZN1 A;  4M7A F;  1VQ6 A;  3JCM X;  4QQ6 A;  3LLR A;  5CIU A;  5GAN g;  2QI2 A;  2VV5 A;  5HK0 A;  3QSU A;  4CRI A;  1K73 C;  4ELZ C;  3OA6 A;  3QHS A;  1WJQ A;  4ZGE B;  4XU3 A;  2EQU A;  3OMC A;  2K4Y A;  3SWN A;  3GIB A;  3JB9 H;  3UWN A;  1R8O B;  3MET A;  1XOV A;  3A8M B;  5FRN A;  1Y96 A;  1M5Q 1;  3JCM c;  3BDU A;  4UC4 A;  1WQ7 A;  3MEA A;  1M90 U;  1B34 B;  5J26 A;  3CCQ A;  2OTL T;  3CC2 A;  2P0K A;  3M56 A;  5GAN 4;  2ZPF B;  3GLX A;  2ZPI B;  3GP8 A;  2KDS A;  1VQ9 T;  3J7A F;  1FWZ A;  2RI3 A;  5J3B A;  1MHN A;  3N5B B;  4LDU A;  3JCM e;  3CC7 T;  3JB9 G;  4M7D F;  1IZ6 A;  2JNG A;  4BI8 B;  2DD4 A;  4JS5 A;  2R5A A;  4M77 F;  3URG A;  4C92 B;  1VQ5 T;  2DK3 A;  1M1K U;  2LCC A;  4X9C A;  4PLI A;  3VYH B;  1JJ2 S;  1H64 1;  3OYF A;  4DA4 A;  3A8H B;  5GAO n;  4BDY A;  2V8J A;  2F5K A;  2XKO C;  3HP9 A;  1YIT T;  1VQP T;  1M8V A;  3OBW A;  4EMK A;  3X26 B;  2OTJ A;  4LDW A;  2E5Q A;  3M59 A;  5CQX A;  1I81 A;  2GF7 A;  3RIR A;  4DOV A;  4F7U F;  3RMQ A;  5DLO A;  3JCM P;  4RG8 A;  4MZP A;  5C0M A;  2RB6 A;  1W2B A;  4OB2 B;  2QEX A;  1G5V A;  4E47 A;  2KK4 A;  4A4F A;  1Y07 A;  3QYH B;  3HKS A;  2RJF A;  3CCR A;  1KG1 A;  2LRQ A;  2JTF A;  3DLM A;  4HA8 A;  5GAO l;  3JSC A;  4HKE A;  2DXB A;  3OYH A;  2XDD A;  3NTH A;  2MWO A;  3OW2 S;  4A4K A;  3JCM W;  4ZTJ A;  3G71 A;  1YHQ A;  4V2S A;  3SDZ A;  3HPW A;  1AHJ B;  3WXM B;  2H3J A;  2XDP A;  4XTV A;  2MMP A;  4A4H A;  2YLC A;  4PJO E;  2K3Y A;  4HCZ A;  3OS0 A;  1VQM T;  4PJO F;  1YIJ A;  1X01 A;  2QQA A;  2E1H A;  3MP8 A;  4M78 B;  2DD5 A;  1Q82 U;  3A5Z B;  3A8O B;  2CZ6 B;  3M4Y A;  1HK9 A;  3L2Z A;  3OY9 A;  1S72 T;  2XD0 A;  4NL3 A;  5I2S A;  4C92 A;  2RO0 A;  3GNF B;  4M77 E;  1KQ1 A;  2JTM A;  2M1H A;  2QQS A;  3VKI A;  3GPL A;  3X20 B;  1DJ7 B;  1OI1 A;  4EDU A;  4Z02 A;  2KMT A;  2XID A;  4XU1 A;  3QZ9 B;  4GLK A;  4EPC A;  3L2V A;  3LGF A;  3RKY A;  2PUK B;  3HSB A;  2EJF A;  2OTL A;  1WQW A;  1YI2 T;  1KHC A;  4NOY A;  5GAM j;  4M75 D;  4II1 A;  4RCB A;  1VQO T;  2LC4 A;  3CC4 T;  2MI6 A;  3PMI A;  2FHD A;  2EJG A;  5FLX E;  2K3X A;  2ZGW A;  3CC7 A;  4PJO B;  1BI3 A;  4E7I A;  5HK3 A;  4M7D B;  5GAN 5;  3JCM d;  1UGS B;  3M55 A;  3LH0 A;  1N6A A;  3EFS A;  3MEW A;  3V7R A;  3NTI A;  3OYM A;  3A8G B;  2XHC A;  4BD3 A;  3JB9 I;  3QPH A;  1NJI C;  2L89 A;  4C8Q E;  1VQK T;  3CCQ T;  4IUT A;  3JCM f;  3E9F A;  1VQK A;  1MGQ A;  3OW2 A;  3H6Z A;  1M1G A;  1Y7X A;  5GMK i;  5CQY A;  3CCL T;  2RI2 A;  3CCM A;  4ZTF A;  2ZPH B;  3OB9 A;  1N8R U;  4C8Q B;  4FM4 B;  2M16 A;  5GAM h;  4M75 C;  3WVD B;  1XTD A;  2DXU A;  1I4K 1;  2LTO A;  2FL7 A;  2QQ9 A;  1PSE A;  2EFI A;  2XU8 A;  4X34 A;  3JCM V;  3I55 T;  1SSF A;  2O4X A;  2I2L A;  4A53 A;  4ZGJ B;  2MAM A;  4LDX A;  1UEB A;  3RKW A;  5A0G A;  2E65 A;  4RCC A;  3TRE A;  4J7I A;  3G6E T;  2EQM A;  2QXF A;  2PQW A;  3V8K A;  3PIP A;  2RJE A;  4B9W A;  4C5G A;  3UDC A;  4F7U A;  4JJN K;  1UGQ B;  2RI5 A;  2DXC A;  4XK8 E;  4EMG A;  5KCH A;  3HHT B;  4IUU A;  4Q5W A;  5GAM g;  3AHU A;  4XAX B;  3QO3 A;  4MDX A;  3MCA B;  3L2U A;  1V29 B;  1PSF A;  1FXX A;  4J6W A;  2GFA A;  1YIT A;  2VXE A;  3MEU A;  3CPW A;  4M7D G;  5I2M A;  5FRM A;  1I5L A;  4XQ3 A;  2JZ2 A;  3OYA A;  2YRV A;  2QEX T;  4EMK B;  1VQL A;  2AHJ B;  4M77 C;  5DLQ E;  4LD9 K;  3I56 T;  3P8D A;  1VQ4 A;  3G7Z A;  2P0Q A;  1YHQ T;  3M5A A;  1N27 A;  2HNI A;  2LNV A;  3EAE A;  1FX7 A;  5KCO A;  1KC8 C;  3E1S A;  1VQP A;  2ZPB B;  2DAQ A;  4C8Q A;  4BE2 A;  2HD0 A;  1KD1 U;  3CD6 A;  2BUD A;  2YLB A;  2JN0 A;  2MF2 A;  2E12 A;  2QQB A;  1WJS A;  2XDB A;  1WPY A;  2HAX A;  3PIO A;  2DIQ A;  3QDR B;  4M77 D;  2DKG A;  1QVP A;  3BY7 A;  3V8L A;  5HKC A;  1LJO A;  4QVD A;  1Y71 A;  4M75 G;  4M7A B;  3OS2 A;  2LQK A;  2EWN A;  5I21 A;  4HT9 A;  4E7H A;  3HRS A;  3DB3 A;  3UPU A;  5LJ5 f;  2NLU A;  3CEY A;  2WSE E;  4BY6 B;  4QVZ A;  3ASK A;  4PJO G;  2KY9 A;  1I8F A;  3VV0 A;  4C0F A;  3OBY A;  2FYK A;  3M57 A;  3SWN B;  1Q81 C;  3FRN A;  4A54 A;  1QVG S;  1BI0 A;  1VQ7 T;  3ME9 A;  1YJW A;  3M54 A;  3HFN A;  3OMG A;  1Y96 B;  1RI0 A;  4M78 E;  4R56 A;  3CME T;  2VC8 A;  1QVG A;  1VQ8 T;  4LDV A;  3A8L B;  4JLI A;  1G3T A;  3L2W A;  2KAF A;  3JCM b;  5GMK j;  5GAN h;  2L5Q A;  5CO7 A;  3X24 B;  3QXE B;  3BW1 A;  5LJ3 f;  2HQE A;  5GMK l;  4N0A C;  1TH7 A;  1UGP B;  2DPP B;  4M75 A;  4OP0 A;  4ZN3 A;  5LJ3 g;  1KQS S;  4MZM A;  3CBP A;  3OYI A;  4JRQ A;  3HFO A;  3UT1 A;  3V8J A;  2EQK A;  1U1S A;  3HRU A;  1BI1 A;  2XG8 D;  4FSX A;  1BYM A;  3QUI A;  1VQ6 T;  4MDW A;  3CMA A;  5A0D A;  1QP3 A;  2RJD A;  3P8B B;  4N4G A;  4RKU E;  2BIV A;  2RHI A;  4L59 A;  4ME7 A;  2R5M A;  5GMK h;  3CCS A;  5GAN j;  3FC3 A;  2QDY B;  2OAU A;  2V8I A;  4M77 A;  2DTH A;  3RER A;  2VGN A;  5DY9 A;  3OSS C;  5GAO q;  1K9M U;  1OYX A;  5FU7 B;  2RH2 A;  4XTZ A;  3OYJ A;  1H3Z A;  3LWI A;  2LQ8 A;  2JOY A;  3S3O A;  3QG1 A;  1NJI U;  4XU0 A;  4PNO A;  2DEQ A;  5L8R E;  5GAM f;  5CKE A;  1O75 A;  3CPF A;  4J6Y A;  1LNX A;  1YJW T;  2HQX A;  5GAN 3;  4BE0 A;  2DIG A;  2RHX A;  3CCU A;  4FT4 A;  4OB3 B;  5D6Y A;  3JCM h;  4C8Q F;  3CCU T;  5D6X A;  2GCX A;  3MP1 A;  3JAM E;  3DLL A;  3M53 A;  5LJ5 d;  1YIJ T;  1Q7Y C;  1VQL T;  2EQJ A;  2Y4X A;  1K8A U;  4FT2 A;  4KUD K;  3C12 A;  2CS7 A;  4E7J A;  2FVU A;  3O8V A;  5GAN 2;  2VYT A;  2DTO A;  1VQN A;  2X35 A;  1UGR B;  4BB7 A;  3FLG A;  4C0D C;  3HL8 A;  4C92 F;  2ZZD A;  1N8R C;  3JB9 F;  3PT9 A;  3QII A;  2DJZ A;  2PU9 B;  1VIE A;  5CKB A;  3OYL A;  3ZEH A;  4OGE A;  5C6S A;  4M78 A;  5FU6 B;  4JS4 A;  2YHT A;  2ZPG B;  4J5Y A;  5HY6 A;  4C5I A;  1YCY A;  3VUZ A;  2DTI A;  2E70 A;  1LOJ A;  5IN1 A;  2K2V A;  4QW2 A;  5LJ3 e;  3G4S A;  1VQ9 A;  5IAY A;  1OZ2 A;  2GFU A;  2LT4 A;  4PJO A;  2EAY A;  3CXC S;  1QP2 A;  3BFM A;  3FIF A;  4ELY C;  1BKB A;  1ZQ1 A;  3I56 A;  2DZC A;  4PLL A;  4PJO C;  1OZ3 A;  3ZBD A;  2A3L A;  4IKF A;  2R58 A;  4TVR A;  4BUG A;  3CCL A;  3CBM A;  4FIB A;  2QQR A;  5GMK m;  4BI4 A;  1VQ5 A;  3CMA T;  2GQV A;  2IG0 A;  3LWH A;  2VXF A;  3L2R A;  4JDS A;  3TU4 K;  3CCE T;  1KD1 C;  3VUB A;  2PVG B;  3OYY A;  4M75 E;  2M9U A;  4F7U E;  5DM7 R;  3RES A;  4M7A E;  4PKC C;  4QQG A;  4C92 C;  5LJ5 e;  1M9S A;  3CME A;  3CCV A;  2XK0 A;  2Y4Y A;  3OSV A;  3C4S A;  4C8Q C;  4QVC A;  2RHU A;  4BI3 A;  4C92 E;  4CI0 C;  2L8D A;  4R55 A;  3VU3 C;  2RK2 A;  4A4E A;  4PJO D;  1IRE B;  2PVO B;  4RG2 A;  2QA4 A;  3LGL A;  2O4X B;  3MO8 A;  2RM4 A;  3CCE A;  1VQ8 A;  2P0P A;  3VJP A;  4NS5 A;  5KE3 A;  4OVA A;  1VQ7 A;  1ZBX A;  3GNG A;  4F7U G;  3TCJ A;  3GOX A;  5EG2 A;  1KHI A;  3VYG A;  2RK1 A;  4M7A A;  4HT8 A;  4C92 D;  3OQ5 A;  3EFR A;  3PTA A;  2DXT A;  5A0L A;  3CCV T;  3OYB A;  1JB0 E;  4M78 G;  4Y28 E;  4C8Q D;  3S3N A;  3P8H A;  4M7D A;  3G4S T;  1P92 A;  1N9R A;  1VQN T;  3CCJ A;  2CYZ B;  3L42 A;  3RKX A;  5GMK e;  3SFM A;  4C0G A;  2ZCF B;  1Q81 U;  4EMK C;  3M4G A;  4MML A;  1YJN A;  4WF2 A;  1ZHI A;  4B9X A;  3CC4 A;  2KSS A;  2X4X A;  4XU2 A;  4IUP A;  4X9D A;  4QQD A;  1KQS A;  1U1T A;  3CBO A;  5LL6 S;  3ZFJ A;  4O6J A;  4NL2 A;  5GAM e;  3RMS A;  5LJ3 d;  3JB9 D;  1G3W A;  2PUO B;  4KBM B;  2JVV A;  3JCM Q;  1XNI A;  5J39 A;  5IT9 E;  3L1A A;  3F70 A;  4KUL A;  3PNW C;  4PL6 A;  3LW5 E;  3SD4 A;  2F5T X;  5GAN e;  3S3M A;  4EMH A;  1VQ4 T;  4MMK A;  3OYK A;  1U8R A;  2DZ9 A;  1S72 A;  1BIB A;  1K8A C;  2WAC A;  3CCR T;  3H8Z A;  2K5F A;  1D3B B;  2KVQ G;  4LDY A;  4M78 D;  1WGS A;  5A2Q E;  4M7A C;  2A7Y A;  4XTW A;  3LX7 A;  4C5H A;  5GAN 6;  5CKD A;  5CK9 A;  5GAO m;  3OYC A;  4L5G A;  2EIF A;  3NFC A;  3SB2 A;  5GAN f;  3I55 A;  2CZ7 B;  1BI2 A;  3OYG A;  1WNL A;  5FRO A;  4BDZ A;  3PMT A;  2XI9 A;  3BDL A;  2PVD B;  2FB7 A;  3LYI A;  4IUR A;  4J8O A;  2R57 A;  1K9M C;  1QVF S;  2RHZ A;  2M0O A;  1NPP A;  1Q7Y U;  4M75 B;  4E7K A;  2VUB A;  4XTY A;  4HCB A;  3M9Q A;  1KQ2 A;  4VUB A;  4M7A G;  2DVE A;  2E41 A;  1YJ9 T;  1JJ2 A;  4N4I A;  2WSC E;  3CCJ T;  4M78 C;  4M7D D;  4M7A D;  4OB0 B;  2E10 A;  2P4T A;  3S6W A;  4OMF B;  4ATO A;  4FL6 A;  5CKF A;  3C95 A;  5KH6 A;  4JRP A;  1KC8 U;  5M9O A;  5CCA A;  1GXI E;  2C06 A;  2E6N A;  2RJC A;  1JBM A;  4FU6 A;  3X28 B;  5CR2 A;  4OB1 B;  1X6O A;  3OS1 A;  2L3R A;  4KT0 E;  3CCS T;  2EKO A;  3DKM A;  3MHX A;  1X75 C;  3G6E A;  2ZPE B;  4L6V 5;  3QZ5 B;  3OYN A;  2BKD N;  2IVW A;  3C94 A;  2DO3 A;  1M1K C;  2O01 E;  3R6O A;  2JUF A;  4M75 F;  3L2Q A;  5LJ3 j;  3FDR A;  1Q86 U;  1QW1 A;  2D6F A;  2XIC A;  2RHY A;  1K73 U;  2D0Q B;  3OS5 A;  5GAN 8;  3INZ A;  5GAO r;  4M7D C;  4JRI A;  5CAI A;  4HCC A;  1QVF A;  2EYQ A;  4JUV A;  2LVM A;  1HXD A;  1YBY A;  1W4S A;  4M77 G;  2LDM A;  3DB4 A;  4Y91 A;  3CCM T;  4JRK A;  2MWP A;  2LT1 A;  2G3R A;  2WSF E;  2B8A A;  2HBP A;  3KUF A;  4XTU A;  3CC2 T;  1XQH A;  2LCL A;  1JRI A;  5FU7 C;  2KQW A;  2RA2 A;  4XTX A;  3JRZ A;  3T9N A;  1M90 C;  2D9T A;  3SWN C;  2CZ0 B;  2CKK A;  3MEV A;  2X4J A;  3E19 A;  4LD6 A;  4N4H A;  2QTX A;  5LJ5 j;  5LJ3 h;  1G3S A;  4DOW A;  1W2B S;  3RUX A;  3QYG B;  5GAN 7;  2LX9 A;  3V7C A;  3NTK A;  5GAO p;  3JB9 J;  1YJ9 A;  3Q1J A;  1VQM A;  3GF5 A;  1YI2 A;  3FB9 A;  4DQ2 A;  3CD6 T;  3QBY A;  1BIA A;  1VUB A;  5CVI A;  4A4G A;  2F69 A;  2CGH A;  4M78 F;  5CKH A;  2CZ1 B;  4C0D B;  3CXC A;  4OGC A;  1M4Z A;  2EJ9 A;  4KUI A;  1N9S A;  4MZT A;  3OYD A;  3MP6 A;  4JLG A;  2OTJ T;  3FJP A;  5LJ5 h;  4BY6 C;  2E64 A;  3M58 A;  1D3B A;  5FU6 C;  4IUV A;  1NPR A;  1RL2 A;  2K57 A;  4D6W A;  3JCM J;  3JCM g;  5AYF A;  4J7F A;  1NZ9 A;  4M77 B;  5LJ5 g;  4ZGD B;  5GAN d;  1UB4 A;  1EIF A;  3OYE A;  2V8K A;  3G71 T;  3J80 E;  1O9S A;  3WVE B;  5GAM d;  2Y90 A;  3X25 B;  3PFS A;  4C5E A;  3QJ6 A;  1G3Y A;  5KE2 A;  1M1F A;  3QJY A;  4F7U B;  4C8Q G;  2K5I A;  3TEE A;  1Q86 C;  3ER0 A;  3J81 E;  4M7D E;  3FEO A;  4O5V A;  4BE1 A;  3E9G A;  2X4W A;  3KXT A;  2QA4 T;  1YJN T;  3KBG A;  4J83 A;  2VGM A;  3PGG A;  4IUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...