1H47A

Structures of mecp synthase in complex with (i) cmp and (ii) cmp and product
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Identification of Isoprenoids that Bind in the Intersubunit Cavity of Escherichia Coli 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase by Complementary Biophysical Methods
pubmed doi rcsb
source organism Escherichia coli
molecule tags Synthase
molecule keywords 2C-METHYL-D-ERYTHRITOL-2,4-CYCLODIPHOSPHATE SYNTHASE
total genus 47
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1h47A00
3IKFA 3QHDA 3IKEA 3EORA 3KE1A 3FPIA 1W55A 1IV4A 3K2XA 2PMPA 3T80A 1W57A 1VHAA 3F0FA 1JN1A 2GZLA 3JVHA 4C8EA 1YQNA 1H48A 4C82A 3F0GA 3P10A 3GHZA 1IV2A 1H47A 1JY8A 2UZHA 1T0AA 1KNJA 3K14A 4C81A 1IV1A 1IV3A 3FBAA 3IEQA 1U43A 3B6NA 3ESJA 3F0DA 3Q8HA 3ERNA 1KNKA 3F0EA 3P0ZA 3RE3A 4C8GA 3IEWA 1U40A 1VH8A 3ELCA 2AMTA 1GX1A 3MBMA 5B8FA 3F6MA 1U3LA 4C8IA 1U3PA
chains in the Genus database with same CATH superfamily
2ZOVA 2OTMA 4BVQA 3DDNA 4KWEA 1W57A 3RA6A 1YJWF 1W40A 3JVHA 5KMGA 4C82A 3VMFB 5IJ0B 3JARB 3M1XA 4F6RB 1Z5WA 3RA5A 2UYNB 4R40B 1W41A 5HY1A 3J7AR 1VQPF 3UT5B 2NMUA 3HWUA 3RYHA 2ZVZA 1NJIH 3JALA 4YJ2A 3WPWA 2Z1FA 4O4IB 1JFFA 2GVIA 3QTYA 1VQ9F 1RQ7A 1OFUA 2H6LA 4TV9B 4X1KB 5HWEA 5KX5A 5LOVB 5HY2A 2CW4A 1JN1A 4TUYB 4IHJB 4XCQA 4DRXB 3CCLF 2LBTA 3JASA 4EB6A 2Z1TA 2JNBA 1XBIA 4BT4A 5CB4A 4ZHYB 2GLZA 4O4JB 2OZBA 5HY0A 2FC3A 3LWQC 3S0YA 5LP6C 2RHOA 5LYJA 4I4TB 3MBMA 5LA6B 2BO1A 4ZHQB 4IIJB 3G6EF 1VQ7F 3HJWC 2VAPA 1W3EX 3KE1A 4X1YB 3CYPB 3JAWA 3V4DA 2ZF8A 2PMPA 3N2GB 4I55A 5GIPC 3NVIB 1UI9A 3E20B 4BT5A 4ERHA 1M1KH 3OBWA 3GHZA 5AVMA 1Q7YH 3CMEF 4X1IB 1R1MA 2HRUA 2YXZA 2BTUA 5MN5A 2OTLF 4B5CA 1KNKA 1U40A 3PLAC 1GO0A 1TVKB 3NK6A 1ODEA 1U3PA 3I56F 3U0OA 3HKBA 4LNUB 1Q81H 3FPIA 1W55A 1IV4A 3WJQA 1VQMF 3K12A 4C8EA 4NWOB 3C9SA 5J2UB 4O4LB 4O4HB 4NQ3A 5JCOC 1T0AA 4BY9D 2WALA 4I50B 3KIZA 3J81M 4YJ3B 2QTPA 3WGMA 2HRYA 2OHWA 3ERNA 3N2KA 2RHJA 3NVKE 1ZWZA 4ZHVA 1RA4A 3CCVF 2AMTA 5G4UC 1Z5VA 3QUWA 5GONA 1KD1H 5J2TB 2VGNA 2H8CA 1W5AA 2UYPA 3FD5A 3JAWB 3TD5A 4BVTA 3O85A 4O4HA 4G88A 1E7KA 3WGJA 4G4ZA 3DC2A 3M4SA 5ITZB 3SIUA 5LP6A 1FNKA 3K0TA 3FBAA 1KQSF 5JH7B 1J7HA 1YGYA 3CCRF 5J2TA 1QVFF 5MN4A 4RQOA 3E22B 3FD6A 4WBNA 3KHNA 4TUYA 4G4XA 4ZOLA 1W5FA 4EI9A 5LOVA 3E1YA 3HTNA 1UFYA 3BYQA 3VO8A 4G4VA 2KGWA 3HKEB 4X20B 3VYUC 1H48A 4X1IA 3L7QA 2YYEA 3MDOA 2HS4A 1KNJA 3WGNA 2Q1XA 1SZQA 2HS3A 2UYNA 4ZHQA 4C8GA 3LMEA 3J80M 5DCVA 4FFBA 4C8IA 3IMPA 4NUTA 1JJ2F 1ONIA 2IAFA 3LWOC 3D54A 3T80A 4WBNB 1VQVA 3KJJA 3LYBA 5EO3A 3V3TA 3LFOA 1XRGA 1W59A 3JASB 3WGKA 3D01A 5FLXM 1S72F 4IHJA 1VQ8F 3N2GA 3ZOPA 4C81A 4TV9A 4ZK7A 5KX5B 2CVLA 3B6NA 1QVGF 1VQNF 4FFBB 2R751 3C9TA 3CYQA 5LA6A 3ELCA 5LYJB 1M90H 4E6EA 3CC2F 3IR9A 1OAPA 3CMAF 3K2XA 3G71F 3F0FA 4LCKA 4F6RA 2ZAUA 4EB6B 2Z01A 5IJ0A 4TZZA 4X20A 4DXDA 3CCSF 5GINC 5GIOC 2UYKA 4X1KA 4ZHWA 3VIUA 5BMVA 1N8RH 3TD4A 3MCQA 2OTJF 3UT5A 5B8FA 3C8LA 3MCAB 3CCJF 4G4YA 4BVRA 1CN7A 1XV2A 4X1YA 5LP6B 2K1SA 4B45A 1Q8RA 4G4WA 2KTUA 1VQKF 3HKEA 3S02A 1PF5A 1IV3A 4O4JA 4ZOLB 3F0DA 3WPXA 5IT9M 2LCAA 3CXCF 5GONB 3SIVA 3S0HA 1VH8A 3VYTC 1VQOF 1Q86H 3N2KB 2HP0B 3WGLA 4I55B 3ZP7A 3I7TA 3QHDA 3G4SF 3LWVC 3S06A 1JFFB 4RHAA 1W2BF 1YJ9F 4IIJA 5EIBC 2FGYA 2KG4A 4YJ2B 3CC4F 5EB1B 2LBXA 3VOBA 1YQNA 3P10A 5J2UA 1JY8A 5HXUA 3VTIC 1YJNF 5MN6A 2Z1EA 5GANK 3Q8HA 2QA4F 3HKDA 3TD3A 5CB4B 1VK3A 1W5EA 2RHLA 2EWCA 2HP3A 1FFXA 2VAWA 1COMA 1NMUB 3V7EA 3IKFA 4O2AB 5CA0B 3C9UA 4O4IA 3NMUC 3ON1A 2Z1UA 4TV8A 2GZLA 1K9MH 3E22A 5C8YB 1W5BA 4B46A 2I6RA 5JH7A 3LWRC 3CCEF 3AGKA 3RYFB 2HS0A 2W8BC 4C4WC 3VCZA 3HKBB 3RYIA 3JAKB 5ITZA 4BVSA 3D00A 1TVKA 3CB2A 1W42A 3ZO8A 1NQ3A 3RE3A 2VXYA 5EAZA 2VAMA 3MQWA 3C9RA 2CWJA 2RHHA 3EORA 5HP8A 1YI2F 2BTQB 5A2QM 3HKCA 2N48A 1QU9A 4PWTA 1SA0A 5JVDA 3VI6A 3RYCB 2QI2A 5EYPB 4YJ3A 1K73H 1YIJF 3FFMA 1U43A 1QAHA 1XHOA 4I50A 1FNJA 4X3MA 5EWRA 3RYIB 5JQGA 2ZVYA 3KJKA 2HX0A 4I4TA 1X7OA 2IG8A 3RYHB 4O4LA 3LWPC 1VQLF 2IQQA 4BT7A 2MQEA 3CPQA 2R6R1 2HQSC 3F6MA 1RQ2A 1VQ4F 5IYZB 1RLUA 2AIZP 4B62A 4LNUA 2HVYD 3WXMB 3I3FA 1VHAA 5CA0A 4EI8A 3CCQF 4O2AA 4DRXA 3RYCA 1DBFA 2F9ZC 3F0GA 2RB9A 5HP7A 3NK7A 1GO1A 5FJ4C 1H7MA 2B33A 3K14A 4U3JB 3IEQA 3JALB 3GTZA 2LBWA 1X52A 3JCMM 5CA1A 3OW2F 3OBYA 2DYYA 2H8EA 3IEWA 1PXWA 4BW0B 4EI7A 1DT9A 4HNAA 5EZYA 3I55F 2CHSA 4ZI7B 2KTVA 3VOAA 4BT3A 1X25A 2DT4A 2UYJA 1W581 3RYFA 5EB0A 1FSZA 1TUBB 5IJ9A 2VGMA 5JVDB 1IV2A 1SA0B 2UZHA 3WJRA 1CLIA 2CZWA 3M84A 4TV8B 5CA1B 3ESJA 1KC8H 1T0KB 5JCOA 3R0PA 3P0ZA 2Q1YA 3JAMM 3CCMF 4O2BB 1YHQF 1YITF 1GX1A 3P4EA 1X7PA 1K8AH 1FFXB 2AIFA 3CC7F 2QEXF 3CCUF 3GYQA 2BTOA 2PHNA 3S03A 2I6DA 5FNVB 3CG6A 1SDSA 1QD9A 5FNVA 5C8YA 3ZP4A 4BT6A 2CSLA 1IPAA 1IV1A 4U3JA 2ZODA 5BMVB 2P6YA 3JARA 1VQ6F 3PAFA 1GZ0A 5HY4A 3JATA 1CK2A 2HP0A 5LXTA 3JATB 5LXTB 5KMGB 1Q82H 3N4YA 3HKCB 3IKEA 3HKDB 3CPWF 5HXZA 3V7QA 3LDTA 5IYZA 3CD6F 2CHTA 5G4VC 3HAXD 1JD1A 3N4ZA 1TUBA 5EIBD 5IJ9B 1H47A 4X3LA 5JQGB 2ALEA 3JAKA 1RLGA 4ZI7A 5EYPA 3VYSC 4HNAB 5EZYB 2V9YA 3F0EA 3OONA 2G9IA 4O2BA 3S0WA 4U39A 5GAPK 1VQ5F 4BT2A 3WJPA 4M8IA 1U3LA 2L26A
chains in the Genus database with same CATH topology
3IKFA 3QHDA 3IKEA 3EORA 3KE1A 3FPIA 1W55A 1IV4A 3K2XA 2PMPA 3T80A 1W57A 1VHAA 3F0FA 1JN1A 2GZLA 3JVHA 4C8EA 1YQNA 1H48A 4C82A 3F0GA 3P10A 3GHZA 1IV2A 1H47A 1JY8A 2UZHA 1T0AA 1KNJA 3K14A 4C81A 1IV1A 1IV3A 3FBAA 3IEQA 1U43A 3B6NA 3ESJA 3F0DA 3Q8HA 3ERNA 1KNKA 3F0EA 3P0ZA 3RE3A 4C8GA 3IEWA 1U40A 1VH8A 3ELCA 2AMTA 1GX1A 3MBMA 5B8FA 3F6MA 1U3LA 4C8IA 1U3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKF A;  3QHD A;  3IKE A;  3EOR A;  3KE1 A;  3FPI A;  1W55 A;  1IV4 A;  3K2X A;  2PMP A;  3T80 A;  1W57 A;  1VHA A;  3F0F A;  1JN1 A;  2GZL A;  3JVH A;  4C8E A;  1YQN A;  1H48 A;  4C82 A;  3F0G A;  3P10 A;  3GHZ A;  1IV2 A;  1H47 A;  1JY8 A;  2UZH A;  1T0A A;  1KNJ A;  3K14 A;  4C81 A;  1IV1 A;  1IV3 A;  3FBA A;  3IEQ A;  1U43 A;  3B6N A;  3ESJ A;  3F0D A;  3Q8H A;  3ERN A;  1KNK A;  3F0E A;  3P0Z A;  3RE3 A;  4C8G A;  3IEW A;  1U40 A;  1VH8 A;  3ELC A;  2AMT A;  1GX1 A;  3MBM A;  5B8F A;  3F6M A;  1U3L A;  4C8I A;  1U3P A; 
#chains in the Genus database with same CATH topology
 2ZOV A;  2OTM A;  4BVQ A;  3DDN A;  4KWE A;  1W57 A;  3RA6 A;  1YJW F;  1W40 A;  3JVH A;  5KMG A;  4C82 A;  3VMF B;  5IJ0 B;  3JAR B;  3M1X A;  4F6R B;  1Z5W A;  3RA5 A;  2UYN B;  4R40 B;  1W41 A;  5HY1 A;  3J7A R;  1VQP F;  3UT5 B;  2NMU A;  3HWU A;  3RYH A;  2ZVZ A;  1NJI H;  3JAL A;  4YJ2 A;  3WPW A;  2Z1F A;  4O4I B;  1JFF A;  2GVI A;  3QTY A;  1VQ9 F;  1RQ7 A;  1OFU A;  2H6L A;  4TV9 B;  4X1K B;  5HWE A;  5KX5 A;  5LOV B;  5HY2 A;  2CW4 A;  1JN1 A;  4TUY B;  4IHJ B;  4XCQ A;  4DRX B;  3CCL F;  2LBT A;  3JAS A;  4EB6 A;  2Z1T A;  2JNB A;  1XBI A;  4BT4 A;  5CB4 A;  4ZHY B;  2GLZ A;  4O4J B;  2OZB A;  5HY0 A;  2FC3 A;  3LWQ C;  3S0Y A;  5LP6 C;  2RHO A;  5LYJ A;  4I4T B;  3MBM A;  5LA6 B;  2BO1 A;  4ZHQ B;  4IIJ B;  3G6E F;  1VQ7 F;  3HJW C;  2VAP A;  1W3E X;  3KE1 A;  4X1Y B;  3CYP B;  3JAW A;  3V4D A;  2ZF8 A;  2PMP A;  3N2G B;  4I55 A;  5GIP C;  3NVI B;  1UI9 A;  3E20 B;  4BT5 A;  4ERH A;  1M1K H;  3OBW A;  3GHZ A;  5AVM A;  1Q7Y H;  3CME F;  4X1I B;  1R1M A;  2HRU A;  2YXZ A;  2BTU A;  5MN5 A;  2OTL F;  4B5C A;  1KNK A;  1U40 A;  3PLA C;  1GO0 A;  1TVK B;  3NK6 A;  1ODE A;  1U3P A;  3I56 F;  3U0O A;  3HKB A;  4LNU B;  1Q81 H;  3FPI A;  1W55 A;  1IV4 A;  3WJQ A;  1VQM F;  3K12 A;  4C8E A;  4NWO B;  3C9S A;  5J2U B;  4O4L B;  4O4H B;  4NQ3 A;  5JCO C;  1T0A A;  4BY9 D;  2WAL A;  4I50 B;  3KIZ A;  3J81 M;  4YJ3 B;  2QTP A;  3WGM A;  2HRY A;  2OHW A;  3ERN A;  3N2K A;  2RHJ A;  3NVK E;  1ZWZ A;  4ZHV A;  1RA4 A;  3CCV F;  2AMT A;  5G4U C;  1Z5V A;  3QUW A;  5GON A;  1KD1 H;  5J2T B;  2VGN A;  2H8C A;  1W5A A;  2UYP A;  3FD5 A;  3JAW B;  3TD5 A;  4BVT A;  3O85 A;  4O4H A;  4G88 A;  1E7K A;  3WGJ A;  4G4Z A;  3DC2 A;  3M4S A;  5ITZ B;  3SIU A;  5LP6 A;  1FNK A;  3K0T A;  3FBA A;  1KQS F;  5JH7 B;  1J7H A;  1YGY A;  3CCR F;  5J2T A;  1QVF F;  5MN4 A;  4RQO A;  3E22 B;  3FD6 A;  4WBN A;  3KHN A;  4TUY A;  4G4X A;  4ZOL A;  1W5F A;  4EI9 A;  5LOV A;  3E1Y A;  3HTN A;  1UFY A;  3BYQ A;  3VO8 A;  4G4V A;  2KGW A;  3HKE B;  4X20 B;  3VYU C;  1H48 A;  4X1I A;  3L7Q A;  2YYE A;  3MDO A;  2HS4 A;  1KNJ A;  3WGN A;  2Q1X A;  1SZQ A;  2HS3 A;  2UYN A;  4ZHQ A;  4C8G A;  3LME A;  3J80 M;  5DCV A;  4FFB A;  4C8I A;  3IMP A;  4NUT A;  1JJ2 F;  1ONI A;  2IAF A;  3LWO C;  3D54 A;  3T80 A;  4WBN B;  1VQV A;  3KJJ A;  3LYB A;  5EO3 A;  3V3T A;  3LFO A;  1XRG A;  1W59 A;  3JAS B;  3WGK A;  3D01 A;  5FLX M;  1S72 F;  4IHJ A;  1VQ8 F;  3N2G A;  3ZOP A;  4C81 A;  4TV9 A;  4ZK7 A;  5KX5 B;  2CVL A;  3B6N A;  1QVG F;  1VQN F;  4FFB B;  2R75 1;  3C9T A;  3CYQ A;  5LA6 A;  3ELC A;  5LYJ B;  1M90 H;  4E6E A;  3CC2 F;  3IR9 A;  1OAP A;  3CMA F;  3K2X A;  3G71 F;  3F0F A;  4LCK A;  4F6R A;  2ZAU A;  4EB6 B;  2Z01 A;  5IJ0 A;  4TZZ A;  4X20 A;  4DXD A;  3CCS F;  5GIN C;  5GIO C;  2UYK A;  4X1K A;  4ZHW A;  3VIU A;  5BMV A;  1N8R H;  3TD4 A;  3MCQ A;  2OTJ F;  3UT5 A;  5B8F A;  3C8L A;  3MCA B;  3CCJ F;  4G4Y A;  4BVR A;  1CN7 A;  1XV2 A;  4X1Y A;  5LP6 B;  2K1S A;  4B45 A;  1Q8R A;  4G4W A;  2KTU A;  1VQK F;  3HKE A;  3S02 A;  1PF5 A;  1IV3 A;  4O4J A;  4ZOL B;  3F0D A;  3WPX A;  5IT9 M;  2LCA A;  3CXC F;  5GON B;  3SIV A;  3S0H A;  1VH8 A;  3VYT C;  1VQO F;  1Q86 H;  3N2K B;  2HP0 B;  3WGL A;  4I55 B;  3ZP7 A;  3I7T A;  3QHD A;  3G4S F;  3LWV C;  3S06 A;  1JFF B;  4RHA A;  1W2B F;  1YJ9 F;  4IIJ A;  5EIB C;  2FGY A;  2KG4 A;  4YJ2 B;  3CC4 F;  5EB1 B;  2LBX A;  3VOB A;  1YQN A;  3P10 A;  5J2U A;  1JY8 A;  5HXU A;  3VTI C;  1YJN F;  5MN6 A;  2Z1E A;  5GAN K;  3Q8H A;  2QA4 F;  3HKD A;  3TD3 A;  5CB4 B;  1VK3 A;  1W5E A;  2RHL A;  2EWC A;  2HP3 A;  1FFX A;  2VAW A;  1COM A;  1NMU B;  3V7E A;  3IKF A;  4O2A B;  5CA0 B;  3C9U A;  4O4I A;  3NMU C;  3ON1 A;  2Z1U A;  4TV8 A;  2GZL A;  1K9M H;  3E22 A;  5C8Y B;  1W5B A;  4B46 A;  2I6R A;  5JH7 A;  3LWR C;  3CCE F;  3AGK A;  3RYF B;  2HS0 A;  2W8B C;  4C4W C;  3VCZ A;  3HKB B;  3RYI A;  3JAK B;  5ITZ A;  4BVS A;  3D00 A;  1TVK A;  3CB2 A;  1W42 A;  3ZO8 A;  1NQ3 A;  3RE3 A;  2VXY A;  5EAZ A;  2VAM A;  3MQW A;  3C9R A;  2CWJ A;  2RHH A;  3EOR A;  5HP8 A;  1YI2 F;  2BTQ B;  5A2Q M;  3HKC A;  2N48 A;  1QU9 A;  4PWT A;  1SA0 A;  5JVD A;  3VI6 A;  3RYC B;  2QI2 A;  5EYP B;  4YJ3 A;  1K73 H;  1YIJ F;  3FFM A;  1U43 A;  1QAH A;  1XHO A;  4I50 A;  1FNJ A;  4X3M A;  5EWR A;  3RYI B;  5JQG A;  2ZVY A;  3KJK A;  2HX0 A;  4I4T A;  1X7O A;  2IG8 A;  3RYH B;  4O4L A;  3LWP C;  1VQL F;  2IQQ A;  4BT7 A;  2MQE A;  3CPQ A;  2R6R 1;  2HQS C;  3F6M A;  1RQ2 A;  1VQ4 F;  5IYZ B;  1RLU A;  2AIZ P;  4B62 A;  4LNU A;  2HVY D;  3WXM B;  3I3F A;  1VHA A;  5CA0 A;  4EI8 A;  3CCQ F;  4O2A A;  4DRX A;  3RYC A;  1DBF A;  2F9Z C;  3F0G A;  2RB9 A;  5HP7 A;  3NK7 A;  1GO1 A;  5FJ4 C;  1H7M A;  2B33 A;  3K14 A;  4U3J B;  3IEQ A;  3JAL B;  3GTZ A;  2LBW A;  1X52 A;  3JCM M;  5CA1 A;  3OW2 F;  3OBY A;  2DYY A;  2H8E A;  3IEW A;  1PXW A;  4BW0 B;  4EI7 A;  1DT9 A;  4HNA A;  5EZY A;  3I55 F;  2CHS A;  4ZI7 B;  2KTV A;  3VOA A;  4BT3 A;  1X25 A;  2DT4 A;  2UYJ A;  1W58 1;  3RYF A;  5EB0 A;  1FSZ A;  1TUB B;  5IJ9 A;  2VGM A;  5JVD B;  1IV2 A;  1SA0 B;  2UZH A;  3WJR A;  1CLI A;  2CZW A;  3M84 A;  4TV8 B;  5CA1 B;  3ESJ A;  1KC8 H;  1T0K B;  5JCO A;  3R0P A;  3P0Z A;  2Q1Y A;  3JAM M;  3CCM F;  4O2B B;  1YHQ F;  1YIT F;  1GX1 A;  3P4E A;  1X7P A;  1K8A H;  1FFX B;  2AIF A;  3CC7 F;  2QEX F;  3CCU F;  3GYQ A;  2BTO A;  2PHN A;  3S03 A;  2I6D A;  5FNV B;  3CG6 A;  1SDS A;  1QD9 A;  5FNV A;  5C8Y A;  3ZP4 A;  4BT6 A;  2CSL A;  1IPA A;  1IV1 A;  4U3J A;  2ZOD A;  5BMV B;  2P6Y A;  3JAR A;  1VQ6 F;  3PAF A;  1GZ0 A;  5HY4 A;  3JAT A;  1CK2 A;  2HP0 A;  5LXT A;  3JAT B;  5LXT B;  5KMG B;  1Q82 H;  3N4Y A;  3HKC B;  3IKE A;  3HKD B;  3CPW F;  5HXZ A;  3V7Q A;  3LDT A;  5IYZ A;  3CD6 F;  2CHT A;  5G4V C;  3HAX D;  1JD1 A;  3N4Z A;  1TUB A;  5EIB D;  5IJ9 B;  1H47 A;  4X3L A;  5JQG B;  2ALE A;  3JAK A;  1RLG A;  4ZI7 A;  5EYP A;  3VYS C;  4HNA B;  5EZY B;  2V9Y A;  3F0E A;  3OON A;  2G9I A;  4O2B A;  3S0W A;  4U39 A;  5GAP K;  1VQ5 F;  4BT2 A;  3WJP A;  4M8I A;  1U3L A;  2L26 A; 
#chains in the Genus database with same CATH homology
 3IKF A;  3QHD A;  3IKE A;  3EOR A;  3KE1 A;  3FPI A;  1W55 A;  1IV4 A;  3K2X A;  2PMP A;  3T80 A;  1W57 A;  1VHA A;  3F0F A;  1JN1 A;  2GZL A;  3JVH A;  4C8E A;  1YQN A;  1H48 A;  4C82 A;  3F0G A;  3P10 A;  3GHZ A;  1IV2 A;  1H47 A;  1JY8 A;  2UZH A;  1T0A A;  1KNJ A;  3K14 A;  4C81 A;  1IV1 A;  1IV3 A;  3FBA A;  3IEQ A;  1U43 A;  3B6N A;  3ESJ A;  3F0D A;  3Q8H A;  3ERN A;  1KNK A;  3F0E A;  3P0Z A;  3RE3 A;  4C8G A;  3IEW A;  1U40 A;  1VH8 A;  3ELC A;  2AMT A;  1GX1 A;  3MBM A;  5B8F A;  3F6M A;  1U3L A;  4C8I A;  1U3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...