1H47A

Structures of mecp synthase in complex with (i) cmp and (ii) cmp and product
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Identification of Isoprenoids that Bind in the Intersubunit Cavity of Escherichia Coli 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase by Complementary Biophysical Methods
pubmed doi rcsb
source organism Escherichia coli
molecule tags Synthase
molecule keywords 2C-METHYL-D-ERYTHRITOL-2,4-CYCLODIPHOSPHATE SYNTHASE
total genus 47
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1h47A00
2PMPA 1VH8A 2AMTA 1IV1A 3KE1A 3FPIA 3FBAA 3GHZA 3ESJA 1IV2A 4C8GA 3P0ZA 3T80A 3B6NA 3F0DA 4C81A 3Q8HA 3F0FA 3F0GA 5B8FA 1U3PA 1U43A 2UZHA 1IV4A 3IKEA 1W57A 3RE3A 3F6MA 3JVHA 3MBMA 1W55A 1U40A 3K2XA 1KNKA 3F0EA 3QHDA 3ERNA 1JY8A 4C8IA 3IEWA 1JN1A 1U3LA 1IV3A 3K14A 1T0AA 1VHAA 4C82A 1KNJA 2GZLA 1GX1A 1H47A 1H48A 1YQNA 3ELCA 3EORA 4C8EA 3IEQA 3P10A 3IKFA
chains in the Genus database with same CATH superfamily
1SA0B 2ZVYA 5GIPC 3S02A 3K0TA 4EI8A 3GHZA 2W8BC 3L7QA 3WXMB 5KX5B 5J2UB 5FNVA 1FNKA 2YYEA 4FFBB 5B8FA 1UFYA 1VQ6F 2VGMA 3VCZA 4DXDA 4B46A 3WPXA 4O4JB 1U40A 4BY9D 1T0KB 1VQ7F 4B5CA 1FFXA 4BT2A 3TD4A 5LXTB 2CW4A 3E22A 2ZF8A 3U0OA 1YJWF 4R40B 2DT4A 2UYPA 2OZBA 5IJ0B 3J80M 1CK2A 1X7OA 4X20A 4X1YA 5CB4A 5GAPK 4IIJA 3S06A 1VQ4F 3M1XA 4I4TA 1YJNF 3RYCB 2BTOA 3GTZA 1K9MH 3ON1A 3F0GA 4BVSA 1RQ2A 4IHJA 3WGMA 4XCQA 4X1IB 3WGNA 1ONIA 4TV9B 4B45A 1VQMF 5LA6A 1YHQF 1W5EA 4F6RA 4DRXB 1XRGA 2CWJA 1H47A 5IJ9B 2HP0A 3RYFA 1W5AA 1JFFB 5JQGB 2JNBA 3CMAF 4O4IA 1XBIA 2HP3A 4BT5A 3B6NA 1R1MA 3PAFA 2H8EA 5EIBD 4TUYA 4NQ3A 1M1KH 5EB0A 4B62A 3RYIA 5HP8A 2AIZP 3ZP4A 2L26A 2VAWA 5KX5A 2Z01A 1RQ7A 5CA0A 4O4LB 5LP6C 3JATB 2RHHA 1W5BA 3M4SA 2V9YA 4E6EA 4ZI7A 2PHNA 2BO1A 5JCOC 1IV1A 2Q1YA 3FPIA 3M84A 4O2BB 1VQOF 3MCQA 3NK6A 5LP6B 3CXCF 1U3PA 3KJKA 3QTYA 5IJ0A 3HKBB 1W55A 3JASB 2LBXA 4WBNB 2LBWA 5LYJB 5JCOA 5J2TB 2RHJA 3ERNA 2B33A 1VQLF 3WPWA 4C82A 4BT3A 1JD1A 2BTQB 2R6R1 3ELCA 4TV9A 1Z5WA 5FNVB 3CPWF 4ERHA 2PMPA 3N2GA 2IG8A 2GVIA 3JAKB 5ITZB 3CCQF 5JH7B 3JCMM 3E1YA 4TV8A 4O4JA 4LNUB 3CCRF 4ZHQA 3CD6F 3HKEB 2KTVA 1IV4A 2ZOVA 2ZVZA 3ZP7A 2HVYD 1M90H 5LXTA 3JVHA 3S0HA 4G88A 3G6EF 4WBNA 2RB9A 5CA1B 1KNKA 3C9SA 5IYZA 1IV3A 3FD6A 3HTNA 3I55F 2F9ZC 1SDSA 1GX1A 4IHJB 3WJRA 4KWEA 3LWPC 1X52A 4I55A 2HX0A 2ZAUA 2AMTA 4TV8B 5IT9M 4U39A 3NMUC 2YXZA 3LWQC 3CC4F 2VXYA 3AGKA 3RE3A 1Q8RA 3F6MA 2Q1XA 2VAMA 4ZOLA 4EB6A 3FD5A 5G4VC 1X25A 2KGWA 1YGYA 1FFXB 3F0EA 3PLAC 3QHDA 2RHLA 1JFFA 3K14A 1IPAA 2CHTA 3G71F 4O4IB 3NVIB 2HS4A 5EZYA 3J81M 3RYCA 5AVMA 4O4HB 4I50B 1FSZA 1NQ3A 3T80A 3I56F 4YJ2B 2VGNA 5CA0B 4X1IA 4BVTA 5FLXM 1TUBB 3MQWA 1Z5VA 3VYSC 1VQVA 1YJ9F 3CC7F 5HY1A 3V3TA 3LWOC 3LDTA 2ALEA 4C8IA 3HKCA 3I7TA 3J7AR 4C4WC 1W42A 3JALB 1H48A 3IEQA 3UT5A 3NVKE 3O85A 3JARB 5EB1B 1COMA 3C9UA 2I6RA 5CA1A 3FBAA 5LYJA 3P0ZA 3RYIB 4YJ2A 1W41A 3V4DA 2HS3A 3NK7A 3ZO8A 5HXUA 2N48A 4BW0B 3OONA 3CCMF 1J7HA 2BTUA 4EI9A 3JAWB 3SIUA 3IEWA 4YJ3A 1VQ5F 2HQSC 2QI2A 4G4XA 3VYUC 4X1KA 3HKEA 5GINC 3KE1A 5GONA 5MN6A 1W3EX 3P4EA 3F0DA 5GIOC 1DBFA 1QVFF 3V7EA 2QA4F 5DCVA 3VOBA 3LYBA 1W5FA 1GZ0A 1ZWZA 2UYNB 4BT7A 4O4HA 2IAFA 3DDNA 3C9TA 2OHWA 3D54A 3FFMA 2R751 3R0PA 3S03A 4LCKA 3CCUF 2LBTA 2GZLA 5LOVB 2WALA 3WGJA 1RLUA 3N2KB 4NWOB 5JH7A 1K8AH 3MCAB 4HNAB 1VH8A 3KHNA 4LNUA 3S0YA 3CCVF 3WJPA 2CHSA 5ITZA 4ZOLB 4EB6B 1CN7A 2LCAA 2HRUA 3N2GB 3BYQA 3F0FA 1XHOA 4X3LA 5HY0A 3OW2F 4ZHVA 1TVKB 1RA4A 1X7PA 3KIZA 1PF5A 5HY4A 2MQEA 4I50A 3SIVA 2G9IA 2KTUA 5LOVA 2QTPA 1VQNF 3CCEF 1KC8H 2ZODA 3GYQA 5C8YA 4NUTA 5EO3A 3G4SF 2UYKA 1NJIH 4O2AB 2K1SA 5BMVA 4RQOA 4EI7A 1RLGA 4U3JB 3CPQA 1VQ8F 3VIUA 3HKCB 3HJWC 2UZHA 1YIJF 3VI6A 3JALA 1QD9A 1S72F 3N4ZA 1W59A 1E7KA 4BT4A 3HKDA 4ZHQB 5GONB 2CVLA 1XV2A 3ZOPA 3CYQA 2KG4A 3UT5B 2DYYA 2NMUA 1CLIA 2CSLA 3E20B 1K73H 3RYHB 3CCJF 3EORA 3IKFA 1JJ2F 5IYZB 5EYPA 5HP7A 4C8GA 4ZHWA 1IV2A 1QVGF 3D00A 3WGKA 3Q8HA 4PWTA 3I3FA 4G4YA 3OBYA 2AIFA 3OBWA 1GO0A 5HWEA 1Q7YH 4X3MA 5GANK 3CG6A 2FGYA 5JQGA 2Z1UA 3JARA 1PXWA 2HS0A 1KQSF 5EIBC 3E22B 4BVRA 3DC2A 3K12A 3LMEA 3HWUA 4X20B 5CB4B 2OTJF 3RA6A 3LWVC 3LWRC 3CB2A 5FJ4C 4G4VA 2UYNA 1Q81H 5EZYB 4X1YB 1SA0A 2CZWA 4G4ZA 1QU9A 2EWCA 3JAWA 3IMPA 5J2UA 1VQPF 4O2AA 5BMVB 3C9RA 4YJ3B 2GLZA 1KD1H 3C8LA 1OFUA 2HP0B 2HRYA 1TUBA 5LA6B 3RYFB 4X1KB 3CC2F 4FFBA 1OAPA 5JVDA 2P6YA 5KMGA 3CYPB 4ZHYB 1VQKF 2Z1TA 1DT9A 1YI2F 1SZQA 3TD5A 1N8RH 3CMEF 3VYTC 3WJQA 1W2BF 1H7MA 3S0WA 4C81A 5HY2A 3VOAA 3RYHA 4BVQA 4TZZA 5J2TA 2RHOA 2H8CA 3WGLA 2Z1FA 3VTIC 1FNJA 3K2XA 3JATA 4ZK7A 4I4TB 4O4LA 2VAPA 1JY8A 2OTMA 4BT6A 1JN1A 1U3LA 1T0AA 4HNAA 1YITF 2H6LA 2QEXF 2FC3A 1QAHA 3N2KA 4C8EA 2I6DA 1UI9A 4DRXA 5MN5A 3HKBA 1W40A 1W57A 3N4YA 3HAXD 3JAMM 2OTLF 1VQ9F 5HXZA 5LP6A 5EAZA 4RHAA 3TD3A 4IIJB 1NMUB 1Q82H 5MN4A 4TUYB 1TVKA 1Q86H 4I55B 3JASA 3MDOA 1VHAA 1KNJA 3CCLF 3D01A 1YQNA 3RA5A 3P10A 5A2QM 1W581 3JAKA 4M8IA 4F6RB 3ESJA 5C8YB 4U3JA 5G4UC 4ZI7B 3VO8A 4G4WA 1VK3A 5JVDB 1U43A 5KMGB 2Z1EA 3IKEA 5IJ9A 4O2BA 3MBMA 5EWRA 2UYJA 3QUWA 3HKDB 3IR9A 5EYPB 3CCSF 3VMFB 1ODEA 2IQQA 1GO1A 3V7QA 3LFOA 3KJJA
chains in the Genus database with same CATH topology
2PMPA 1VH8A 2AMTA 1IV1A 3KE1A 3FPIA 3FBAA 3GHZA 3ESJA 1IV2A 4C8GA 3P0ZA 3T80A 3B6NA 3F0DA 4C81A 3Q8HA 3F0FA 3F0GA 5B8FA 1U3PA 1U43A 2UZHA 1IV4A 3IKEA 1W57A 3RE3A 3F6MA 3JVHA 3MBMA 1W55A 1U40A 3K2XA 1KNKA 3F0EA 3QHDA 3ERNA 1JY8A 4C8IA 3IEWA 1JN1A 1U3LA 1IV3A 3K14A 1T0AA 1VHAA 4C82A 1KNJA 2GZLA 1GX1A 1H47A 1H48A 1YQNA 3ELCA 3EORA 4C8EA 3IEQA 3P10A 3IKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMP A;  1VH8 A;  2AMT A;  1IV1 A;  3KE1 A;  3FPI A;  3FBA A;  3GHZ A;  3ESJ A;  1IV2 A;  4C8G A;  3P0Z A;  3T80 A;  3B6N A;  3F0D A;  4C81 A;  3Q8H A;  3F0F A;  3F0G A;  5B8F A;  1U3P A;  1U43 A;  2UZH A;  1IV4 A;  3IKE A;  1W57 A;  3RE3 A;  3F6M A;  3JVH A;  3MBM A;  1W55 A;  1U40 A;  3K2X A;  1KNK A;  3F0E A;  3QHD A;  3ERN A;  1JY8 A;  4C8I A;  3IEW A;  1JN1 A;  1U3L A;  1IV3 A;  3K14 A;  1T0A A;  1VHA A;  4C82 A;  1KNJ A;  2GZL A;  1GX1 A;  1H47 A;  1H48 A;  1YQN A;  3ELC A;  3EOR A;  4C8E A;  3IEQ A;  3P10 A;  3IKF A; 
#chains in the Genus database with same CATH topology
 1SA0 B;  2ZVY A;  5GIP C;  3S02 A;  3K0T A;  4EI8 A;  3GHZ A;  2W8B C;  3L7Q A;  3WXM B;  5KX5 B;  5J2U B;  5FNV A;  1FNK A;  2YYE A;  4FFB B;  5B8F A;  1UFY A;  1VQ6 F;  2VGM A;  3VCZ A;  4DXD A;  4B46 A;  3WPX A;  4O4J B;  1U40 A;  4BY9 D;  1T0K B;  1VQ7 F;  4B5C A;  1FFX A;  4BT2 A;  3TD4 A;  5LXT B;  2CW4 A;  3E22 A;  2ZF8 A;  3U0O A;  1YJW F;  4R40 B;  2DT4 A;  2UYP A;  2OZB A;  5IJ0 B;  3J80 M;  1CK2 A;  1X7O A;  4X20 A;  4X1Y A;  5CB4 A;  5GAP K;  4IIJ A;  3S06 A;  1VQ4 F;  3M1X A;  4I4T A;  1YJN F;  3RYC B;  2BTO A;  3GTZ A;  1K9M H;  3ON1 A;  3F0G A;  4BVS A;  1RQ2 A;  4IHJ A;  3WGM A;  4XCQ A;  4X1I B;  3WGN A;  1ONI A;  4TV9 B;  4B45 A;  1VQM F;  5LA6 A;  1YHQ F;  1W5E A;  4F6R A;  4DRX B;  1XRG A;  2CWJ A;  1H47 A;  5IJ9 B;  2HP0 A;  3RYF A;  1W5A A;  1JFF B;  5JQG B;  2JNB A;  3CMA F;  4O4I A;  1XBI A;  2HP3 A;  4BT5 A;  3B6N A;  1R1M A;  3PAF A;  2H8E A;  5EIB D;  4TUY A;  4NQ3 A;  1M1K H;  5EB0 A;  4B62 A;  3RYI A;  5HP8 A;  2AIZ P;  3ZP4 A;  2L26 A;  2VAW A;  5KX5 A;  2Z01 A;  1RQ7 A;  5CA0 A;  4O4L B;  5LP6 C;  3JAT B;  2RHH A;  1W5B A;  3M4S A;  2V9Y A;  4E6E A;  4ZI7 A;  2PHN A;  2BO1 A;  5JCO C;  1IV1 A;  2Q1Y A;  3FPI A;  3M84 A;  4O2B B;  1VQO F;  3MCQ A;  3NK6 A;  5LP6 B;  3CXC F;  1U3P A;  3KJK A;  3QTY A;  5IJ0 A;  3HKB B;  1W55 A;  3JAS B;  2LBX A;  4WBN B;  2LBW A;  5LYJ B;  5JCO A;  5J2T B;  2RHJ A;  3ERN A;  2B33 A;  1VQL F;  3WPW A;  4C82 A;  4BT3 A;  1JD1 A;  2BTQ B;  2R6R 1;  3ELC A;  4TV9 A;  1Z5W A;  5FNV B;  3CPW F;  4ERH A;  2PMP A;  3N2G A;  2IG8 A;  2GVI A;  3JAK B;  5ITZ B;  3CCQ F;  5JH7 B;  3JCM M;  3E1Y A;  4TV8 A;  4O4J A;  4LNU B;  3CCR F;  4ZHQ A;  3CD6 F;  3HKE B;  2KTV A;  1IV4 A;  2ZOV A;  2ZVZ A;  3ZP7 A;  2HVY D;  1M90 H;  5LXT A;  3JVH A;  3S0H A;  4G88 A;  3G6E F;  4WBN A;  2RB9 A;  5CA1 B;  1KNK A;  3C9S A;  5IYZ A;  1IV3 A;  3FD6 A;  3HTN A;  3I55 F;  2F9Z C;  1SDS A;  1GX1 A;  4IHJ B;  3WJR A;  4KWE A;  3LWP C;  1X52 A;  4I55 A;  2HX0 A;  2ZAU A;  2AMT A;  4TV8 B;  5IT9 M;  4U39 A;  3NMU C;  2YXZ A;  3LWQ C;  3CC4 F;  2VXY A;  3AGK A;  3RE3 A;  1Q8R A;  3F6M A;  2Q1X A;  2VAM A;  4ZOL A;  4EB6 A;  3FD5 A;  5G4V C;  1X25 A;  2KGW A;  1YGY A;  1FFX B;  3F0E A;  3PLA C;  3QHD A;  2RHL A;  1JFF A;  3K14 A;  1IPA A;  2CHT A;  3G71 F;  4O4I B;  3NVI B;  2HS4 A;  5EZY A;  3J81 M;  3RYC A;  5AVM A;  4O4H B;  4I50 B;  1FSZ A;  1NQ3 A;  3T80 A;  3I56 F;  4YJ2 B;  2VGN A;  5CA0 B;  4X1I A;  4BVT A;  5FLX M;  1TUB B;  3MQW A;  1Z5V A;  3VYS C;  1VQV A;  1YJ9 F;  3CC7 F;  5HY1 A;  3V3T A;  3LWO C;  3LDT A;  2ALE A;  4C8I A;  3HKC A;  3I7T A;  3J7A R;  4C4W C;  1W42 A;  3JAL B;  1H48 A;  3IEQ A;  3UT5 A;  3NVK E;  3O85 A;  3JAR B;  5EB1 B;  1COM A;  3C9U A;  2I6R A;  5CA1 A;  3FBA A;  5LYJ A;  3P0Z A;  3RYI B;  4YJ2 A;  1W41 A;  3V4D A;  2HS3 A;  3NK7 A;  3ZO8 A;  5HXU A;  2N48 A;  4BW0 B;  3OON A;  3CCM F;  1J7H A;  2BTU A;  4EI9 A;  3JAW B;  3SIU A;  3IEW A;  4YJ3 A;  1VQ5 F;  2HQS C;  2QI2 A;  4G4X A;  3VYU C;  4X1K A;  3HKE A;  5GIN C;  3KE1 A;  5GON A;  5MN6 A;  1W3E X;  3P4E A;  3F0D A;  5GIO C;  1DBF A;  1QVF F;  3V7E A;  2QA4 F;  5DCV A;  3VOB A;  3LYB A;  1W5F A;  1GZ0 A;  1ZWZ A;  2UYN B;  4BT7 A;  4O4H A;  2IAF A;  3DDN A;  3C9T A;  2OHW A;  3D54 A;  3FFM A;  2R75 1;  3R0P A;  3S03 A;  4LCK A;  3CCU F;  2LBT A;  2GZL A;  5LOV B;  2WAL A;  3WGJ A;  1RLU A;  3N2K B;  4NWO B;  5JH7 A;  1K8A H;  3MCA B;  4HNA B;  1VH8 A;  3KHN A;  4LNU A;  3S0Y A;  3CCV F;  3WJP A;  2CHS A;  5ITZ A;  4ZOL B;  4EB6 B;  1CN7 A;  2LCA A;  2HRU A;  3N2G B;  3BYQ A;  3F0F A;  1XHO A;  4X3L A;  5HY0 A;  3OW2 F;  4ZHV A;  1TVK B;  1RA4 A;  1X7P A;  3KIZ A;  1PF5 A;  5HY4 A;  2MQE A;  4I50 A;  3SIV A;  2G9I A;  2KTU A;  5LOV A;  2QTP A;  1VQN F;  3CCE F;  1KC8 H;  2ZOD A;  3GYQ A;  5C8Y A;  4NUT A;  5EO3 A;  3G4S F;  2UYK A;  1NJI H;  4O2A B;  2K1S A;  5BMV A;  4RQO A;  4EI7 A;  1RLG A;  4U3J B;  3CPQ A;  1VQ8 F;  3VIU A;  3HKC B;  3HJW C;  2UZH A;  1YIJ F;  3VI6 A;  3JAL A;  1QD9 A;  1S72 F;  3N4Z A;  1W59 A;  1E7K A;  4BT4 A;  3HKD A;  4ZHQ B;  5GON B;  2CVL A;  1XV2 A;  3ZOP A;  3CYQ A;  2KG4 A;  3UT5 B;  2DYY A;  2NMU A;  1CLI A;  2CSL A;  3E20 B;  1K73 H;  3RYH B;  3CCJ F;  3EOR A;  3IKF A;  1JJ2 F;  5IYZ B;  5EYP A;  5HP7 A;  4C8G A;  4ZHW A;  1IV2 A;  1QVG F;  3D00 A;  3WGK A;  3Q8H A;  4PWT A;  3I3F A;  4G4Y A;  3OBY A;  2AIF A;  3OBW A;  1GO0 A;  5HWE A;  1Q7Y H;  4X3M A;  5GAN K;  3CG6 A;  2FGY A;  5JQG A;  2Z1U A;  3JAR A;  1PXW A;  2HS0 A;  1KQS F;  5EIB C;  3E22 B;  4BVR A;  3DC2 A;  3K12 A;  3LME A;  3HWU A;  4X20 B;  5CB4 B;  2OTJ F;  3RA6 A;  3LWV C;  3LWR C;  3CB2 A;  5FJ4 C;  4G4V A;  2UYN A;  1Q81 H;  5EZY B;  4X1Y B;  1SA0 A;  2CZW A;  4G4Z A;  1QU9 A;  2EWC A;  3JAW A;  3IMP A;  5J2U A;  1VQP F;  4O2A A;  5BMV B;  3C9R A;  4YJ3 B;  2GLZ A;  1KD1 H;  3C8L A;  1OFU A;  2HP0 B;  2HRY A;  1TUB A;  5LA6 B;  3RYF B;  4X1K B;  3CC2 F;  4FFB A;  1OAP A;  5JVD A;  2P6Y A;  5KMG A;  3CYP B;  4ZHY B;  1VQK F;  2Z1T A;  1DT9 A;  1YI2 F;  1SZQ A;  3TD5 A;  1N8R H;  3CME F;  3VYT C;  3WJQ A;  1W2B F;  1H7M A;  3S0W A;  4C81 A;  5HY2 A;  3VOA A;  3RYH A;  4BVQ A;  4TZZ A;  5J2T A;  2RHO A;  2H8C A;  3WGL A;  2Z1F A;  3VTI C;  1FNJ A;  3K2X A;  3JAT A;  4ZK7 A;  4I4T B;  4O4L A;  2VAP A;  1JY8 A;  2OTM A;  4BT6 A;  1JN1 A;  1U3L A;  1T0A A;  4HNA A;  1YIT F;  2H6L A;  2QEX F;  2FC3 A;  1QAH A;  3N2K A;  4C8E A;  2I6D A;  1UI9 A;  4DRX A;  5MN5 A;  3HKB A;  1W40 A;  1W57 A;  3N4Y A;  3HAX D;  3JAM M;  2OTL F;  1VQ9 F;  5HXZ A;  5LP6 A;  5EAZ A;  4RHA A;  3TD3 A;  4IIJ B;  1NMU B;  1Q82 H;  5MN4 A;  4TUY B;  1TVK A;  1Q86 H;  4I55 B;  3JAS A;  3MDO A;  1VHA A;  1KNJ A;  3CCL F;  3D01 A;  1YQN A;  3RA5 A;  3P10 A;  5A2Q M;  1W58 1;  3JAK A;  4M8I A;  4F6R B;  3ESJ A;  5C8Y B;  4U3J A;  5G4U C;  4ZI7 B;  3VO8 A;  4G4W A;  1VK3 A;  5JVD B;  1U43 A;  5KMG B;  2Z1E A;  3IKE A;  5IJ9 A;  4O2B A;  3MBM A;  5EWR A;  2UYJ A;  3QUW A;  3HKD B;  3IR9 A;  5EYP B;  3CCS F;  3VMF B;  1ODE A;  2IQQ A;  1GO1 A;  3V7Q A;  3LFO A;  3KJJ A; 
#chains in the Genus database with same CATH homology
 2PMP A;  1VH8 A;  2AMT A;  1IV1 A;  3KE1 A;  3FPI A;  3FBA A;  3GHZ A;  3ESJ A;  1IV2 A;  4C8G A;  3P0Z A;  3T80 A;  3B6N A;  3F0D A;  4C81 A;  3Q8H A;  3F0F A;  3F0G A;  5B8F A;  1U3P A;  1U43 A;  2UZH A;  1IV4 A;  3IKE A;  1W57 A;  3RE3 A;  3F6M A;  3JVH A;  3MBM A;  1W55 A;  1U40 A;  3K2X A;  1KNK A;  3F0E A;  3QHD A;  3ERN A;  1JY8 A;  4C8I A;  3IEW A;  1JN1 A;  1U3L A;  1IV3 A;  3K14 A;  1T0A A;  1VHA A;  4C82 A;  1KNJ A;  2GZL A;  1GX1 A;  1H47 A;  1H48 A;  1YQN A;  3ELC A;  3EOR A;  4C8E A;  3IEQ A;  3P10 A;  3IKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...