1H47A

Structures of mecp synthase in complex with (i) cmp and (ii) cmp and product
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-METHYL-D-ERYTHRITOL-2,4-CYCLODIPHOSPHATE SYNTHASE
publication title The Identification of Isoprenoids that Bind in the Intersubunit Cavity of Escherichia Coli 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase by Complementary Biophysical Methods
pubmed doi rcsb
source organism Escherichia coli
molecule tags Synthase
total genus 47
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1h47A00
4C8GA 3F0GA 3F0FA 1GX1A 1VH8A 3EORA 3F0EA 3T80A 3RE3A 2UZHA 1U3LA 3P10A 3QHDA 3K2XA 2AMTA 3ESJA 1IV1A 1KNJA 4C81A 3Q8HA 1VHAA 3FBAA 3FPIA 3B6NA 3GHZA 4C82A 4C8IA 1T0AA 1W55A 2PMPA 3ELCA 3IKEA 1IV2A 1U40A 3IKFA 3K14A 1H48A 4C8EA 3P0ZA 3ERNA 5B8FA 1IV3A 1YQNA 3MBMA 1H47A 3JVHA 2GZLA 1JN1A 1IV4A 1KNKA 1JY8A 3IEWA 1W57A 1U43A 3KE1A 3IEQA 3F0DA 3F6MA 1U3PA
chains in the Genus database with same CATH superfamily
1VQLF 3V7EA 4TUYA 3N2KB 3V4DA 3S03A 2KGWA 4E6EA 3NMUC 4ZOLA 5DCVA 1JFFB 4U3JA 4FFBA 3Q8HA 3HKEA 3MDOA 3JCMM 3JAMM 4ZHQB 1W55A 1KC8H 5HP7A 2HP3A 1YI2F 2N48A 3E22B 5IJ0A 5KX5A 1W41A 2YYEA 1UI9A 4BVTA 3M84A 3WXMB 2HX0A 1W5BA 3LWVC 5GINC 3CCQF 2HS3A 4C81A 5BMVA 3SIUA 3F0GA 3LWOC 3WJQA 3EORA 2LCAA 3RYCA 3HKDA 2BO1A 2MQEA 1IV1A 3RYHB 3JASB 3I3FA 1VK3A 3WGMA 5J2TB 5GANK 4BVSA 4ZK7A 1RA4A 4O2BA 3LWPC 3VI6A 4X1IB 2IAFA 2V9YA 1Z5WA 3J81M 3CB2A 4ZHVA 1Q82H 4C4WC 3HWUA 3F6MA 5G4UC 1YJ9F 2QTPA 5CB4B 2KTUA 1FFXB 5HXZA 5GIPC 5J2UB 4U39A 4X1KB 2UYNB 3V7QA 2G9IA 2OHWA 1OFUA 1E7KA 3ZP4A 5LP6C 4TV9A 2UYKA 3MCQA 1QVFF 4RQOA 4YJ3B 3CYQA 1DT9A 2KTVA 1NMUB 1GO1A 4XCQA 5EWRA 3F0DA 4NWOB 4YJ2A 3OW2F 1RLGA 5EYPA 5JH7A 3JALA 4O4HB 4BT2A 3VMFB 3S0WA 5A2QM 2H8CA 5EB1B 3HAXD 4HNAB 1JJ2F 1QAHA 1TVKA 2GLZA 2RHOA 3MCAB 5AVMA 2Z1EA 3G71F 2VAWA 4EI8A 5MN6A 1SA0A 4C8IA 3LWQC 5IYZA 3D01A 3ELCA 2LBWA 4G4ZA 2ZVZA 4O4IA 4ZI7B 1GZ0A 5ITZA 3K12A 3HKBB 2YXZA 5EAZA 5GIOC 4F6RA 3CCRF 3TD3A 3RA5A 2IQQA 3LYBA 3LMEA 1VQPF 1KNKA 3ZOPA 1VQ9F 4BY9D 3J7AR 2LBTA 4BT7A 4BVRA 1U43A 4IIJB 3IR9A 4LNUA 3N2GA 3CCEF 1U3PA 2ZF8A 4BT5A 3WGLA 3J80M 2RHJA 1TUBA 2BTQB 4I50A 3RYIA 5JQGB 1VQ8F 4B46A 1FNKA 4EB6B 3HJWC 1KNJA 1H7MA 2CW4A 4G4VA 1COMA 3JAWB 3CMEF 3C9SA 2F9ZC 2K1SA 1W5FA 2CSLA 5HP8A 3CCUF 3K0TA 4RHAA 2GZLA 1JN1A 5LXTA 3IEQA 1W5AA 1ZWZA 3VOAA 1U3LA 1DBFA 2Q1XA 1XBIA 3NVIB 3D00A 2FGYA 2AMTA 2CVLA 2UYJA 5C8YA 5CA1B 3CCLF 1Q81H 5MN5A 3IMPA 3S06A 3GHZA 3N2KA 5JVDA 2OTMA 3IKEA 2RHHA 4X20A 3VYTC 1IV2A 1JFFA 3JATB 2EWCA 1RQ2A 3OBWA 1H47A 5HXUA 2DYYA 4TUYB 4TZZA 1VQ5F 4NQ3A 4TV8A 4ZOLB 3WJRA 3M1XA 1GX1A 4FFBB 4U3JB 1VH8A 1XHOA 1YJWF 3HKEB 3ZO8A 2HRUA 5IJ0B 4LCKA 1SZQA 4G88A 3WGKA 1PXWA 5LOVB 3CD6F 1VQKF 1X7PA 3I56F 1Q7YH 3R0PA 1U40A 3C9TA 3VTIC 3KHNA 2ZODA 1RQ7A 1K8AH 1IV4A 4BVQA 3WGNA 3RYCB 2Z1TA 3HKDB 2QA4F 5EIBD 2QEXF 5FNVA 3O85A 3QUWA 5FLXM 5FJ4C 3BYQA 3QHDA 5KMGA 1VQVA 1YHQF 3OBYA 5HY2A 4M8IA 4O2BB 1IPAA 3VCZA 3KJJA 3CC7F 1PF5A 1S72F 2ZOVA 1W59A 1QU9A 5GAPK 3FD5A 1QVGF 2IG8A 5LA6A 3UT5A 3NK7A 3MBMA 1VQMF 1ONIA 2KG4A 3I55F 3ON1A 4IHJA 4X1YB 3S02A 3F0FA 1YJNF 5LYJA 3F0EA 3WPXA 3HTNA 3LDTA 3N4ZA 3WGJA 4I4TA 5HY1A 3FBAA 3FPIA 5GONA 1QD9A 4KWEA 3CCSF 5EZYA 2PMPA 4ZHYB 3JAKA 3CG6A 5LP6A 4DRXA 1W42A 1H48A 1SDSA 3MQWA 3QTYA 3RYFB 2NMUA 4YJ2B 1CLIA 4O2AB 5EYPB 2B33A 1W2BF 1J7HA 1Q8RA 5CA0A 2HP0B 3L7QA 2P6YA 1Q86H 1TVKB 3VIUA 1YITF 1FNJA 4O4JA 1YIJF 4DXDA 3FFMA 2JNBA 1M1KH 5IYZB 2HS0A 3E1YA 5ITZB 2L26A 3G4SF 5JCOC 5JQGA 3AGKA 4ZHWA 1K73H 2R751 4LNUB 5B8FA 2BTUA 2CHSA 1TUBB 3JARA 4I50B 2LBXA 3RYIB 5IJ9B 2CWJA 3KE1A 4I55A 3DC2A 3WPWA 4G4WA 3T80A 4ERHA 2W8BC 4WBNA 3RYFA 3GTZA 5G4VC 4O4LB 4G4YA 1VHAA 1R1MA 4C82A 2ZAUA 5EB0A 4BT6A 3OONA 5CA1A 2VGNA 2FC3A 3HKCB 3TD4A 1GO0A 1JD1A 1M90H 1W581 3M4SA 3U0OA 4ZHQA 2DT4A 3CCMF 2H8EA 2RB9A 2Z1FA 3E22A 3IEWA 4B5CA 2PHNA 2Z1UA 3E20B 3VO8A 2RHLA 5EIBC 5C8YB 4EI7A 3CYPB 3CCJF 1CK2A 5JVDB 3PLAC 3K2XA 2VAMA 3NK6A 4X20B 3CC4F 3S0HA 5KX5B 1KD1H 3NVKE 4B62A 1UFYA 5LOVA 3RYHA 2GVIA 3JASA 4TV8B 1VQNF 1IV3A 5BMVB 5J2TA 5HY0A 3C9RA 1JY8A 2HS4A 4X1IA 1T0KB 1KQSF 3V3TA 3P10A 1VQOF 2QI2A 2WALA 5CB4A 2AIFA 3B6NA 1FFXA 5J2UA 3CC2F 4X1KA 5EO3A 1VQ7F 1RLUA 5IT9M 2UYNA 2R6R1 5FNVB 2Z01A 4X3MA 3G6EF 2VGMA 3ZP7A 1X7OA 5KMGB 3VYUC 1NQ3A 2ALEA 2H6LA 3P4EA 4YJ3A 4G4XA 4X1YA 3CMAF 1K9MH 2BTOA 3RA6A 4TV9B 2UYPA 3WJPA 1VQ6F 1XRGA 5LA6B 3UT5B 2I6DA 4O4HA 4HNAA 1CN7A 3N4YA 3K14A 4IHJB 5HWEA 1FSZA 2HRYA 3D54A 1N8RH 3PAFA 5LYJB 3JVHA 4ZI7A 5JH7B 3JALB 3HKBA 3CXCF 4C8EA 2OTJF 2CHTA 3I7TA 4O2AA 1W5EA 4NUTA 3VYSC 4I4TB 5GONB 5EZYB 2HP0A 1VQ4F 1X52A 3JAKB 1SA0B 4IIJA 5LP6B 4DRXB 4B45A 2HQSC 4BT4A 4O4IB 3KIZA 1T0AA 3GYQA 4F6RB 2HVYD 5HY4A 4EB6A 3CPWF 3IKFA 3TD5A 5CA0B 1Z5VA 3P0ZA 1W3EX 3C9UA 4O4JB 1YQNA 3JAWA 3N2GB 1XV2A 4R40B 2OZBA 3DDNA 1OAPA 4X3LA 1ODEA 4C8GA 1W40A 3LWRC 3SIVA 3RE3A 2OTLF 2UZHA 2CZWA 5IJ9A 3VOBA 2I6RA 4EI9A 3ESJA 4BW0B 3CCVF 4PWTA 2VXYA 5JCOA 5MN4A 3C8LA 3KJKA 3JARB 1YGYA 4O4LA 1NJIH 3S0YA 2AIZP 4I55B 5LXTB 4BT3A 2ZVYA 1X25A 3HKCA 2Q1YA 3LFOA 3JATA 4WBNB 1W57A 3ERNA 2VAPA 3CPQA 3FD6A
chains in the Genus database with same CATH topology
4C8GA 3F0GA 3F0FA 1GX1A 1VH8A 3EORA 3F0EA 3T80A 3RE3A 2UZHA 1U3LA 3P10A 3QHDA 3K2XA 2AMTA 3ESJA 1IV1A 1KNJA 4C81A 3Q8HA 1VHAA 3FBAA 3FPIA 3B6NA 3GHZA 4C82A 4C8IA 1T0AA 1W55A 2PMPA 3ELCA 3IKEA 1IV2A 1U40A 3IKFA 3K14A 1H48A 4C8EA 3P0ZA 3ERNA 5B8FA 1IV3A 1YQNA 3MBMA 1H47A 3JVHA 2GZLA 1JN1A 1IV4A 1KNKA 1JY8A 3IEWA 1W57A 1U43A 3KE1A 3IEQA 3F0DA 3F6MA 1U3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8G A;  3F0G A;  3F0F A;  1GX1 A;  1VH8 A;  3EOR A;  3F0E A;  3T80 A;  3RE3 A;  2UZH A;  1U3L A;  3P10 A;  3QHD A;  3K2X A;  2AMT A;  3ESJ A;  1IV1 A;  1KNJ A;  4C81 A;  3Q8H A;  1VHA A;  3FBA A;  3FPI A;  3B6N A;  3GHZ A;  4C82 A;  4C8I A;  1T0A A;  1W55 A;  2PMP A;  3ELC A;  3IKE A;  1IV2 A;  1U40 A;  3IKF A;  3K14 A;  1H48 A;  4C8E A;  3P0Z A;  3ERN A;  5B8F A;  1IV3 A;  1YQN A;  3MBM A;  1H47 A;  3JVH A;  2GZL A;  1JN1 A;  1IV4 A;  1KNK A;  1JY8 A;  3IEW A;  1W57 A;  1U43 A;  3KE1 A;  3IEQ A;  3F0D A;  3F6M A;  1U3P A; 
#chains in the Genus database with same CATH topology
 1VQL F;  3V7E A;  4TUY A;  3N2K B;  3V4D A;  3S03 A;  2KGW A;  4E6E A;  3NMU C;  4ZOL A;  5DCV A;  1JFF B;  4U3J A;  4FFB A;  3Q8H A;  3HKE A;  3MDO A;  3JCM M;  3JAM M;  4ZHQ B;  1W55 A;  1KC8 H;  5HP7 A;  2HP3 A;  1YI2 F;  2N48 A;  3E22 B;  5IJ0 A;  5KX5 A;  1W41 A;  2YYE A;  1UI9 A;  4BVT A;  3M84 A;  3WXM B;  2HX0 A;  1W5B A;  3LWV C;  5GIN C;  3CCQ F;  2HS3 A;  4C81 A;  5BMV A;  3SIU A;  3F0G A;  3LWO C;  3WJQ A;  3EOR A;  2LCA A;  3RYC A;  3HKD A;  2BO1 A;  2MQE A;  1IV1 A;  3RYH B;  3JAS B;  3I3F A;  1VK3 A;  3WGM A;  5J2T B;  5GAN K;  4BVS A;  4ZK7 A;  1RA4 A;  4O2B A;  3LWP C;  3VI6 A;  4X1I B;  2IAF A;  2V9Y A;  1Z5W A;  3J81 M;  3CB2 A;  4ZHV A;  1Q82 H;  4C4W C;  3HWU A;  3F6M A;  5G4U C;  1YJ9 F;  2QTP A;  5CB4 B;  2KTU A;  1FFX B;  5HXZ A;  5GIP C;  5J2U B;  4U39 A;  4X1K B;  2UYN B;  3V7Q A;  2G9I A;  2OHW A;  1OFU A;  1E7K A;  3ZP4 A;  5LP6 C;  4TV9 A;  2UYK A;  3MCQ A;  1QVF F;  4RQO A;  4YJ3 B;  3CYQ A;  1DT9 A;  2KTV A;  1NMU B;  1GO1 A;  4XCQ A;  5EWR A;  3F0D A;  4NWO B;  4YJ2 A;  3OW2 F;  1RLG A;  5EYP A;  5JH7 A;  3JAL A;  4O4H B;  4BT2 A;  3VMF B;  3S0W A;  5A2Q M;  2H8C A;  5EB1 B;  3HAX D;  4HNA B;  1JJ2 F;  1QAH A;  1TVK A;  2GLZ A;  2RHO A;  3MCA B;  5AVM A;  2Z1E A;  3G71 F;  2VAW A;  4EI8 A;  5MN6 A;  1SA0 A;  4C8I A;  3LWQ C;  5IYZ A;  3D01 A;  3ELC A;  2LBW A;  4G4Z A;  2ZVZ A;  4O4I A;  4ZI7 B;  1GZ0 A;  5ITZ A;  3K12 A;  3HKB B;  2YXZ A;  5EAZ A;  5GIO C;  4F6R A;  3CCR F;  3TD3 A;  3RA5 A;  2IQQ A;  3LYB A;  3LME A;  1VQP F;  1KNK A;  3ZOP A;  1VQ9 F;  4BY9 D;  3J7A R;  2LBT A;  4BT7 A;  4BVR A;  1U43 A;  4IIJ B;  3IR9 A;  4LNU A;  3N2G A;  3CCE F;  1U3P A;  2ZF8 A;  4BT5 A;  3WGL A;  3J80 M;  2RHJ A;  1TUB A;  2BTQ B;  4I50 A;  3RYI A;  5JQG B;  1VQ8 F;  4B46 A;  1FNK A;  4EB6 B;  3HJW C;  1KNJ A;  1H7M A;  2CW4 A;  4G4V A;  1COM A;  3JAW B;  3CME F;  3C9S A;  2F9Z C;  2K1S A;  1W5F A;  2CSL A;  5HP8 A;  3CCU F;  3K0T A;  4RHA A;  2GZL A;  1JN1 A;  5LXT A;  3IEQ A;  1W5A A;  1ZWZ A;  3VOA A;  1U3L A;  1DBF A;  2Q1X A;  1XBI A;  3NVI B;  3D00 A;  2FGY A;  2AMT A;  2CVL A;  2UYJ A;  5C8Y A;  5CA1 B;  3CCL F;  1Q81 H;  5MN5 A;  3IMP A;  3S06 A;  3GHZ A;  3N2K A;  5JVD A;  2OTM A;  3IKE A;  2RHH A;  4X20 A;  3VYT C;  1IV2 A;  1JFF A;  3JAT B;  2EWC A;  1RQ2 A;  3OBW A;  1H47 A;  5HXU A;  2DYY A;  4TUY B;  4TZZ A;  1VQ5 F;  4NQ3 A;  4TV8 A;  4ZOL B;  3WJR A;  3M1X A;  1GX1 A;  4FFB B;  4U3J B;  1VH8 A;  1XHO A;  1YJW F;  3HKE B;  3ZO8 A;  2HRU A;  5IJ0 B;  4LCK A;  1SZQ A;  4G88 A;  3WGK A;  1PXW A;  5LOV B;  3CD6 F;  1VQK F;  1X7P A;  3I56 F;  1Q7Y H;  3R0P A;  1U40 A;  3C9T A;  3VTI C;  3KHN A;  2ZOD A;  1RQ7 A;  1K8A H;  1IV4 A;  4BVQ A;  3WGN A;  3RYC B;  2Z1T A;  3HKD B;  2QA4 F;  5EIB D;  2QEX F;  5FNV A;  3O85 A;  3QUW A;  5FLX M;  5FJ4 C;  3BYQ A;  3QHD A;  5KMG A;  1VQV A;  1YHQ F;  3OBY A;  5HY2 A;  4M8I A;  4O2B B;  1IPA A;  3VCZ A;  3KJJ A;  3CC7 F;  1PF5 A;  1S72 F;  2ZOV A;  1W59 A;  1QU9 A;  5GAP K;  3FD5 A;  1QVG F;  2IG8 A;  5LA6 A;  3UT5 A;  3NK7 A;  3MBM A;  1VQM F;  1ONI A;  2KG4 A;  3I55 F;  3ON1 A;  4IHJ A;  4X1Y B;  3S02 A;  3F0F A;  1YJN F;  5LYJ A;  3F0E A;  3WPX A;  3HTN A;  3LDT A;  3N4Z A;  3WGJ A;  4I4T A;  5HY1 A;  3FBA A;  3FPI A;  5GON A;  1QD9 A;  4KWE A;  3CCS F;  5EZY A;  2PMP A;  4ZHY B;  3JAK A;  3CG6 A;  5LP6 A;  4DRX A;  1W42 A;  1H48 A;  1SDS A;  3MQW A;  3QTY A;  3RYF B;  2NMU A;  4YJ2 B;  1CLI A;  4O2A B;  5EYP B;  2B33 A;  1W2B F;  1J7H A;  1Q8R A;  5CA0 A;  2HP0 B;  3L7Q A;  2P6Y A;  1Q86 H;  1TVK B;  3VIU A;  1YIT F;  1FNJ A;  4O4J A;  1YIJ F;  4DXD A;  3FFM A;  2JNB A;  1M1K H;  5IYZ B;  2HS0 A;  3E1Y A;  5ITZ B;  2L26 A;  3G4S F;  5JCO C;  5JQG A;  3AGK A;  4ZHW A;  1K73 H;  2R75 1;  4LNU B;  5B8F A;  2BTU A;  2CHS A;  1TUB B;  3JAR A;  4I50 B;  2LBX A;  3RYI B;  5IJ9 B;  2CWJ A;  3KE1 A;  4I55 A;  3DC2 A;  3WPW A;  4G4W A;  3T80 A;  4ERH A;  2W8B C;  4WBN A;  3RYF A;  3GTZ A;  5G4V C;  4O4L B;  4G4Y A;  1VHA A;  1R1M A;  4C82 A;  2ZAU A;  5EB0 A;  4BT6 A;  3OON A;  5CA1 A;  2VGN A;  2FC3 A;  3HKC B;  3TD4 A;  1GO0 A;  1JD1 A;  1M90 H;  1W58 1;  3M4S A;  3U0O A;  4ZHQ A;  2DT4 A;  3CCM F;  2H8E A;  2RB9 A;  2Z1F A;  3E22 A;  3IEW A;  4B5C A;  2PHN A;  2Z1U A;  3E20 B;  3VO8 A;  2RHL A;  5EIB C;  5C8Y B;  4EI7 A;  3CYP B;  3CCJ F;  1CK2 A;  5JVD B;  3PLA C;  3K2X A;  2VAM A;  3NK6 A;  4X20 B;  3CC4 F;  3S0H A;  5KX5 B;  1KD1 H;  3NVK E;  4B62 A;  1UFY A;  5LOV A;  3RYH A;  2GVI A;  3JAS A;  4TV8 B;  1VQN F;  1IV3 A;  5BMV B;  5J2T A;  5HY0 A;  3C9R A;  1JY8 A;  2HS4 A;  4X1I A;  1T0K B;  1KQS F;  3V3T A;  3P10 A;  1VQO F;  2QI2 A;  2WAL A;  5CB4 A;  2AIF A;  3B6N A;  1FFX A;  5J2U A;  3CC2 F;  4X1K A;  5EO3 A;  1VQ7 F;  1RLU A;  5IT9 M;  2UYN A;  2R6R 1;  5FNV B;  2Z01 A;  4X3M A;  3G6E F;  2VGM A;  3ZP7 A;  1X7O A;  5KMG B;  3VYU C;  1NQ3 A;  2ALE A;  2H6L A;  3P4E A;  4YJ3 A;  4G4X A;  4X1Y A;  3CMA F;  1K9M H;  2BTO A;  3RA6 A;  4TV9 B;  2UYP A;  3WJP A;  1VQ6 F;  1XRG A;  5LA6 B;  3UT5 B;  2I6D A;  4O4H A;  4HNA A;  1CN7 A;  3N4Y A;  3K14 A;  4IHJ B;  5HWE A;  1FSZ A;  2HRY A;  3D54 A;  1N8R H;  3PAF A;  5LYJ B;  3JVH A;  4ZI7 A;  5JH7 B;  3JAL B;  3HKB A;  3CXC F;  4C8E A;  2OTJ F;  2CHT A;  3I7T A;  4O2A A;  1W5E A;  4NUT A;  3VYS C;  4I4T B;  5GON B;  5EZY B;  2HP0 A;  1VQ4 F;  1X52 A;  3JAK B;  1SA0 B;  4IIJ A;  5LP6 B;  4DRX B;  4B45 A;  2HQS C;  4BT4 A;  4O4I B;  3KIZ A;  1T0A A;  3GYQ A;  4F6R B;  2HVY D;  5HY4 A;  4EB6 A;  3CPW F;  3IKF A;  3TD5 A;  5CA0 B;  1Z5V A;  3P0Z A;  1W3E X;  3C9U A;  4O4J B;  1YQN A;  3JAW A;  3N2G B;  1XV2 A;  4R40 B;  2OZB A;  3DDN A;  1OAP A;  4X3L A;  1ODE A;  4C8G A;  1W40 A;  3LWR C;  3SIV A;  3RE3 A;  2OTL F;  2UZH A;  2CZW A;  5IJ9 A;  3VOB A;  2I6R A;  4EI9 A;  3ESJ A;  4BW0 B;  3CCV F;  4PWT A;  2VXY A;  5JCO A;  5MN4 A;  3C8L A;  3KJK A;  3JAR B;  1YGY A;  4O4L A;  1NJI H;  3S0Y A;  2AIZ P;  4I55 B;  5LXT B;  4BT3 A;  2ZVY A;  1X25 A;  3HKC A;  2Q1Y A;  3LFO A;  3JAT A;  4WBN B;  1W57 A;  3ERN A;  2VAP A;  3CPQ A;  3FD6 A; 
#chains in the Genus database with same CATH homology
 4C8G A;  3F0G A;  3F0F A;  1GX1 A;  1VH8 A;  3EOR A;  3F0E A;  3T80 A;  3RE3 A;  2UZH A;  1U3L A;  3P10 A;  3QHD A;  3K2X A;  2AMT A;  3ESJ A;  1IV1 A;  1KNJ A;  4C81 A;  3Q8H A;  1VHA A;  3FBA A;  3FPI A;  3B6N A;  3GHZ A;  4C82 A;  4C8I A;  1T0A A;  1W55 A;  2PMP A;  3ELC A;  3IKE A;  1IV2 A;  1U40 A;  3IKF A;  3K14 A;  1H48 A;  4C8E A;  3P0Z A;  3ERN A;  5B8F A;  1IV3 A;  1YQN A;  3MBM A;  1H47 A;  3JVH A;  2GZL A;  1JN1 A;  1IV4 A;  1KNK A;  1JY8 A;  3IEW A;  1W57 A;  1U43 A;  3KE1 A;  3IEQ A;  3F0D A;  3F6M A;  1U3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...