1H47A

Structures of mecp synthase in complex with (i) cmp and (ii) cmp and product
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Identification of Isoprenoids that Bind in the Intersubunit Cavity of Escherichia Coli 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase by Complementary Biophysical Methods
pubmed doi rcsb
molecule keywords 2C-METHYL-D-ERYTHRITOL-2,4-CYCLODIPHOSPHATE SYNTHASE
molecule tags Synthase
source organism Escherichia coli
total genus 47
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1h47A00
3F0FA 3IEWA 4C8EA 1H47A 3EORA 3B6NA 3F0DA 1VH8A 3RE3A 1JY8A 4C8GA 1VHAA 4C82A 3QHDA 3F0EA 3Q8HA 3P10A 2UZHA 1IV3A 3ELCA 3IEQA 1U3PA 3MBMA 3GHZA 3ESJA 3P0ZA 1IV1A 3F6MA 1JN1A 1GX1A 2GZLA 1IV2A 1U40A 1W55A 1KNKA 3IKEA 1KNJA 3K2XA 3IKFA 1U3LA 3KE1A 2AMTA 1IV4A 3FBAA 1U43A 1YQNA 3ERNA 3FPIA 1T0AA 3K14A 3F0GA 3T80A 4C8IA 5B8FA 1H48A 3JVHA 1W57A 2PMPA 4C81A
chains in the Genus database with same CATH superfamily
3F0FA 1Q82H 4B5CA 1RLUA 3VOBA 4ZHQB 2NMUA 3B6NA 2LBTA 3CCQF 4C8GA 2HS4A 2LBXA 4BY9D 1T0KB 2MQEA 3WJPA 4LCKA 1W5EA 1W5AA 2KTVA 1W59A 3CG6A 5HY2A 1U3PA 4IHJB 3AGKA 3HKBA 4EI7A 2RHJA 2WALA 1VQ9F 3DDNA 3E22B 5JQGB 1U43A 2R751 3FPIA 2LBWA 3D54A 3JATB 1W57A 3VYTC 3JALA 3LWOC 4U3JB 1PXWA 5LYJA 5G4UC 1DT9A 1CN7A 5GONB 5LA6A 1SA0B 4F6RA 1X7OA 4X20B 5MN5A 5IJ9B 3Q8HA 1SZQA 3CCLF 1NJIH 2AIFA 5FJ4C 2OTJF 1W42A 3LWRC 1JD1A 2Z1UA 3WPWA 1U40A 4TV9B 1YI2F 1X52A 3LWVC 1NMUB 3FD6A 4ZOLA 5EIBD 1QD9A 2OHWA 5EWRA 3KJJA 2KTUA 3RA6A 1JY8A 1W2BF 1QAHA 3WXMB 4ZHVA 2RHLA 3JALB 4M8IA 3HAXD 4O2BA 3MBMA 1RLGA 1IPAA 5LYJB 1IV1A 5LA6B 3OBYA 1Q7YH 2GZLA 4O2AA 4F6RB 3CC4F 3MQWA 2PHNA 1VQKF 1OAPA 5LXTA 4ZI7A 3FBAA 1KC8H 4ZHWA 4NQ3A 2PMPA 3OONA 3S0YA 3KHNA 3J7AR 1SDSA 3RE3A 2QA4F 3JARB 3N4YA 2V9YA 4BVQA 3RYHB 2Z01A 4O4HA 1JN1A 5IYZB 2I6RA 3MDOA 3E20B 1KNKA 3CMAF 3SIVA 1DBFA 3WJRA 1K9MH 4O2BB 3WPXA 5LP6C 3C9RA 3P0ZA 3FD5A 2QI2A 4RHAA 1XBIA 2HVYD 5LXTB 3D00A 4ZI7B 2BTQB 4IHJA 3N2KA 3UT5A 5HP8A 3F0EA 4I55A 3S03A 4NUTA 5C8YA 3WGKA 1IV3A 3E22A 1Z5WA 3F6MA 3JATA 2I6DA 2ZVZA 5IJ0A 1U3LA 3N2GB 4O4HB 3F0GA 1TUBB 3E1YA 3VCZA 1VQ8F 5IJ9A 4TUYA 1Q86H 4EI8A 4X3MA 1QVFF 1VHAA 1Q81H 1W581 2W8BC 4DRXA 1S72F 2VGNA 1RQ7A 4TV9A 2HRUA 3VOAA 2UZHA 2VAPA 2OTLF 3ZP7A 2CVLA 3V4DA 3HWUA 5ITZB 3N2KB 3UT5B 3CCJF 3VIUA 4YJ2B 5JVDA 3RYFB 2CW4A 3G4SF 4I55B 3CC7F 3CC2F 5C8YB 2DYYA 4BT7A 5GIPC 1GO1A 3JAMM 5IJ0B 5IT9M 3CCUF 5A2QM 2Z1FA 1CK2A 1RA4A 4X1KA 3CPWF 3DC2A 4G4ZA 2QTPA 3VO8A 4KWEA 1JJ2F 3TD3A 3WGNA 1CLIA 3NK7A 4TUYB 5JCOC 2GVIA 3ELCA 1X25A 5EB1B 3MCAB 3J80M 1M1KH 5EYPA 2HP3A 4DRXB 1K73H 4HNAA 4B62A 1W55A 2UYJA 3VYSC 3K2XA 4BVSA 3IKFA 5J2UA 3K0TA 4BT2A 4G4VA 3V3TA 2P6YA 4I50A 5BMVA 2CHTA 5JVDB 2L26A 2Q1XA 4XCQA 3WGLA 1RQ2A 2IQQA 3JARA 2KGWA 3RYHA 5LOVA 4B46A 5IYZA 3QHDA 2N48A 1KQSF 3LYBA 1R1MA 3QTYA 3IEQA 5GAPK 3CYPB 4NWOB 5LP6B 2UYPA 1UFYA 4X1KB 5CA1B 3HJWC 3N4ZA 1GX1A 1IV2A 3VTIC 1YIJF 1N8RH 3GYQA 2CHSA 3U0OA 1YGYA 2CZWA 1YJNF 3K14A 5EYPB 1H48A 2YYEA 4HNAB 3J81M 3CPQA 4C81A 1QVGF 4R40B 1VQLF 3ZOPA 2Z1TA 5MN6A 5J2UB 3IR9A 3LMEA 2HQSC 3D01A 4LNUA 1GO0A 1ODEA 4I50B 5EB0A 1NQ3A 5FNVA 5BMVB 5CA0B 4X1IA 1OFUA 3N2GA 3VMFB 3NK6A 5LOVB 1VQMF 1GZ0A 3OW2F 5JCOA 1TUBA 3C9TA 4B45A 1W5FA 3FFMA 3S0HA 3JASA 2BTOA 1E7KA 3CCEF 3I7TA 3BYQA 2QEXF 1Q8RA 3CCMF 2F9ZC 4X1YA 3RA5A 5JH7A 3I3FA 3V7EA 1J7HA 4TV8A 4I4TA 1VK3A 2YXZA 3OBWA 1W3EX 5ITZA 4YJ2A 3RYFA 3LWPC 2Z1EA 2H8EA 3NVKE 2HX0A 4LNUB 4BW0B 2BO1A 1COMA 3IKEA 5FNVB 1KNJA 2EWCA 4X1IB 2AMTA 2AIZP 5KMGB 3ESJA 5MN4A 4BT5A 3JASB 3ZP4A 3ZO8A 1PF5A 4G88A 2ZVYA 3KIZA 2CWJA 3CCSF 4X1YB 5GINC 1VQ4F 5JH7B 3C9SA 2B33A 4FFBB 3CD6F 3S06A 4TV8B 4I4TB 2VXYA 4ZHYB 4DXDA 1VQ6F 2FGYA 1XHOA 3KE1A 3RYIB 5HY4A 1KD1H 1IV4A 5B8FA 1Z5VA 1TVKA 3O85A 3JVHA 4EB6A 2FC3A 2G9IA 2HP0A 4O4IB 1JFFA 3CCRF 4BVRA 3JAWA 3ON1A 4YJ3B 5LP6A 5HWEA 3CCVF 5CA1A 3WGMA 3HKEA 1W40A 3P10A 4C4WC 3WJQA 4IIJA 4ZK7A 3MCQA 4TZZA 3K12A 3HKCA 5GIOC 1XV2A 3HKDA 5HXUA 2LCAA 3CYQA 3QUWA 2VAMA 2ZOVA 4O4JB 4RQOA 5CA0A 2ZF8A 3F0DA 3IMPA 1TVKB 1QU9A 4EB6B 3CXCF 2ZAUA 2HP0B 3M1XA 5FLXM 1JFFB 3JAWB 2JNBA 5CB4A 1VQOF 2RHHA 2CSLA 3JAKA 1YJWF 3HKEB 4PWTA 1ONIA 3CMEF 4G4XA 1X7PA 4BT3A 1UI9A 2RB9A 2HS0A 2HRYA 4IIJB 3HTNA 1YQNA 3ERNA 5EZYA 5AVMA 5G4VC 3S0WA 3HKBB 1ZWZA 3L7QA 3G6EF 3HKCB 2RHOA 3IEWA 1H47A 4E6EA 1FNJA 5HP7A 3HKDB 3VYUC 1VQ5F 5HY0A 2UYNA 5HXZA 2GLZA 2VAWA 1H7MA 3M84A 5EO3A 5KMGA 3C9UA 5KX5A 3GTZA 3LWQC 1FFXA 2IG8A 3I56F 5CB4B 3RYCA 3JAKB 3WGJA 2ALEA 3NMUC 4G4WA 3LDTA 2IAFA 1M90H 2KG4A 4BT6A 3VI6A 5EZYB 3PAFA 5J2TA 4FFBA 3CB2A 4WBNA 4ZOLB 4U39A 5GANK 1K8AH 3S02A 5DCVA 4O4LA 3RYIA 1YJ9F 3M4SA 1W5BA 4EI9A 3LFOA 1VQ7F 2H8CA 2UYNB 1FSZA 2Q1YA 4X3LA 4ZHQA 4BVTA 1FNKA 4O4IA 2OTMA 3T80A 5EIBC 2OZBA 1T0AA 4G4YA 4O2AB 2UYKA 4YJ3A 3G71F 3JCMM 4C8EA 4ERHA 1YHQF 1W41A 3SIUA 3KJKA 5KX5B 3EORA 1VH8A 2VGMA 2HS3A 1FFXB 2R6R1 3R0PA 1VQNF 4C82A 3RYCB 2DT4A 5HY1A 5EAZA 3V7QA 5JQGA 1YITF 2K1SA 3GHZA 1VQVA 5J2TB 1XRGA 4WBNB 2ZODA 4BT4A 3I55F 2H6LA 3PLAC 4U3JA 4O4JA 4O4LB 5GONA 2BTUA 3TD4A 3C8LA 1SA0A 4C8IA 3NVIB 4X20A 1VQPF 3P4EA 3TD5A
chains in the Genus database with same CATH topology
3F0FA 3IEWA 4C8EA 1H47A 3EORA 3B6NA 3F0DA 1VH8A 3RE3A 1JY8A 4C8GA 1VHAA 4C82A 3QHDA 3F0EA 3Q8HA 3P10A 2UZHA 1IV3A 3ELCA 3IEQA 1U3PA 3MBMA 3GHZA 3ESJA 3P0ZA 1IV1A 3F6MA 1JN1A 1GX1A 2GZLA 1IV2A 1U40A 1W55A 1KNKA 3IKEA 1KNJA 3K2XA 3IKFA 1U3LA 3KE1A 2AMTA 1IV4A 3FBAA 1U43A 1YQNA 3ERNA 3FPIA 1T0AA 3K14A 3F0GA 3T80A 4C8IA 5B8FA 1H48A 3JVHA 1W57A 2PMPA 4C81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0F A;  3IEW A;  4C8E A;  1H47 A;  3EOR A;  3B6N A;  3F0D A;  1VH8 A;  3RE3 A;  1JY8 A;  4C8G A;  1VHA A;  4C82 A;  3QHD A;  3F0E A;  3Q8H A;  3P10 A;  2UZH A;  1IV3 A;  3ELC A;  3IEQ A;  1U3P A;  3MBM A;  3GHZ A;  3ESJ A;  3P0Z A;  1IV1 A;  3F6M A;  1JN1 A;  1GX1 A;  2GZL A;  1IV2 A;  1U40 A;  1W55 A;  1KNK A;  3IKE A;  1KNJ A;  3K2X A;  3IKF A;  1U3L A;  3KE1 A;  2AMT A;  1IV4 A;  3FBA A;  1U43 A;  1YQN A;  3ERN A;  3FPI A;  1T0A A;  3K14 A;  3F0G A;  3T80 A;  4C8I A;  5B8F A;  1H48 A;  3JVH A;  1W57 A;  2PMP A;  4C81 A; 
#chains in the Genus database with same CATH topology
 3F0F A;  1Q82 H;  4B5C A;  1RLU A;  3VOB A;  4ZHQ B;  2NMU A;  3B6N A;  2LBT A;  3CCQ F;  4C8G A;  2HS4 A;  2LBX A;  4BY9 D;  1T0K B;  2MQE A;  3WJP A;  4LCK A;  1W5E A;  1W5A A;  2KTV A;  1W59 A;  3CG6 A;  5HY2 A;  1U3P A;  4IHJ B;  3AGK A;  3HKB A;  4EI7 A;  2RHJ A;  2WAL A;  1VQ9 F;  3DDN A;  3E22 B;  5JQG B;  1U43 A;  2R75 1;  3FPI A;  2LBW A;  3D54 A;  3JAT B;  1W57 A;  3VYT C;  3JAL A;  3LWO C;  4U3J B;  1PXW A;  5LYJ A;  5G4U C;  1DT9 A;  1CN7 A;  5GON B;  5LA6 A;  1SA0 B;  4F6R A;  1X7O A;  4X20 B;  5MN5 A;  5IJ9 B;  3Q8H A;  1SZQ A;  3CCL F;  1NJI H;  2AIF A;  5FJ4 C;  2OTJ F;  1W42 A;  3LWR C;  1JD1 A;  2Z1U A;  3WPW A;  1U40 A;  4TV9 B;  1YI2 F;  1X52 A;  3LWV C;  1NMU B;  3FD6 A;  4ZOL A;  5EIB D;  1QD9 A;  2OHW A;  5EWR A;  3KJJ A;  2KTU A;  3RA6 A;  1JY8 A;  1W2B F;  1QAH A;  3WXM B;  4ZHV A;  2RHL A;  3JAL B;  4M8I A;  3HAX D;  4O2B A;  3MBM A;  1RLG A;  1IPA A;  5LYJ B;  1IV1 A;  5LA6 B;  3OBY A;  1Q7Y H;  2GZL A;  4O2A A;  4F6R B;  3CC4 F;  3MQW A;  2PHN A;  1VQK F;  1OAP A;  5LXT A;  4ZI7 A;  3FBA A;  1KC8 H;  4ZHW A;  4NQ3 A;  2PMP A;  3OON A;  3S0Y A;  3KHN A;  3J7A R;  1SDS A;  3RE3 A;  2QA4 F;  3JAR B;  3N4Y A;  2V9Y A;  4BVQ A;  3RYH B;  2Z01 A;  4O4H A;  1JN1 A;  5IYZ B;  2I6R A;  3MDO A;  3E20 B;  1KNK A;  3CMA F;  3SIV A;  1DBF A;  3WJR A;  1K9M H;  4O2B B;  3WPX A;  5LP6 C;  3C9R A;  3P0Z A;  3FD5 A;  2QI2 A;  4RHA A;  1XBI A;  2HVY D;  5LXT B;  3D00 A;  4ZI7 B;  2BTQ B;  4IHJ A;  3N2K A;  3UT5 A;  5HP8 A;  3F0E A;  4I55 A;  3S03 A;  4NUT A;  5C8Y A;  3WGK A;  1IV3 A;  3E22 A;  1Z5W A;  3F6M A;  3JAT A;  2I6D A;  2ZVZ A;  5IJ0 A;  1U3L A;  3N2G B;  4O4H B;  3F0G A;  1TUB B;  3E1Y A;  3VCZ A;  1VQ8 F;  5IJ9 A;  4TUY A;  1Q86 H;  4EI8 A;  4X3M A;  1QVF F;  1VHA A;  1Q81 H;  1W58 1;  2W8B C;  4DRX A;  1S72 F;  2VGN A;  1RQ7 A;  4TV9 A;  2HRU A;  3VOA A;  2UZH A;  2VAP A;  2OTL F;  3ZP7 A;  2CVL A;  3V4D A;  3HWU A;  5ITZ B;  3N2K B;  3UT5 B;  3CCJ F;  3VIU A;  4YJ2 B;  5JVD A;  3RYF B;  2CW4 A;  3G4S F;  4I55 B;  3CC7 F;  3CC2 F;  5C8Y B;  2DYY A;  4BT7 A;  5GIP C;  1GO1 A;  3JAM M;  5IJ0 B;  5IT9 M;  3CCU F;  5A2Q M;  2Z1F A;  1CK2 A;  1RA4 A;  4X1K A;  3CPW F;  3DC2 A;  4G4Z A;  2QTP A;  3VO8 A;  4KWE A;  1JJ2 F;  3TD3 A;  3WGN A;  1CLI A;  3NK7 A;  4TUY B;  5JCO C;  2GVI A;  3ELC A;  1X25 A;  5EB1 B;  3MCA B;  3J80 M;  1M1K H;  5EYP A;  2HP3 A;  4DRX B;  1K73 H;  4HNA A;  4B62 A;  1W55 A;  2UYJ A;  3VYS C;  3K2X A;  4BVS A;  3IKF A;  5J2U A;  3K0T A;  4BT2 A;  4G4V A;  3V3T A;  2P6Y A;  4I50 A;  5BMV A;  2CHT A;  5JVD B;  2L26 A;  2Q1X A;  4XCQ A;  3WGL A;  1RQ2 A;  2IQQ A;  3JAR A;  2KGW A;  3RYH A;  5LOV A;  4B46 A;  5IYZ A;  3QHD A;  2N48 A;  1KQS F;  3LYB A;  1R1M A;  3QTY A;  3IEQ A;  5GAP K;  3CYP B;  4NWO B;  5LP6 B;  2UYP A;  1UFY A;  4X1K B;  5CA1 B;  3HJW C;  3N4Z A;  1GX1 A;  1IV2 A;  3VTI C;  1YIJ F;  1N8R H;  3GYQ A;  2CHS A;  3U0O A;  1YGY A;  2CZW A;  1YJN F;  3K14 A;  5EYP B;  1H48 A;  2YYE A;  4HNA B;  3J81 M;  3CPQ A;  4C81 A;  1QVG F;  4R40 B;  1VQL F;  3ZOP A;  2Z1T A;  5MN6 A;  5J2U B;  3IR9 A;  3LME A;  2HQS C;  3D01 A;  4LNU A;  1GO0 A;  1ODE A;  4I50 B;  5EB0 A;  1NQ3 A;  5FNV A;  5BMV B;  5CA0 B;  4X1I A;  1OFU A;  3N2G A;  3VMF B;  3NK6 A;  5LOV B;  1VQM F;  1GZ0 A;  3OW2 F;  5JCO A;  1TUB A;  3C9T A;  4B45 A;  1W5F A;  3FFM A;  3S0H A;  3JAS A;  2BTO A;  1E7K A;  3CCE F;  3I7T A;  3BYQ A;  2QEX F;  1Q8R A;  3CCM F;  2F9Z C;  4X1Y A;  3RA5 A;  5JH7 A;  3I3F A;  3V7E A;  1J7H A;  4TV8 A;  4I4T A;  1VK3 A;  2YXZ A;  3OBW A;  1W3E X;  5ITZ A;  4YJ2 A;  3RYF A;  3LWP C;  2Z1E A;  2H8E A;  3NVK E;  2HX0 A;  4LNU B;  4BW0 B;  2BO1 A;  1COM A;  3IKE A;  5FNV B;  1KNJ A;  2EWC A;  4X1I B;  2AMT A;  2AIZ P;  5KMG B;  3ESJ A;  5MN4 A;  4BT5 A;  3JAS B;  3ZP4 A;  3ZO8 A;  1PF5 A;  4G88 A;  2ZVY A;  3KIZ A;  2CWJ A;  3CCS F;  4X1Y B;  5GIN C;  1VQ4 F;  5JH7 B;  3C9S A;  2B33 A;  4FFB B;  3CD6 F;  3S06 A;  4TV8 B;  4I4T B;  2VXY A;  4ZHY B;  4DXD A;  1VQ6 F;  2FGY A;  1XHO A;  3KE1 A;  3RYI B;  5HY4 A;  1KD1 H;  1IV4 A;  5B8F A;  1Z5V A;  1TVK A;  3O85 A;  3JVH A;  4EB6 A;  2FC3 A;  2G9I A;  2HP0 A;  4O4I B;  1JFF A;  3CCR F;  4BVR A;  3JAW A;  3ON1 A;  4YJ3 B;  5LP6 A;  5HWE A;  3CCV F;  5CA1 A;  3WGM A;  3HKE A;  1W40 A;  3P10 A;  4C4W C;  3WJQ A;  4IIJ A;  4ZK7 A;  3MCQ A;  4TZZ A;  3K12 A;  3HKC A;  5GIO C;  1XV2 A;  3HKD A;  5HXU A;  2LCA A;  3CYQ A;  3QUW A;  2VAM A;  2ZOV A;  4O4J B;  4RQO A;  5CA0 A;  2ZF8 A;  3F0D A;  3IMP A;  1TVK B;  1QU9 A;  4EB6 B;  3CXC F;  2ZAU A;  2HP0 B;  3M1X A;  5FLX M;  1JFF B;  3JAW B;  2JNB A;  5CB4 A;  1VQO F;  2RHH A;  2CSL A;  3JAK A;  1YJW F;  3HKE B;  4PWT A;  1ONI A;  3CME F;  4G4X A;  1X7P A;  4BT3 A;  1UI9 A;  2RB9 A;  2HS0 A;  2HRY A;  4IIJ B;  3HTN A;  1YQN A;  3ERN A;  5EZY A;  5AVM A;  5G4V C;  3S0W A;  3HKB B;  1ZWZ A;  3L7Q A;  3G6E F;  3HKC B;  2RHO A;  3IEW A;  1H47 A;  4E6E A;  1FNJ A;  5HP7 A;  3HKD B;  3VYU C;  1VQ5 F;  5HY0 A;  2UYN A;  5HXZ A;  2GLZ A;  2VAW A;  1H7M A;  3M84 A;  5EO3 A;  5KMG A;  3C9U A;  5KX5 A;  3GTZ A;  3LWQ C;  1FFX A;  2IG8 A;  3I56 F;  5CB4 B;  3RYC A;  3JAK B;  3WGJ A;  2ALE A;  3NMU C;  4G4W A;  3LDT A;  2IAF A;  1M90 H;  2KG4 A;  4BT6 A;  3VI6 A;  5EZY B;  3PAF A;  5J2T A;  4FFB A;  3CB2 A;  4WBN A;  4ZOL B;  4U39 A;  5GAN K;  1K8A H;  3S02 A;  5DCV A;  4O4L A;  3RYI A;  1YJ9 F;  3M4S A;  1W5B A;  4EI9 A;  3LFO A;  1VQ7 F;  2H8C A;  2UYN B;  1FSZ A;  2Q1Y A;  4X3L A;  4ZHQ A;  4BVT A;  1FNK A;  4O4I A;  2OTM A;  3T80 A;  5EIB C;  2OZB A;  1T0A A;  4G4Y A;  4O2A B;  2UYK A;  4YJ3 A;  3G71 F;  3JCM M;  4C8E A;  4ERH A;  1YHQ F;  1W41 A;  3SIU A;  3KJK A;  5KX5 B;  3EOR A;  1VH8 A;  2VGM A;  2HS3 A;  1FFX B;  2R6R 1;  3R0P A;  1VQN F;  4C82 A;  3RYC B;  2DT4 A;  5HY1 A;  5EAZ A;  3V7Q A;  5JQG A;  1YIT F;  2K1S A;  3GHZ A;  1VQV A;  5J2T B;  1XRG A;  4WBN B;  2ZOD A;  4BT4 A;  3I55 F;  2H6L A;  3PLA C;  4U3J A;  4O4J A;  4O4L B;  5GON A;  2BTU A;  3TD4 A;  3C8L A;  1SA0 A;  4C8I A;  3NVI B;  4X20 A;  1VQP F;  3P4E A;  3TD5 A; 
#chains in the Genus database with same CATH homology
 3F0F A;  3IEW A;  4C8E A;  1H47 A;  3EOR A;  3B6N A;  3F0D A;  1VH8 A;  3RE3 A;  1JY8 A;  4C8G A;  1VHA A;  4C82 A;  3QHD A;  3F0E A;  3Q8H A;  3P10 A;  2UZH A;  1IV3 A;  3ELC A;  3IEQ A;  1U3P A;  3MBM A;  3GHZ A;  3ESJ A;  3P0Z A;  1IV1 A;  3F6M A;  1JN1 A;  1GX1 A;  2GZL A;  1IV2 A;  1U40 A;  1W55 A;  1KNK A;  3IKE A;  1KNJ A;  3K2X A;  3IKF A;  1U3L A;  3KE1 A;  2AMT A;  1IV4 A;  3FBA A;  1U43 A;  1YQN A;  3ERN A;  3FPI A;  1T0A A;  3K14 A;  3F0G A;  3T80 A;  4C8I A;  5B8F A;  1H48 A;  3JVH A;  1W57 A;  2PMP A;  4C81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...