1H47A

Structures of mecp synthase in complex with (i) cmp and (ii) cmp and product
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
b'EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-METHYL-D-ERYTHRITOL-2,4-CYCLODIPHOSPHATE SYNTHASE
publication title The Identification of Isoprenoids that Bind in the Intersubunit Cavity of Escherichia Coli 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase by Complementary Biophysical Methods
pubmed doi rcsb
source organism Escherichia coli
molecule tags Synthase
total genus 47
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1h47A00
3Q8HA 3IEWA 1GX1A 1U40A 3FBAA 3MBMA 3K2XA 3P10A 2AMTA 1H47A 3KE1A 3ELCA 3IKEA 3ERNA 3IEQA 1JY8A 3QHDA 2PMPA 1W55A 3F0EA 3EORA 5B8FA 1VHAA 3P0ZA 3T80A 1IV1A 1U43A 3ESJA 3F0GA 4C82A 2GZLA 1JN1A 1KNJA 4C8IA 2UZHA 1H48A 1IV4A 3F6MA 3F0DA 1U3PA 1YQNA 1IV3A 1U3LA 1T0AA 1KNKA 4C81A 3FPIA 3K14A 1W57A 3GHZA 3IKFA 3JVHA 4C8EA 3F0FA 1VH8A 3RE3A 1IV2A 4C8GA 3B6NA
chains in the Genus database with same CATH superfamily
2LBWA 3S0WA 1QU9A 5JQGA 3RYIA 3K0TA 3R0PA 4XCQA 5LP6C 4X3LA 3S02A 2B33A 5J2TB 4BVTA 2I6RA 3RA6A 3CB2A 3UT5B 5GIPC 4ZI7B 3IMPA 5JH7B 3CYPB 3CCUF 4KWEA 1E7KA 2LCAA 3D01A 1QVFF 1OFUA 1JFFB 4BT7A 3VI6A 1W5FA 3LMEA 4IHJA 4C8EA 2GLZA 5EIBD 5GIOC 3FD6A 1TVKA 1XHOA 4G4YA 4BT4A 3WPXA 4YJ3B 4ZHQB 4TZZA 3SIUA 1M1KH 2OZBA 3LWRC 5HY2A 5JQGB 3P4EA 3QHDA 5HXUA 2UYPA 1J7HA 5IJ9B 3LYBA 3DC2A 3OBWA 1X7OA 2BTQB 5EZYA 1VQPF 1VHAA 2GZLA 1FFXA 4R40B 1U3LA 2HS3A 5DCVA 1PXWA 2Z01A 3TD5A 2BTUA 3CXCF 1Q7YH 1H7MA 1X52A 2UYKA 3ZP4A 2RHHA 5LYJA 3FBAA 4X3MA 4U3JA 2QTPA 2Q1XA 3HKEA 2PMPA 3WJQA 4X1KB 1XRGA 1KD1H 3E20B 1TUBB 3JARB 3MCAB 4NUTA 1SDSA 1KNJA 1RQ7A 2IAFA 5FJ4C 4LNUB 5EZYB 1QVGF 1U3PA 1FFXB 4C81A 2W8BC 5GONA 3RA5A 4WBNB 1W57A 3S06A 5EIBC 3KJJA 3LWQC 5CA0A 5LXTB 3Q8HA 4G4WA 3C9SA 4NWOB 3RYHA 3D00A 3J80M 2DYYA 3S03A 5AVMA 4U3JB 1YITF 4O4IA 1Q82H 3EORA 4G88A 5B8FA 4I4TA 3HKDA 2CWJA 3CCEF 5CA1A 3CC4F 2KG4A 3I7TA 1FSZA 3KHNA 2BTOA 1DT9A 3J7AR 2H8CA 1VQ9F 3GHZA 3NK7A 3NVKE 3CCJF 3LFOA 2V9YA 3F0FA 5GONB 1IV2A 4DXDA 4ZHVA 4EB6B 1OAPA 3V7QA 1CK2A 1YJNF 2L26A 5LP6A 3HAXD 2LBXA 3RYHB 3AGKA 4ZI7A 5GAPK 5JVDA 2VAMA 5HY4A 3N2KA 1W5BA 2WALA 4O4IB 3V7EA 2UYJA 1JFFA 4TUYA 3MQWA 4BVQA 3K12A 1IV3A 5EB0A 4LCKA 4B62A 5HP7A 3V4DA 2R6R1 1FNKA 5LA6B 4X1IA 4G4ZA 2QI2A 2QEXF 4YJ3A 1VQ8F 3GTZA 3IR9A 3G6EF 2CW4A 4DRXA 5IT9M 1VQ5F 3VYSC 1YHQF 2NMUA 1ODEA 3PAFA 3OBYA 4TV9A 5FNVB 2Z1TA 4BT3A 5HXZA 5IJ9A 5LP6B 1Q86H 3ZO8A 2HX0A 3LWPC 3TD3A 3VO8A 3WGNA 2R751 4I50B 3WGMA 3JASB 5JVDB 1JN1A 3N2KB 1VQOF 4TUYB 1ONIA 1YJWF 1Z5VA 1VQNF 3TD4A 1NJIH 3NMUC 5G4VC 3RE3A 2OTJF 4IIJB 1RQ2A 1Z5WA 4X1IB 2HVYD 5EB1B 4X1YA 1YI2F 2FC3A 1W3EX 1W40A 4O4LB 3ZP7A 4DRXB 4X1KA 2RB9A 1YIJF 1TUBA 3JARA 2OHWA 5EAZA 4TV9B 2MQEA 3CCVF 4LNUA 1IV1A 3T80A 1DBFA 3ESJA 1NQ3A 3PLAC 4EI9A 4WBNA 5IJ0B 1RLUA 1M90H 5JCOC 4X20B 5LXTA 2ZAUA 4ZHWA 1JD1A 3WJPA 3S0HA 3CCRF 5G4UC 4BT5A 2CHTA 1K73H 5HY0A 1YGYA 1Q8RA 3VOAA 3MBMA 2CSLA 3HKBA 1VQ4F 4B46A 4X1YB 3IEQA 3MCQA 1JJ2F 1UI9A 3U0OA 1GO0A 3E1YA 1K8AH 2HRUA 1YJ9F 4YJ2A 4U39A 4G4VA 4ZOLB 1VQVA 2AIZP 3CMEF 1IPAA 3HJWC 2VAWA 1W41A 4EB6A 4M8IA 2Z1EA 1CN7A 3MDOA 3VTIC 5IYZA 2AMTA 1H47A 2ZODA 2RHOA 1Q81H 3ON1A 3HKBB 1FNJA 5C8YA 1QD9A 5MN5A 1VQMF 3CC2F 1KQSF 3CC7F 3JATB 3KIZA 4F6RB 4YJ2B 2IQQA 5LA6A 2PHNA 3JALB 3LDTA 5A2QM 5LOVA 2Q1YA 4O4JB 3IKFA 3VCZA 1VK3A 3LWVC 2ZOVA 2N48A 1SZQA 4BY9D 3HTNA 1GX1A 3WXMB 2H6LA 2DT4A 2ZVZA 2I6DA 5FNVA 5KX5B 5HP8A 5IYZB 2Z1UA 2HS4A 1CLIA 4I50A 3JASA 1COMA 3CCLF 3V3TA 5KMGB 1W581 4C8IA 5C8YB 3CPWF 1S72F 3VOBA 2RHJA 3WJRA 3L7QA 4IIJA 5LOVB 3CPQA 3OONA 3WGJA 3M4SA 3CMAF 3JAMM 4O4LA 3I55F 3KE1A 2CZWA 3M1XA 3KJKA 4TV8A 3JAKA 3FD5A 5HWEA 5J2UA 2KGWA 3D54A 1RLGA 1XBIA 4RQOA 3F0GA 2OTLF 5IJ0A 2HP0A 3VYUC 4ZHYB 4X20A 3QTYA 1NMUB 5EWRA 4E6EA 3JVHA 3ERNA 4O2AA 4RHAA 4EI8A 3GYQA 2JNBA 3NK6A 3P10A 1GZ0A 1SA0B 2F9ZC 2ALEA 4I55A 3G71F 3FFMA 1W55A 2RHLA 3S0YA 4TV8B 3E22B 3JAKB 3J81M 2Z1FA 2G9IA 3C9UA 5J2UB 4ZOLA 3F0DA 4BT2A 3CCQF 3O85A 5BMVB 3FPIA 1X7PA 2HP0B 3N2GB 1VH8A 4B5CA 1VQ7F 1N8RH 3B6NA 5EO3A 1X25A 3IEWA 4BT6A 5CB4B 4O4HA 1KC8H 4O2AB 3RYIB 3ELCA 3IKEA 5FLXM 2VAPA 4FFBA 3WGKA 3WGLA 3NVIB 5ITZA 3CYQA 2ZVYA 4I55B 3JATA 3P0ZA 1U43A 4G4XA 3VMFB 4PWTA 4BVRA 3CG6A 4F6RA 2UZHA 3ZOPA 3JALA 2HRYA 4O4JA 3K14A 5GINC 1W42A 3QUWA 3G4SF 1VQ6F 3N4ZA 2KTVA 3JAWA 3CD6F 1XV2A 4C8GA 4IHJB 2CHSA 1TVKB 4BW0B 4HNAA 5KX5A 3CCSF 2YXZA 2VXYA 3K2XA 1W59A 5EYPA 3RYFA 4NQ3A 3HWUA 2UYNA 5MN4A 2ZF8A 1JY8A 4O4HB 2QA4F 1R1MA 2EWCA 4ZK7A 5KMGA 3F0EA 3I56F 4FFBB 4ERHA 3OW2F 4BVSA 1VQKF 5ITZB 5GANK 2FGYA 3F6MA 3C9TA 1W5EA 1UFYA 3VIUA 3DDNA 5HY1A 3CCMF 2K1SA 4O2BA 2LBTA 1QAHA 3JAWB 3I3FA 5LYJB 1ZWZA 2HS0A 4HNAB 4B45A 3C9RA 3RYCA 5EYPB 3RYFB 3HKEB 2UYNB 2IG8A 4C82A 1H48A 2P6YA 2GVIA 5MN6A 1T0AA 1KNKA 3HKCA 2KTUA 2CVLA 1PF5A 2HQSC 3LWOC 3JCMM 2YYEA 3BYQA 5CA0B 1T0KB 1U40A 4O2BB 2H8EA 2VGMA 1SA0A 2VGNA 5J2TA 3WPWA 2OTMA 3UT5A 2AIFA 5JH7A 3SIVA 3E22A 2BO1A 1K9MH 1VQLF 3RYCB 1W2BF 4C4WC 3N4YA 1GO1A 4I4TB 2HP3A 3HKDB 1IV4A 1W5AA 5BMVA 5CA1B 1RA4A 1YQNA 4EI7A 5JCOA 3VYTC 3N2GA 3M84A 3HKCB 3C8LA 5CB4A 4ZHQA
chains in the Genus database with same CATH topology
3Q8HA 3IEWA 1GX1A 1U40A 3FBAA 3MBMA 3K2XA 3P10A 2AMTA 1H47A 3KE1A 3ELCA 3IKEA 3ERNA 3IEQA 1JY8A 3QHDA 2PMPA 1W55A 3F0EA 3EORA 5B8FA 1VHAA 3P0ZA 3T80A 1IV1A 1U43A 3ESJA 3F0GA 4C82A 2GZLA 1JN1A 1KNJA 4C8IA 2UZHA 1H48A 1IV4A 3F6MA 3F0DA 1U3PA 1YQNA 1IV3A 1U3LA 1T0AA 1KNKA 4C81A 3FPIA 3K14A 1W57A 3GHZA 3IKFA 3JVHA 4C8EA 3F0FA 1VH8A 3RE3A 1IV2A 4C8GA 3B6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8H A;  3IEW A;  1GX1 A;  1U40 A;  3FBA A;  3MBM A;  3K2X A;  3P10 A;  2AMT A;  1H47 A;  3KE1 A;  3ELC A;  3IKE A;  3ERN A;  3IEQ A;  1JY8 A;  3QHD A;  2PMP A;  1W55 A;  3F0E A;  3EOR A;  5B8F A;  1VHA A;  3P0Z A;  3T80 A;  1IV1 A;  1U43 A;  3ESJ A;  3F0G A;  4C82 A;  2GZL A;  1JN1 A;  1KNJ A;  4C8I A;  2UZH A;  1H48 A;  1IV4 A;  3F6M A;  3F0D A;  1U3P A;  1YQN A;  1IV3 A;  1U3L A;  1T0A A;  1KNK A;  4C81 A;  3FPI A;  3K14 A;  1W57 A;  3GHZ A;  3IKF A;  3JVH A;  4C8E A;  3F0F A;  1VH8 A;  3RE3 A;  1IV2 A;  4C8G A;  3B6N A; 
#chains in the Genus database with same CATH topology
 2LBW A;  3S0W A;  1QU9 A;  5JQG A;  3RYI A;  3K0T A;  3R0P A;  4XCQ A;  5LP6 C;  4X3L A;  3S02 A;  2B33 A;  5J2T B;  4BVT A;  2I6R A;  3RA6 A;  3CB2 A;  3UT5 B;  5GIP C;  4ZI7 B;  3IMP A;  5JH7 B;  3CYP B;  3CCU F;  4KWE A;  1E7K A;  2LCA A;  3D01 A;  1QVF F;  1OFU A;  1JFF B;  4BT7 A;  3VI6 A;  1W5F A;  3LME A;  4IHJ A;  4C8E A;  2GLZ A;  5EIB D;  5GIO C;  3FD6 A;  1TVK A;  1XHO A;  4G4Y A;  4BT4 A;  3WPX A;  4YJ3 B;  4ZHQ B;  4TZZ A;  3SIU A;  1M1K H;  2OZB A;  3LWR C;  5HY2 A;  5JQG B;  3P4E A;  3QHD A;  5HXU A;  2UYP A;  1J7H A;  5IJ9 B;  3LYB A;  3DC2 A;  3OBW A;  1X7O A;  2BTQ B;  5EZY A;  1VQP F;  1VHA A;  2GZL A;  1FFX A;  4R40 B;  1U3L A;  2HS3 A;  5DCV A;  1PXW A;  2Z01 A;  3TD5 A;  2BTU A;  3CXC F;  1Q7Y H;  1H7M A;  1X52 A;  2UYK A;  3ZP4 A;  2RHH A;  5LYJ A;  3FBA A;  4X3M A;  4U3J A;  2QTP A;  2Q1X A;  3HKE A;  2PMP A;  3WJQ A;  4X1K B;  1XRG A;  1KD1 H;  3E20 B;  1TUB B;  3JAR B;  3MCA B;  4NUT A;  1SDS A;  1KNJ A;  1RQ7 A;  2IAF A;  5FJ4 C;  4LNU B;  5EZY B;  1QVG F;  1U3P A;  1FFX B;  4C81 A;  2W8B C;  5GON A;  3RA5 A;  4WBN B;  1W57 A;  3S06 A;  5EIB C;  3KJJ A;  3LWQ C;  5CA0 A;  5LXT B;  3Q8H A;  4G4W A;  3C9S A;  4NWO B;  3RYH A;  3D00 A;  3J80 M;  2DYY A;  3S03 A;  5AVM A;  4U3J B;  1YIT F;  4O4I A;  1Q82 H;  3EOR A;  4G88 A;  5B8F A;  4I4T A;  3HKD A;  2CWJ A;  3CCE F;  5CA1 A;  3CC4 F;  2KG4 A;  3I7T A;  1FSZ A;  3KHN A;  2BTO A;  1DT9 A;  3J7A R;  2H8C A;  1VQ9 F;  3GHZ A;  3NK7 A;  3NVK E;  3CCJ F;  3LFO A;  2V9Y A;  3F0F A;  5GON B;  1IV2 A;  4DXD A;  4ZHV A;  4EB6 B;  1OAP A;  3V7Q A;  1CK2 A;  1YJN F;  2L26 A;  5LP6 A;  3HAX D;  2LBX A;  3RYH B;  3AGK A;  4ZI7 A;  5GAP K;  5JVD A;  2VAM A;  5HY4 A;  3N2K A;  1W5B A;  2WAL A;  4O4I B;  3V7E A;  2UYJ A;  1JFF A;  4TUY A;  3MQW A;  4BVQ A;  3K12 A;  1IV3 A;  5EB0 A;  4LCK A;  4B62 A;  5HP7 A;  3V4D A;  2R6R 1;  1FNK A;  5LA6 B;  4X1I A;  4G4Z A;  2QI2 A;  2QEX F;  4YJ3 A;  1VQ8 F;  3GTZ A;  3IR9 A;  3G6E F;  2CW4 A;  4DRX A;  5IT9 M;  1VQ5 F;  3VYS C;  1YHQ F;  2NMU A;  1ODE A;  3PAF A;  3OBY A;  4TV9 A;  5FNV B;  2Z1T A;  4BT3 A;  5HXZ A;  5IJ9 A;  5LP6 B;  1Q86 H;  3ZO8 A;  2HX0 A;  3LWP C;  3TD3 A;  3VO8 A;  3WGN A;  2R75 1;  4I50 B;  3WGM A;  3JAS B;  5JVD B;  1JN1 A;  3N2K B;  1VQO F;  4TUY B;  1ONI A;  1YJW F;  1Z5V A;  1VQN F;  3TD4 A;  1NJI H;  3NMU C;  5G4V C;  3RE3 A;  2OTJ F;  4IIJ B;  1RQ2 A;  1Z5W A;  4X1I B;  2HVY D;  5EB1 B;  4X1Y A;  1YI2 F;  2FC3 A;  1W3E X;  1W40 A;  4O4L B;  3ZP7 A;  4DRX B;  4X1K A;  2RB9 A;  1YIJ F;  1TUB A;  3JAR A;  2OHW A;  5EAZ A;  4TV9 B;  2MQE A;  3CCV F;  4LNU A;  1IV1 A;  3T80 A;  1DBF A;  3ESJ A;  1NQ3 A;  3PLA C;  4EI9 A;  4WBN A;  5IJ0 B;  1RLU A;  1M90 H;  5JCO C;  4X20 B;  5LXT A;  2ZAU A;  4ZHW A;  1JD1 A;  3WJP A;  3S0H A;  3CCR F;  5G4U C;  4BT5 A;  2CHT A;  1K73 H;  5HY0 A;  1YGY A;  1Q8R A;  3VOA A;  3MBM A;  2CSL A;  3HKB A;  1VQ4 F;  4B46 A;  4X1Y B;  3IEQ A;  3MCQ A;  1JJ2 F;  1UI9 A;  3U0O A;  1GO0 A;  3E1Y A;  1K8A H;  2HRU A;  1YJ9 F;  4YJ2 A;  4U39 A;  4G4V A;  4ZOL B;  1VQV A;  2AIZ P;  3CME F;  1IPA A;  3HJW C;  2VAW A;  1W41 A;  4EB6 A;  4M8I A;  2Z1E A;  1CN7 A;  3MDO A;  3VTI C;  5IYZ A;  2AMT A;  1H47 A;  2ZOD A;  2RHO A;  1Q81 H;  3ON1 A;  3HKB B;  1FNJ A;  5C8Y A;  1QD9 A;  5MN5 A;  1VQM F;  3CC2 F;  1KQS F;  3CC7 F;  3JAT B;  3KIZ A;  4F6R B;  4YJ2 B;  2IQQ A;  5LA6 A;  2PHN A;  3JAL B;  3LDT A;  5A2Q M;  5LOV A;  2Q1Y A;  4O4J B;  3IKF A;  3VCZ A;  1VK3 A;  3LWV C;  2ZOV A;  2N48 A;  1SZQ A;  4BY9 D;  3HTN A;  1GX1 A;  3WXM B;  2H6L A;  2DT4 A;  2ZVZ A;  2I6D A;  5FNV A;  5KX5 B;  5HP8 A;  5IYZ B;  2Z1U A;  2HS4 A;  1CLI A;  4I50 A;  3JAS A;  1COM A;  3CCL F;  3V3T A;  5KMG B;  1W58 1;  4C8I A;  5C8Y B;  3CPW F;  1S72 F;  3VOB A;  2RHJ A;  3WJR A;  3L7Q A;  4IIJ A;  5LOV B;  3CPQ A;  3OON A;  3WGJ A;  3M4S A;  3CMA F;  3JAM M;  4O4L A;  3I55 F;  3KE1 A;  2CZW A;  3M1X A;  3KJK A;  4TV8 A;  3JAK A;  3FD5 A;  5HWE A;  5J2U A;  2KGW A;  3D54 A;  1RLG A;  1XBI A;  4RQO A;  3F0G A;  2OTL F;  5IJ0 A;  2HP0 A;  3VYU C;  4ZHY B;  4X20 A;  3QTY A;  1NMU B;  5EWR A;  4E6E A;  3JVH A;  3ERN A;  4O2A A;  4RHA A;  4EI8 A;  3GYQ A;  2JNB A;  3NK6 A;  3P10 A;  1GZ0 A;  1SA0 B;  2F9Z C;  2ALE A;  4I55 A;  3G71 F;  3FFM A;  1W55 A;  2RHL A;  3S0Y A;  4TV8 B;  3E22 B;  3JAK B;  3J81 M;  2Z1F A;  2G9I A;  3C9U A;  5J2U B;  4ZOL A;  3F0D A;  4BT2 A;  3CCQ F;  3O85 A;  5BMV B;  3FPI A;  1X7P A;  2HP0 B;  3N2G B;  1VH8 A;  4B5C A;  1VQ7 F;  1N8R H;  3B6N A;  5EO3 A;  1X25 A;  3IEW A;  4BT6 A;  5CB4 B;  4O4H A;  1KC8 H;  4O2A B;  3RYI B;  3ELC A;  3IKE A;  5FLX M;  2VAP A;  4FFB A;  3WGK A;  3WGL A;  3NVI B;  5ITZ A;  3CYQ A;  2ZVY A;  4I55 B;  3JAT A;  3P0Z A;  1U43 A;  4G4X A;  3VMF B;  4PWT A;  4BVR A;  3CG6 A;  4F6R A;  2UZH A;  3ZOP A;  3JAL A;  2HRY A;  4O4J A;  3K14 A;  5GIN C;  1W42 A;  3QUW A;  3G4S F;  1VQ6 F;  3N4Z A;  2KTV A;  3JAW A;  3CD6 F;  1XV2 A;  4C8G A;  4IHJ B;  2CHS A;  1TVK B;  4BW0 B;  4HNA A;  5KX5 A;  3CCS F;  2YXZ A;  2VXY A;  3K2X A;  1W59 A;  5EYP A;  3RYF A;  4NQ3 A;  3HWU A;  2UYN A;  5MN4 A;  2ZF8 A;  1JY8 A;  4O4H B;  2QA4 F;  1R1M A;  2EWC A;  4ZK7 A;  5KMG A;  3F0E A;  3I56 F;  4FFB B;  4ERH A;  3OW2 F;  4BVS A;  1VQK F;  5ITZ B;  5GAN K;  2FGY A;  3F6M A;  3C9T A;  1W5E A;  1UFY A;  3VIU A;  3DDN A;  5HY1 A;  3CCM F;  2K1S A;  4O2B A;  2LBT A;  1QAH A;  3JAW B;  3I3F A;  5LYJ B;  1ZWZ A;  2HS0 A;  4HNA B;  4B45 A;  3C9R A;  3RYC A;  5EYP B;  3RYF B;  3HKE B;  2UYN B;  2IG8 A;  4C82 A;  1H48 A;  2P6Y A;  2GVI A;  5MN6 A;  1T0A A;  1KNK A;  3HKC A;  2KTU A;  2CVL A;  1PF5 A;  2HQS C;  3LWO C;  3JCM M;  2YYE A;  3BYQ A;  5CA0 B;  1T0K B;  1U40 A;  4O2B B;  2H8E A;  2VGM A;  1SA0 A;  2VGN A;  5J2T A;  3WPW A;  2OTM A;  3UT5 A;  2AIF A;  5JH7 A;  3SIV A;  3E22 A;  2BO1 A;  1K9M H;  1VQL F;  3RYC B;  1W2B F;  4C4W C;  3N4Y A;  1GO1 A;  4I4T B;  2HP3 A;  3HKD B;  1IV4 A;  1W5A A;  5BMV A;  5CA1 B;  1RA4 A;  1YQN A;  4EI7 A;  5JCO A;  3VYT C;  3N2G A;  3M84 A;  3HKC B;  3C8L A;  5CB4 A;  4ZHQ A; 
#chains in the Genus database with same CATH homology
 3Q8H A;  3IEW A;  1GX1 A;  1U40 A;  3FBA A;  3MBM A;  3K2X A;  3P10 A;  2AMT A;  1H47 A;  3KE1 A;  3ELC A;  3IKE A;  3ERN A;  3IEQ A;  1JY8 A;  3QHD A;  2PMP A;  1W55 A;  3F0E A;  3EOR A;  5B8F A;  1VHA A;  3P0Z A;  3T80 A;  1IV1 A;  1U43 A;  3ESJ A;  3F0G A;  4C82 A;  2GZL A;  1JN1 A;  1KNJ A;  4C8I A;  2UZH A;  1H48 A;  1IV4 A;  3F6M A;  3F0D A;  1U3P A;  1YQN A;  1IV3 A;  1U3L A;  1T0A A;  1KNK A;  4C81 A;  3FPI A;  3K14 A;  1W57 A;  3GHZ A;  3IKF A;  3JVH A;  4C8E A;  3F0F A;  1VH8 A;  3RE3 A;  1IV2 A;  4C8G A;  3B6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...