1H4OA

Monoclinic form of human peroxiredoxin 5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
APIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXIREDOXIN 5
publication title Crystal Structure of Human Peroxiredoxin 5, a Novel Type of Mammalian Peroxiredoxin at 1.5 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 49
structure length 161
sequence length 161
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2001-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1h4oA00
1SK1A 1TI3A 4LL1B 5D73A 4ECJA 2TRCP 3ZIJA 2HYXA 1NSWA 1ERWA 4ZBBA 4OFTA 5IMVA 1N8JA 3FR3A 5G31A 1A2LA 4OO4A 5ECQB 2DJ1A 1FVKA 2HXKA 4PQIA 1GL8A 4WBJA 2VCXA 1TW9A 2R3XA 3KM6A 3P2AA 2DIZA 5DVBA 4JRRA 1C72A 2GSQA 1TOFA 4Q5NA 1PX6A 1LBKA 2EIOA 4GWRA 4CHSA 2BTOT 1VGLA 1XWCA 3HVVA 1A2JA 1T3BA 4TXOB 1TI1A 1ERTA 4HJ2A 1W89A 3HCZA 3FZ5A 1QMVA 4KH7A 2YN1A 1M2DA 4MF5A 1Z6NA 2DMMA 2WZ9A 2HNLA 2E2MA 4NMUA 4I8BA 4EXJA 2V6KA 3I6AA 5D93A 5AIVA 1HQOA 1WJKA 1SD9A 1QFNA 5J41A 3KH9A 1UC7A 2G2QA 4GSSA 4EDYA 4G10A 3IK9A 1XZOA 1Z3EA 4AJ6A 4K9ZA 4NHWA 4LMVA 2AAWA 3TRQA 1H4OA 3HJMA 1Q4JA 3C1RA 5A5KA 3ZREA 3KZQA 2NPBA 3VWUA 4EDZA 4IP1A 1YF0A 1GSUA 2LS5A 3GX0A 5FHIA 2YWNA 3HJOA 4MDCA 1THOA 10GSA 4TW5A 1GTBA 1A0FA 1E6BA 2L6DA 5J3RA 1G7EA 4JR4A 3VFIA 1XWGA 4NXIA 3NZNA 4IBPA 3GL3A 1V58A 1YQ1A 2B5XA 2ES7A 1X9WB 3P7XA 3HKRA 5G5FA 2WCIA 2IMKA 2PVOC 4L5LA 1F37A 2IIYA 4GSNA 3DXBA 4OCFA 13GSA 2PERA 4WEYA 1F3AA 1BJXA 2JADA 1OE7A 6GSSA 1GWCA 2CT6A 5DDLA 1VF3A 5DAKA 5B6MA 3TUEA 5IPHA 3G7IA 2MMZA 2HLSA 3IE3A 3H4KA 3QFBC 2HZEB 5HR0A 3GRXA 5ECPB 3WGEA 4Q5RA 5D9XA 5CNWA 1SD8A 3RPNA 5EL8A 4DEJA 3BCIA 3KJYA 4NAXA 1SL0B 1WOUA 12GSA 1GUMA 3IRAA 4MZWA 2A2RA 1OC9B 18GSA 3VWVA 1KEBA 4MH3A 3LORA 1TKDB 1BEDA 3UVHA 5E59A 3GIXA 4KCAA 2PUKC 2F51A 4PUFC 5L71A 1B9YC 2C3NA 3N9JA 1PL1A 2ZNMA 3GSTA 1X5EA 2QKEA 4WF4A 3IC4A 3IK7A 2PU9C 2L4QA 2VM2A 4ML6A 3UAPA 3U6VA 3Q19A 5DBQA 2MBSA 3LYPA 1X9SB 2PN8A 1JZWA 5JWOB 2C80A 1U87A 6GSXA 3E9JB 4IP6A 1R4WA 2EIQA 3HZ8A 4O32A 2R5GA 4MP4A 2VLVA 4D73A 4PXOA 1MDIA 1MD4A 2CVBA 1U6TA 1XVWA 4I2UA 2AV4A 2RM5A 2JL4A 4OFMA 1CQGA 2Z9SA 4HOJA 3UVTA 4ZB8A 20GSA 2K8VA 5IO0A 2FWGA 1KNGA 1J0FA 2LEGA 4ECIA 4E8EA 3VWXA 3GHAA 3EYTA 3TDGA 5ECMB 1KTEA 2RIIA 2H6YA 2F9SA 2OE0A 1A23A 5B8BA 3TKRA 3FW2A 14GSA 5DQSA 2R4VA 1ST9A 3R2QA 1M9BA 2LJKA 1JZDA 3GURA 1Y25A 2IWTA 4MJEA 1OYJA 4NV5A 1ZGNA 3RHBA 1I5GA 3EMPA 2H6XA 4IHUA 2CX3A 3QOUA 3KGKA 4YAPA 5KN3A 5IIZA 4XS4B 4XCSA 4O92A 2QGVA 3ZTLA 4MMMA 2K6VA 4BPYA 2R2JA 5ELAA 1EEJA 2B1LA 1K0DA 2OKAA 3APOA 3FKFA 3KMNA 4KE3A 3A2XA 3M9JA 4POKA 4P3YB 2K8SA 4CW9A 2C4JA 1SJ6A 2CVDA 2JU5A 3TOUA 2FCHA 2WFCA 2O87A 4QL9A 1Z5YE 3DYRA 5G1LA 1A0RP 3A2WA 2PPTA 2KHPA 3TB2A 1SENA 5J9BA 3LG6A 4OD7A 5G30A 1H75A 5IO2A 1V2AA 4QL7A 1TDIA 2DJ3A 2VCTA 4X1UA 2VAFA 1AXDA 3ERWA 2HRNA 2YV7A 1GSEA 3H93A 3ZRDA 3C71A 5ECKB 5D9VA 3TKSA 3F4TA 3M1GA 4MA9A 1GTUA 3D21A 1K0MA 2CZ2A 1O85A 2MMOA 1O6JA 5CYYA 3AY8A 5AIXA 3LGCA 2MBTA 2VCQA 4YAVA 2HFDA 2H1AA 1WIKA 5ECLB 2KLXA 1PA3A 2DIYA 3WD6A 2WB9A 1DE1A 3GSSA 3US3A 1Z6MA 2J23A 3F3QA 5GSTA 3L0HA 4YQVA 1SL1B 4K2DA 4NV2A 2WJUA 2I3YA 1WMJA 3GA4A 3FR6A 4J2FA 2X8HA 2VOCA 4AJ8A 1NHYA 4FIWA 2E2GA 2E7PA 5ID2A 3DVWA 1J9BA 1K0CA 2MZCA 3UEMA 1U3AA 1BG5A 3BCKA 3D4TA 1YKCA 1ACVA 4GXZA 1E2YA 3ISOA 2NBSA 5EVOA 5LD0A 1MEKA 2H73A 4WBRD 2X8GA 4HDEA 5A4VA 1K0OA 5F06A 1HNAA 2DLXA 3TGZA 9GSSA 3LXTA 5G5EA 4IKHA 5IPGA 1O8XA 2VUPA 2X99A 2B3SA 3RPPA 3VWWA 1RQMA 4JR6A 3EURA 5B7CA 3ME7A 4YQUA 5DAKB 5J5NA 3F0IA 2V41A 2IFQB 1ZL9A 1GLQA 7GSSA 5HR1A 2DC5A 1X9MB 5G1KA 3CYNA 1SKRB 4GQCA 4L0WA 4PQHA 1A24A 1M9AA 2GZYA 1UN2A 3F6FA 1SKSB 2V2GA 4IJIA 4LLRA 4NPBA 3KP9A 2QSIA 2AJQB 1S3AA 2N5BA 4RQXA 4K0GA 1M0UA 2OJLA 3GV1A 4F2IA 1BAYA 2C1YA 1XOBA 4EUYA 1G0TA 3BOAA 4ECCA 3QMXA 2X64A 3D5JA 2C3QA 5F8BA 2FY6A 2RUFA 3OR5A 5H5QA 1FVJA 1XWKA 2OBIA 4EO3A 4HEA2 16GSA 3C73A 3DMLA 1TK0B 1TRVA 1VF2A 2OE1A 1AW9A 2GDRA 3QCPA 3A5WA 2RLIA 4OFNA 2DJJA 4MH2A 3L9UA 2EC4A 3KIJA 2GT6A 4GTUA 3E3EA 4GQFA 1NM3A 3NOFA 4XRDA 5JCGA 2H0IA 2N5AA 1SL2B 4BA7A 4K0NA 5CRDA 2OACA 3D0ZA 5HR3A 1YDKA 2LJAA 4YH2A 1GSDA 3UJ1A 2HT9A 5E4WA 1QGVA 1FW1A 4O5RA 4D73B 4ZIJA 1USBA 2REMA 4GRFA 1ML6A 2G0FA 1PGTA 4PNFA 4N11A 4ZXGA 2HE3A 1R26A 4OWYA 2I4AA 2NDOA 3IXRA 4ZB6A 3TOTA 4EC0A 1FB0A 2AUVA 1OKDA 4FYCA 4N10A 3VPTA 4JU5A 1PSQA 3HD5A 1R7HA 3GKKA 4IGJA 1FHEA 3M0FA 2B6MA 5COHA 11GSA 2VL9A 2C0EA 3DVXA 4TVEA 3PGTA 4RQRA 2FA8A 2GSTA 1A8LA 2YANA 3GTUA 1T4ZA 1JFUA 4PURA 2GLRA 3CTGA 2A4VA 2YNXA 5ENUA 3M3MA 1TU8A 1Z9HA 2PVQA 3Q74A 1WPIA 1YJ6A 3GKXA 1F2EA 1AAZA 3I9V2 4XHMA 4IJ3A 2IMDA 4PUAA 4E8HA 5JCWA 5HFIA 3TJJA 2P31A 3GNJA 2IFQA 1TXXA 1F9MA 4HU9A 1GUKA 4NHZA 4ECBA 1ZOFA 1EP7A 2J9HA 4TR3A 2YWOA 5H5SA 1V40A 3W6GA 4MJCA 4IVFA 3GH9A 5INYA 3TRXA 4PQ1A 3K8NA 2JZTA 3CRTA 3EVIA 4MPGA 1AC1A 4RI6A 3LFLA 2C8UA 2JACA 3EU4A 5CAXA 1X0RA 3HY2A 2RUEA 1YEPA 3HZ4A 1K3YA 1B8XA 5ECIB 3TKSE 3EC3A 2D2ZA 2GVPA 1SU9A 3IAM2 4EE0A 2DJKA 1XWAA 3F6DA 4IQ1A 5DCHA 2XC2A 3EWLA 2YWMA 1O7UA 3LJRA 3WT2A 4X43A 3BJ5A 3C8EA 3KTLA 2CAQA 1XW5A 1XW6A 4KAEA 3IA1A 4ZL7A 1U3IA 2B5EA 2CV4A 4V2MA 1SKWB 5J4UA 4N30A 4X0XA 2FLSA 2CVKA 5ECOB 4MF6A 1EGOA 5ECRB 1XWBA 4HS1A 1AQWA 4V2NA 1A2MA 3CXGA 1HNBA 2GSRA 2M72A 4HUAA 2IMFA 1IYHA 2ZCTA 3TKQA 1O8WA 4G9HA 4ZILA 1V9WA 1OE8A 3VI7A 1B4QA 4ILFA 2L5OA 1EV4A 2B5YA 4MZBA 2IJYA 1EV9A 1G6WA 2VD1A 2LNSA 3TRPA 2LUSA 2KP1A 2DMLA 2IMIA 1ON4A 3TKSC 5ID2B 4QQ7A 2FA4A 3MSZA 1EP8A 4ZBAA 1VRSD 5FWGA 4GF0A 4EKZA 1Z7PA 4TKYA 5C00A 5DCGA 4JZQA 1PN9A 1JZOA 2GZPA 1BYEA 3HHVA 2OBKA 2H19A 5A4WA 2LRTA 2VLUA 3ZLPA 5CRGA 5C04A 5JWRB 2H01A 3D4MA 1UA5A 3QAWA 3TJKA 3KD0A 2N5FA 2HI7A 3ZL5A 1ABAA 3GH6A 2R37A 3QFAC 2H0GA 22GSA 2VCVA 4KA0A 3KTBA 4POBA 1JZRA 4BWSA 1ZYQB 2YPMA 3BBYA 5IMDA 3VLNA 1EWXA 4Q5QA 1R5AA 1SYRA 3LQ7A 4TN8A 2VL2A 4ZL9A 4KDYA 2JZSA 2M80A 4HZ2A 4EVMA 3MWHA 1TRWA 1WE0A 3I69A 5JCUA 3LWAA 2YWIA 3LXZA 4F03A 3G7YA 2IPAA 1GSYA 4DSSA 1PRXA 3DD3A 1V98A 4BWQA 3KCMA 3F4RA 2XPEA 1MTCA 2FUG2 1MDKA 1RK4A 2GQMA 2B7JA 3FY7A 5D8IA 4F9ZA 1YKAA 4GLTA 4J57E 1HD2A 2MMNA 1T8EB 5LCZA 2YZUA 3MAKA 2PGTA 4L8EA 3ERFA 4HI7A 1ERUA 2MMAA 1LJRA 5IMCA 2CAIA 4KB3A 4J56E 3ZMKA 1XW9A 2H71A 4V2LA 4LA1A 3KMOA 4WETA 4KNDA 1GTAA 2IL3A 2O8VB 1V57A 2OADA 1K0AA 2YJ7A 5IMFA 5F05A 3SWLA 2P5QA 2L5LA 4JEDA 1TJDA 1AQXA 4MPFA 5DALA 3UOMA 5HQPA 2YP6A 1PX7A 2VCWA 4AF2A 2VM1A 3APSA 4KGIA 1EOGA 2KP2A 3UL3A 1JLWA 1T1VA 2FNOA 2X8CA 1YZXA 4N0VA 3EMXA 2H8LA 4G2EA 2JZRA 4MJAA 3APQA 3LYKA 3VK9A 2NVLA 4L5OA 5F0GA 4F0CA 2LV3A 5CREA 2WULA 3FZ4A 4F0BA 2RM6A 1XCCA 4AJ7A 4KSMA 4CDOA 4ACSA 3GTUB 3DIEA 3UBLA 2WS2A 1O81A 4HQSA 4K6XA 4WXTA 3TJGA 4WR4A 3KH7A 4K7NA 5CRWA 2XBIA 3G7JA 5HFGA 1GSQA 3GYKA 3IV4A 5AISA 5CRHA 3GN3A 1XIYA 4HZ4A 1XFLA 2CQ9A 2GGTA 2P5RA 4DVCA 4ZL8A 3C7MA 4TR1A 3VURA 1PL2A 4V1Ag 4MK3A 1TU7A 4Q5FA 2ALBA 1SK0A 3UBKA 1PKZA 1F6MC 2H1GA 4GCIA 2GS3A 3QR6A 4KX4A 2VD0A 2BJXA 1EEMA 3LEFA 3ZFLA 4OCEA 2C3TA 2HRFA 1OC8A 3EU3A 4KW6A 1PD21 2FGXA 2C0GA 3EE2A 4I97A 3JCML 3P8WA 2VO4A 1SYXA 3FHKA 5F07A 4ZBDA 3IPZA 3DWVA 3SBCA 4IQAA 3O76A 2H76A 2E0QA 2FHEA 1URMA 4HU7A 4TXVA 4JE1A 2NTOA 2H70A 3NIVA 5IMAA 1XVQA 3GMFA 3TJFA 3RBTA 3VI5A 1NW2A 4I6XA 4ID0A 3H1NA 3QD9A 2H75A 2AYTA 5IOXA 2MYGA 2LTKA 2VLTA 2PWJA 3J7Yk 1F3BA 4BVXA 2LRCA 2I9HA 4EL1A 3TJBA 1WRYA 3KP8A 2EIRA 5A4UA 2GQKA 1EOHA 2V6OA 2H30A 2LNTA 1Q98A 1XXUA 1RW1A 2GZZA 1N2AA 3L9VA 3L4NA 2OA7A 2KUCA 3HA9A 5AGYA 1GTIA 1CQHA 4MF7A 1FO5A 2CZ3A 4XIHA 3BD2A 5B6NA 3HXSA 3LSZA 3GFKA 4G19A 1MD3A 4KCEA 1WWJA 2DSAA 3M9KA 6GSUA 3FEUA 5AN1A 3D6IA 2JSZA 1JLVA 2L57A 1T7PB 19GSA 1GSSA 3QAGA 2F3MA 2K18A 4GSTA 1ZZYA 4MJBA 5CP1A 1GSFA 3IBHA 4FYBA 4I5QA 4KDXA 4MCUA 3CSHA 1QUWA 1X5DA 2DJ2A 3GUSA 1KBNA 2WDUA 2B7KA 1M99A 3ZZXA 1DUGA 1A8YA 2AHEA 3GKNA 1THXA 1OKTA 2XPDA 2ON7A 2TRXA 4HQZA 2P0GA 3GKMA 2ON5A 2ZUPA 4HJMA 4K8MA 3FRCA 1QK8A 4YQMA 3FZ9A 3IHQA 3W8JA 3RAZA 4O7HA 1W4VA 4KSOA 2O89A 1X5CA 3DGQA 1QXHA 2LSTA 4JBBA 3RDWA 4DSSB 5KN0A 3U5RE 4ISDA 1S3CA 1DSBA 2M46A 4OMVA 1GRXA 1PMTA 1EGRA 4PX1A 1PQNA 2LRNA 3DEXA 5IQYA 5DQYA 3FYGA 1AQVA 2AB6A 2WRTA 3P90A 4N0ZA 1M2AA 2R6KA 5J9CA 2H6ZA 2WGRA 1YEXA 3O6TA 4XS6A 4IS0A 2H66A 3WYWA 3O3TA 3IDVA 4POMA 3M8NA 4F82A 2VL2C 1Y6EA 4FYUA 5EY6A 4FH8A 4MLYA 1SK2A 2H0HA 4PNGA 2CA8A 2YJHA 3H79A 2HSYA 3RHCA 5DALB 3ED3A 4NWYA 2LJRA 2K9FA 4AGSA 4FO5A 3HVSA 4ML1A 4BVYA 2IN3A 1I9DA 5ABRA 5GAPD 4TXOA 4PGTA 1ILOA 2LQQA 2IMEA 5EPFA 3L78A 3FR9A 1B9XC 1TP9A 3IOSA 3I43A 4TRXA 2YOIA 2F8FA 2PMTA 4K1FA 2GTUA 1M2BA 1K0NA 3FZAA 1BX9A 3HDCA 1DBYA 3WT1A 4MABA 3F8UA 3Q6OA 3E0UA 1SJZA 5IMZA 2CX4A 1OAZA 2C0DA 1MDJA 3PINA 1GUHA 1J08A 1O73A 3S9FA 2BMXA 3QAVA 3UIWA 2GSSA 5ELGA 4WF5A 4POLA 2HZFA 5KEJA 4Z7XA 1SJIA 4H86A 1Z7RA 3CRUA 1BQ7A 2C0FA 1GP1A 3L9SA 3WGDA 4MZCA 2FWFA 3N5OA 2L59A 5IOWA 1PKWA 3ZVJD 1OVNA 5D9WA 3HYPA 1XPVA 1FAAA 1T4YA 3C1SA 1K3LA 3ZITA 3PR8A 4TR1B 3CMIA 4V1Ap 1GNWA 5B8AA 3FK8A 1UVZA 1ZYEA 2FD3A 1TK8B 5FT3A 1XOAA 2JSYA 1S3DA 6GSVA 1EZKA 1FG4A 4KUNA 5KN2A 3TCOA 2YV9A 1GNEA 3G9BA 2KOKA 1FOVA 4BL7A 3CTFA 5D9TA 1HYUA 2H1DA 1GLPA 3DKSA 3DRNA 4DSQA 6GSYA 4TOPA 2XBQA 1VF1A 3IR4A 3MDKA 4IW9A 2HZEA 4ULXA 4WKWA 2F8AA 3A2VA 3ZYWA 2I1UA 2TIRA 1ERVA 5GSSA 3F3RA 4XTSA 1ZMAA 1FB6A 2V1MA 4L0UA 2LQOA 4K7OA 3W8SA 3GX8A 5ECSA 2FWEA 3QPMA 1OC9A 2DBCA 3TKPA 4ZB9A 1B4PA 2PBJA 4XRAA 3PH9A 5IM9A 2V32A 1G6YA 3F9UA 3ZFBA 4LL4B 5HFKA 3UARA 1G7OA 4K7IA 3QDNA 4RUVA 2VCZA 2A2SA 3WGXA 2L6CA 1K0BA 1NHOA 3H8QA 2HSHA 3HVXA 1GH2A 5JWQB 2H74A 1AUCA 4DSRA 2QC7A 17GSA 1GULA 1YF1A 3V1WA 3F4SA 5DJMA 3CBUA 3ERGA 2YZHA 5GZZB 3MNGA 3KEBA 6GSTA 4TR4A 4OO5A 3HJPA 1VF4A 3F63A 3EINA 2L4CA 1T00A 4I2TA 1TRSA 3KXOA 1R5PA 1WP0A 1ZCPA 1M7TA 3VPQA 2O7KA 4IELA 5DJLA 5CO3A 2O85A 5G2ZA 2XHFA 4RI7A 3GL5A 5HR2A 2H72A 1HNCA 1TRUA 4WR5A 1IYIA 1XBSA 2GQLA 8GSSA 1JHBA 4KDUA 3ME8A 2FWHA 5ECNB 2H1BA 3IAS2 2VIMA 2YCDA 3D22A 1B48A 3ZMLA 2VL3A 1OC3A 2B1KA 2LKUA 1U88A 4LMWA 4XS1A 5H5RA 2OE3A 3ZVJA 1LU4A 2DJ0A 5LNKe 1TTZA 3CSIA 5ECHB 1DE2A 2I81A 3UMAA 3Q18A 1AIUA 3ZIVA 1QQ2A 3CSJA 1TK5B 4TR0A 2GT5A 5KN1A 4XS4A 5D96A 4EF0A 6GSWA 5GAND 4IN0A 1K3OA 3A3TA 3J7Yb 1YY7A
chains in the Genus database with same CATH superfamily
5BRTA 1SK1A 1TI3A 4LL1B 5D73A 4ECJA 2TRCP 3ZIJA 2HYXA 1NSWA 1ERWA 4ZBBA 4OFTA 5IMVA 1N8JA 3FR3A 5G31A 1A2LA 4OO4A 5ECQB 2DJ1A 1FVKA 2HXKA 4PQIA 1GL8A 4WBJA 2VCXA 1TW9A 2R3XA 3KM6A 3P2AA 2DIZA 5DVBA 4JRRA 1C72A 2GSQA 1TOFA 1FOHA 4Q5NA 1PX6A 4BVYB 1LBKA 2EIOA 4GWRA 4CHSA 2BTOT 1VGLA 1XWCA 3HVVA 1A2JA 1T3BA 4TXOB 1TI1A 1ERTA 4HJ2A 1W89A 3HCZA 3FZ5A 1QMVA 4KH7A 2YN1A 1M2DA 4MF5A 1Z6NA 2DMMA 2WZ9A 2HNLA 2E2MA 4NMUA 4I8BA 4EXJA 2V6KA 3I6AA 5D93A 5AIVA 1HQOA 1WJKA 1SD9A 1QFNA 4G0LA 5J41A 3KH9A 1UC7A 2G2QA 4GSSA 4EDYA 4G10A 3IK9A 1XZOA 1Z3EA 4AJ6A 4K9ZA 4NHWA 4LMVA 2AAWA 3TRQA 1H4OA 3HJMA 1Q4JA 4Z2RA 3C1RA 5A5KA 3ZREA 3KZQA 2NPBA 3VWUA 4EDZA 4IP1A 1YF0A 1GSUA 3PPUA 2LS5A 3GX0A 5FHIA 2YWNA 4YKGA 3HJOA 4MDCA 1THOA 10GSA 4TW5A 1GTBA 1A0FA 1E6BA 2L6DA 5J3RA 1G7EA 4JR4A 3VFIA 1XWGA 4NXIA 3NZNA 4IBPA 3GL3A 1V58A 1S3RA 2R0GA 1YQ1A 2B5XA 2ES7A 1X9WB 3P7XA 3HKRA 5G5FA 2WCIA 2IMKA 2PVOC 4L5LA 1F37A 2IIYA 4GSNA 3DXBA 4OCFA 13GSA 2PERA 4WEYA 1F3AA 1BJXA 2JADA 1OE7A 6GSSA 1GWCA 2CT6A 4BL7B 5DDLA 1VF3A 5DAKA 5B6MA 3TUEA 5IPHA 3G7IA 2MMZA 2HLSA 3IE3A 3H4KA 3QFBC 2HZEB 5HR0A 3GRXA 5ECPB 3WGEA 4Q5RA 5D9XA 5CNWA 2A4HA 1SD8A 3RPNA 5EL8A 4DEJA 3BCIA 3KJYA 4NAXA 1SL0B 1WOUA 4K5SA 12GSA 1GUMA 3IRAA 4MZWA 2A2RA 1OC9B 1PFOA 18GSA 5KOXA 3VWVA 1KEBA 4MH3A 3LORA 1TKDB 1BEDA 3UVHA 5E59A 3GIXA 4KCAA 2PUKC 2F51A 4PUFC 5L71A 4HSCX 1B9YC 2C3NA 3N9JA 1PL1A 2ZNMA 3GSTA 1X5EA 2QKEA 2QA1A 4WF4A 4CY8A 3IC4A 3IK7A 2PU9C 2L4QA 2VM2A 4ML6A 3UAPA 3U6VA 3Q19A 5DBQA 2MBSA 3LYPA 1X9SB 1ZYNA 2PN8A 1JZWA 5JWOB 2C80A 1U87A 6GSXA 3E9JB 4IP6A 1R4WA 2EIQA 3HZ8A 4O32A 2R5GA 4MP4A 2VLVA 4D73A 4PXOA 1MDIA 4K2XA 1MD4A 2CVBA 1U6TA 1XVWA 4I2UA 2AV4A 2RM5A 2JL4A 4OFMA 1CQGA 2Z9SA 4HOJA 3UVTA 4ZB8A 20GSA 2K8VA 5IO0A 2FWGA 1KNGA 1J0FA 2LEGA 4ECIA 4E8EA 3VWXA 3GHAA 3EYTA 3TDGA 5ECMB 1KTEA 2RIIA 2H6YA 4Z2UA 2F9SA 2OE0A 1A23A 5B8BA 2DKIA 3FW2A 2A2PA 3TKRA 14GSA 5DQSA 2R4VA 1ST9A 3R2QA 1M9BA 2LJKA 1JZDA 3GURA 1Y25A 2IWTA 4MJEA 1OYJA 4NV5A 1ZGNA 3RHBA 1I5GA 3EMPA 2H6XA 4IHUA 2CX3A 3QOUA 3KGKA 4YAPA 5KN3A 5IIZA 4XS4B 4XCSA 4O92A 2QGVA 3ZTLA 4MMMA 2K6VA 4BPYA 2R2JA 5ELAA 1EEJA 2B1LA 1K0DA 2OKAA 3APOA 3FKFA 3KMNA 4KE3A 3A2XA 3M9JA 4POKA 4P3YB 2K8SA 4CW9A 2C4JA 1SJ6A 2CVDA 2JU5A 3TOUA 2FCHA 2WFCA 2O87A 4QL9A 1Z5YE 3DYRA 5G1LA 1A0RP 3A2WA 2PPTA 2KHPA 3TB2A 1SENA 5J9BA 3LG6A 4O5QA 4OD7A 5G30A 1H75A 5IO2A 1V2AA 4QL7A 1TDIA 2R0PA 2DJ3A 2VCTA 4X1UA 2VAFA 1AXDA 3ERWA 2HRNA 2YV7A 1GSEA 3H93A 3ZRDA 3C71A 5ECKB 4MNNA 5D9VA 3TKSA 3F4TA 3M1GA 4MA9A 1GTUA 3D21A 1K0MA 2CZ2A 1O85A 2MMOA 1O6JA 5CYYA 3AY8A 5AIXA 3LGCA 2MBTA 2VCQA 4YAVA 2HFDA 2H1AA 1WIKA 5ECLB 2KLXA 1PA3A 2DIYA 3WD6A 2WB9A 1DE1A 3GSSA 3US3A 1Z6MA 2J23A 3F3QA 5GSTA 3L0HA 4YQVA 1SL1B 3EPTA 4K2DA 4NV2A 2WJUA 2I3YA 2QA2A 1WMJA 3GA4A 3FR6A 4J2FA 2X8HA 2VOCA 4AJ8A 1NHYA 4FIWA 2E2GA 2E7PA 5ID2A 3DVWA 1J9BA 1K0CA 2MZCA 3UEMA 1U3AA 1BG5A 3BCKA 3D4TA 1YKCA 1ACVA 4KF9A 4GXZA 1E2YA 3ISOA 2NBSA 5EVOA 5LD0A 1MEKA 2H73A 4WBRD 2X8GA 4HDEA 5A4VA 1K0OA 5F06A 4EIQA 1HNAA 2DLXA 3TGZA 9GSSA 3LXTA 3MIXA 5G5EA 4IKHA 5IPGA 1O8XA 2VUPA 2X99A 2B3SA 3RPPA 3VWWA 1RQMA 4JR6A 3EURA 5B7CA 3ME7A 4YQUA 5DAKB 5J5NA 3F0IA 2V41A 2IFQB 1ZL9A 1GLQA 7GSSA 5HR1A 2DC5A 1X9MB 5G1KA 3CYNA 3MYDA 1SKRB 4GQCA 4L0WA 4PQHA 1A24A 1M9AA 2GZYA 1UN2A 4G0KA 3F6FA 1SKSB 2V2GA 4IJIA 4LLRA 4NPBA 3KP9A 2QSIA 3HVNA 2AJQB 1S3AA 2N5BA 4RQXA 4K0GA 3IHGA 1M0UA 2OJLA 3GV1A 4F2IA 1BAYA 2C1YA 1XOBA 4EUYA 1G0TA 3BOAA 4ECCA 3QMXA 2X64A 3D5JA 3IC8A 2C3QA 2FY6A 2RUFA 3OR5A 5F8BA 5H5QA 1FVJA 1XWKA 2OBIA 4EO3A 4HEA2 16GSA 3C73A 3DMLA 1TK0B 1TRVA 1VF2A 2OE1A 1AW9A 2GDRA 3QCPA 3A5WA 2RLIA 4OFNA 2DJJA 4MH2A 3L9UA 2EC4A 3KIJA 2GT6A 4GTUA 3E3EA 4GQFA 1NM3A 3NOFA 4XRDA 5JCGA 4A5PA 2H0IA 2N5AA 1SL2B 4BA7A 4K0NA 5CRDA 2OACA 3D0ZA 5HR3A 1YDKA 2LJAA 4YH2A 1GSDA 3UJ1A 4BIKA 2HT9A 5E4WA 1QGVA 1FW1A 4O5RA 3R3EA 4D73B 4ZIJA 1USBA 2REMA 4GRFA 1ML6A 2G0FA 1PGTA 4PNFA 4N11A 4ZXGA 2HE3A 1R26A 4OWYA 2I4AA 2NDOA 3IXRA 4ZB6A 3TOTA 4EC0A 1FB0A 2AUVA 1OKDA 4FYCA 4N10A 3VPTA 4JU5A 1PSQA 3HD5A 1R7HA 3GKKA 4IGJA 1FHEA 3M0FA 2B6MA 5COHA 2DKHA 11GSA 2VL9A 2C0EA 3DVXA 4TVEA 3PGTA 4RQRA 2FA8A 2GSTA 1A8LA 2YANA 3GTUA 1T4ZA 1JFUA 4PURA 2GLRA 3CTGA 2A4VA 2YNXA 5ENUA 3M3MA 1TU8A 1Z9HA 2PVQA 3Q74A 1WPIA 1M3IA 1YJ6A 3GKXA 1F2EA 1AAZA 3I9V2 4XHMA 4IJ3A 2IMDA 4PUAA 4E8HA 5JCWA 5HFIA 3TJJA 2P31A 2X49A 3GNJA 2IFQA 1TXXA 1F9MA 4HU9A 4PTSA 1GUKA 4NHZA 4ECBA 1ZOFA 1EP7A 2J9HA 4K5RA 4TR3A 4Z2TA 2YWOA 5H5SA 1V40A 3W6GA 4MJCA 4IVFA 3GH9A 5INYA 3TRXA 4PQ1A 3K8NA 2JZTA 3CRTA 3EVIA 4MPGA 1AC1A 4RI6A 3LFLA 2C8UA 2JACA 3EU4A 5CAXA 1X0RA 3HY2A 2RUEA 1YEPA 3HZ4A 1K3YA 1B8XA 5ECIB 3TKSE 3EC3A 2D2ZA 2GVPA 1SU9A 3IAM2 4EE0A 2DJKA 1XWAA 3F6DA 4IQ1A 5DCHA 2XC2A 3EWLA 2YWMA 1O7UA 3LJRA 3WT2A 4X43A 3BJ5A 3C8EA 3KTLA 4YKFA 2CAQA 1XW5A 1XW6A 4KAEA 3IA1A 4ZL7A 1U3IA 2B5EA 2CV4A 4V2MA 1SKWB 5J4UA 4N30A 4X0XA 2FLSA 2CVKA 5ECOB 4MF6A 1EGOA 5ECRB 1XWBA 4HS1A 1AQWA 4V2NA 4EIPA 1A2MA 3CXGA 1HNBA 2GSRA 2M72A 4HUAA 2IMFA 1IYHA 2ZCTA 4O5UA 3TKQA 1O8WA 4G9HA 4ZILA 1V9WA 1OE8A 3VI7A 1B4QA 4ILFA 2L5OA 1EV4A 2B5YA 4MZBA 2IJYA 1EV9A 1XG8A 1G6WA 2VD1A 2LNSA 3TRPA 2LUSA 2KP1A 2DMLA 2IMIA 1ON4A 3TKSC 5ID2B 4QQ7A 2FA4A 3MSZA 1EP8A 4ZBAA 1VRSD 5FWGA 4GF0A 4EKZA 1Z7PA 4TKYA 5C00A 5DCGA 4JZQA 1PN9A 1JZOA 2GZPA 1BYEA 3HHVA 2OBKA 2H19A 5A4WA 2LRTA 2VLUA 3ZLPA 5CRGA 5C04A 5JWRB 2H01A 3D4MA 1UA5A 3QAWA 3TJKA 3KD0A 2N5FA 2HI7A 3ZL5A 1ABAA 3GH6A 2R37A 3QFAC 2H0GA 22GSA 2VCVA 4KA0A 3KTBA 4POBA 1JZRA 4BWSA 1ZYQB 2YPMA 3BBYA 5IMDA 3VLNA 1EWXA 4Q5QA 1R5AA 1SYRA 3LQ7A 4TN8A 2VL2A 4ZL9A 4KDYA 2JZSA 2M80A 4HZ2A 4EVMA 3MWHA 1TRWA 1WE0A 3I69A 5JCUA 3LWAA 2YWIA 3LXZA 4F03A 3G7YA 2IPAA 1GSYA 4CY6A 4DSSA 1PRXA 3DD3A 1V98A 4BWQA 3KCMA 3F4RA 2XPEA 1MTCA 2FUG2 1MDKA 1RK4A 2GQMA 2B7JA 3FY7A 5D8IA 2HRKA 4F9ZA 1YKAA 4GLTA 4J57E 5BMUA 1HD2A 2MMNA 1T8EB 5LCZA 2YZUA 3MAKA 2PGTA 4L8EA 3ERFA 4HI7A 1ERUA 2MMAA 1LJRA 5IMCA 2CAIA 2R0CA 4KB3A 4J56E 3ZMKA 1XW9A 2H71A 4V2LA 4LA1A 3KMOA 4WETA 4KNDA 1GTAA 2IL3A 2O8VB 1V57A 2OADA 1K0AA 2YJ7A 5IMFA 5F05A 3SWLA 2P5QA 2L5LA 4JEDA 1TJDA 1AQXA 4MPFA 5DALA 3UOMA 5HQPA 2YP6A 1PX7A 2VCWA 4AF2A 2VM1A 3APSA 4KGIA 1EOGA 2KP2A 3UL3A 1JLWA 1T1VA 2FNOA 2X8CA 1YZXA 4N0VA 3EMXA 2H8LA 4G2EA 2JZRA 4G0IA 4MJAA 3APQA 3LYKA 3VK9A 3LW9A 2NVLA 4L5OA 5F0GA 4F0CA 2LV3A 5CREA 2WULA 3FZ4A 4F0BA 2RM6A 1XCCA 4AJ7A 4KSMA 4CDOA 4ACSA 3GTUB 2UZ8A 3DIEA 3UBLA 2WS2A 1O81A 4HQSA 4K6XA 4WXTA 3TJGA 4WR4A 3KH7A 4K7NA 5CRWA 2XBIA 3G7JA 5HFGA 1GSQA 3GYKA 3IV4A 5AISA 5CRHA 3GN3A 1XIYA 4HZ4A 1XFLA 2CQ9A 2GGTA 2P5RA 4DVCA 4ZL8A 3C7MA 4TR1A 3VURA 1PL2A 4V1Ag 4MK3A 1TU7A 4Q5FA 2ALBA 1SK0A 3UBKA 1PKZA 1F6MC 2H1GA 4GCIA 2GS3A 3QR6A 4KX4A 2VD0A 2BJXA 1EEMA 3LEFA 3ZFLA 4OCEA 2C3TA 2HRFA 1OC8A 3EU3A 4KW6A 1PD21 2FGXA 2C0GA 3EE2A 4I97A 3JCML 3P8WA 2VO4A 1SYXA 4FQUA 3FHKA 5F07A 4ZBDA 3IPZA 3DWVA 3SBCA 4IQAA 3O76A 2H76A 2E0QA 2FHEA 1URMA 4HU7A 4TXVA 4JE1A 2NTOA 2H70A 3NIVA 5IMAA 1XVQA 3GMFA 3TJFA 3RBTA 3VI5A 1NW2A 4I6XA 4ID0A 3H1NA 3QD9A 2H75A 2AYTA 5IOXA 2MYGA 2LTKA 2VLTA 4ICYA 2PWJA 3J7Yk 1F3BA 4BVXA 2LRCA 2I9HA 4EL1A 3TJBA 1WRYA 3KP8A 2EIRA 5A4UA 2GQKA 1EOHA 2V6OA 2H30A 2LNTA 1Q98A 1XXUA 1RW1A 2GZZA 1N2AA 3L9VA 3L4NA 2OA7A 2KUCA 3HA9A 2HSMA 1GTIA 5AGYA 1CQHA 4MF7A 1FO5A 2CZ3A 4XIHA 3BD2A 5B6NA 3HXSA 2HRAA 3LSZA 3GFKA 4G19A 1MD3A 4KCEA 1WWJA 2DSAA 3M9KA 6GSUA 3FEUA 5AN1A 3D6IA 2JSZA 1JLVA 2L57A 1T7PB 19GSA 1GSSA 3QAGA 2F3MA 2K18A 4GSTA 1ZZYA 4MJBA 5CP1A 1GSFA 3IBHA 4FYBA 4I5QA 4KDXA 4MCUA 3CSHA 1QUWA 1X5DA 2DJ2A 3GUSA 5KOWA 1KBNA 2WDUA 2B7KA 1M99A 3ZZXA 1DUGA 1A8YA 2AHEA 3GKNA 1THXA 1OKTA 2XPDA 2ON7A 2TRXA 4HQZA 2P0GA 3GKMA 2ON5A 2ZUPA 4HJMA 4K8MA 3FRCA 1QK8A 4YQMA 3FZ9A 3IHQA 3W8JA 3RAZA 4O7HA 1W4VA 4KSOA 2O89A 1X5CA 3DGQA 1QXHA 2LSTA 4JBBA 3RDWA 4DSSB 5KN0A 3U5RE 4ISDA 1S3CA 1DSBA 2M46A 4OMVA 1GRXA 3FMWA 1PMTA 1EGRA 4PX1A 1PQNA 1ZYPA 2LRNA 3DEXA 5IQYA 5DQYA 3FYGA 1AQVA 2AB6A 2WRTA 3P90A 4N0ZA 1M2AA 2R6KA 5J9CA 2H6ZA 2WGRA 1YEXA 3O6TA 4XS6A 4IS0A 2H66A 3WYWA 3O3TA 3IDVA 4POMA 3M8NA 4F82A 2VL2C 1Y6EA 4FYUA 5EY6A 4FH8A 4MLYA 1SK2A 2H0HA 4PNGA 2CA8A 2YJHA 3H79A 2HSYA 3RHCA 5DALB 3ED3A 4NWYA 2LJRA 2K9FA 4AGSA 4FO5A 3HVSA 4ML1A 4BVYA 2IN3A 1I9DA 5ABRA 5GAPD 4TXOA 4PGTA 1ILOA 2LQQA 2IMEA 5EPFA 3L78A 3FR9A 1B9XC 1TP9A 3IOSA 3I43A 4TRXA 2YOIA 2F8FA 2PMTA 4K1FA 2GTUA 1M2BA 4X4JA 1K0NA 3FZAA 1BX9A 3HDCA 1DBYA 3WT1A 4MABA 3F8UA 3Q6OA 3E0UA 1SJZA 5IMZA 2CX4A 1OAZA 2C0DA 1MDJA 3PINA 1GUHA 1J08A 1O73A 3S9FA 2BMXA 3QAVA 3UIWA 2GSSA 5ELGA 4WF5A 4POLA 2HZFA 5KEJA 4Z7XA 1SJIA 4H86A 1Z7RA 3CRUA 1BQ7A 2C0FA 1GP1A 3L9SA 3WGDA 4MZCA 2FWFA 3N5OA 2L59A 5IOWA 1PKWA 3CQFA 3ZVJD 1OVNA 5D9WA 3HYPA 1XPVA 1FAAA 1T4YA 3C1SA 1K3LA 3ZITA 3PR8A 4TR1B 3CMIA 4V1Ap 1GNWA 5B8AA 4USSA 3FK8A 1UVZA 1ZYEA 2FD3A 1TK8B 5FT3A 1XOAA 2JSYA 1S3DA 6GSVA 1EZKA 1FG4A 4KUNA 5KN2A 3TCOA 2YV9A 1GNEA 3G9BA 2KOKA 1FOVA 4BL7A 3CTFA 5D9TA 1HYUA 2H1DA 1GLPA 3DKSA 3DRNA 4DSQA 6GSYA 4TOPA 2XBQA 1VF1A 3IR4A 3MDKA 4IW9A 2HZEA 4ULXA 4WKWA 2F8AA 3A2VA 3ZYWA 2I1UA 2TIRA 1ERVA 5GSSA 3F3RA 4XTSA 1ZMAA 1FB6A 2V1MA 4L0UA 2LQOA 4K7OA 3W8SA 3GX8A 5ECSA 2FWEA 3QPMA 1OC9A 2DBCA 3TKPA 4ZB9A 1B4PA 2PBJA 4XRAA 3PH9A 5IM9A 2V32A 1G6YA 3F9UA 3ZFBA 4LL4B 5HFKA 3UARA 1G7OA 4K7IA 1M3JA 3QDNA 4RUVA 4BVXB 2VCZA 2A2SA 3WGXA 2L6CA 1K0BA 1NHOA 3H8QA 2HSHA 3HVXA 1GH2A 2X4AA 5JWQB 2H74A 1AUCA 4DSRA 2QC7A 17GSA 1GULA 1YF1A 3V1WA 3F4SA 5DJMA 3CBUA 3ERGA 2YZHA 5GZZB 3MNGA 3KEBA 6GSTA 4TR4A 4OO5A 3HJPA 1VF4A 3F63A 3EINA 2L4CA 1T00A 4I2TA 1TRSA 3KXOA 1R5PA 1WP0A 1ZCPA 1M7TA 3VPQA 2O7KA 4IELA 5DJLA 5CO3A 2O85A 5G2ZA 2XHFA 4RI7A 3GL5A 5HR2A 2H72A 1HNCA 1TRUA 4WR5A 1IYIA 1XBSA 2GQLA 1PN0A 8GSSA 1JHBA 4KDUA 3ME8A 2FWHA 5ECNB 2H1BA 3IAS2 2VIMA 2YCDA 3D22A 1B48A 3ZMLA 2VL3A 1OC3A 2B1KA 2LKUA 1U88A 4LMWA 4XS1A 5H5RA 2OE3A 3ZVJA 1LU4A 2DJ0A 5LNKe 1TTZA 3CSIA 5ECHB 1DE2A 2I81A 3UMAA 3Q18A 1AIUA 3ZIVA 1QQ2A 3CSJA 1TK5B 4TR0A 2GT5A 5KN1A 4XS4A 5D96A 4EF0A 6GSWA 5GAND 4IN0A 1K3OA 3A3TA 3J7Yb 1YY7A 3A5IA
chains in the Genus database with same CATH topology
5BRTA 1SK1A 1TI3A 4LL1B 5D73A 4ECJA 2TRCP 3ZIJA 2HYXA 1NSWA 1ERWA 4ZBBA 4OFTA 5IMVA 1N8JA 3FR3A 5G31A 1A2LA 4OO4A 5ECQB 2DJ1A 1FVKA 2HXKA 4PQIA 1GL8A 4WBJA 2VCXA 1TW9A 2R3XA 3KM6A 3P2AA 2DIZA 5DVBA 4JRRA 1C72A 2GSQA 1TOFA 1FOHA 4Q5NA 1PX6A 4BVYB 1LBKA 2EIOA 4GWRA 4CHSA 2BTOT 1VGLA 1XWCA 3HVVA 1A2JA 1T3BA 4TXOB 1TI1A 1ERTA 4HJ2A 1W89A 3HCZA 3FZ5A 1QMVA 4KH7A 2YN1A 1M2DA 4MF5A 1Z6NA 2DMMA 2WZ9A 2HNLA 2E2MA 4NMUA 4I8BA 4EXJA 2V6KA 3I6AA 5D93A 5AIVA 1HQOA 1WJKA 1SD9A 1QFNA 4G0LA 5J41A 3KH9A 1UC7A 2G2QA 4GSSA 4EDYA 4G10A 3IK9A 1XZOA 1Z3EA 4AJ6A 4K9ZA 4NHWA 4LMVA 2AAWA 3TRQA 1H4OA 3HJMA 1Q4JA 4Z2RA 3C1RA 5A5KA 3ZREA 3KZQA 2NPBA 3VWUA 4EDZA 4IP1A 1YF0A 1GSUA 3PPUA 2LS5A 3GX0A 5FHIA 2YWNA 4YKGA 3HJOA 4MDCA 1THOA 10GSA 4TW5A 1GTBA 1A0FA 1E6BA 2L6DA 5J3RA 1G7EA 4JR4A 3VFIA 1XWGA 4NXIA 3NZNA 4IBPA 3GL3A 1V58A 2R0GA 1YQ1A 2B5XA 2ES7A 1X9WB 3P7XA 3HKRA 5G5FA 2WCIA 2IMKA 2PVOC 4L5LA 1F37A 2IIYA 4GSNA 3DXBA 4OCFA 13GSA 2PERA 4WEYA 1F3AA 1BJXA 2JADA 1OE7A 6GSSA 1GWCA 2CT6A 4BL7B 5DDLA 1VF3A 5DAKA 5B6MA 3TUEA 5IPHA 3G7IA 2MMZA 2HLSA 3IE3A 3H4KA 3QFBC 2HZEB 5HR0A 3GRXA 5ECPB 3WGEA 4Q5RA 5D9XA 5CNWA 2A4HA 1SD8A 3RPNA 5EL8A 4DEJA 3BCIA 3KJYA 4NAXA 1SL0B 1WOUA 4K5SA 12GSA 1GUMA 3IRAA 4MZWA 2A2RA 1OC9B 18GSA 5KOXA 3VWVA 1KEBA 4MH3A 3LORA 1TKDB 1BEDA 3UVHA 5E59A 3GIXA 4KCAA 2PUKC 2F51A 4PUFC 5L71A 1B9YC 2C3NA 3N9JA 1PL1A 2ZNMA 3GSTA 1X5EA 2QKEA 2QA1A 4WF4A 4CY8A 3IC4A 3IK7A 2PU9C 2L4QA 2VM2A 4ML6A 3UAPA 3U6VA 3Q19A 5DBQA 2MBSA 3LYPA 1X9SB 1ZYNA 2PN8A 1JZWA 5JWOB 2C80A 1U87A 6GSXA 3E9JB 4IP6A 1R4WA 2EIQA 3HZ8A 4O32A 2R5GA 4MP4A 2VLVA 4D73A 4PXOA 1MDIA 4K2XA 1MD4A 2CVBA 1U6TA 1XVWA 4I2UA 2AV4A 2RM5A 2JL4A 4OFMA 1CQGA 2Z9SA 4HOJA 3UVTA 4ZB8A 20GSA 2K8VA 5IO0A 2FWGA 1KNGA 1J0FA 2LEGA 4ECIA 4E8EA 3VWXA 3GHAA 3EYTA 3TDGA 5ECMB 1KTEA 2RIIA 2H6YA 4Z2UA 2F9SA 2OE0A 1A23A 5B8BA 2DKIA 3FW2A 2A2PA 3TKRA 14GSA 5DQSA 2R4VA 1ST9A 3R2QA 1M9BA 2LJKA 1JZDA 3GURA 1Y25A 2IWTA 4MJEA 1OYJA 4NV5A 1ZGNA 3RHBA 1I5GA 3EMPA 2H6XA 4IHUA 2CX3A 3QOUA 3KGKA 4YAPA 5KN3A 5IIZA 4XS4B 4XCSA 4O92A 2QGVA 3ZTLA 4MMMA 2K6VA 4BPYA 2R2JA 5ELAA 1EEJA 2B1LA 1K0DA 2OKAA 3APOA 3FKFA 3KMNA 4KE3A 3A2XA 3M9JA 4POKA 4P3YB 2K8SA 4CW9A 2C4JA 1SJ6A 2CVDA 2JU5A 3TOUA 2FCHA 2WFCA 2O87A 4QL9A 1Z5YE 3DYRA 5G1LA 1A0RP 3A2WA 2PPTA 2KHPA 3TB2A 1SENA 5J9BA 3LG6A 4O5QA 4OD7A 5G30A 1H75A 5IO2A 1V2AA 4QL7A 1TDIA 2R0PA 2DJ3A 2VCTA 4X1UA 2VAFA 1AXDA 3ERWA 2HRNA 2YV7A 1GSEA 3H93A 3ZRDA 3C71A 5ECKB 4MNNA 5D9VA 3TKSA 3F4TA 3M1GA 4MA9A 1GTUA 3D21A 1K0MA 2CZ2A 1O85A 2MMOA 1O6JA 5CYYA 3AY8A 5AIXA 3LGCA 2MBTA 2VCQA 4YAVA 2HFDA 2H1AA 1WIKA 5ECLB 2KLXA 1PA3A 2DIYA 3WD6A 2WB9A 1DE1A 3GSSA 3US3A 1Z6MA 2J23A 3F3QA 5GSTA 3L0HA 4YQVA 1SL1B 3EPTA 4K2DA 4NV2A 2WJUA 2I3YA 2QA2A 1WMJA 3GA4A 3FR6A 4J2FA 2X8HA 2VOCA 4AJ8A 1NHYA 4FIWA 2E2GA 2E7PA 5ID2A 3DVWA 1J9BA 1K0CA 2MZCA 3UEMA 1U3AA 1BG5A 3BCKA 3D4TA 1YKCA 1ACVA 4KF9A 4GXZA 1E2YA 3ISOA 2NBSA 5EVOA 5LD0A 1MEKA 2H73A 4WBRD 2X8GA 4HDEA 5A4VA 1K0OA 5F06A 4EIQA 1HNAA 2DLXA 3TGZA 9GSSA 3LXTA 3MIXA 5G5EA 4IKHA 5IPGA 1O8XA 2VUPA 2X99A 2B3SA 3RPPA 3VWWA 1RQMA 4JR6A 3EURA 5B7CA 3ME7A 4YQUA 5DAKB 5J5NA 3F0IA 2V41A 2IFQB 1ZL9A 1GLQA 7GSSA 5HR1A 2DC5A 1X9MB 5G1KA 3CYNA 3MYDA 1SKRB 4GQCA 4L0WA 4PQHA 1A24A 1M9AA 2GZYA 1UN2A 4G0KA 3F6FA 1SKSB 2V2GA 4IJIA 4LLRA 4NPBA 3KP9A 2QSIA 2AJQB 1S3AA 2N5BA 4RQXA 4K0GA 3IHGA 1M0UA 2OJLA 3GV1A 4F2IA 1BAYA 2C1YA 1XOBA 4EUYA 1G0TA 3BOAA 4ECCA 3QMXA 2X64A 3D5JA 3IC8A 2C3QA 2FY6A 2RUFA 3OR5A 5F8BA 5H5QA 1FVJA 1XWKA 2OBIA 4EO3A 4HEA2 16GSA 3C73A 3DMLA 1TK0B 1TRVA 1VF2A 2OE1A 1AW9A 2GDRA 3QCPA 3A5WA 2RLIA 4OFNA 2DJJA 4MH2A 3L9UA 2EC4A 3KIJA 2GT6A 4GTUA 3E3EA 4GQFA 1NM3A 3NOFA 4XRDA 5JCGA 4A5PA 2H0IA 2N5AA 1SL2B 4BA7A 4K0NA 5CRDA 2OACA 3D0ZA 5HR3A 1YDKA 2LJAA 4YH2A 1GSDA 3UJ1A 2HT9A 5E4WA 1QGVA 1FW1A 4O5RA 3R3EA 4D73B 4ZIJA 1USBA 2REMA 4GRFA 1ML6A 2G0FA 1PGTA 4PNFA 4N11A 4ZXGA 2HE3A 1R26A 4OWYA 2I4AA 2NDOA 3IXRA 4ZB6A 3TOTA 4EC0A 1FB0A 2AUVA 1OKDA 4FYCA 4N10A 3VPTA 4JU5A 1PSQA 3HD5A 1R7HA 3GKKA 4IGJA 1FHEA 3M0FA 2B6MA 5COHA 2DKHA 11GSA 2VL9A 2C0EA 3DVXA 4TVEA 3PGTA 4RQRA 2FA8A 2GSTA 1A8LA 2YANA 3GTUA 1T4ZA 1JFUA 4PURA 2GLRA 3CTGA 2A4VA 2YNXA 5ENUA 3M3MA 1TU8A 1Z9HA 2PVQA 3Q74A 1WPIA 1YJ6A 3GKXA 1F2EA 1AAZA 3I9V2 4XHMA 4IJ3A 2IMDA 4PUAA 4E8HA 5JCWA 5HFIA 3TJJA 2P31A 2X49A 3GNJA 2IFQA 1TXXA 1F9MA 4HU9A 4PTSA 1GUKA 4NHZA 4ECBA 1ZOFA 1EP7A 2J9HA 4K5RA 4TR3A 4Z2TA 2YWOA 5H5SA 1V40A 3W6GA 4MJCA 4IVFA 3GH9A 5INYA 3TRXA 4PQ1A 3K8NA 2JZTA 3CRTA 3EVIA 4MPGA 1AC1A 4RI6A 3LFLA 2C8UA 2JACA 3EU4A 5CAXA 1X0RA 3HY2A 2RUEA 1YEPA 3HZ4A 1K3YA 1B8XA 5ECIB 3TKSE 3EC3A 2D2ZA 2GVPA 1SU9A 3IAM2 4EE0A 2DJKA 1XWAA 3F6DA 4IQ1A 5DCHA 2XC2A 3EWLA 2YWMA 1O7UA 3LJRA 3WT2A 4X43A 3BJ5A 3C8EA 3KTLA 4YKFA 2CAQA 1XW5A 1XW6A 4KAEA 3IA1A 4ZL7A 1U3IA 2B5EA 2CV4A 4V2MA 1SKWB 5J4UA 4N30A 4X0XA 2FLSA 2CVKA 5ECOB 4MF6A 1EGOA 5ECRB 1XWBA 4HS1A 1AQWA 4V2NA 4EIPA 1A2MA 3CXGA 1HNBA 2GSRA 2M72A 4HUAA 2IMFA 1IYHA 2ZCTA 4O5UA 3TKQA 1O8WA 4G9HA 4ZILA 1V9WA 1OE8A 3VI7A 1B4QA 4ILFA 2L5OA 1EV4A 2B5YA 4MZBA 2IJYA 1EV9A 1G6WA 2VD1A 2LNSA 3TRPA 2LUSA 2KP1A 2DMLA 2IMIA 1ON4A 3TKSC 5ID2B 4QQ7A 2FA4A 3MSZA 1EP8A 4ZBAA 1VRSD 5FWGA 4GF0A 4EKZA 1Z7PA 4TKYA 5C00A 5DCGA 4JZQA 1PN9A 1JZOA 2GZPA 1BYEA 3HHVA 2OBKA 2H19A 5A4WA 2LRTA 2VLUA 3ZLPA 5CRGA 5C04A 5JWRB 2H01A 3D4MA 1UA5A 3QAWA 3TJKA 3KD0A 2N5FA 2HI7A 3ZL5A 1ABAA 3GH6A 2R37A 3QFAC 2H0GA 22GSA 2VCVA 4KA0A 3KTBA 4POBA 1JZRA 4BWSA 1ZYQB 2YPMA 3BBYA 5IMDA 3VLNA 1EWXA 4Q5QA 1R5AA 1SYRA 3LQ7A 4TN8A 2VL2A 4ZL9A 4KDYA 2JZSA 2M80A 4HZ2A 4EVMA 3MWHA 1TRWA 1WE0A 3I69A 5JCUA 3LWAA 2YWIA 3LXZA 4F03A 3G7YA 2IPAA 1GSYA 4CY6A 4DSSA 1PRXA 3DD3A 1V98A 4BWQA 3KCMA 3F4RA 2XPEA 1MTCA 2FUG2 1MDKA 1RK4A 2GQMA 2B7JA 3FY7A 5D8IA 2HRKA 4F9ZA 1YKAA 4GLTA 4J57E 5BMUA 1HD2A 2MMNA 1T8EB 5LCZA 2YZUA 3MAKA 2PGTA 4L8EA 3ERFA 4HI7A 1ERUA 2MMAA 1LJRA 5IMCA 2CAIA 2R0CA 4KB3A 4J56E 3ZMKA 1XW9A 2H71A 4V2LA 4LA1A 3KMOA 4WETA 4KNDA 1GTAA 2IL3A 2O8VB 1V57A 2OADA 1K0AA 2YJ7A 5IMFA 5F05A 3SWLA 2P5QA 2L5LA 4JEDA 1TJDA 1AQXA 4MPFA 5DALA 3UOMA 5HQPA 2YP6A 1PX7A 2VCWA 4AF2A 2VM1A 3APSA 4KGIA 1EOGA 2KP2A 3UL3A 1JLWA 1T1VA 2FNOA 2X8CA 1YZXA 4N0VA 3EMXA 2H8LA 4G2EA 2JZRA 4G0IA 4MJAA 3APQA 3LYKA 3VK9A 3LW9A 2NVLA 4L5OA 5F0GA 4F0CA 2LV3A 5CREA 2WULA 3FZ4A 4F0BA 2RM6A 1XCCA 4AJ7A 4KSMA 4CDOA 4ACSA 3GTUB 2UZ8A 3DIEA 3UBLA 2WS2A 1O81A 4HQSA 4K6XA 4WXTA 3TJGA 4WR4A 3KH7A 4K7NA 5CRWA 2XBIA 3G7JA 5HFGA 1GSQA 3GYKA 3IV4A 5AISA 5CRHA 3GN3A 1XIYA 4HZ4A 1XFLA 2CQ9A 2GGTA 2P5RA 4DVCA 4ZL8A 3C7MA 4TR1A 3VURA 1PL2A 4V1Ag 4MK3A 1TU7A 4Q5FA 2ALBA 1SK0A 3UBKA 1PKZA 1F6MC 2H1GA 4GCIA 2GS3A 3QR6A 4KX4A 2VD0A 2BJXA 1EEMA 3LEFA 3ZFLA 4OCEA 2C3TA 2HRFA 1OC8A 3EU3A 4KW6A 1PD21 2FGXA 2C0GA 3EE2A 4I97A 3JCML 3P8WA 2VO4A 1SYXA 4FQUA 3FHKA 5F07A 4ZBDA 3IPZA 3DWVA 3SBCA 4IQAA 3O76A 2H76A 2E0QA 2FHEA 1URMA 4HU7A 4TXVA 4JE1A 2NTOA 2H70A 3NIVA 5IMAA 1XVQA 3GMFA 3TJFA 3RBTA 3VI5A 1NW2A 4I6XA 4ID0A 3H1NA 3QD9A 2H75A 2AYTA 5IOXA 2MYGA 2LTKA 2VLTA 4ICYA 2PWJA 3J7Yk 1F3BA 4BVXA 2LRCA 2I9HA 4EL1A 3TJBA 1WRYA 3KP8A 2EIRA 5A4UA 2GQKA 1EOHA 2V6OA 2H30A 2LNTA 1Q98A 1XXUA 1RW1A 2GZZA 1N2AA 3L9VA 3L4NA 2OA7A 2KUCA 3HA9A 2HSMA 1GTIA 5AGYA 1CQHA 4MF7A 1FO5A 2CZ3A 4XIHA 3BD2A 5B6NA 3HXSA 2HRAA 3LSZA 3GFKA 4G19A 1MD3A 4KCEA 1WWJA 2DSAA 3M9KA 6GSUA 3FEUA 5AN1A 3D6IA 2JSZA 1JLVA 2L57A 1T7PB 19GSA 1GSSA 3QAGA 2F3MA 2K18A 4GSTA 1ZZYA 4MJBA 5CP1A 1GSFA 3IBHA 4FYBA 4I5QA 4KDXA 4MCUA 3CSHA 1QUWA 1X5DA 2DJ2A 3GUSA 5KOWA 1KBNA 2WDUA 2B7KA 1M99A 3ZZXA 1DUGA 1A8YA 2AHEA 3GKNA 1THXA 1OKTA 2XPDA 2ON7A 2TRXA 4HQZA 2P0GA 3GKMA 2ON5A 2ZUPA 4HJMA 4K8MA 3FRCA 1QK8A 4YQMA 3FZ9A 3IHQA 3W8JA 3RAZA 4O7HA 1W4VA 4KSOA 2O89A 1X5CA 3DGQA 1QXHA 2LSTA 4JBBA 3RDWA 4DSSB 5KN0A 3U5RE 4ISDA 1S3CA 1DSBA 2M46A 4OMVA 1GRXA 3FMWA 1PMTA 1EGRA 4PX1A 1PQNA 1ZYPA 2LRNA 3DEXA 5IQYA 5DQYA 3FYGA 1AQVA 2AB6A 2WRTA 3P90A 4N0ZA 1M2AA 2R6KA 5J9CA 2H6ZA 2WGRA 1YEXA 3O6TA 4XS6A 4IS0A 2H66A 3WYWA 3O3TA 3IDVA 4POMA 3M8NA 4F82A 2VL2C 1Y6EA 4FYUA 5EY6A 4FH8A 4MLYA 1SK2A 2H0HA 4PNGA 2CA8A 2YJHA 3H79A 2HSYA 3RHCA 5DALB 3ED3A 4NWYA 2LJRA 2K9FA 4AGSA 4FO5A 3HVSA 4ML1A 4BVYA 2IN3A 1I9DA 5ABRA 5GAPD 4TXOA 4PGTA 1ILOA 2LQQA 2IMEA 5EPFA 3L78A 3FR9A 1B9XC 1TP9A 3IOSA 3I43A 4TRXA 2YOIA 2F8FA 2PMTA 4K1FA 2GTUA 1M2BA 4X4JA 1K0NA 3FZAA 1BX9A 3HDCA 1DBYA 3WT1A 4MABA 3F8UA 3Q6OA 3E0UA 1SJZA 5IMZA 2CX4A 1OAZA 2C0DA 1MDJA 3PINA 1GUHA 1J08A 1O73A 3S9FA 2BMXA 3QAVA 3UIWA 2GSSA 5ELGA 4WF5A 4POLA 2HZFA 5KEJA 4Z7XA 1SJIA 4H86A 1Z7RA 3CRUA 1BQ7A 2C0FA 1GP1A 3L9SA 3WGDA 4MZCA 2FWFA 3N5OA 2L59A 5IOWA 1PKWA 3ZVJD 1OVNA 5D9WA 3HYPA 1XPVA 1FAAA 1T4YA 3C1SA 1K3LA 3ZITA 3PR8A 4TR1B 3CMIA 4V1Ap 1GNWA 5B8AA 4USSA 3FK8A 1UVZA 1ZYEA 2FD3A 1TK8B 5FT3A 1XOAA 2JSYA 1S3DA 6GSVA 1EZKA 1FG4A 4KUNA 5KN2A 3TCOA 2YV9A 1GNEA 3G9BA 2KOKA 1FOVA 4BL7A 3CTFA 5D9TA 1HYUA 2H1DA 1GLPA 3DKSA 3DRNA 4DSQA 6GSYA 4TOPA 2XBQA 1VF1A 3IR4A 3MDKA 4IW9A 2HZEA 4ULXA 4WKWA 2F8AA 3A2VA 3ZYWA 2I1UA 2TIRA 1ERVA 5GSSA 3F3RA 4XTSA 1ZMAA 1FB6A 2V1MA 4L0UA 2LQOA 4K7OA 3W8SA 3GX8A 5ECSA 2FWEA 3QPMA 1OC9A 2DBCA 3TKPA 4ZB9A 1B4PA 2PBJA 4XRAA 3PH9A 5IM9A 2V32A 1G6YA 3F9UA 3ZFBA 4LL4B 5HFKA 3UARA 1G7OA 4K7IA 3QDNA 4RUVA 4BVXB 2VCZA 2A2SA 3WGXA 2L6CA 1K0BA 1NHOA 3H8QA 2HSHA 3HVXA 1GH2A 2X4AA 5JWQB 2H74A 1AUCA 4DSRA 2QC7A 17GSA 1GULA 1YF1A 3V1WA 3F4SA 5DJMA 3CBUA 3ERGA 2YZHA 5GZZB 3MNGA 3KEBA 6GSTA 4TR4A 4OO5A 3HJPA 1VF4A 3F63A 3EINA 2L4CA 1T00A 4I2TA 1TRSA 3KXOA 1R5PA 1WP0A 1ZCPA 1M7TA 3VPQA 2O7KA 4IELA 5DJLA 5CO3A 2O85A 5G2ZA 2XHFA 4RI7A 3GL5A 5HR2A 2H72A 1HNCA 1TRUA 4WR5A 1IYIA 1XBSA 2GQLA 1PN0A 8GSSA 1JHBA 4KDUA 3ME8A 2FWHA 5ECNB 2H1BA 3IAS2 2VIMA 2YCDA 3D22A 1B48A 3ZMLA 2VL3A 1OC3A 2B1KA 2LKUA 1U88A 4LMWA 4XS1A 5H5RA 2OE3A 3ZVJA 1LU4A 2DJ0A 5LNKe 1TTZA 3CSIA 5ECHB 1DE2A 2I81A 3UMAA 3Q18A 1AIUA 3ZIVA 1QQ2A 3CSJA 1TK5B 4TR0A 2GT5A 5KN1A 4XS4A 5D96A 4EF0A 6GSWA 5GAND 4IN0A 1K3OA 3A3TA 3J7Yb 1YY7A 3A5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SK1 A;  1TI3 A;  4LL1 B;  5D73 A;  4ECJ A;  2TRC P;  3ZIJ A;  2HYX A;  1NSW A;  1ERW A;  4ZBB A;  4OFT A;  5IMV A;  1N8J A;  3FR3 A;  5G31 A;  1A2L A;  4OO4 A;  5ECQ B;  2DJ1 A;  1FVK A;  2HXK A;  4PQI A;  1GL8 A;  4WBJ A;  2VCX A;  1TW9 A;  2R3X A;  3KM6 A;  3P2A A;  2DIZ A;  5DVB A;  4JRR A;  1C72 A;  2GSQ A;  1TOF A;  4Q5N A;  1PX6 A;  1LBK A;  2EIO A;  4GWR A;  4CHS A;  2BTO T;  1VGL A;  1XWC A;  3HVV A;  1A2J A;  1T3B A;  4TXO B;  1TI1 A;  1ERT A;  4HJ2 A;  1W89 A;  3HCZ A;  3FZ5 A;  1QMV A;  4KH7 A;  2YN1 A;  1M2D A;  4MF5 A;  1Z6N A;  2DMM A;  2WZ9 A;  2HNL A;  2E2M A;  4NMU A;  4I8B A;  4EXJ A;  2V6K A;  3I6A A;  5D93 A;  5AIV A;  1HQO A;  1WJK A;  1SD9 A;  1QFN A;  5J41 A;  3KH9 A;  1UC7 A;  2G2Q A;  4GSS A;  4EDY A;  4G10 A;  3IK9 A;  1XZO A;  1Z3E A;  4AJ6 A;  4K9Z A;  4NHW A;  4LMV A;  2AAW A;  3TRQ A;  1H4O A;  3HJM A;  1Q4J A;  3C1R A;  5A5K A;  3ZRE A;  3KZQ A;  2NPB A;  3VWU A;  4EDZ A;  4IP1 A;  1YF0 A;  1GSU A;  2LS5 A;  3GX0 A;  5FHI A;  2YWN A;  3HJO A;  4MDC A;  1THO A;  10GS A;  4TW5 A;  1GTB A;  1A0F A;  1E6B A;  2L6D A;  5J3R A;  1G7E A;  4JR4 A;  3VFI A;  1XWG A;  4NXI A;  3NZN A;  4IBP A;  3GL3 A;  1V58 A;  1YQ1 A;  2B5X A;  2ES7 A;  1X9W B;  3P7X A;  3HKR A;  5G5F A;  2WCI A;  2IMK A;  2PVO C;  4L5L A;  1F37 A;  2IIY A;  4GSN A;  3DXB A;  4OCF A;  13GS A;  2PER A;  4WEY A;  1F3A A;  1BJX A;  2JAD A;  1OE7 A;  6GSS A;  1GWC A;  2CT6 A;  5DDL A;  1VF3 A;  5DAK A;  5B6M A;  3TUE A;  5IPH A;  3G7I A;  2MMZ A;  2HLS A;  3IE3 A;  3H4K A;  3QFB C;  2HZE B;  5HR0 A;  3GRX A;  5ECP B;  3WGE A;  4Q5R A;  5D9X A;  5CNW A;  1SD8 A;  3RPN A;  5EL8 A;  4DEJ A;  3BCI A;  3KJY A;  4NAX A;  1SL0 B;  1WOU A;  12GS A;  1GUM A;  3IRA A;  4MZW A;  2A2R A;  1OC9 B;  18GS A;  3VWV A;  1KEB A;  4MH3 A;  3LOR A;  1TKD B;  1BED A;  3UVH A;  5E59 A;  3GIX A;  4KCA A;  2PUK C;  2F51 A;  4PUF C;  5L71 A;  1B9Y C;  2C3N A;  3N9J A;  1PL1 A;  2ZNM A;  3GST A;  1X5E A;  2QKE A;  4WF4 A;  3IC4 A;  3IK7 A;  2PU9 C;  2L4Q A;  2VM2 A;  4ML6 A;  3UAP A;  3U6V A;  3Q19 A;  5DBQ A;  2MBS A;  3LYP A;  1X9S B;  2PN8 A;  1JZW A;  5JWO B;  2C80 A;  1U87 A;  6GSX A;  3E9J B;  4IP6 A;  1R4W A;  2EIQ A;  3HZ8 A;  4O32 A;  2R5G A;  4MP4 A;  2VLV A;  4D73 A;  4PXO A;  1MDI A;  1MD4 A;  2CVB A;  1U6T A;  1XVW A;  4I2U A;  2AV4 A;  2RM5 A;  2JL4 A;  4OFM A;  1CQG A;  2Z9S A;  4HOJ A;  3UVT A;  4ZB8 A;  20GS A;  2K8V A;  5IO0 A;  2FWG A;  1KNG A;  1J0F A;  2LEG A;  4ECI A;  4E8E A;  3VWX A;  3GHA A;  3EYT A;  3TDG A;  5ECM B;  1KTE A;  2RII A;  2H6Y A;  2F9S A;  2OE0 A;  1A23 A;  5B8B A;  3TKR A;  3FW2 A;  14GS A;  5DQS A;  2R4V A;  1ST9 A;  3R2Q A;  1M9B A;  2LJK A;  1JZD A;  3GUR A;  1Y25 A;  2IWT A;  4MJE A;  1OYJ A;  4NV5 A;  1ZGN A;  3RHB A;  1I5G A;  3EMP A;  2H6X A;  4IHU A;  2CX3 A;  3QOU A;  3KGK A;  4YAP A;  5KN3 A;  5IIZ A;  4XS4 B;  4XCS A;  4O92 A;  2QGV A;  3ZTL A;  4MMM A;  2K6V A;  4BPY A;  2R2J A;  5ELA A;  1EEJ A;  2B1L A;  1K0D A;  2OKA A;  3APO A;  3FKF A;  3KMN A;  4KE3 A;  3A2X A;  3M9J A;  4POK A;  4P3Y B;  2K8S A;  4CW9 A;  2C4J A;  1SJ6 A;  2CVD A;  2JU5 A;  3TOU A;  2FCH A;  2WFC A;  2O87 A;  4QL9 A;  1Z5Y E;  3DYR A;  5G1L A;  1A0R P;  3A2W A;  2PPT A;  2KHP A;  3TB2 A;  1SEN A;  5J9B A;  3LG6 A;  4OD7 A;  5G30 A;  1H75 A;  5IO2 A;  1V2A A;  4QL7 A;  1TDI A;  2DJ3 A;  2VCT A;  4X1U A;  2VAF A;  1AXD A;  3ERW A;  2HRN A;  2YV7 A;  1GSE A;  3H93 A;  3ZRD A;  3C71 A;  5ECK B;  5D9V A;  3TKS A;  3F4T A;  3M1G A;  4MA9 A;  1GTU A;  3D21 A;  1K0M A;  2CZ2 A;  1O85 A;  2MMO A;  1O6J A;  5CYY A;  3AY8 A;  5AIX A;  3LGC A;  2MBT A;  2VCQ A;  4YAV A;  2HFD A;  2H1A A;  1WIK A;  5ECL B;  2KLX A;  1PA3 A;  2DIY A;  3WD6 A;  2WB9 A;  1DE1 A;  3GSS A;  3US3 A;  1Z6M A;  2J23 A;  3F3Q A;  5GST A;  3L0H A;  4YQV A;  1SL1 B;  4K2D A;  4NV2 A;  2WJU A;  2I3Y A;  1WMJ A;  3GA4 A;  3FR6 A;  4J2F A;  2X8H A;  2VOC A;  4AJ8 A;  1NHY A;  4FIW A;  2E2G A;  2E7P A;  5ID2 A;  3DVW A;  1J9B A;  1K0C A;  2MZC A;  3UEM A;  1U3A A;  1BG5 A;  3BCK A;  3D4T A;  1YKC A;  1ACV A;  4GXZ A;  1E2Y A;  3ISO A;  2NBS A;  5EVO A;  5LD0 A;  1MEK A;  2H73 A;  4WBR D;  2X8G A;  4HDE A;  5A4V A;  1K0O A;  5F06 A;  1HNA A;  2DLX A;  3TGZ A;  9GSS A;  3LXT A;  5G5E A;  4IKH A;  5IPG A;  1O8X A;  2VUP A;  2X99 A;  2B3S A;  3RPP A;  3VWW A;  1RQM A;  4JR6 A;  3EUR A;  5B7C A;  3ME7 A;  4YQU A;  5DAK B;  5J5N A;  3F0I A;  2V41 A;  2IFQ B;  1ZL9 A;  1GLQ A;  7GSS A;  5HR1 A;  2DC5 A;  1X9M B;  5G1K A;  3CYN A;  1SKR B;  4GQC A;  4L0W A;  4PQH A;  1A24 A;  1M9A A;  2GZY A;  1UN2 A;  3F6F A;  1SKS B;  2V2G A;  4IJI A;  4LLR A;  4NPB A;  3KP9 A;  2QSI A;  2AJQ B;  1S3A A;  2N5B A;  4RQX A;  4K0G A;  1M0U A;  2OJL A;  3GV1 A;  4F2I A;  1BAY A;  2C1Y A;  1XOB A;  4EUY A;  1G0T A;  3BOA A;  4ECC A;  3QMX A;  2X64 A;  3D5J A;  2C3Q A;  5F8B A;  2FY6 A;  2RUF A;  3OR5 A;  5H5Q A;  1FVJ A;  1XWK A;  2OBI A;  4EO3 A;  4HEA 2;  16GS A;  3C73 A;  3DML A;  1TK0 B;  1TRV A;  1VF2 A;  2OE1 A;  1AW9 A;  2GDR A;  3QCP A;  3A5W A;  2RLI A;  4OFN A;  2DJJ A;  4MH2 A;  3L9U A;  2EC4 A;  3KIJ A;  2GT6 A;  4GTU A;  3E3E A;  4GQF A;  1NM3 A;  3NOF A;  4XRD A;  5JCG A;  2H0I A;  2N5A A;  1SL2 B;  4BA7 A;  4K0N A;  5CRD A;  2OAC A;  3D0Z A;  5HR3 A;  1YDK A;  2LJA A;  4YH2 A;  1GSD A;  3UJ1 A;  2HT9 A;  5E4W A;  1QGV A;  1FW1 A;  4O5R A;  4D73 B;  4ZIJ A;  1USB A;  2REM A;  4GRF A;  1ML6 A;  2G0F A;  1PGT A;  4PNF A;  4N11 A;  4ZXG A;  2HE3 A;  1R26 A;  4OWY A;  2I4A A;  2NDO A;  3IXR A;  4ZB6 A;  3TOT A;  4EC0 A;  1FB0 A;  2AUV A;  1OKD A;  4FYC A;  4N10 A;  3VPT A;  4JU5 A;  1PSQ A;  3HD5 A;  1R7H A;  3GKK A;  4IGJ A;  1FHE A;  3M0F A;  2B6M A;  5COH A;  11GS A;  2VL9 A;  2C0E A;  3DVX A;  4TVE A;  3PGT A;  4RQR A;  2FA8 A;  2GST A;  1A8L A;  2YAN A;  3GTU A;  1T4Z A;  1JFU A;  4PUR A;  2GLR A;  3CTG A;  2A4V A;  2YNX A;  5ENU A;  3M3M A;  1TU8 A;  1Z9H A;  2PVQ A;  3Q74 A;  1WPI A;  1YJ6 A;  3GKX A;  1F2E A;  1AAZ A;  3I9V 2;  4XHM A;  4IJ3 A;  2IMD A;  4PUA A;  4E8H A;  5JCW A;  5HFI A;  3TJJ A;  2P31 A;  3GNJ A;  2IFQ A;  1TXX A;  1F9M A;  4HU9 A;  1GUK A;  4NHZ A;  4ECB A;  1ZOF A;  1EP7 A;  2J9H A;  4TR3 A;  2YWO A;  5H5S A;  1V40 A;  3W6G A;  4MJC A;  4IVF A;  3GH9 A;  5INY A;  3TRX A;  4PQ1 A;  3K8N A;  2JZT A;  3CRT A;  3EVI A;  4MPG A;  1AC1 A;  4RI6 A;  3LFL A;  2C8U A;  2JAC A;  3EU4 A;  5CAX A;  1X0R A;  3HY2 A;  2RUE A;  1YEP A;  3HZ4 A;  1K3Y A;  1B8X A;  5ECI B;  3TKS E;  3EC3 A;  2D2Z A;  2GVP A;  1SU9 A;  3IAM 2;  4EE0 A;  2DJK A;  1XWA A;  3F6D A;  4IQ1 A;  5DCH A;  2XC2 A;  3EWL A;  2YWM A;  1O7U A;  3LJR A;  3WT2 A;  4X43 A;  3BJ5 A;  3C8E A;  3KTL A;  2CAQ A;  1XW5 A;  1XW6 A;  4KAE A;  3IA1 A;  4ZL7 A;  1U3I A;  2B5E A;  2CV4 A;  4V2M A;  1SKW B;  5J4U A;  4N30 A;  4X0X A;  2FLS A;  2CVK A;  5ECO B;  4MF6 A;  1EGO A;  5ECR B;  1XWB A;  4HS1 A;  1AQW A;  4V2N A;  1A2M A;  3CXG A;  1HNB A;  2GSR A;  2M72 A;  4HUA A;  2IMF A;  1IYH A;  2ZCT A;  3TKQ A;  1O8W A;  4G9H A;  4ZIL A;  1V9W A;  1OE8 A;  3VI7 A;  1B4Q A;  4ILF A;  2L5O A;  1EV4 A;  2B5Y A;  4MZB A;  2IJY A;  1EV9 A;  1G6W A;  2VD1 A;  2LNS A;  3TRP A;  2LUS A;  2KP1 A;  2DML A;  2IMI A;  1ON4 A;  3TKS C;  5ID2 B;  4QQ7 A;  2FA4 A;  3MSZ A;  1EP8 A;  4ZBA A;  1VRS D;  5FWG A;  4GF0 A;  4EKZ A;  1Z7P A;  4TKY A;  5C00 A;  5DCG A;  4JZQ A;  1PN9 A;  1JZO A;  2GZP A;  1BYE A;  3HHV A;  2OBK A;  2H19 A;  5A4W A;  2LRT A;  2VLU A;  3ZLP A;  5CRG A;  5C04 A;  5JWR B;  2H01 A;  3D4M A;  1UA5 A;  3QAW A;  3TJK A;  3KD0 A;  2N5F A;  2HI7 A;  3ZL5 A;  1ABA A;  3GH6 A;  2R37 A;  3QFA C;  2H0G A;  22GS A;  2VCV A;  4KA0 A;  3KTB A;  4POB A;  1JZR A;  4BWS A;  1ZYQ B;  2YPM A;  3BBY A;  5IMD A;  3VLN A;  1EWX A;  4Q5Q A;  1R5A A;  1SYR A;  3LQ7 A;  4TN8 A;  2VL2 A;  4ZL9 A;  4KDY A;  2JZS A;  2M80 A;  4HZ2 A;  4EVM A;  3MWH A;  1TRW A;  1WE0 A;  3I69 A;  5JCU A;  3LWA A;  2YWI A;  3LXZ A;  4F03 A;  3G7Y A;  2IPA A;  1GSY A;  4DSS A;  1PRX A;  3DD3 A;  1V98 A;  4BWQ A;  3KCM A;  3F4R A;  2XPE A;  1MTC A;  2FUG 2;  1MDK A;  1RK4 A;  2GQM A;  2B7J A;  3FY7 A;  5D8I A;  4F9Z A;  1YKA A;  4GLT A;  4J57 E;  1HD2 A;  2MMN A;  1T8E B;  5LCZ A;  2YZU A;  3MAK A;  2PGT A;  4L8E A;  3ERF A;  4HI7 A;  1ERU A;  2MMA A;  1LJR A;  5IMC A;  2CAI A;  4KB3 A;  4J56 E;  3ZMK A;  1XW9 A;  2H71 A;  4V2L A;  4LA1 A;  3KMO A;  4WET A;  4KND A;  1GTA A;  2IL3 A;  2O8V B;  1V57 A;  2OAD A;  1K0A A;  2YJ7 A;  5IMF A;  5F05 A;  3SWL A;  2P5Q A;  2L5L A;  4JED A;  1TJD A;  1AQX A;  4MPF A;  5DAL A;  3UOM A;  5HQP A;  2YP6 A;  1PX7 A;  2VCW A;  4AF2 A;  2VM1 A;  3APS A;  4KGI A;  1EOG A;  2KP2 A;  3UL3 A;  1JLW A;  1T1V A;  2FNO A;  2X8C A;  1YZX A;  4N0V A;  3EMX A;  2H8L A;  4G2E A;  2JZR A;  4MJA A;  3APQ A;  3LYK A;  3VK9 A;  2NVL A;  4L5O A;  5F0G A;  4F0C A;  2LV3 A;  5CRE A;  2WUL A;  3FZ4 A;  4F0B A;  2RM6 A;  1XCC A;  4AJ7 A;  4KSM A;  4CDO A;  4ACS A;  3GTU B;  3DIE A;  3UBL A;  2WS2 A;  1O81 A;  4HQS A;  4K6X A;  4WXT A;  3TJG A;  4WR4 A;  3KH7 A;  4K7N A;  5CRW A;  2XBI A;  3G7J A;  5HFG A;  1GSQ A;  3GYK A;  3IV4 A;  5AIS A;  5CRH A;  3GN3 A;  1XIY A;  4HZ4 A;  1XFL A;  2CQ9 A;  2GGT A;  2P5R A;  4DVC A;  4ZL8 A;  3C7M A;  4TR1 A;  3VUR A;  1PL2 A;  4V1A g;  4MK3 A;  1TU7 A;  4Q5F A;  2ALB A;  1SK0 A;  3UBK A;  1PKZ A;  1F6M C;  2H1G A;  4GCI A;  2GS3 A;  3QR6 A;  4KX4 A;  2VD0 A;  2BJX A;  1EEM A;  3LEF A;  3ZFL A;  4OCE A;  2C3T A;  2HRF A;  1OC8 A;  3EU3 A;  4KW6 A;  1PD2 1;  2FGX A;  2C0G A;  3EE2 A;  4I97 A;  3JCM L;  3P8W A;  2VO4 A;  1SYX A;  3FHK A;  5F07 A;  4ZBD A;  3IPZ A;  3DWV A;  3SBC A;  4IQA A;  3O76 A;  2H76 A;  2E0Q A;  2FHE A;  1URM A;  4HU7 A;  4TXV A;  4JE1 A;  2NTO A;  2H70 A;  3NIV A;  5IMA A;  1XVQ A;  3GMF A;  3TJF A;  3RBT A;  3VI5 A;  1NW2 A;  4I6X A;  4ID0 A;  3H1N A;  3QD9 A;  2H75 A;  2AYT A;  5IOX A;  2MYG A;  2LTK A;  2VLT A;  2PWJ A;  3J7Y k;  1F3B A;  4BVX A;  2LRC A;  2I9H A;  4EL1 A;  3TJB A;  1WRY A;  3KP8 A;  2EIR A;  5A4U A;  2GQK A;  1EOH A;  2V6O A;  2H30 A;  2LNT A;  1Q98 A;  1XXU A;  1RW1 A;  2GZZ A;  1N2A A;  3L9V A;  3L4N A;  2OA7 A;  2KUC A;  3HA9 A;  5AGY A;  1GTI A;  1CQH A;  4MF7 A;  1FO5 A;  2CZ3 A;  4XIH A;  3BD2 A;  5B6N A;  3HXS A;  3LSZ A;  3GFK A;  4G19 A;  1MD3 A;  4KCE A;  1WWJ A;  2DSA A;  3M9K A;  6GSU A;  3FEU A;  5AN1 A;  3D6I A;  2JSZ A;  1JLV A;  2L57 A;  1T7P B;  19GS A;  1GSS A;  3QAG A;  2F3M A;  2K18 A;  4GST A;  1ZZY A;  4MJB A;  5CP1 A;  1GSF A;  3IBH A;  4FYB A;  4I5Q A;  4KDX A;  4MCU A;  3CSH A;  1QUW A;  1X5D A;  2DJ2 A;  3GUS A;  1KBN A;  2WDU A;  2B7K A;  1M99 A;  3ZZX A;  1DUG A;  1A8Y A;  2AHE A;  3GKN A;  1THX A;  1OKT A;  2XPD A;  2ON7 A;  2TRX A;  4HQZ A;  2P0G A;  3GKM A;  2ON5 A;  2ZUP A;  4HJM A;  4K8M A;  3FRC A;  1QK8 A;  4YQM A;  3FZ9 A;  3IHQ A;  3W8J A;  3RAZ A;  4O7H A;  1W4V A;  4KSO A;  2O89 A;  1X5C A;  3DGQ A;  1QXH A;  2LST A;  4JBB A;  3RDW A;  4DSS B;  5KN0 A;  3U5R E;  4ISD A;  1S3C A;  1DSB A;  2M46 A;  4OMV A;  1GRX A;  1PMT A;  1EGR A;  4PX1 A;  1PQN A;  2LRN A;  3DEX A;  5IQY A;  5DQY A;  3FYG A;  1AQV A;  2AB6 A;  2WRT A;  3P90 A;  4N0Z A;  1M2A A;  2R6K A;  5J9C A;  2H6Z A;  2WGR A;  1YEX A;  3O6T A;  4XS6 A;  4IS0 A;  2H66 A;  3WYW A;  3O3T A;  3IDV A;  4POM A;  3M8N A;  4F82 A;  2VL2 C;  1Y6E A;  4FYU A;  5EY6 A;  4FH8 A;  4MLY A;  1SK2 A;  2H0H A;  4PNG A;  2CA8 A;  2YJH A;  3H79 A;  2HSY A;  3RHC A;  5DAL B;  3ED3 A;  4NWY A;  2LJR A;  2K9F A;  4AGS A;  4FO5 A;  3HVS A;  4ML1 A;  4BVY A;  2IN3 A;  1I9D A;  5ABR A;  5GAP D;  4TXO A;  4PGT A;  1ILO A;  2LQQ A;  2IME A;  5EPF A;  3L78 A;  3FR9 A;  1B9X C;  1TP9 A;  3IOS A;  3I43 A;  4TRX A;  2YOI A;  2F8F A;  2PMT A;  4K1F A;  2GTU A;  1M2B A;  1K0N A;  3FZA A;  1BX9 A;  3HDC A;  1DBY A;  3WT1 A;  4MAB A;  3F8U A;  3Q6O A;  3E0U A;  1SJZ A;  5IMZ A;  2CX4 A;  1OAZ A;  2C0D A;  1MDJ A;  3PIN A;  1GUH A;  1J08 A;  1O73 A;  3S9F A;  2BMX A;  3QAV A;  3UIW A;  2GSS A;  5ELG A;  4WF5 A;  4POL A;  2HZF A;  5KEJ A;  4Z7X A;  1SJI A;  4H86 A;  1Z7R A;  3CRU A;  1BQ7 A;  2C0F A;  1GP1 A;  3L9S A;  3WGD A;  4MZC A;  2FWF A;  3N5O A;  2L59 A;  5IOW A;  1PKW A;  3ZVJ D;  1OVN A;  5D9W A;  3HYP A;  1XPV A;  1FAA A;  1T4Y A;  3C1S A;  1K3L A;  3ZIT A;  3PR8 A;  4TR1 B;  3CMI A;  4V1A p;  1GNW A;  5B8A A;  3FK8 A;  1UVZ A;  1ZYE A;  2FD3 A;  1TK8 B;  5FT3 A;  1XOA A;  2JSY A;  1S3D A;  6GSV A;  1EZK A;  1FG4 A;  4KUN A;  5KN2 A;  3TCO A;  2YV9 A;  1GNE A;  3G9B A;  2KOK A;  1FOV A;  4BL7 A;  3CTF A;  5D9T A;  1HYU A;  2H1D A;  1GLP A;  3DKS A;  3DRN A;  4DSQ A;  6GSY A;  4TOP A;  2XBQ A;  1VF1 A;  3IR4 A;  3MDK A;  4IW9 A;  2HZE A;  4ULX A;  4WKW A;  2F8A A;  3A2V A;  3ZYW A;  2I1U A;  2TIR A;  1ERV A;  5GSS A;  3F3R A;  4XTS A;  1ZMA A;  1FB6 A;  2V1M A;  4L0U A;  2LQO A;  4K7O A;  3W8S A;  3GX8 A;  5ECS A;  2FWE A;  3QPM A;  1OC9 A;  2DBC A;  3TKP A;  4ZB9 A;  1B4P A;  2PBJ A;  4XRA A;  3PH9 A;  5IM9 A;  2V32 A;  1G6Y A;  3F9U A;  3ZFB A;  4LL4 B;  5HFK A;  3UAR A;  1G7O A;  4K7I A;  3QDN A;  4RUV A;  2VCZ A;  2A2S A;  3WGX A;  2L6C A;  1K0B A;  1NHO A;  3H8Q A;  2HSH A;  3HVX A;  1GH2 A;  5JWQ B;  2H74 A;  1AUC A;  4DSR A;  2QC7 A;  17GS A;  1GUL A;  1YF1 A;  3V1W A;  3F4S A;  5DJM A;  3CBU A;  3ERG A;  2YZH A;  5GZZ B;  3MNG A;  3KEB A;  6GST A;  4TR4 A;  4OO5 A;  3HJP A;  1VF4 A;  3F63 A;  3EIN A;  2L4C A;  1T00 A;  4I2T A;  1TRS A;  3KXO A;  1R5P A;  1WP0 A;  1ZCP A;  1M7T A;  3VPQ A;  2O7K A;  4IEL A;  5DJL A;  5CO3 A;  2O85 A;  5G2Z A;  2XHF A;  4RI7 A;  3GL5 A;  5HR2 A;  2H72 A;  1HNC A;  1TRU A;  4WR5 A;  1IYI A;  1XBS A;  2GQL A;  8GSS A;  1JHB A;  4KDU A;  3ME8 A;  2FWH A;  5ECN B;  2H1B A;  3IAS 2;  2VIM A;  2YCD A;  3D22 A;  1B48 A;  3ZML A;  2VL3 A;  1OC3 A;  2B1K A;  2LKU A;  1U88 A;  4LMW A;  4XS1 A;  5H5R A;  2OE3 A;  3ZVJ A;  1LU4 A;  2DJ0 A;  5LNK e;  1TTZ A;  3CSI A;  5ECH B;  1DE2 A;  2I81 A;  3UMA A;  3Q18 A;  1AIU A;  3ZIV A;  1QQ2 A;  3CSJ A;  1TK5 B;  4TR0 A;  2GT5 A;  5KN1 A;  4XS4 A;  5D96 A;  4EF0 A;  6GSW A;  5GAN D;  4IN0 A;  1K3O A;  3A3T A;  3J7Y b;  1YY7 A; 
#chains in the Genus database with same CATH topology
 5BRT A;  1SK1 A;  1TI3 A;  4LL1 B;  5D73 A;  4ECJ A;  2TRC P;  3ZIJ A;  2HYX A;  1NSW A;  1ERW A;  4ZBB A;  4OFT A;  5IMV A;  1N8J A;  3FR3 A;  5G31 A;  1A2L A;  4OO4 A;  5ECQ B;  2DJ1 A;  1FVK A;  2HXK A;  4PQI A;  1GL8 A;  4WBJ A;  2VCX A;  1TW9 A;  2R3X A;  3KM6 A;  3P2A A;  2DIZ A;  5DVB A;  4JRR A;  1C72 A;  2GSQ A;  1TOF A;  1FOH A;  4Q5N A;  1PX6 A;  4BVY B;  1LBK A;  2EIO A;  4GWR A;  4CHS A;  2BTO T;  1VGL A;  1XWC A;  3HVV A;  1A2J A;  1T3B A;  4TXO B;  1TI1 A;  1ERT A;  4HJ2 A;  1W89 A;  3HCZ A;  3FZ5 A;  1QMV A;  4KH7 A;  2YN1 A;  1M2D A;  4MF5 A;  1Z6N A;  2DMM A;  2WZ9 A;  2HNL A;  2E2M A;  4NMU A;  4I8B A;  4EXJ A;  2V6K A;  3I6A A;  5D93 A;  5AIV A;  1HQO A;  1WJK A;  1SD9 A;  1QFN A;  4G0L A;  5J41 A;  3KH9 A;  1UC7 A;  2G2Q A;  4GSS A;  4EDY A;  4G10 A;  3IK9 A;  1XZO A;  1Z3E A;  4AJ6 A;  4K9Z A;  4NHW A;  4LMV A;  2AAW A;  3TRQ A;  1H4O A;  3HJM A;  1Q4J A;  4Z2R A;  3C1R A;  5A5K A;  3ZRE A;  3KZQ A;  2NPB A;  3VWU A;  4EDZ A;  4IP1 A;  1YF0 A;  1GSU A;  3PPU A;  2LS5 A;  3GX0 A;  5FHI A;  2YWN A;  4YKG A;  3HJO A;  4MDC A;  1THO A;  10GS A;  4TW5 A;  1GTB A;  1A0F A;  1E6B A;  2L6D A;  5J3R A;  1G7E A;  4JR4 A;  3VFI A;  1XWG A;  4NXI A;  3NZN A;  4IBP A;  3GL3 A;  1V58 A;  1S3R A;  2R0G A;  1YQ1 A;  2B5X A;  2ES7 A;  1X9W B;  3P7X A;  3HKR A;  5G5F A;  2WCI A;  2IMK A;  2PVO C;  4L5L A;  1F37 A;  2IIY A;  4GSN A;  3DXB A;  4OCF A;  13GS A;  2PER A;  4WEY A;  1F3A A;  1BJX A;  2JAD A;  1OE7 A;  6GSS A;  1GWC A;  2CT6 A;  4BL7 B;  5DDL A;  1VF3 A;  5DAK A;  5B6M A;  3TUE A;  5IPH A;  3G7I A;  2MMZ A;  2HLS A;  3IE3 A;  3H4K A;  3QFB C;  2HZE B;  5HR0 A;  3GRX A;  5ECP B;  3WGE A;  4Q5R A;  5D9X A;  5CNW A;  2A4H A;  1SD8 A;  3RPN A;  5EL8 A;  4DEJ A;  3BCI A;  3KJY A;  4NAX A;  1SL0 B;  1WOU A;  4K5S A;  12GS A;  1GUM A;  3IRA A;  4MZW A;  2A2R A;  1OC9 B;  1PFO A;  18GS A;  5KOX A;  3VWV A;  1KEB A;  4MH3 A;  3LOR A;  1TKD B;  1BED A;  3UVH A;  5E59 A;  3GIX A;  4KCA A;  2PUK C;  2F51 A;  4PUF C;  5L71 A;  4HSC X;  1B9Y C;  2C3N A;  3N9J A;  1PL1 A;  2ZNM A;  3GST A;  1X5E A;  2QKE A;  2QA1 A;  4WF4 A;  4CY8 A;  3IC4 A;  3IK7 A;  2PU9 C;  2L4Q A;  2VM2 A;  4ML6 A;  3UAP A;  3U6V A;  3Q19 A;  5DBQ A;  2MBS A;  3LYP A;  1X9S B;  1ZYN A;  2PN8 A;  1JZW A;  5JWO B;  2C80 A;  1U87 A;  6GSX A;  3E9J B;  4IP6 A;  1R4W A;  2EIQ A;  3HZ8 A;  4O32 A;  2R5G A;  4MP4 A;  2VLV A;  4D73 A;  4PXO A;  1MDI A;  4K2X A;  1MD4 A;  2CVB A;  1U6T A;  1XVW A;  4I2U A;  2AV4 A;  2RM5 A;  2JL4 A;  4OFM A;  1CQG A;  2Z9S A;  4HOJ A;  3UVT A;  4ZB8 A;  20GS A;  2K8V A;  5IO0 A;  2FWG A;  1KNG A;  1J0F A;  2LEG A;  4ECI A;  4E8E A;  3VWX A;  3GHA A;  3EYT A;  3TDG A;  5ECM B;  1KTE A;  2RII A;  2H6Y A;  4Z2U A;  2F9S A;  2OE0 A;  1A23 A;  5B8B A;  2DKI A;  3FW2 A;  2A2P A;  3TKR A;  14GS A;  5DQS A;  2R4V A;  1ST9 A;  3R2Q A;  1M9B A;  2LJK A;  1JZD A;  3GUR A;  1Y25 A;  2IWT A;  4MJE A;  1OYJ A;  4NV5 A;  1ZGN A;  3RHB A;  1I5G A;  3EMP A;  2H6X A;  4IHU A;  2CX3 A;  3QOU A;  3KGK A;  4YAP A;  5KN3 A;  5IIZ A;  4XS4 B;  4XCS A;  4O92 A;  2QGV A;  3ZTL A;  4MMM A;  2K6V A;  4BPY A;  2R2J A;  5ELA A;  1EEJ A;  2B1L A;  1K0D A;  2OKA A;  3APO A;  3FKF A;  3KMN A;  4KE3 A;  3A2X A;  3M9J A;  4POK A;  4P3Y B;  2K8S A;  4CW9 A;  2C4J A;  1SJ6 A;  2CVD A;  2JU5 A;  3TOU A;  2FCH A;  2WFC A;  2O87 A;  4QL9 A;  1Z5Y E;  3DYR A;  5G1L A;  1A0R P;  3A2W A;  2PPT A;  2KHP A;  3TB2 A;  1SEN A;  5J9B A;  3LG6 A;  4O5Q A;  4OD7 A;  5G30 A;  1H75 A;  5IO2 A;  1V2A A;  4QL7 A;  1TDI A;  2R0P A;  2DJ3 A;  2VCT A;  4X1U A;  2VAF A;  1AXD A;  3ERW A;  2HRN A;  2YV7 A;  1GSE A;  3H93 A;  3ZRD A;  3C71 A;  5ECK B;  4MNN A;  5D9V A;  3TKS A;  3F4T A;  3M1G A;  4MA9 A;  1GTU A;  3D21 A;  1K0M A;  2CZ2 A;  1O85 A;  2MMO A;  1O6J A;  5CYY A;  3AY8 A;  5AIX A;  3LGC A;  2MBT A;  2VCQ A;  4YAV A;  2HFD A;  2H1A A;  1WIK A;  5ECL B;  2KLX A;  1PA3 A;  2DIY A;  3WD6 A;  2WB9 A;  1DE1 A;  3GSS A;  3US3 A;  1Z6M A;  2J23 A;  3F3Q A;  5GST A;  3L0H A;  4YQV A;  1SL1 B;  3EPT A;  4K2D A;  4NV2 A;  2WJU A;  2I3Y A;  2QA2 A;  1WMJ A;  3GA4 A;  3FR6 A;  4J2F A;  2X8H A;  2VOC A;  4AJ8 A;  1NHY A;  4FIW A;  2E2G A;  2E7P A;  5ID2 A;  3DVW A;  1J9B A;  1K0C A;  2MZC A;  3UEM A;  1U3A A;  1BG5 A;  3BCK A;  3D4T A;  1YKC A;  1ACV A;  4KF9 A;  4GXZ A;  1E2Y A;  3ISO A;  2NBS A;  5EVO A;  5LD0 A;  1MEK A;  2H73 A;  4WBR D;  2X8G A;  4HDE A;  5A4V A;  1K0O A;  5F06 A;  4EIQ A;  1HNA A;  2DLX A;  3TGZ A;  9GSS A;  3LXT A;  3MIX A;  5G5E A;  4IKH A;  5IPG A;  1O8X A;  2VUP A;  2X99 A;  2B3S A;  3RPP A;  3VWW A;  1RQM A;  4JR6 A;  3EUR A;  5B7C A;  3ME7 A;  4YQU A;  5DAK B;  5J5N A;  3F0I A;  2V41 A;  2IFQ B;  1ZL9 A;  1GLQ A;  7GSS A;  5HR1 A;  2DC5 A;  1X9M B;  5G1K A;  3CYN A;  3MYD A;  1SKR B;  4GQC A;  4L0W A;  4PQH A;  1A24 A;  1M9A A;  2GZY A;  1UN2 A;  4G0K A;  3F6F A;  1SKS B;  2V2G A;  4IJI A;  4LLR A;  4NPB A;  3KP9 A;  2QSI A;  3HVN A;  2AJQ B;  1S3A A;  2N5B A;  4RQX A;  4K0G A;  3IHG A;  1M0U A;  2OJL A;  3GV1 A;  4F2I A;  1BAY A;  2C1Y A;  1XOB A;  4EUY A;  1G0T A;  3BOA A;  4ECC A;  3QMX A;  2X64 A;  3D5J A;  3IC8 A;  2C3Q A;  2FY6 A;  2RUF A;  3OR5 A;  5F8B A;  5H5Q A;  1FVJ A;  1XWK A;  2OBI A;  4EO3 A;  4HEA 2;  16GS A;  3C73 A;  3DML A;  1TK0 B;  1TRV A;  1VF2 A;  2OE1 A;  1AW9 A;  2GDR A;  3QCP A;  3A5W A;  2RLI A;  4OFN A;  2DJJ A;  4MH2 A;  3L9U A;  2EC4 A;  3KIJ A;  2GT6 A;  4GTU A;  3E3E A;  4GQF A;  1NM3 A;  3NOF A;  4XRD A;  5JCG A;  4A5P A;  2H0I A;  2N5A A;  1SL2 B;  4BA7 A;  4K0N A;  5CRD A;  2OAC A;  3D0Z A;  5HR3 A;  1YDK A;  2LJA A;  4YH2 A;  1GSD A;  3UJ1 A;  4BIK A;  2HT9 A;  5E4W A;  1QGV A;  1FW1 A;  4O5R A;  3R3E A;  4D73 B;  4ZIJ A;  1USB A;  2REM A;  4GRF A;  1ML6 A;  2G0F A;  1PGT A;  4PNF A;  4N11 A;  4ZXG A;  2HE3 A;  1R26 A;  4OWY A;  2I4A A;  2NDO A;  3IXR A;  4ZB6 A;  3TOT A;  4EC0 A;  1FB0 A;  2AUV A;  1OKD A;  4FYC A;  4N10 A;  3VPT A;  4JU5 A;  1PSQ A;  3HD5 A;  1R7H A;  3GKK A;  4IGJ A;  1FHE A;  3M0F A;  2B6M A;  5COH A;  2DKH A;  11GS A;  2VL9 A;  2C0E A;  3DVX A;  4TVE A;  3PGT A;  4RQR A;  2FA8 A;  2GST A;  1A8L A;  2YAN A;  3GTU A;  1T4Z A;  1JFU A;  4PUR A;  2GLR A;  3CTG A;  2A4V A;  2YNX A;  5ENU A;  3M3M A;  1TU8 A;  1Z9H A;  2PVQ A;  3Q74 A;  1WPI A;  1M3I A;  1YJ6 A;  3GKX A;  1F2E A;  1AAZ A;  3I9V 2;  4XHM A;  4IJ3 A;  2IMD A;  4PUA A;  4E8H A;  5JCW A;  5HFI A;  3TJJ A;  2P31 A;  2X49 A;  3GNJ A;  2IFQ A;  1TXX A;  1F9M A;  4HU9 A;  4PTS A;  1GUK A;  4NHZ A;  4ECB A;  1ZOF A;  1EP7 A;  2J9H A;  4K5R A;  4TR3 A;  4Z2T A;  2YWO A;  5H5S A;  1V40 A;  3W6G A;  4MJC A;  4IVF A;  3GH9 A;  5INY A;  3TRX A;  4PQ1 A;  3K8N A;  2JZT A;  3CRT A;  3EVI A;  4MPG A;  1AC1 A;  4RI6 A;  3LFL A;  2C8U A;  2JAC A;  3EU4 A;  5CAX A;  1X0R A;  3HY2 A;  2RUE A;  1YEP A;  3HZ4 A;  1K3Y A;  1B8X A;  5ECI B;  3TKS E;  3EC3 A;  2D2Z A;  2GVP A;  1SU9 A;  3IAM 2;  4EE0 A;  2DJK A;  1XWA A;  3F6D A;  4IQ1 A;  5DCH A;  2XC2 A;  3EWL A;  2YWM A;  1O7U A;  3LJR A;  3WT2 A;  4X43 A;  3BJ5 A;  3C8E A;  3KTL A;  4YKF A;  2CAQ A;  1XW5 A;  1XW6 A;  4KAE A;  3IA1 A;  4ZL7 A;  1U3I A;  2B5E A;  2CV4 A;  4V2M A;  1SKW B;  5J4U A;  4N30 A;  4X0X A;  2FLS A;  2CVK A;  5ECO B;  4MF6 A;  1EGO A;  5ECR B;  1XWB A;  4HS1 A;  1AQW A;  4V2N A;  4EIP A;  1A2M A;  3CXG A;  1HNB A;  2GSR A;  2M72 A;  4HUA A;  2IMF A;  1IYH A;  2ZCT A;  4O5U A;  3TKQ A;  1O8W A;  4G9H A;  4ZIL A;  1V9W A;  1OE8 A;  3VI7 A;  1B4Q A;  4ILF A;  2L5O A;  1EV4 A;  2B5Y A;  4MZB A;  2IJY A;  1EV9 A;  1XG8 A;  1G6W A;  2VD1 A;  2LNS A;  3TRP A;  2LUS A;  2KP1 A;  2DML A;  2IMI A;  1ON4 A;  3TKS C;  5ID2 B;  4QQ7 A;  2FA4 A;  3MSZ A;  1EP8 A;  4ZBA A;  1VRS D;  5FWG A;  4GF0 A;  4EKZ A;  1Z7P A;  4TKY A;  5C00 A;  5DCG A;  4JZQ A;  1PN9 A;  1JZO A;  2GZP A;  1BYE A;  3HHV A;  2OBK A;  2H19 A;  5A4W A;  2LRT A;  2VLU A;  3ZLP A;  5CRG A;  5C04 A;  5JWR B;  2H01 A;  3D4M A;  1UA5 A;  3QAW A;  3TJK A;  3KD0 A;  2N5F A;  2HI7 A;  3ZL5 A;  1ABA A;  3GH6 A;  2R37 A;  3QFA C;  2H0G A;  22GS A;  2VCV A;  4KA0 A;  3KTB A;  4POB A;  1JZR A;  4BWS A;  1ZYQ B;  2YPM A;  3BBY A;  5IMD A;  3VLN A;  1EWX A;  4Q5Q A;  1R5A A;  1SYR A;  3LQ7 A;  4TN8 A;  2VL2 A;  4ZL9 A;  4KDY A;  2JZS A;  2M80 A;  4HZ2 A;  4EVM A;  3MWH A;  1TRW A;  1WE0 A;  3I69 A;  5JCU A;  3LWA A;  2YWI A;  3LXZ A;  4F03 A;  3G7Y A;  2IPA A;  1GSY A;  4CY6 A;  4DSS A;  1PRX A;  3DD3 A;  1V98 A;  4BWQ A;  3KCM A;  3F4R A;  2XPE A;  1MTC A;  2FUG 2;  1MDK A;  1RK4 A;  2GQM A;  2B7J A;  3FY7 A;  5D8I A;  2HRK A;  4F9Z A;  1YKA A;  4GLT A;  4J57 E;  5BMU A;  1HD2 A;  2MMN A;  1T8E B;  5LCZ A;  2YZU A;  3MAK A;  2PGT A;  4L8E A;  3ERF A;  4HI7 A;  1ERU A;  2MMA A;  1LJR A;  5IMC A;  2CAI A;  2R0C A;  4KB3 A;  4J56 E;  3ZMK A;  1XW9 A;  2H71 A;  4V2L A;  4LA1 A;  3KMO A;  4WET A;  4KND A;  1GTA A;  2IL3 A;  2O8V B;  1V57 A;  2OAD A;  1K0A A;  2YJ7 A;  5IMF A;  5F05 A;  3SWL A;  2P5Q A;  2L5L A;  4JED A;  1TJD A;  1AQX A;  4MPF A;  5DAL A;  3UOM A;  5HQP A;  2YP6 A;  1PX7 A;  2VCW A;  4AF2 A;  2VM1 A;  3APS A;  4KGI A;  1EOG A;  2KP2 A;  3UL3 A;  1JLW A;  1T1V A;  2FNO A;  2X8C A;  1YZX A;  4N0V A;  3EMX A;  2H8L A;  4G2E A;  2JZR A;  4G0I A;  4MJA A;  3APQ A;  3LYK A;  3VK9 A;  3LW9 A;  2NVL A;  4L5O A;  5F0G A;  4F0C A;  2LV3 A;  5CRE A;  2WUL A;  3FZ4 A;  4F0B A;  2RM6 A;  1XCC A;  4AJ7 A;  4KSM A;  4CDO A;  4ACS A;  3GTU B;  2UZ8 A;  3DIE A;  3UBL A;  2WS2 A;  1O81 A;  4HQS A;  4K6X A;  4WXT A;  3TJG A;  4WR4 A;  3KH7 A;  4K7N A;  5CRW A;  2XBI A;  3G7J A;  5HFG A;  1GSQ A;  3GYK A;  3IV4 A;  5AIS A;  5CRH A;  3GN3 A;  1XIY A;  4HZ4 A;  1XFL A;  2CQ9 A;  2GGT A;  2P5R A;  4DVC A;  4ZL8 A;  3C7M A;  4TR1 A;  3VUR A;  1PL2 A;  4V1A g;  4MK3 A;  1TU7 A;  4Q5F A;  2ALB A;  1SK0 A;  3UBK A;  1PKZ A;  1F6M C;  2H1G A;  4GCI A;  2GS3 A;  3QR6 A;  4KX4 A;  2VD0 A;  2BJX A;  1EEM A;  3LEF A;  3ZFL A;  4OCE A;  2C3T A;  2HRF A;  1OC8 A;  3EU3 A;  4KW6 A;  1PD2 1;  2FGX A;  2C0G A;  3EE2 A;  4I97 A;  3JCM L;  3P8W A;  2VO4 A;  1SYX A;  4FQU A;  3FHK A;  5F07 A;  4ZBD A;  3IPZ A;  3DWV A;  3SBC A;  4IQA A;  3O76 A;  2H76 A;  2E0Q A;  2FHE A;  1URM A;  4HU7 A;  4TXV A;  4JE1 A;  2NTO A;  2H70 A;  3NIV A;  5IMA A;  1XVQ A;  3GMF A;  3TJF A;  3RBT A;  3VI5 A;  1NW2 A;  4I6X A;  4ID0 A;  3H1N A;  3QD9 A;  2H75 A;  2AYT A;  5IOX A;  2MYG A;  2LTK A;  2VLT A;  4ICY A;  2PWJ A;  3J7Y k;  1F3B A;  4BVX A;  2LRC A;  2I9H A;  4EL1 A;  3TJB A;  1WRY A;  3KP8 A;  2EIR A;  5A4U A;  2GQK A;  1EOH A;  2V6O A;  2H30 A;  2LNT A;  1Q98 A;  1XXU A;  1RW1 A;  2GZZ A;  1N2A A;  3L9V A;  3L4N A;  2OA7 A;  2KUC A;  3HA9 A;  2HSM A;  1GTI A;  5AGY A;  1CQH A;  4MF7 A;  1FO5 A;  2CZ3 A;  4XIH A;  3BD2 A;  5B6N A;  3HXS A;  2HRA A;  3LSZ A;  3GFK A;  4G19 A;  1MD3 A;  4KCE A;  1WWJ A;  2DSA A;  3M9K A;  6GSU A;  3FEU A;  5AN1 A;  3D6I A;  2JSZ A;  1JLV A;  2L57 A;  1T7P B;  19GS A;  1GSS A;  3QAG A;  2F3M A;  2K18 A;  4GST A;  1ZZY A;  4MJB A;  5CP1 A;  1GSF A;  3IBH A;  4FYB A;  4I5Q A;  4KDX A;  4MCU A;  3CSH A;  1QUW A;  1X5D A;  2DJ2 A;  3GUS A;  5KOW A;  1KBN A;  2WDU A;  2B7K A;  1M99 A;  3ZZX A;  1DUG A;  1A8Y A;  2AHE A;  3GKN A;  1THX A;  1OKT A;  2XPD A;  2ON7 A;  2TRX A;  4HQZ A;  2P0G A;  3GKM A;  2ON5 A;  2ZUP A;  4HJM A;  4K8M A;  3FRC A;  1QK8 A;  4YQM A;  3FZ9 A;  3IHQ A;  3W8J A;  3RAZ A;  4O7H A;  1W4V A;  4KSO A;  2O89 A;  1X5C A;  3DGQ A;  1QXH A;  2LST A;  4JBB A;  3RDW A;  4DSS B;  5KN0 A;  3U5R E;  4ISD A;  1S3C A;  1DSB A;  2M46 A;  4OMV A;  1GRX A;  3FMW A;  1PMT A;  1EGR A;  4PX1 A;  1PQN A;  1ZYP A;  2LRN A;  3DEX A;  5IQY A;  5DQY A;  3FYG A;  1AQV A;  2AB6 A;  2WRT A;  3P90 A;  4N0Z A;  1M2A A;  2R6K A;  5J9C A;  2H6Z A;  2WGR A;  1YEX A;  3O6T A;  4XS6 A;  4IS0 A;  2H66 A;  3WYW A;  3O3T A;  3IDV A;  4POM A;  3M8N A;  4F82 A;  2VL2 C;  1Y6E A;  4FYU A;  5EY6 A;  4FH8 A;  4MLY A;  1SK2 A;  2H0H A;  4PNG A;  2CA8 A;  2YJH A;  3H79 A;  2HSY A;  3RHC A;  5DAL B;  3ED3 A;  4NWY A;  2LJR A;  2K9F A;  4AGS A;  4FO5 A;  3HVS A;  4ML1 A;  4BVY A;  2IN3 A;  1I9D A;  5ABR A;  5GAP D;  4TXO A;  4PGT A;  1ILO A;  2LQQ A;  2IME A;  5EPF A;  3L78 A;  3FR9 A;  1B9X C;  1TP9 A;  3IOS A;  3I43 A;  4TRX A;  2YOI A;  2F8F A;  2PMT A;  4K1F A;  2GTU A;  1M2B A;  4X4J A;  1K0N A;  3FZA A;  1BX9 A;  3HDC A;  1DBY A;  3WT1 A;  4MAB A;  3F8U A;  3Q6O A;  3E0U A;  1SJZ A;  5IMZ A;  2CX4 A;  1OAZ A;  2C0D A;  1MDJ A;  3PIN A;  1GUH A;  1J08 A;  1O73 A;  3S9F A;  2BMX A;  3QAV A;  3UIW A;  2GSS A;  5ELG A;  4WF5 A;  4POL A;  2HZF A;  5KEJ A;  4Z7X A;  1SJI A;  4H86 A;  1Z7R A;  3CRU A;  1BQ7 A;  2C0F A;  1GP1 A;  3L9S A;  3WGD A;  4MZC A;  2FWF A;  3N5O A;  2L59 A;  5IOW A;  1PKW A;  3CQF A;  3ZVJ D;  1OVN A;  5D9W A;  3HYP A;  1XPV A;  1FAA A;  1T4Y A;  3C1S A;  1K3L A;  3ZIT A;  3PR8 A;  4TR1 B;  3CMI A;  4V1A p;  1GNW A;  5B8A A;  4USS A;  3FK8 A;  1UVZ A;  1ZYE A;  2FD3 A;  1TK8 B;  5FT3 A;  1XOA A;  2JSY A;  1S3D A;  6GSV A;  1EZK A;  1FG4 A;  4KUN A;  5KN2 A;  3TCO A;  2YV9 A;  1GNE A;  3G9B A;  2KOK A;  1FOV A;  4BL7 A;  3CTF A;  5D9T A;  1HYU A;  2H1D A;  1GLP A;  3DKS A;  3DRN A;  4DSQ A;  6GSY A;  4TOP A;  2XBQ A;  1VF1 A;  3IR4 A;  3MDK A;  4IW9 A;  2HZE A;  4ULX A;  4WKW A;  2F8A A;  3A2V A;  3ZYW A;  2I1U A;  2TIR A;  1ERV A;  5GSS A;  3F3R A;  4XTS A;  1ZMA A;  1FB6 A;  2V1M A;  4L0U A;  2LQO A;  4K7O A;  3W8S A;  3GX8 A;  5ECS A;  2FWE A;  3QPM A;  1OC9 A;  2DBC A;  3TKP A;  4ZB9 A;  1B4P A;  2PBJ A;  4XRA A;  3PH9 A;  5IM9 A;  2V32 A;  1G6Y A;  3F9U A;  3ZFB A;  4LL4 B;  5HFK A;  3UAR A;  1G7O A;  4K7I A;  1M3J A;  3QDN A;  4RUV A;  4BVX B;  2VCZ A;  2A2S A;  3WGX A;  2L6C A;  1K0B A;  1NHO A;  3H8Q A;  2HSH A;  3HVX A;  1GH2 A;  2X4A A;  5JWQ B;  2H74 A;  1AUC A;  4DSR A;  2QC7 A;  17GS A;  1GUL A;  1YF1 A;  3V1W A;  3F4S A;  5DJM A;  3CBU A;  3ERG A;  2YZH A;  5GZZ B;  3MNG A;  3KEB A;  6GST A;  4TR4 A;  4OO5 A;  3HJP A;  1VF4 A;  3F63 A;  3EIN A;  2L4C A;  1T00 A;  4I2T A;  1TRS A;  3KXO A;  1R5P A;  1WP0 A;  1ZCP A;  1M7T A;  3VPQ A;  2O7K A;  4IEL A;  5DJL A;  5CO3 A;  2O85 A;  5G2Z A;  2XHF A;  4RI7 A;  3GL5 A;  5HR2 A;  2H72 A;  1HNC A;  1TRU A;  4WR5 A;  1IYI A;  1XBS A;  2GQL A;  1PN0 A;  8GSS A;  1JHB A;  4KDU A;  3ME8 A;  2FWH A;  5ECN B;  2H1B A;  3IAS 2;  2VIM A;  2YCD A;  3D22 A;  1B48 A;  3ZML A;  2VL3 A;  1OC3 A;  2B1K A;  2LKU A;  1U88 A;  4LMW A;  4XS1 A;  5H5R A;  2OE3 A;  3ZVJ A;  1LU4 A;  2DJ0 A;  5LNK e;  1TTZ A;  3CSI A;  5ECH B;  1DE2 A;  2I81 A;  3UMA A;  3Q18 A;  1AIU A;  3ZIV A;  1QQ2 A;  3CSJ A;  1TK5 B;  4TR0 A;  2GT5 A;  5KN1 A;  4XS4 A;  5D96 A;  4EF0 A;  6GSW A;  5GAN D;  4IN0 A;  1K3O A;  3A3T A;  3J7Y b;  1YY7 A;  3A5I A; 
#chains in the Genus database with same CATH homology
 5BRT A;  1SK1 A;  1TI3 A;  4LL1 B;  5D73 A;  4ECJ A;  2TRC P;  3ZIJ A;  2HYX A;  1NSW A;  1ERW A;  4ZBB A;  4OFT A;  5IMV A;  1N8J A;  3FR3 A;  5G31 A;  1A2L A;  4OO4 A;  5ECQ B;  2DJ1 A;  1FVK A;  2HXK A;  4PQI A;  1GL8 A;  4WBJ A;  2VCX A;  1TW9 A;  2R3X A;  3KM6 A;  3P2A A;  2DIZ A;  5DVB A;  4JRR A;  1C72 A;  2GSQ A;  1TOF A;  1FOH A;  4Q5N A;  1PX6 A;  4BVY B;  1LBK A;  2EIO A;  4GWR A;  4CHS A;  2BTO T;  1VGL A;  1XWC A;  3HVV A;  1A2J A;  1T3B A;  4TXO B;  1TI1 A;  1ERT A;  4HJ2 A;  1W89 A;  3HCZ A;  3FZ5 A;  1QMV A;  4KH7 A;  2YN1 A;  1M2D A;  4MF5 A;  1Z6N A;  2DMM A;  2WZ9 A;  2HNL A;  2E2M A;  4NMU A;  4I8B A;  4EXJ A;  2V6K A;  3I6A A;  5D93 A;  5AIV A;  1HQO A;  1WJK A;  1SD9 A;  1QFN A;  4G0L A;  5J41 A;  3KH9 A;  1UC7 A;  2G2Q A;  4GSS A;  4EDY A;  4G10 A;  3IK9 A;  1XZO A;  1Z3E A;  4AJ6 A;  4K9Z A;  4NHW A;  4LMV A;  2AAW A;  3TRQ A;  1H4O A;  3HJM A;  1Q4J A;  4Z2R A;  3C1R A;  5A5K A;  3ZRE A;  3KZQ A;  2NPB A;  3VWU A;  4EDZ A;  4IP1 A;  1YF0 A;  1GSU A;  3PPU A;  2LS5 A;  3GX0 A;  5FHI A;  2YWN A;  4YKG A;  3HJO A;  4MDC A;  1THO A;  10GS A;  4TW5 A;  1GTB A;  1A0F A;  1E6B A;  2L6D A;  5J3R A;  1G7E A;  4JR4 A;  3VFI A;  1XWG A;  4NXI A;  3NZN A;  4IBP A;  3GL3 A;  1V58 A;  2R0G A;  1YQ1 A;  2B5X A;  2ES7 A;  1X9W B;  3P7X A;  3HKR A;  5G5F A;  2WCI A;  2IMK A;  2PVO C;  4L5L A;  1F37 A;  2IIY A;  4GSN A;  3DXB A;  4OCF A;  13GS A;  2PER A;  4WEY A;  1F3A A;  1BJX A;  2JAD A;  1OE7 A;  6GSS A;  1GWC A;  2CT6 A;  4BL7 B;  5DDL A;  1VF3 A;  5DAK A;  5B6M A;  3TUE A;  5IPH A;  3G7I A;  2MMZ A;  2HLS A;  3IE3 A;  3H4K A;  3QFB C;  2HZE B;  5HR0 A;  3GRX A;  5ECP B;  3WGE A;  4Q5R A;  5D9X A;  5CNW A;  2A4H A;  1SD8 A;  3RPN A;  5EL8 A;  4DEJ A;  3BCI A;  3KJY A;  4NAX A;  1SL0 B;  1WOU A;  4K5S A;  12GS A;  1GUM A;  3IRA A;  4MZW A;  2A2R A;  1OC9 B;  18GS A;  5KOX A;  3VWV A;  1KEB A;  4MH3 A;  3LOR A;  1TKD B;  1BED A;  3UVH A;  5E59 A;  3GIX A;  4KCA A;  2PUK C;  2F51 A;  4PUF C;  5L71 A;  1B9Y C;  2C3N A;  3N9J A;  1PL1 A;  2ZNM A;  3GST A;  1X5E A;  2QKE A;  2QA1 A;  4WF4 A;  4CY8 A;  3IC4 A;  3IK7 A;  2PU9 C;  2L4Q A;  2VM2 A;  4ML6 A;  3UAP A;  3U6V A;  3Q19 A;  5DBQ A;  2MBS A;  3LYP A;  1X9S B;  1ZYN A;  2PN8 A;  1JZW A;  5JWO B;  2C80 A;  1U87 A;  6GSX A;  3E9J B;  4IP6 A;  1R4W A;  2EIQ A;  3HZ8 A;  4O32 A;  2R5G A;  4MP4 A;  2VLV A;  4D73 A;  4PXO A;  1MDI A;  4K2X A;  1MD4 A;  2CVB A;  1U6T A;  1XVW A;  4I2U A;  2AV4 A;  2RM5 A;  2JL4 A;  4OFM A;  1CQG A;  2Z9S A;  4HOJ A;  3UVT A;  4ZB8 A;  20GS A;  2K8V A;  5IO0 A;  2FWG A;  1KNG A;  1J0F A;  2LEG A;  4ECI A;  4E8E A;  3VWX A;  3GHA A;  3EYT A;  3TDG A;  5ECM B;  1KTE A;  2RII A;  2H6Y A;  4Z2U A;  2F9S A;  2OE0 A;  1A23 A;  5B8B A;  2DKI A;  3FW2 A;  2A2P A;  3TKR A;  14GS A;  5DQS A;  2R4V A;  1ST9 A;  3R2Q A;  1M9B A;  2LJK A;  1JZD A;  3GUR A;  1Y25 A;  2IWT A;  4MJE A;  1OYJ A;  4NV5 A;  1ZGN A;  3RHB A;  1I5G A;  3EMP A;  2H6X A;  4IHU A;  2CX3 A;  3QOU A;  3KGK A;  4YAP A;  5KN3 A;  5IIZ A;  4XS4 B;  4XCS A;  4O92 A;  2QGV A;  3ZTL A;  4MMM A;  2K6V A;  4BPY A;  2R2J A;  5ELA A;  1EEJ A;  2B1L A;  1K0D A;  2OKA A;  3APO A;  3FKF A;  3KMN A;  4KE3 A;  3A2X A;  3M9J A;  4POK A;  4P3Y B;  2K8S A;  4CW9 A;  2C4J A;  1SJ6 A;  2CVD A;  2JU5 A;  3TOU A;  2FCH A;  2WFC A;  2O87 A;  4QL9 A;  1Z5Y E;  3DYR A;  5G1L A;  1A0R P;  3A2W A;  2PPT A;  2KHP A;  3TB2 A;  1SEN A;  5J9B A;  3LG6 A;  4O5Q A;  4OD7 A;  5G30 A;  1H75 A;  5IO2 A;  1V2A A;  4QL7 A;  1TDI A;  2R0P A;  2DJ3 A;  2VCT A;  4X1U A;  2VAF A;  1AXD A;  3ERW A;  2HRN A;  2YV7 A;  1GSE A;  3H93 A;  3ZRD A;  3C71 A;  5ECK B;  4MNN A;  5D9V A;  3TKS A;  3F4T A;  3M1G A;  4MA9 A;  1GTU A;  3D21 A;  1K0M A;  2CZ2 A;  1O85 A;  2MMO A;  1O6J A;  5CYY A;  3AY8 A;  5AIX A;  3LGC A;  2MBT A;  2VCQ A;  4YAV A;  2HFD A;  2H1A A;  1WIK A;  5ECL B;  2KLX A;  1PA3 A;  2DIY A;  3WD6 A;  2WB9 A;  1DE1 A;  3GSS A;  3US3 A;  1Z6M A;  2J23 A;  3F3Q A;  5GST A;  3L0H A;  4YQV A;  1SL1 B;  3EPT A;  4K2D A;  4NV2 A;  2WJU A;  2I3Y A;  2QA2 A;  1WMJ A;  3GA4 A;  3FR6 A;  4J2F A;  2X8H A;  2VOC A;  4AJ8 A;  1NHY A;  4FIW A;  2E2G A;  2E7P A;  5ID2 A;  3DVW A;  1J9B A;  1K0C A;  2MZC A;  3UEM A;  1U3A A;  1BG5 A;  3BCK A;  3D4T A;  1YKC A;  1ACV A;  4KF9 A;  4GXZ A;  1E2Y A;  3ISO A;  2NBS A;  5EVO A;  5LD0 A;  1MEK A;  2H73 A;  4WBR D;  2X8G A;  4HDE A;  5A4V A;  1K0O A;  5F06 A;  4EIQ A;  1HNA A;  2DLX A;  3TGZ A;  9GSS A;  3LXT A;  3MIX A;  5G5E A;  4IKH A;  5IPG A;  1O8X A;  2VUP A;  2X99 A;  2B3S A;  3RPP A;  3VWW A;  1RQM A;  4JR6 A;  3EUR A;  5B7C A;  3ME7 A;  4YQU A;  5DAK B;  5J5N A;  3F0I A;  2V41 A;  2IFQ B;  1ZL9 A;  1GLQ A;  7GSS A;  5HR1 A;  2DC5 A;  1X9M B;  5G1K A;  3CYN A;  3MYD A;  1SKR B;  4GQC A;  4L0W A;  4PQH A;  1A24 A;  1M9A A;  2GZY A;  1UN2 A;  4G0K A;  3F6F A;  1SKS B;  2V2G A;  4IJI A;  4LLR A;  4NPB A;  3KP9 A;  2QSI A;  2AJQ B;  1S3A A;  2N5B A;  4RQX A;  4K0G A;  3IHG A;  1M0U A;  2OJL A;  3GV1 A;  4F2I A;  1BAY A;  2C1Y A;  1XOB A;  4EUY A;  1G0T A;  3BOA A;  4ECC A;  3QMX A;  2X64 A;  3D5J A;  3IC8 A;  2C3Q A;  2FY6 A;  2RUF A;  3OR5 A;  5F8B A;  5H5Q A;  1FVJ A;  1XWK A;  2OBI A;  4EO3 A;  4HEA 2;  16GS A;  3C73 A;  3DML A;  1TK0 B;  1TRV A;  1VF2 A;  2OE1 A;  1AW9 A;  2GDR A;  3QCP A;  3A5W A;  2RLI A;  4OFN A;  2DJJ A;  4MH2 A;  3L9U A;  2EC4 A;  3KIJ A;  2GT6 A;  4GTU A;  3E3E A;  4GQF A;  1NM3 A;  3NOF A;  4XRD A;  5JCG A;  4A5P A;  2H0I A;  2N5A A;  1SL2 B;  4BA7 A;  4K0N A;  5CRD A;  2OAC A;  3D0Z A;  5HR3 A;  1YDK A;  2LJA A;  4YH2 A;  1GSD A;  3UJ1 A;  2HT9 A;  5E4W A;  1QGV A;  1FW1 A;  4O5R A;  3R3E A;  4D73 B;  4ZIJ A;  1USB A;  2REM A;  4GRF A;  1ML6 A;  2G0F A;  1PGT A;  4PNF A;  4N11 A;  4ZXG A;  2HE3 A;  1R26 A;  4OWY A;  2I4A A;  2NDO A;  3IXR A;  4ZB6 A;  3TOT A;  4EC0 A;  1FB0 A;  2AUV A;  1OKD A;  4FYC A;  4N10 A;  3VPT A;  4JU5 A;  1PSQ A;  3HD5 A;  1R7H A;  3GKK A;  4IGJ A;  1FHE A;  3M0F A;  2B6M A;  5COH A;  2DKH A;  11GS A;  2VL9 A;  2C0E A;  3DVX A;  4TVE A;  3PGT A;  4RQR A;  2FA8 A;  2GST A;  1A8L A;  2YAN A;  3GTU A;  1T4Z A;  1JFU A;  4PUR A;  2GLR A;  3CTG A;  2A4V A;  2YNX A;  5ENU A;  3M3M A;  1TU8 A;  1Z9H A;  2PVQ A;  3Q74 A;  1WPI A;  1YJ6 A;  3GKX A;  1F2E A;  1AAZ A;  3I9V 2;  4XHM A;  4IJ3 A;  2IMD A;  4PUA A;  4E8H A;  5JCW A;  5HFI A;  3TJJ A;  2P31 A;  2X49 A;  3GNJ A;  2IFQ A;  1TXX A;  1F9M A;  4HU9 A;  4PTS A;  1GUK A;  4NHZ A;  4ECB A;  1ZOF A;  1EP7 A;  2J9H A;  4K5R A;  4TR3 A;  4Z2T A;  2YWO A;  5H5S A;  1V40 A;  3W6G A;  4MJC A;  4IVF A;  3GH9 A;  5INY A;  3TRX A;  4PQ1 A;  3K8N A;  2JZT A;  3CRT A;  3EVI A;  4MPG A;  1AC1 A;  4RI6 A;  3LFL A;  2C8U A;  2JAC A;  3EU4 A;  5CAX A;  1X0R A;  3HY2 A;  2RUE A;  1YEP A;  3HZ4 A;  1K3Y A;  1B8X A;  5ECI B;  3TKS E;  3EC3 A;  2D2Z A;  2GVP A;  1SU9 A;  3IAM 2;  4EE0 A;  2DJK A;  1XWA A;  3F6D A;  4IQ1 A;  5DCH A;  2XC2 A;  3EWL A;  2YWM A;  1O7U A;  3LJR A;  3WT2 A;  4X43 A;  3BJ5 A;  3C8E A;  3KTL A;  4YKF A;  2CAQ A;  1XW5 A;  1XW6 A;  4KAE A;  3IA1 A;  4ZL7 A;  1U3I A;  2B5E A;  2CV4 A;  4V2M A;  1SKW B;  5J4U A;  4N30 A;  4X0X A;  2FLS A;  2CVK A;  5ECO B;  4MF6 A;  1EGO A;  5ECR B;  1XWB A;  4HS1 A;  1AQW A;  4V2N A;  4EIP A;  1A2M A;  3CXG A;  1HNB A;  2GSR A;  2M72 A;  4HUA A;  2IMF A;  1IYH A;  2ZCT A;  4O5U A;  3TKQ A;  1O8W A;  4G9H A;  4ZIL A;  1V9W A;  1OE8 A;  3VI7 A;  1B4Q A;  4ILF A;  2L5O A;  1EV4 A;  2B5Y A;  4MZB A;  2IJY A;  1EV9 A;  1G6W A;  2VD1 A;  2LNS A;  3TRP A;  2LUS A;  2KP1 A;  2DML A;  2IMI A;  1ON4 A;  3TKS C;  5ID2 B;  4QQ7 A;  2FA4 A;  3MSZ A;  1EP8 A;  4ZBA A;  1VRS D;  5FWG A;  4GF0 A;  4EKZ A;  1Z7P A;  4TKY A;  5C00 A;  5DCG A;  4JZQ A;  1PN9 A;  1JZO A;  2GZP A;  1BYE A;  3HHV A;  2OBK A;  2H19 A;  5A4W A;  2LRT A;  2VLU A;  3ZLP A;  5CRG A;  5C04 A;  5JWR B;  2H01 A;  3D4M A;  1UA5 A;  3QAW A;  3TJK A;  3KD0 A;  2N5F A;  2HI7 A;  3ZL5 A;  1ABA A;  3GH6 A;  2R37 A;  3QFA C;  2H0G A;  22GS A;  2VCV A;  4KA0 A;  3KTB A;  4POB A;  1JZR A;  4BWS A;  1ZYQ B;  2YPM A;  3BBY A;  5IMD A;  3VLN A;  1EWX A;  4Q5Q A;  1R5A A;  1SYR A;  3LQ7 A;  4TN8 A;  2VL2 A;  4ZL9 A;  4KDY A;  2JZS A;  2M80 A;  4HZ2 A;  4EVM A;  3MWH A;  1TRW A;  1WE0 A;  3I69 A;  5JCU A;  3LWA A;  2YWI A;  3LXZ A;  4F03 A;  3G7Y A;  2IPA A;  1GSY A;  4CY6 A;  4DSS A;  1PRX A;  3DD3 A;  1V98 A;  4BWQ A;  3KCM A;  3F4R A;  2XPE A;  1MTC A;  2FUG 2;  1MDK A;  1RK4 A;  2GQM A;  2B7J A;  3FY7 A;  5D8I A;  2HRK A;  4F9Z A;  1YKA A;  4GLT A;  4J57 E;  5BMU A;  1HD2 A;  2MMN A;  1T8E B;  5LCZ A;  2YZU A;  3MAK A;  2PGT A;  4L8E A;  3ERF A;  4HI7 A;  1ERU A;  2MMA A;  1LJR A;  5IMC A;  2CAI A;  2R0C A;  4KB3 A;  4J56 E;  3ZMK A;  1XW9 A;  2H71 A;  4V2L A;  4LA1 A;  3KMO A;  4WET A;  4KND A;  1GTA A;  2IL3 A;  2O8V B;  1V57 A;  2OAD A;  1K0A A;  2YJ7 A;  5IMF A;  5F05 A;  3SWL A;  2P5Q A;  2L5L A;  4JED A;  1TJD A;  1AQX A;  4MPF A;  5DAL A;  3UOM A;  5HQP A;  2YP6 A;  1PX7 A;  2VCW A;  4AF2 A;  2VM1 A;  3APS A;  4KGI A;  1EOG A;  2KP2 A;  3UL3 A;  1JLW A;  1T1V A;  2FNO A;  2X8C A;  1YZX A;  4N0V A;  3EMX A;  2H8L A;  4G2E A;  2JZR A;  4G0I A;  4MJA A;  3APQ A;  3LYK A;  3VK9 A;  3LW9 A;  2NVL A;  4L5O A;  5F0G A;  4F0C A;  2LV3 A;  5CRE A;  2WUL A;  3FZ4 A;  4F0B A;  2RM6 A;  1XCC A;  4AJ7 A;  4KSM A;  4CDO A;  4ACS A;  3GTU B;  2UZ8 A;  3DIE A;  3UBL A;  2WS2 A;  1O81 A;  4HQS A;  4K6X A;  4WXT A;  3TJG A;  4WR4 A;  3KH7 A;  4K7N A;  5CRW A;  2XBI A;  3G7J A;  5HFG A;  1GSQ A;  3GYK A;  3IV4 A;  5AIS A;  5CRH A;  3GN3 A;  1XIY A;  4HZ4 A;  1XFL A;  2CQ9 A;  2GGT A;  2P5R A;  4DVC A;  4ZL8 A;  3C7M A;  4TR1 A;  3VUR A;  1PL2 A;  4V1A g;  4MK3 A;  1TU7 A;  4Q5F A;  2ALB A;  1SK0 A;  3UBK A;  1PKZ A;  1F6M C;  2H1G A;  4GCI A;  2GS3 A;  3QR6 A;  4KX4 A;  2VD0 A;  2BJX A;  1EEM A;  3LEF A;  3ZFL A;  4OCE A;  2C3T A;  2HRF A;  1OC8 A;  3EU3 A;  4KW6 A;  1PD2 1;  2FGX A;  2C0G A;  3EE2 A;  4I97 A;  3JCM L;  3P8W A;  2VO4 A;  1SYX A;  4FQU A;  3FHK A;  5F07 A;  4ZBD A;  3IPZ A;  3DWV A;  3SBC A;  4IQA A;  3O76 A;  2H76 A;  2E0Q A;  2FHE A;  1URM A;  4HU7 A;  4TXV A;  4JE1 A;  2NTO A;  2H70 A;  3NIV A;  5IMA A;  1XVQ A;  3GMF A;  3TJF A;  3RBT A;  3VI5 A;  1NW2 A;  4I6X A;  4ID0 A;  3H1N A;  3QD9 A;  2H75 A;  2AYT A;  5IOX A;  2MYG A;  2LTK A;  2VLT A;  4ICY A;  2PWJ A;  3J7Y k;  1F3B A;  4BVX A;  2LRC A;  2I9H A;  4EL1 A;  3TJB A;  1WRY A;  3KP8 A;  2EIR A;  5A4U A;  2GQK A;  1EOH A;  2V6O A;  2H30 A;  2LNT A;  1Q98 A;  1XXU A;  1RW1 A;  2GZZ A;  1N2A A;  3L9V A;  3L4N A;  2OA7 A;  2KUC A;  3HA9 A;  2HSM A;  1GTI A;  5AGY A;  1CQH A;  4MF7 A;  1FO5 A;  2CZ3 A;  4XIH A;  3BD2 A;  5B6N A;  3HXS A;  2HRA A;  3LSZ A;  3GFK A;  4G19 A;  1MD3 A;  4KCE A;  1WWJ A;  2DSA A;  3M9K A;  6GSU A;  3FEU A;  5AN1 A;  3D6I A;  2JSZ A;  1JLV A;  2L57 A;  1T7P B;  19GS A;  1GSS A;  3QAG A;  2F3M A;  2K18 A;  4GST A;  1ZZY A;  4MJB A;  5CP1 A;  1GSF A;  3IBH A;  4FYB A;  4I5Q A;  4KDX A;  4MCU A;  3CSH A;  1QUW A;  1X5D A;  2DJ2 A;  3GUS A;  5KOW A;  1KBN A;  2WDU A;  2B7K A;  1M99 A;  3ZZX A;  1DUG A;  1A8Y A;  2AHE A;  3GKN A;  1THX A;  1OKT A;  2XPD A;  2ON7 A;  2TRX A;  4HQZ A;  2P0G A;  3GKM A;  2ON5 A;  2ZUP A;  4HJM A;  4K8M A;  3FRC A;  1QK8 A;  4YQM A;  3FZ9 A;  3IHQ A;  3W8J A;  3RAZ A;  4O7H A;  1W4V A;  4KSO A;  2O89 A;  1X5C A;  3DGQ A;  1QXH A;  2LST A;  4JBB A;  3RDW A;  4DSS B;  5KN0 A;  3U5R E;  4ISD A;  1S3C A;  1DSB A;  2M46 A;  4OMV A;  1GRX A;  3FMW A;  1PMT A;  1EGR A;  4PX1 A;  1PQN A;  1ZYP A;  2LRN A;  3DEX A;  5IQY A;  5DQY A;  3FYG A;  1AQV A;  2AB6 A;  2WRT A;  3P90 A;  4N0Z A;  1M2A A;  2R6K A;  5J9C A;  2H6Z A;  2WGR A;  1YEX A;  3O6T A;  4XS6 A;  4IS0 A;  2H66 A;  3WYW A;  3O3T A;  3IDV A;  4POM A;  3M8N A;  4F82 A;  2VL2 C;  1Y6E A;  4FYU A;  5EY6 A;  4FH8 A;  4MLY A;  1SK2 A;  2H0H A;  4PNG A;  2CA8 A;  2YJH A;  3H79 A;  2HSY A;  3RHC A;  5DAL B;  3ED3 A;  4NWY A;  2LJR A;  2K9F A;  4AGS A;  4FO5 A;  3HVS A;  4ML1 A;  4BVY A;  2IN3 A;  1I9D A;  5ABR A;  5GAP D;  4TXO A;  4PGT A;  1ILO A;  2LQQ A;  2IME A;  5EPF A;  3L78 A;  3FR9 A;  1B9X C;  1TP9 A;  3IOS A;  3I43 A;  4TRX A;  2YOI A;  2F8F A;  2PMT A;  4K1F A;  2GTU A;  1M2B A;  4X4J A;  1K0N A;  3FZA A;  1BX9 A;  3HDC A;  1DBY A;  3WT1 A;  4MAB A;  3F8U A;  3Q6O A;  3E0U A;  1SJZ A;  5IMZ A;  2CX4 A;  1OAZ A;  2C0D A;  1MDJ A;  3PIN A;  1GUH A;  1J08 A;  1O73 A;  3S9F A;  2BMX A;  3QAV A;  3UIW A;  2GSS A;  5ELG A;  4WF5 A;  4POL A;  2HZF A;  5KEJ A;  4Z7X A;  1SJI A;  4H86 A;  1Z7R A;  3CRU A;  1BQ7 A;  2C0F A;  1GP1 A;  3L9S A;  3WGD A;  4MZC A;  2FWF A;  3N5O A;  2L59 A;  5IOW A;  1PKW A;  3ZVJ D;  1OVN A;  5D9W A;  3HYP A;  1XPV A;  1FAA A;  1T4Y A;  3C1S A;  1K3L A;  3ZIT A;  3PR8 A;  4TR1 B;  3CMI A;  4V1A p;  1GNW A;  5B8A A;  4USS A;  3FK8 A;  1UVZ A;  1ZYE A;  2FD3 A;  1TK8 B;  5FT3 A;  1XOA A;  2JSY A;  1S3D A;  6GSV A;  1EZK A;  1FG4 A;  4KUN A;  5KN2 A;  3TCO A;  2YV9 A;  1GNE A;  3G9B A;  2KOK A;  1FOV A;  4BL7 A;  3CTF A;  5D9T A;  1HYU A;  2H1D A;  1GLP A;  3DKS A;  3DRN A;  4DSQ A;  6GSY A;  4TOP A;  2XBQ A;  1VF1 A;  3IR4 A;  3MDK A;  4IW9 A;  2HZE A;  4ULX A;  4WKW A;  2F8A A;  3A2V A;  3ZYW A;  2I1U A;  2TIR A;  1ERV A;  5GSS A;  3F3R A;  4XTS A;  1ZMA A;  1FB6 A;  2V1M A;  4L0U A;  2LQO A;  4K7O A;  3W8S A;  3GX8 A;  5ECS A;  2FWE A;  3QPM A;  1OC9 A;  2DBC A;  3TKP A;  4ZB9 A;  1B4P A;  2PBJ A;  4XRA A;  3PH9 A;  5IM9 A;  2V32 A;  1G6Y A;  3F9U A;  3ZFB A;  4LL4 B;  5HFK A;  3UAR A;  1G7O A;  4K7I A;  3QDN A;  4RUV A;  4BVX B;  2VCZ A;  2A2S A;  3WGX A;  2L6C A;  1K0B A;  1NHO A;  3H8Q A;  2HSH A;  3HVX A;  1GH2 A;  2X4A A;  5JWQ B;  2H74 A;  1AUC A;  4DSR A;  2QC7 A;  17GS A;  1GUL A;  1YF1 A;  3V1W A;  3F4S A;  5DJM A;  3CBU A;  3ERG A;  2YZH A;  5GZZ B;  3MNG A;  3KEB A;  6GST A;  4TR4 A;  4OO5 A;  3HJP A;  1VF4 A;  3F63 A;  3EIN A;  2L4C A;  1T00 A;  4I2T A;  1TRS A;  3KXO A;  1R5P A;  1WP0 A;  1ZCP A;  1M7T A;  3VPQ A;  2O7K A;  4IEL A;  5DJL A;  5CO3 A;  2O85 A;  5G2Z A;  2XHF A;  4RI7 A;  3GL5 A;  5HR2 A;  2H72 A;  1HNC A;  1TRU A;  4WR5 A;  1IYI A;  1XBS A;  2GQL A;  1PN0 A;  8GSS A;  1JHB A;  4KDU A;  3ME8 A;  2FWH A;  5ECN B;  2H1B A;  3IAS 2;  2VIM A;  2YCD A;  3D22 A;  1B48 A;  3ZML A;  2VL3 A;  1OC3 A;  2B1K A;  2LKU A;  1U88 A;  4LMW A;  4XS1 A;  5H5R A;  2OE3 A;  3ZVJ A;  1LU4 A;  2DJ0 A;  5LNK e;  1TTZ A;  3CSI A;  5ECH B;  1DE2 A;  2I81 A;  3UMA A;  3Q18 A;  1AIU A;  3ZIV A;  1QQ2 A;  3CSJ A;  1TK5 B;  4TR0 A;  2GT5 A;  5KN1 A;  4XS4 A;  5D96 A;  4EF0 A;  6GSW A;  5GAN D;  4IN0 A;  1K3O A;  3A3T A;  3J7Y b;  1YY7 A;  3A5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...