1H5SB

Thymidylyltransferase complexed with tmp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
291
structure length
291
Chain Sequence
MKMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVALMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKQTKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-1-phosphate thymidylyltransferase 1
publication title Kinetic and crystallographic analyses support a sequential-ordered bi bi catalytic mechanism for Escherichia coli glucose-1-phosphate thymidylyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 92
structure length 291
sequence length 291
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2001-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1h5sB00
2VS5A 1VZXA 1GA8A 4IRQA 2FY7A 3K8EA 2YQHA 4CJCA 1FR8A 2PGYA 2RJ1A 5C3DA 4G3PA 5FYEA 3FOQA 4FRPA 4DE7A 1Z90A 5C4FA 2DPWA 1VH1A 1VGWA 4D0TA 3Q7UA 5C3AA 2D7IA 1ZCUA 3I0CA 2FYBA 2GGQA 2GGOA 1H7GA 1FO9A 3OH4A 2A8UA 1YP4A 1VGZA 2X65A 3PNNA 1GQ9A 1S4NA 2MZBA 4HO3A 4Y64A 1NWGB 1G93A 2I7BA 1WT3A 1H7FA 4NALA 5CQPA 4ARWA 2Y4KA 1HM9A 1G9RA 1EYRA 5AJPA 5FUHA 1ZJPA 4G3SA 1GQCA 1H5SB 4EE5A 5C4CA 3I0EA 3OH2A 5CMHA 1S4OA 1ZDGA 4HOCA 5J49A 1O23B 4EEAA 3SX3A 3I0LA 3K8DA 4Y63A 1ZJ0A 1LL2A 2AESA 3OH3A 4EEMA 4Y62A 5C49A 3O3PA 5FV9A 2RIYA 3PKQA 4HO0A 1H3MA 2XWMA 3CGXA 1ZCYA 2FYDB 4HCQA 4FRMA 1V84A 1ZI3A 3I0IX 1H7LA 1H5RB 3ZLKA 4LW3A 1R7VA 3SXEA 4FROA 1I52A 4DDZA 4ASJA 3IOJA 3LW6A 4AYJA 5CMJA 2ZU9A 2VSHA 3SX8A 1GX0A 3USRA 3I0DA 4M2BA 1H7EA 1FZWA 4EE3A 3CKQA 1LZ7A 1FGXA 1H7HA 3I0HA 3DJ4A 2RJ8A 3DUVA 2D7RA 5CQLX 3T7OA 2RJ4A 2VD4A 1MP5A 2AM5A 2APCA 1IINA 1G2VA 1ZDFA 3V8ZA 4B4GA 5C48A 1INIA 1NF5B 3R3IA 3CKJA 4CJ8A 4HG6A 4P02A 1GWVA 1S4PA 4XWIA 5IDSA 5C1GA 2W0WA 5FTSA 3Q80A 1R7TA 4HO5A 5C4EA 1JVDA 2BO4A 4Y6UA 1FRWA 2X5ZA 1ZI4A 2WGZA 3OAMA 5C8RA 1G1LA 1K4VA 4C2SA 3I0KA 2Y6PA 2A8WA 3ZGFA 1ON6A 1XZ6A 2AGDA 1G3LA 2Y7AA 2YQCA 1VPAA 4P00A 3GUEA 5DDVA 1LL3A 2WEEA 2QGIA 5CQMX 2ICYA 2V0JA 4EEGA 2UX8A 4Y7FA 5CMFX 1QGSA 2FFUA 4KNRA 2QH5A 2Y4JA 3CKOA 2I5EA 1ZI5A 2JCOA 4E1KA 1R7YA 1VM8A 1FWYA 2E8BA 1YP2A 3DK5A 3POLA 2V0KA 5C4DA 5C1LA 5IDTA 1ZI1A 2O1HA 1NQIB 2QKXA 4NANA 1R7UA 2PGVA 3ZF8A 4FRQA 3V0PA 3BCVA 1FXOA 1H4EA 1VZTA 1OMXA 4B3UA 1ZIZA 5EJZA 3ST8A 4NAIA 5JQQA 3IOIA 4KXOA 2FFVA 3D98A 1WVCA 1ZCVA 2RIZA 3I0GA 3KIAA 2VS3A 2XMHA 4FCEA 4KC1A 2VXLA 5L6SA 1G97A 2PA4A 5C4BA 1LZ0A 1W55A 1HM0A 1ZJ1A 1LZIA 2NXVA 4B5BA 2VFZA 1WT2A 5AJOA 3QVBA 2ZU8A 3V90A 4EE4A 3ZLLA 2JCLA 2O1GA 4CJBA 5C3BA 2YESA 4Y9XA 3EE5A 4FRLA 4KRVA 1ON8A 1QWJA 1H5SA 1SS9A 1LZJA 1W57A 2P72A 2XWNA 1FG5N 1V83A 4HO2A 1FR9A 5C36A 1H5TB 3TQDA 2OI7A 3F1CA 1FGGA 4Y7TA 5DDTA 3RMVA 4BMAA 3T7NA 3SXGA 2X5SA 4Y7UA 3SXDA 2XMEA 2V0HA 2VXMA 1H4CA 1WSZA 3HL3A 4G87A 4FRDA 3N9WA 3V0QA 5EJ1A 2YQJA 1FO8A 2O1FA 4KT7A 2E3DA 3OH0A 3JUKA 3T7MA 5HS2A 1MP4A 4JD0A 4KC4A 1XHBA 2AM3A 3CKNA 3PKPA 4HO8A 2ICXA 2P6WA 5C1HA 4KC2A 2RJ5A 1WT1A 3U2XA 2V0IA 4D11A 2RJ9A 2YCMA 3U2TA 1FOAA 5FTVA 1INJA 1VGUA 1ZJOA 3U0YA 4FRHA 4B4MA 1MC3A 4FQWA 3OKRA 1GX4A 3F1YA 2RITA 4UEGA 4FRBA 4FCUA 2OEGA 3FWWA 4L41C 2Q4JA 4K6RA 3V91A 1G8OA 3V0OA 2OI6A 2OI5A 4ZDQA 3I0JA 2FYCB 3E26A 1QGQA 4HO9A 4KPZA 1TZFA 1O7OA 3U2UA 1G95A 2JCJA 3OC9A 4GBPA 4CVHA 4J18A 2WVMA 3SX5A 3I0FA 4BQHA 2I5KA 2V0LA 1OMZA 1VH3A 1R80A 1E5KA 1ZCTA 1EZIA 1VZUA 3NGWA 1O7QA 1H5SD 3OH1A 5CMIA 1FXJA 2WVLA 2WVKA 2AM4A 3V0NA 4Y7VA 4AAWA 2AE7A 3R2WA 4AC3A 1ZJ3A 3OGZA 3SPTA 1TW1A 1NHEB 5FU0A 5I1FA 1G23A 1O0RA 5FU8A 5L6VA 4B42A 1LVWA 1JV3A 1VICA 4Y6NA 4HO4A 2Y4LA 3SXAA 1HJLA 1TVYA 3E25A 4R7PA 2Y4MA 3D8VA 2ZU7A 5AJNA 1KWSA 3USQA 5EIYA 4HO6A 1VGTA 4EEOA 4KPXA 3JTJA 5CQOA 2X60A 3V0LA 1IIMA 3CU0A 1ZJ2A 4NAKA 4M4KA 1JV1A 3RSBA 3U0XA 4Y7GA 4D0ZA 2BO6A 2XWLA 3BRKX 1PZYB 3SX7A 2Z87A 1H5SC 3ZGGA 2PX7A 1YP3A 4LW6A 1JYKA 2AH9A 4EVWA 4AYLA 1V82A 2P73A 1HV9A 2AECA 2VSIA 4MYBA 4ECMA 4M2AA 3U2WA 3V0MA 2Z86A 2RIXA 1HM8A 4IRPA 4B4BA 1H5RA 1JVGA 1H7QA 2RJ7A 4YS8A 3Q4SA 1JYLA 1GWWA 1TW5A 2W0VA 2RJ0A 1PZTA 2D0JA 5C38A 1ZHJA 4B2WA 3RMWA 4B2XA 2FYAA 2WAWA 3TZTA 1NMMB 2WE9A 4M28A 3SXCA 1OQMB 1MP3A 4G3QA 1H5TA 4D48A 4FREA 1H7TA 1YROB 1G0RA 1NKHB 3V8YA 5C47A 3JUJA 1H4DA 1R7XA 5CQNX 1LL0A 2JCKA 4FRAA 5CMGX 4JISA 1R81A 4DECA 2YC5A 2YQSA 3CKVA 3SXBA 1R82A 3IOHA 2VS4A 3D5NA 1QG8A 2BO7A 1W77A 4KNXA 4MNDA 2BO8A 5BXCA 5IFYA 1WT0A 2RJ6A 3U2VA 1HJJA 4KQLA 2CU2A 2OEFA 4D11C 2YC3A 4ASYA
chains in the Genus database with same CATH superfamily
2VS5A 1VZXA 1GA8A 4IRQA 2FY7A 3K8EA 2YQHA 4CJCA 1FR8A 2PGYA 2RJ1A 5C3DA 4G3PA 5FYEA 3FOQA 4FRPA 4DE7A 1Z90A 5C4FA 2DPWA 1VH1A 1VGWA 4D0TA 3Q7UA 5D92A 5C3AA 2D7IA 1ZCUA 3I0CA 2FYBA 2GGQA 2GGOA 1H7GA 1FO9A 3OH4A 2A8UA 1YP4A 1VGZA 2X65A 3PNNA 1GQ9A 1S4NA 2MZBA 4HO3A 4Y64A 1NWGB 1G93A 2I7BA 1WT3A 1H7FA 4NALA 5CQPA 4ARWA 2Y4KA 1HM9A 1G9RA 1EYRA 5AJPA 5FUHA 1ZJPA 4G3SA 1GQCA 1H5SB 4EE5A 5C4CA 3I0EA 3OH2A 5CMHA 1S4OA 1ZDGA 4HOCA 5J49A 1O23B 4EEAA 3SX3A 3I0LA 3K8DA 4Y63A 1ZJ0A 1LL2A 2AESA 3OH3A 4EEMA 4Y62A 5C49A 3O3PA 5FV9A 2RIYA 3PKQA 4HO0A 1H3MA 2J0BA 2XWMA 3CGXA 1ZCYA 2FYDB 4HCQA 4FRMA 1V84A 1ZI3A 3I0IX 1H7LA 1H5RB 3ZLKA 4LW3A 1R7VA 3SXEA 4FROA 1I52A 4DDZA 4ASJA 3IOJA 3LW6A 4AYJA 5CMJA 2ZU9A 2VSHA 3SX8A 1GX0A 3USRA 3I0DA 4M2BA 1H7EA 1FZWA 4EE3A 3CKQA 1LZ7A 1FGXA 1H7HA 3I0HA 3DJ4A 2RJ8A 3DUVA 2D7RA 5CQLX 3T7OA 2RJ4A 2VD4A 1MP5A 2AM5A 2APCA 1IINA 1G2VA 1ZDFA 3V8ZA 4B4GA 5C48A 1INIA 1NF5B 3R3IA 3CKJA 4CJ8A 4HG6A 4P02A 1GWVA 1S4PA 4XWIA 5IDSA 5C1GA 2W0WA 5FTSA 3Q80A 1R7TA 4HO5A 5C4EA 1JVDA 2BO4A 4Y6UA 1FRWA 2X5ZA 1ZI4A 2WGZA 3OAMA 5C8RA 1G1LA 1K4VA 4C2SA 3I0KA 2Y6PA 2A8WA 3ZGFA 1ON6A 1XZ6A 2AGDA 1G3LA 2Y7AA 2YQCA 1VPAA 4P00A 3GUEA 5DDVA 1LL3A 2WEEA 2QGIA 5CQMX 2ICYA 2V0JA 4EEGA 2UX8A 4Y7FA 5CMFX 1QGSA 2FFUA 4KNRA 2QH5A 2Y4JA 3CKOA 2I5EA 1ZI5A 2JCOA 4E1KA 1R7YA 1VM8A 1FWYA 2E8BA 1YP2A 3DK5A 3POLA 2V0KA 5C4DA 5C1LA 5IDTA 1ZI1A 2O1HA 1NQIB 2QKXA 4NANA 1R7UA 2PGVA 3ZF8A 4FRQA 3V0PA 3BCVA 2J0AA 1FXOA 1H4EA 1VZTA 1OMXA 4B3UA 1ZIZA 5EJZA 3ST8A 4NAIA 5JQQA 3IOIA 4KXOA 2FFVA 3D98A 1WVCA 1ZCVA 2RIZA 3I0GA 3KIAA 2VS3A 2XMHA 4FCEA 5D91A 4KC1A 2VXLA 5L6SA 1G97A 2PA4A 5C4BA 1LZ0A 1W55A 1HM0A 1ZJ1A 1LZIA 2NXVA 4B5BA 2VFZA 1WT2A 5AJOA 3QVBA 2ZU8A 3V90A 4EE4A 3ZLLA 2JCLA 2O1GA 4CJBA 5C3BA 2YESA 4Y9XA 3EE5A 4FRLA 4KRVA 1ON8A 1QWJA 1H5SA 1SS9A 1LZJA 1W57A 2P72A 2XWNA 1FG5N 1V83A 4HO2A 1FR9A 5C36A 1H5TB 3TQDA 2OI7A 3F1CA 1FGGA 4Y7TA 5DDTA 3RMVA 4BMAA 3T7NA 3SXGA 2X5SA 4Y7UA 3SXDA 2XMEA 2V0HA 2VXMA 1H4CA 1WSZA 3HL3A 4G87A 4FRDA 3N9WA 3V0QA 5EJ1A 2YQJA 1FO8A 2O1FA 4KT7A 2E3DA 3OH0A 3JUKA 3T7MA 5HS2A 1MP4A 4JD0A 4KC4A 1XHBA 2AM3A 3CKNA 3PKPA 4HO8A 2ICXA 2P6WA 5C1HA 4KC2A 2RJ5A 1WT1A 3U2XA 2V0IA 4D11A 2RJ9A 2YCMA 4Q7CA 3U2TA 1FOAA 5FTVA 1INJA 1VGUA 1ZJOA 3U0YA 4FRHA 4B4MA 1MC3A 4FQWA 3OKRA 1GX4A 3F1YA 2RITA 4UEGA 4FRBA 4FCUA 2OEGA 3FWWA 4L41C 2Q4JA 4K6RA 3V91A 1G8OA 3V0OA 2OI6A 2OI5A 2C0NA 4ZDQA 3I0JA 2FYCB 3E26A 1QGQA 4HO9A 4KPZA 1TZFA 1O7OA 3U2UA 1G95A 2JCJA 3OC9A 4GBPA 4CVHA 4J18A 2WVMA 3SX5A 3I0FA 4BQHA 2I5KA 2V0LA 1OMZA 1VH3A 1R80A 1E5KA 2VK9A 1ZCTA 1EZIA 1VZUA 3NGWA 4FIXA 1O7QA 1H5SD 3OH1A 5CMIA 1FXJA 2WVLA 2WVKA 2AM4A 3V0NA 4Y7VA 4AAWA 2AE7A 3R2WA 4AC3A 1ZJ3A 4O6MA 3OGZA 3SPTA 1TW1A 1NHEB 5FU0A 5I1FA 1G23A 1O0RA 5FU8A 5L6VA 4B42A 1LVWA 1JV3A 1VICA 4Y6NA 4HO4A 2Y4LA 3SXAA 1HJLA 1TVYA 3E25A 4R7PA 2Y4MA 3D8VA 2ZU7A 5AJNA 1KWSA 3USQA 5EIYA 4HO6A 1VGTA 4EEOA 4KPXA 3JTJA 5CQOA 2X60A 3V0LA 1IIMA 3CU0A 1ZJ2A 4NAKA 4M4KA 1JV1A 3RSBA 3U0XA 4Y7GA 4D0ZA 2BO6A 2XWLA 3BRKX 1PZYB 3SX7A 2Z87A 1H5SC 3ZGGA 2PX7A 1YP3A 4LW6A 1JYKA 2AH9A 4EVWA 4AYLA 1V82A 2P73A 1HV9A 2AECA 2VSIA 4MYBA 4ECMA 4M2AA 4O6NA 3U2WA 3V0MA 2Z86A 2RIXA 1HM8A 4FIYA 4MIXA 4IRPA 4B4BA 1H5RA 1JVGA 1H7QA 2RJ7A 4YS8A 3Q4SA 1JYLA 1GWWA 1TW5A 2W0VA 2RJ0A 1PZTA 2D0JA 5C38A 1ZHJA 4B2WA 3RMWA 4B2XA 2FYAA 2WAWA 3TZTA 1NMMB 2WE9A 4M28A 3SXCA 1OQMB 1MP3A 4G3QA 1H5TA 4D48A 4FREA 1H7TA 1YROB 1G0RA 1NKHB 3V8YA 5C47A 3JUJA 1H4DA 1R7XA 5CQNX 1LL0A 2JCKA 4FRAA 5CMGX 4JISA 1R81A 4DECA 2YC5A 2YQSA 3CKVA 3SXBA 1R82A 3IOHA 2VS4A 3D5NA 1QG8A 2BO7A 1W77A 4KNXA 4MNDA 2BO8A 5BXCA 5IFYA 1WT0A 2RJ6A 3U2VA 1HJJA 4KQLA 2CU2A 2OEFA 4D11C 2YC3A 4ASYA
chains in the Genus database with same CATH topology
2VS5A 1VZXA 1GA8A 4IRQA 2FY7A 3K8EA 2YQHA 4CJCA 1FR8A 2PGYA 2RJ1A 5C3DA 4G3PA 5FYEA 3FOQA 4FRPA 4DE7A 1Z90A 5C4FA 2DPWA 1VH1A 1VGWA 4D0TA 3Q7UA 5D92A 5C3AA 2D7IA 1ZCUA 3I0CA 2FYBA 2GGQA 2GGOA 1H7GA 1FO9A 3OH4A 2A8UA 1YP4A 1VGZA 2X65A 3PNNA 1GQ9A 1S4NA 2MZBA 4HO3A 4Y64A 1NWGB 1G93A 2I7BA 1WT3A 1H7FA 4NALA 5CQPA 4ARWA 2Y4KA 1HM9A 1G9RA 1EYRA 5AJPA 5FUHA 1ZJPA 4G3SA 1GQCA 1H5SB 4EE5A 5C4CA 3I0EA 3OH2A 5CMHA 1S4OA 1ZDGA 4HOCA 5J49A 1O23B 4EEAA 3SX3A 3I0LA 3K8DA 4Y63A 1ZJ0A 1LL2A 2AESA 3OH3A 4EEMA 4Y62A 5C49A 3O3PA 5FV9A 2RIYA 3PKQA 4HO0A 1H3MA 2J0BA 2XWMA 3CGXA 1ZCYA 2FYDB 4HCQA 4FRMA 1V84A 1ZI3A 3I0IX 1H7LA 1H5RB 3ZLKA 4LW3A 1R7VA 3SXEA 4FROA 1I52A 4DDZA 4ASJA 3IOJA 3LW6A 4AYJA 5CMJA 2ZU9A 2VSHA 3SX8A 1GX0A 3USRA 3I0DA 4M2BA 1H7EA 1FZWA 4EE3A 3CKQA 1LZ7A 1FGXA 1H7HA 3I0HA 3DJ4A 2RJ8A 3DUVA 2D7RA 5CQLX 3T7OA 2RJ4A 2VD4A 1MP5A 2AM5A 2APCA 1IINA 1G2VA 1ZDFA 3V8ZA 4B4GA 5C48A 1INIA 1NF5B 3R3IA 3CKJA 4CJ8A 4HG6A 4P02A 1GWVA 1S4PA 4XWIA 5IDSA 5C1GA 2W0WA 5FTSA 3Q80A 1R7TA 4HO5A 5C4EA 1JVDA 2BO4A 4Y6UA 1FRWA 2X5ZA 1ZI4A 2WGZA 3OAMA 5C8RA 1G1LA 1K4VA 4C2SA 3I0KA 2Y6PA 2A8WA 3ZGFA 1ON6A 1XZ6A 2AGDA 1G3LA 2Y7AA 2YQCA 1VPAA 4P00A 3GUEA 5DDVA 1LL3A 2WEEA 2QGIA 5CQMX 2ICYA 2V0JA 4EEGA 2UX8A 4Y7FA 5CMFX 1QGSA 2FFUA 4KNRA 2QH5A 2Y4JA 3CKOA 2I5EA 1ZI5A 2JCOA 4E1KA 1R7YA 1VM8A 1FWYA 2E8BA 1YP2A 3DK5A 3POLA 2V0KA 5C4DA 5C1LA 5IDTA 1ZI1A 2O1HA 1NQIB 2QKXA 4NANA 1R7UA 2PGVA 3ZF8A 4FRQA 3V0PA 3BCVA 2J0AA 1FXOA 1H4EA 1VZTA 1OMXA 4B3UA 1ZIZA 5EJZA 3ST8A 4NAIA 5JQQA 3IOIA 4KXOA 2FFVA 3D98A 1WVCA 1ZCVA 2RIZA 3I0GA 3KIAA 2VS3A 2XMHA 4FCEA 5D91A 4KC1A 2VXLA 5L6SA 1G97A 2PA4A 5C4BA 1LZ0A 1W55A 1HM0A 1ZJ1A 1LZIA 2NXVA 4B5BA 2VFZA 1WT2A 5AJOA 3QVBA 2ZU8A 3V90A 4EE4A 3ZLLA 2JCLA 2O1GA 4CJBA 5C3BA 2YESA 4Y9XA 3EE5A 4FRLA 4KRVA 1ON8A 1QWJA 1H5SA 1SS9A 1LZJA 1W57A 2P72A 2XWNA 1FG5N 1V83A 4HO2A 1FR9A 5C36A 1H5TB 3TQDA 2OI7A 3F1CA 1FGGA 4Y7TA 5DDTA 3RMVA 4BMAA 3T7NA 3SXGA 2X5SA 4Y7UA 3SXDA 2XMEA 2V0HA 2VXMA 1H4CA 1WSZA 3HL3A 4G87A 4FRDA 3N9WA 3V0QA 5EJ1A 2YQJA 1FO8A 2O1FA 4KT7A 2E3DA 3OH0A 3JUKA 3T7MA 5HS2A 1MP4A 4JD0A 4KC4A 1XHBA 2AM3A 3CKNA 3PKPA 4HO8A 2ICXA 2P6WA 5C1HA 4KC2A 2RJ5A 1WT1A 3U2XA 2V0IA 4D11A 2RJ9A 2YCMA 4Q7CA 3U2TA 1FOAA 5FTVA 1INJA 1VGUA 1ZJOA 3U0YA 4FRHA 4B4MA 1MC3A 4FQWA 3OKRA 1GX4A 3F1YA 2RITA 4UEGA 4FRBA 4FCUA 2OEGA 3FWWA 4L41C 2Q4JA 4K6RA 3V91A 1G8OA 3V0OA 2OI6A 2OI5A 2C0NA 4ZDQA 3I0JA 2FYCB 3E26A 1QGQA 4HO9A 4KPZA 1TZFA 1O7OA 3U2UA 1G95A 2JCJA 3OC9A 4GBPA 4CVHA 4J18A 2WVMA 3SX5A 3I0FA 4BQHA 2I5KA 2V0LA 1OMZA 1VH3A 1R80A 1E5KA 2VK9A 1ZCTA 1EZIA 1VZUA 3NGWA 4FIXA 1O7QA 1H5SD 3OH1A 5CMIA 1FXJA 2WVLA 2WVKA 2AM4A 3V0NA 4Y7VA 4AAWA 2AE7A 3R2WA 4AC3A 1ZJ3A 4O6MA 3OGZA 3SPTA 1TW1A 1NHEB 5FU0A 5I1FA 1G23A 1O0RA 5FU8A 5L6VA 4B42A 1LVWA 1JV3A 1VICA 4Y6NA 4HO4A 2Y4LA 3SXAA 1HJLA 1TVYA 3E25A 4R7PA 2Y4MA 3D8VA 2ZU7A 5AJNA 1KWSA 3USQA 5EIYA 4HO6A 1VGTA 4EEOA 4KPXA 3JTJA 5CQOA 2X60A 3V0LA 1IIMA 3CU0A 1ZJ2A 4NAKA 4M4KA 1JV1A 3RSBA 3U0XA 4Y7GA 4D0ZA 2BO6A 2XWLA 3BRKX 1PZYB 3SX7A 2Z87A 1H5SC 3ZGGA 2PX7A 1YP3A 4LW6A 1JYKA 2AH9A 4EVWA 4AYLA 1V82A 2P73A 1HV9A 2AECA 2VSIA 4MYBA 4ECMA 4M2AA 4O6NA 3U2WA 3V0MA 2Z86A 2RIXA 1HM8A 4FIYA 4MIXA 4IRPA 4B4BA 1H5RA 1JVGA 1H7QA 2RJ7A 4YS8A 3Q4SA 1JYLA 1GWWA 1TW5A 2W0VA 2RJ0A 1PZTA 2D0JA 5C38A 1ZHJA 4B2WA 3RMWA 4B2XA 2FYAA 2WAWA 3TZTA 1NMMB 2WE9A 4M28A 3SXCA 1OQMB 1MP3A 4G3QA 1H5TA 4D48A 4FREA 1H7TA 1YROB 1G0RA 1NKHB 3V8YA 5C47A 3JUJA 1H4DA 1R7XA 5CQNX 1LL0A 2JCKA 4FRAA 5CMGX 4JISA 1R81A 4DECA 2YC5A 2YQSA 3CKVA 3SXBA 1R82A 3IOHA 2VS4A 3D5NA 1QG8A 2BO7A 1W77A 4KNXA 4MNDA 2BO8A 5BXCA 5IFYA 1WT0A 2RJ6A 3U2VA 1HJJA 4KQLA 2CU2A 2OEFA 4D11C 2YC3A 4ASYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VS5 A;  1VZX A;  1GA8 A;  4IRQ A;  2FY7 A;  3K8E A;  2YQH A;  4CJC A;  1FR8 A;  2PGY A;  2RJ1 A;  5C3D A;  4G3P A;  5FYE A;  3FOQ A;  4FRP A;  4DE7 A;  1Z90 A;  5C4F A;  2DPW A;  1VH1 A;  1VGW A;  4D0T A;  3Q7U A;  5C3A A;  2D7I A;  1ZCU A;  3I0C A;  2FYB A;  2GGQ A;  2GGO A;  1H7G A;  1FO9 A;  3OH4 A;  2A8U A;  1YP4 A;  1VGZ A;  2X65 A;  3PNN A;  1GQ9 A;  1S4N A;  2MZB A;  4HO3 A;  4Y64 A;  1NWG B;  1G93 A;  2I7B A;  1WT3 A;  1H7F A;  4NAL A;  5CQP A;  4ARW A;  2Y4K A;  1HM9 A;  1G9R A;  1EYR A;  5AJP A;  5FUH A;  1ZJP A;  4G3S A;  1GQC A;  1H5S B;  4EE5 A;  5C4C A;  3I0E A;  3OH2 A;  5CMH A;  1S4O A;  1ZDG A;  4HOC A;  5J49 A;  1O23 B;  4EEA A;  3SX3 A;  3I0L A;  3K8D A;  4Y63 A;  1ZJ0 A;  1LL2 A;  2AES A;  3OH3 A;  4EEM A;  4Y62 A;  5C49 A;  3O3P A;  5FV9 A;  2RIY A;  3PKQ A;  4HO0 A;  1H3M A;  2XWM A;  3CGX A;  1ZCY A;  2FYD B;  4HCQ A;  4FRM A;  1V84 A;  1ZI3 A;  3I0I X;  1H7L A;  1H5R B;  3ZLK A;  4LW3 A;  1R7V A;  3SXE A;  4FRO A;  1I52 A;  4DDZ A;  4ASJ A;  3IOJ A;  3LW6 A;  4AYJ A;  5CMJ A;  2ZU9 A;  2VSH A;  3SX8 A;  1GX0 A;  3USR A;  3I0D A;  4M2B A;  1H7E A;  1FZW A;  4EE3 A;  3CKQ A;  1LZ7 A;  1FGX A;  1H7H A;  3I0H A;  3DJ4 A;  2RJ8 A;  3DUV A;  2D7R A;  5CQL X;  3T7O A;  2RJ4 A;  2VD4 A;  1MP5 A;  2AM5 A;  2APC A;  1IIN A;  1G2V A;  1ZDF A;  3V8Z A;  4B4G A;  5C48 A;  1INI A;  1NF5 B;  3R3I A;  3CKJ A;  4CJ8 A;  4HG6 A;  4P02 A;  1GWV A;  1S4P A;  4XWI A;  5IDS A;  5C1G A;  2W0W A;  5FTS A;  3Q80 A;  1R7T A;  4HO5 A;  5C4E A;  1JVD A;  2BO4 A;  4Y6U A;  1FRW A;  2X5Z A;  1ZI4 A;  2WGZ A;  3OAM A;  5C8R A;  1G1L A;  1K4V A;  4C2S A;  3I0K A;  2Y6P A;  2A8W A;  3ZGF A;  1ON6 A;  1XZ6 A;  2AGD A;  1G3L A;  2Y7A A;  2YQC A;  1VPA A;  4P00 A;  3GUE A;  5DDV A;  1LL3 A;  2WEE A;  2QGI A;  5CQM X;  2ICY A;  2V0J A;  4EEG A;  2UX8 A;  4Y7F A;  5CMF X;  1QGS A;  2FFU A;  4KNR A;  2QH5 A;  2Y4J A;  3CKO A;  2I5E A;  1ZI5 A;  2JCO A;  4E1K A;  1R7Y A;  1VM8 A;  1FWY A;  2E8B A;  1YP2 A;  3DK5 A;  3POL A;  2V0K A;  5C4D A;  5C1L A;  5IDT A;  1ZI1 A;  2O1H A;  1NQI B;  2QKX A;  4NAN A;  1R7U A;  2PGV A;  3ZF8 A;  4FRQ A;  3V0P A;  3BCV A;  1FXO A;  1H4E A;  1VZT A;  1OMX A;  4B3U A;  1ZIZ A;  5EJZ A;  3ST8 A;  4NAI A;  5JQQ A;  3IOI A;  4KXO A;  2FFV A;  3D98 A;  1WVC A;  1ZCV A;  2RIZ A;  3I0G A;  3KIA A;  2VS3 A;  2XMH A;  4FCE A;  4KC1 A;  2VXL A;  5L6S A;  1G97 A;  2PA4 A;  5C4B A;  1LZ0 A;  1W55 A;  1HM0 A;  1ZJ1 A;  1LZI A;  2NXV A;  4B5B A;  2VFZ A;  1WT2 A;  5AJO A;  3QVB A;  2ZU8 A;  3V90 A;  4EE4 A;  3ZLL A;  2JCL A;  2O1G A;  4CJB A;  5C3B A;  2YES A;  4Y9X A;  3EE5 A;  4FRL A;  4KRV A;  1ON8 A;  1QWJ A;  1H5S A;  1SS9 A;  1LZJ A;  1W57 A;  2P72 A;  2XWN A;  1FG5 N;  1V83 A;  4HO2 A;  1FR9 A;  5C36 A;  1H5T B;  3TQD A;  2OI7 A;  3F1C A;  1FGG A;  4Y7T A;  5DDT A;  3RMV A;  4BMA A;  3T7N A;  3SXG A;  2X5S A;  4Y7U A;  3SXD A;  2XME A;  2V0H A;  2VXM A;  1H4C A;  1WSZ A;  3HL3 A;  4G87 A;  4FRD A;  3N9W A;  3V0Q A;  5EJ1 A;  2YQJ A;  1FO8 A;  2O1F A;  4KT7 A;  2E3D A;  3OH0 A;  3JUK A;  3T7M A;  5HS2 A;  1MP4 A;  4JD0 A;  4KC4 A;  1XHB A;  2AM3 A;  3CKN A;  3PKP A;  4HO8 A;  2ICX A;  2P6W A;  5C1H A;  4KC2 A;  2RJ5 A;  1WT1 A;  3U2X A;  2V0I A;  4D11 A;  2RJ9 A;  2YCM A;  3U2T A;  1FOA A;  5FTV A;  1INJ A;  1VGU A;  1ZJO A;  3U0Y A;  4FRH A;  4B4M A;  1MC3 A;  4FQW A;  3OKR A;  1GX4 A;  3F1Y A;  2RIT A;  4UEG A;  4FRB A;  4FCU A;  2OEG A;  3FWW A;  4L41 C;  2Q4J A;  4K6R A;  3V91 A;  1G8O A;  3V0O A;  2OI6 A;  2OI5 A;  4ZDQ A;  3I0J A;  2FYC B;  3E26 A;  1QGQ A;  4HO9 A;  4KPZ A;  1TZF A;  1O7O A;  3U2U A;  1G95 A;  2JCJ A;  3OC9 A;  4GBP A;  4CVH A;  4J18 A;  2WVM A;  3SX5 A;  3I0F A;  4BQH A;  2I5K A;  2V0L A;  1OMZ A;  1VH3 A;  1R80 A;  1E5K A;  1ZCT A;  1EZI A;  1VZU A;  3NGW A;  1O7Q A;  1H5S D;  3OH1 A;  5CMI A;  1FXJ A;  2WVL A;  2WVK A;  2AM4 A;  3V0N A;  4Y7V A;  4AAW A;  2AE7 A;  3R2W A;  4AC3 A;  1ZJ3 A;  3OGZ A;  3SPT A;  1TW1 A;  1NHE B;  5FU0 A;  5I1F A;  1G23 A;  1O0R A;  5FU8 A;  5L6V A;  4B42 A;  1LVW A;  1JV3 A;  1VIC A;  4Y6N A;  4HO4 A;  2Y4L A;  3SXA A;  1HJL A;  1TVY A;  3E25 A;  4R7P A;  2Y4M A;  3D8V A;  2ZU7 A;  5AJN A;  1KWS A;  3USQ A;  5EIY A;  4HO6 A;  1VGT A;  4EEO A;  4KPX A;  3JTJ A;  5CQO A;  2X60 A;  3V0L A;  1IIM A;  3CU0 A;  1ZJ2 A;  4NAK A;  4M4K A;  1JV1 A;  3RSB A;  3U0X A;  4Y7G A;  4D0Z A;  2BO6 A;  2XWL A;  3BRK X;  1PZY B;  3SX7 A;  2Z87 A;  1H5S C;  3ZGG A;  2PX7 A;  1YP3 A;  4LW6 A;  1JYK A;  2AH9 A;  4EVW A;  4AYL A;  1V82 A;  2P73 A;  1HV9 A;  2AEC A;  2VSI A;  4MYB A;  4ECM A;  4M2A A;  3U2W A;  3V0M A;  2Z86 A;  2RIX A;  1HM8 A;  4IRP A;  4B4B A;  1H5R A;  1JVG A;  1H7Q A;  2RJ7 A;  4YS8 A;  3Q4S A;  1JYL A;  1GWW A;  1TW5 A;  2W0V A;  2RJ0 A;  1PZT A;  2D0J A;  5C38 A;  1ZHJ A;  4B2W A;  3RMW A;  4B2X A;  2FYA A;  2WAW A;  3TZT A;  1NMM B;  2WE9 A;  4M28 A;  3SXC A;  1OQM B;  1MP3 A;  4G3Q A;  1H5T A;  4D48 A;  4FRE A;  1H7T A;  1YRO B;  1G0R A;  1NKH B;  3V8Y A;  5C47 A;  3JUJ A;  1H4D A;  1R7X A;  5CQN X;  1LL0 A;  2JCK A;  4FRA A;  5CMG X;  4JIS A;  1R81 A;  4DEC A;  2YC5 A;  2YQS A;  3CKV A;  3SXB A;  1R82 A;  3IOH A;  2VS4 A;  3D5N A;  1QG8 A;  2BO7 A;  1W77 A;  4KNX A;  4MND A;  2BO8 A;  5BXC A;  5IFY A;  1WT0 A;  2RJ6 A;  3U2V A;  1HJJ A;  4KQL A;  2CU2 A;  2OEF A;  4D11 C;  2YC3 A;  4ASY A; 
#chains in the Genus database with same CATH topology
 2VS5 A;  1VZX A;  1GA8 A;  4IRQ A;  2FY7 A;  3K8E A;  2YQH A;  4CJC A;  1FR8 A;  2PGY A;  2RJ1 A;  5C3D A;  4G3P A;  5FYE A;  3FOQ A;  4FRP A;  4DE7 A;  1Z90 A;  5C4F A;  2DPW A;  1VH1 A;  1VGW A;  4D0T A;  3Q7U A;  5D92 A;  5C3A A;  2D7I A;  1ZCU A;  3I0C A;  2FYB A;  2GGQ A;  2GGO A;  1H7G A;  1FO9 A;  3OH4 A;  2A8U A;  1YP4 A;  1VGZ A;  2X65 A;  3PNN A;  1GQ9 A;  1S4N A;  2MZB A;  4HO3 A;  4Y64 A;  1NWG B;  1G93 A;  2I7B A;  1WT3 A;  1H7F A;  4NAL A;  5CQP A;  4ARW A;  2Y4K A;  1HM9 A;  1G9R A;  1EYR A;  5AJP A;  5FUH A;  1ZJP A;  4G3S A;  1GQC A;  1H5S B;  4EE5 A;  5C4C A;  3I0E A;  3OH2 A;  5CMH A;  1S4O A;  1ZDG A;  4HOC A;  5J49 A;  1O23 B;  4EEA A;  3SX3 A;  3I0L A;  3K8D A;  4Y63 A;  1ZJ0 A;  1LL2 A;  2AES A;  3OH3 A;  4EEM A;  4Y62 A;  5C49 A;  3O3P A;  5FV9 A;  2RIY A;  3PKQ A;  4HO0 A;  1H3M A;  2J0B A;  2XWM A;  3CGX A;  1ZCY A;  2FYD B;  4HCQ A;  4FRM A;  1V84 A;  1ZI3 A;  3I0I X;  1H7L A;  1H5R B;  3ZLK A;  4LW3 A;  1R7V A;  3SXE A;  4FRO A;  1I52 A;  4DDZ A;  4ASJ A;  3IOJ A;  3LW6 A;  4AYJ A;  5CMJ A;  2ZU9 A;  2VSH A;  3SX8 A;  1GX0 A;  3USR A;  3I0D A;  4M2B A;  1H7E A;  1FZW A;  4EE3 A;  3CKQ A;  1LZ7 A;  1FGX A;  1H7H A;  3I0H A;  3DJ4 A;  2RJ8 A;  3DUV A;  2D7R A;  5CQL X;  3T7O A;  2RJ4 A;  2VD4 A;  1MP5 A;  2AM5 A;  2APC A;  1IIN A;  1G2V A;  1ZDF A;  3V8Z A;  4B4G A;  5C48 A;  1INI A;  1NF5 B;  3R3I A;  3CKJ A;  4CJ8 A;  4HG6 A;  4P02 A;  1GWV A;  1S4P A;  4XWI A;  5IDS A;  5C1G A;  2W0W A;  5FTS A;  3Q80 A;  1R7T A;  4HO5 A;  5C4E A;  1JVD A;  2BO4 A;  4Y6U A;  1FRW A;  2X5Z A;  1ZI4 A;  2WGZ A;  3OAM A;  5C8R A;  1G1L A;  1K4V A;  4C2S A;  3I0K A;  2Y6P A;  2A8W A;  3ZGF A;  1ON6 A;  1XZ6 A;  2AGD A;  1G3L A;  2Y7A A;  2YQC A;  1VPA A;  4P00 A;  3GUE A;  5DDV A;  1LL3 A;  2WEE A;  2QGI A;  5CQM X;  2ICY A;  2V0J A;  4EEG A;  2UX8 A;  4Y7F A;  5CMF X;  1QGS A;  2FFU A;  4KNR A;  2QH5 A;  2Y4J A;  3CKO A;  2I5E A;  1ZI5 A;  2JCO A;  4E1K A;  1R7Y A;  1VM8 A;  1FWY A;  2E8B A;  1YP2 A;  3DK5 A;  3POL A;  2V0K A;  5C4D A;  5C1L A;  5IDT A;  1ZI1 A;  2O1H A;  1NQI B;  2QKX A;  4NAN A;  1R7U A;  2PGV A;  3ZF8 A;  4FRQ A;  3V0P A;  3BCV A;  2J0A A;  1FXO A;  1H4E A;  1VZT A;  1OMX A;  4B3U A;  1ZIZ A;  5EJZ A;  3ST8 A;  4NAI A;  5JQQ A;  3IOI A;  4KXO A;  2FFV A;  3D98 A;  1WVC A;  1ZCV A;  2RIZ A;  3I0G A;  3KIA A;  2VS3 A;  2XMH A;  4FCE A;  5D91 A;  4KC1 A;  2VXL A;  5L6S A;  1G97 A;  2PA4 A;  5C4B A;  1LZ0 A;  1W55 A;  1HM0 A;  1ZJ1 A;  1LZI A;  2NXV A;  4B5B A;  2VFZ A;  1WT2 A;  5AJO A;  3QVB A;  2ZU8 A;  3V90 A;  4EE4 A;  3ZLL A;  2JCL A;  2O1G A;  4CJB A;  5C3B A;  2YES A;  4Y9X A;  3EE5 A;  4FRL A;  4KRV A;  1ON8 A;  1QWJ A;  1H5S A;  1SS9 A;  1LZJ A;  1W57 A;  2P72 A;  2XWN A;  1FG5 N;  1V83 A;  4HO2 A;  1FR9 A;  5C36 A;  1H5T B;  3TQD A;  2OI7 A;  3F1C A;  1FGG A;  4Y7T A;  5DDT A;  3RMV A;  4BMA A;  3T7N A;  3SXG A;  2X5S A;  4Y7U A;  3SXD A;  2XME A;  2V0H A;  2VXM A;  1H4C A;  1WSZ A;  3HL3 A;  4G87 A;  4FRD A;  3N9W A;  3V0Q A;  5EJ1 A;  2YQJ A;  1FO8 A;  2O1F A;  4KT7 A;  2E3D A;  3OH0 A;  3JUK A;  3T7M A;  5HS2 A;  1MP4 A;  4JD0 A;  4KC4 A;  1XHB A;  2AM3 A;  3CKN A;  3PKP A;  4HO8 A;  2ICX A;  2P6W A;  5C1H A;  4KC2 A;  2RJ5 A;  1WT1 A;  3U2X A;  2V0I A;  4D11 A;  2RJ9 A;  2YCM A;  4Q7C A;  3U2T A;  1FOA A;  5FTV A;  1INJ A;  1VGU A;  1ZJO A;  3U0Y A;  4FRH A;  4B4M A;  1MC3 A;  4FQW A;  3OKR A;  1GX4 A;  3F1Y A;  2RIT A;  4UEG A;  4FRB A;  4FCU A;  2OEG A;  3FWW A;  4L41 C;  2Q4J A;  4K6R A;  3V91 A;  1G8O A;  3V0O A;  2OI6 A;  2OI5 A;  2C0N A;  4ZDQ A;  3I0J A;  2FYC B;  3E26 A;  1QGQ A;  4HO9 A;  4KPZ A;  1TZF A;  1O7O A;  3U2U A;  1G95 A;  2JCJ A;  3OC9 A;  4GBP A;  4CVH A;  4J18 A;  2WVM A;  3SX5 A;  3I0F A;  4BQH A;  2I5K A;  2V0L A;  1OMZ A;  1VH3 A;  1R80 A;  1E5K A;  2VK9 A;  1ZCT A;  1EZI A;  1VZU A;  3NGW A;  4FIX A;  1O7Q A;  1H5S D;  3OH1 A;  5CMI A;  1FXJ A;  2WVL A;  2WVK A;  2AM4 A;  3V0N A;  4Y7V A;  4AAW A;  2AE7 A;  3R2W A;  4AC3 A;  1ZJ3 A;  4O6M A;  3OGZ A;  3SPT A;  1TW1 A;  1NHE B;  5FU0 A;  5I1F A;  1G23 A;  1O0R A;  5FU8 A;  5L6V A;  4B42 A;  1LVW A;  1JV3 A;  1VIC A;  4Y6N A;  4HO4 A;  2Y4L A;  3SXA A;  1HJL A;  1TVY A;  3E25 A;  4R7P A;  2Y4M A;  3D8V A;  2ZU7 A;  5AJN A;  1KWS A;  3USQ A;  5EIY A;  4HO6 A;  1VGT A;  4EEO A;  4KPX A;  3JTJ A;  5CQO A;  2X60 A;  3V0L A;  1IIM A;  3CU0 A;  1ZJ2 A;  4NAK A;  4M4K A;  1JV1 A;  3RSB A;  3U0X A;  4Y7G A;  4D0Z A;  2BO6 A;  2XWL A;  3BRK X;  1PZY B;  3SX7 A;  2Z87 A;  1H5S C;  3ZGG A;  2PX7 A;  1YP3 A;  4LW6 A;  1JYK A;  2AH9 A;  4EVW A;  4AYL A;  1V82 A;  2P73 A;  1HV9 A;  2AEC A;  2VSI A;  4MYB A;  4ECM A;  4M2A A;  4O6N A;  3U2W A;  3V0M A;  2Z86 A;  2RIX A;  1HM8 A;  4FIY A;  4MIX A;  4IRP A;  4B4B A;  1H5R A;  1JVG A;  1H7Q A;  2RJ7 A;  4YS8 A;  3Q4S A;  1JYL A;  1GWW A;  1TW5 A;  2W0V A;  2RJ0 A;  1PZT A;  2D0J A;  5C38 A;  1ZHJ A;  4B2W A;  3RMW A;  4B2X A;  2FYA A;  2WAW A;  3TZT A;  1NMM B;  2WE9 A;  4M28 A;  3SXC A;  1OQM B;  1MP3 A;  4G3Q A;  1H5T A;  4D48 A;  4FRE A;  1H7T A;  1YRO B;  1G0R A;  1NKH B;  3V8Y A;  5C47 A;  3JUJ A;  1H4D A;  1R7X A;  5CQN X;  1LL0 A;  2JCK A;  4FRA A;  5CMG X;  4JIS A;  1R81 A;  4DEC A;  2YC5 A;  2YQS A;  3CKV A;  3SXB A;  1R82 A;  3IOH A;  2VS4 A;  3D5N A;  1QG8 A;  2BO7 A;  1W77 A;  4KNX A;  4MND A;  2BO8 A;  5BXC A;  5IFY A;  1WT0 A;  2RJ6 A;  3U2V A;  1HJJ A;  4KQL A;  2CU2 A;  2OEF A;  4D11 C;  2YC3 A;  4ASY A; 
#chains in the Genus database with same CATH homology
 2VS5 A;  1VZX A;  1GA8 A;  4IRQ A;  2FY7 A;  3K8E A;  2YQH A;  4CJC A;  1FR8 A;  2PGY A;  2RJ1 A;  5C3D A;  4G3P A;  5FYE A;  3FOQ A;  4FRP A;  4DE7 A;  1Z90 A;  5C4F A;  2DPW A;  1VH1 A;  1VGW A;  4D0T A;  3Q7U A;  5D92 A;  5C3A A;  2D7I A;  1ZCU A;  3I0C A;  2FYB A;  2GGQ A;  2GGO A;  1H7G A;  1FO9 A;  3OH4 A;  2A8U A;  1YP4 A;  1VGZ A;  2X65 A;  3PNN A;  1GQ9 A;  1S4N A;  2MZB A;  4HO3 A;  4Y64 A;  1NWG B;  1G93 A;  2I7B A;  1WT3 A;  1H7F A;  4NAL A;  5CQP A;  4ARW A;  2Y4K A;  1HM9 A;  1G9R A;  1EYR A;  5AJP A;  5FUH A;  1ZJP A;  4G3S A;  1GQC A;  1H5S B;  4EE5 A;  5C4C A;  3I0E A;  3OH2 A;  5CMH A;  1S4O A;  1ZDG A;  4HOC A;  5J49 A;  1O23 B;  4EEA A;  3SX3 A;  3I0L A;  3K8D A;  4Y63 A;  1ZJ0 A;  1LL2 A;  2AES A;  3OH3 A;  4EEM A;  4Y62 A;  5C49 A;  3O3P A;  5FV9 A;  2RIY A;  3PKQ A;  4HO0 A;  1H3M A;  2J0B A;  2XWM A;  3CGX A;  1ZCY A;  2FYD B;  4HCQ A;  4FRM A;  1V84 A;  1ZI3 A;  3I0I X;  1H7L A;  1H5R B;  3ZLK A;  4LW3 A;  1R7V A;  3SXE A;  4FRO A;  1I52 A;  4DDZ A;  4ASJ A;  3IOJ A;  3LW6 A;  4AYJ A;  5CMJ A;  2ZU9 A;  2VSH A;  3SX8 A;  1GX0 A;  3USR A;  3I0D A;  4M2B A;  1H7E A;  1FZW A;  4EE3 A;  3CKQ A;  1LZ7 A;  1FGX A;  1H7H A;  3I0H A;  3DJ4 A;  2RJ8 A;  3DUV A;  2D7R A;  5CQL X;  3T7O A;  2RJ4 A;  2VD4 A;  1MP5 A;  2AM5 A;  2APC A;  1IIN A;  1G2V A;  1ZDF A;  3V8Z A;  4B4G A;  5C48 A;  1INI A;  1NF5 B;  3R3I A;  3CKJ A;  4CJ8 A;  4HG6 A;  4P02 A;  1GWV A;  1S4P A;  4XWI A;  5IDS A;  5C1G A;  2W0W A;  5FTS A;  3Q80 A;  1R7T A;  4HO5 A;  5C4E A;  1JVD A;  2BO4 A;  4Y6U A;  1FRW A;  2X5Z A;  1ZI4 A;  2WGZ A;  3OAM A;  5C8R A;  1G1L A;  1K4V A;  4C2S A;  3I0K A;  2Y6P A;  2A8W A;  3ZGF A;  1ON6 A;  1XZ6 A;  2AGD A;  1G3L A;  2Y7A A;  2YQC A;  1VPA A;  4P00 A;  3GUE A;  5DDV A;  1LL3 A;  2WEE A;  2QGI A;  5CQM X;  2ICY A;  2V0J A;  4EEG A;  2UX8 A;  4Y7F A;  5CMF X;  1QGS A;  2FFU A;  4KNR A;  2QH5 A;  2Y4J A;  3CKO A;  2I5E A;  1ZI5 A;  2JCO A;  4E1K A;  1R7Y A;  1VM8 A;  1FWY A;  2E8B A;  1YP2 A;  3DK5 A;  3POL A;  2V0K A;  5C4D A;  5C1L A;  5IDT A;  1ZI1 A;  2O1H A;  1NQI B;  2QKX A;  4NAN A;  1R7U A;  2PGV A;  3ZF8 A;  4FRQ A;  3V0P A;  3BCV A;  2J0A A;  1FXO A;  1H4E A;  1VZT A;  1OMX A;  4B3U A;  1ZIZ A;  5EJZ A;  3ST8 A;  4NAI A;  5JQQ A;  3IOI A;  4KXO A;  2FFV A;  3D98 A;  1WVC A;  1ZCV A;  2RIZ A;  3I0G A;  3KIA A;  2VS3 A;  2XMH A;  4FCE A;  5D91 A;  4KC1 A;  2VXL A;  5L6S A;  1G97 A;  2PA4 A;  5C4B A;  1LZ0 A;  1W55 A;  1HM0 A;  1ZJ1 A;  1LZI A;  2NXV A;  4B5B A;  2VFZ A;  1WT2 A;  5AJO A;  3QVB A;  2ZU8 A;  3V90 A;  4EE4 A;  3ZLL A;  2JCL A;  2O1G A;  4CJB A;  5C3B A;  2YES A;  4Y9X A;  3EE5 A;  4FRL A;  4KRV A;  1ON8 A;  1QWJ A;  1H5S A;  1SS9 A;  1LZJ A;  1W57 A;  2P72 A;  2XWN A;  1FG5 N;  1V83 A;  4HO2 A;  1FR9 A;  5C36 A;  1H5T B;  3TQD A;  2OI7 A;  3F1C A;  1FGG A;  4Y7T A;  5DDT A;  3RMV A;  4BMA A;  3T7N A;  3SXG A;  2X5S A;  4Y7U A;  3SXD A;  2XME A;  2V0H A;  2VXM A;  1H4C A;  1WSZ A;  3HL3 A;  4G87 A;  4FRD A;  3N9W A;  3V0Q A;  5EJ1 A;  2YQJ A;  1FO8 A;  2O1F A;  4KT7 A;  2E3D A;  3OH0 A;  3JUK A;  3T7M A;  5HS2 A;  1MP4 A;  4JD0 A;  4KC4 A;  1XHB A;  2AM3 A;  3CKN A;  3PKP A;  4HO8 A;  2ICX A;  2P6W A;  5C1H A;  4KC2 A;  2RJ5 A;  1WT1 A;  3U2X A;  2V0I A;  4D11 A;  2RJ9 A;  2YCM A;  4Q7C A;  3U2T A;  1FOA A;  5FTV A;  1INJ A;  1VGU A;  1ZJO A;  3U0Y A;  4FRH A;  4B4M A;  1MC3 A;  4FQW A;  3OKR A;  1GX4 A;  3F1Y A;  2RIT A;  4UEG A;  4FRB A;  4FCU A;  2OEG A;  3FWW A;  4L41 C;  2Q4J A;  4K6R A;  3V91 A;  1G8O A;  3V0O A;  2OI6 A;  2OI5 A;  2C0N A;  4ZDQ A;  3I0J A;  2FYC B;  3E26 A;  1QGQ A;  4HO9 A;  4KPZ A;  1TZF A;  1O7O A;  3U2U A;  1G95 A;  2JCJ A;  3OC9 A;  4GBP A;  4CVH A;  4J18 A;  2WVM A;  3SX5 A;  3I0F A;  4BQH A;  2I5K A;  2V0L A;  1OMZ A;  1VH3 A;  1R80 A;  1E5K A;  2VK9 A;  1ZCT A;  1EZI A;  1VZU A;  3NGW A;  4FIX A;  1O7Q A;  1H5S D;  3OH1 A;  5CMI A;  1FXJ A;  2WVL A;  2WVK A;  2AM4 A;  3V0N A;  4Y7V A;  4AAW A;  2AE7 A;  3R2W A;  4AC3 A;  1ZJ3 A;  4O6M A;  3OGZ A;  3SPT A;  1TW1 A;  1NHE B;  5FU0 A;  5I1F A;  1G23 A;  1O0R A;  5FU8 A;  5L6V A;  4B42 A;  1LVW A;  1JV3 A;  1VIC A;  4Y6N A;  4HO4 A;  2Y4L A;  3SXA A;  1HJL A;  1TVY A;  3E25 A;  4R7P A;  2Y4M A;  3D8V A;  2ZU7 A;  5AJN A;  1KWS A;  3USQ A;  5EIY A;  4HO6 A;  1VGT A;  4EEO A;  4KPX A;  3JTJ A;  5CQO A;  2X60 A;  3V0L A;  1IIM A;  3CU0 A;  1ZJ2 A;  4NAK A;  4M4K A;  1JV1 A;  3RSB A;  3U0X A;  4Y7G A;  4D0Z A;  2BO6 A;  2XWL A;  3BRK X;  1PZY B;  3SX7 A;  2Z87 A;  1H5S C;  3ZGG A;  2PX7 A;  1YP3 A;  4LW6 A;  1JYK A;  2AH9 A;  4EVW A;  4AYL A;  1V82 A;  2P73 A;  1HV9 A;  2AEC A;  2VSI A;  4MYB A;  4ECM A;  4M2A A;  4O6N A;  3U2W A;  3V0M A;  2Z86 A;  2RIX A;  1HM8 A;  4FIY A;  4MIX A;  4IRP A;  4B4B A;  1H5R A;  1JVG A;  1H7Q A;  2RJ7 A;  4YS8 A;  3Q4S A;  1JYL A;  1GWW A;  1TW5 A;  2W0V A;  2RJ0 A;  1PZT A;  2D0J A;  5C38 A;  1ZHJ A;  4B2W A;  3RMW A;  4B2X A;  2FYA A;  2WAW A;  3TZT A;  1NMM B;  2WE9 A;  4M28 A;  3SXC A;  1OQM B;  1MP3 A;  4G3Q A;  1H5T A;  4D48 A;  4FRE A;  1H7T A;  1YRO B;  1G0R A;  1NKH B;  3V8Y A;  5C47 A;  3JUJ A;  1H4D A;  1R7X A;  5CQN X;  1LL0 A;  2JCK A;  4FRA A;  5CMG X;  4JIS A;  1R81 A;  4DEC A;  2YC5 A;  2YQS A;  3CKV A;  3SXB A;  1R82 A;  3IOH A;  2VS4 A;  3D5N A;  1QG8 A;  2BO7 A;  1W77 A;  4KNX A;  4MND A;  2BO8 A;  5BXC A;  5IFY A;  1WT0 A;  2RJ6 A;  3U2V A;  1HJJ A;  4KQL A;  2CU2 A;  2OEF A;  4D11 C;  2YC3 A;  4ASY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...