1H5VA

Thiopentasaccharide complex of the endoglucanase cel5a from bacillus agaradharens at 1.1 a resolution in the tetragonal crystal form
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
301
structure length
301
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRESA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structure of Endoglucanase Cel5A in Complex with Methyl 4,4II,4III,4Iv-Tetrathio-Alpha-Cellopentoside Highlights the Alternative Binding Modes Targeted by Substrate Mimics
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE 5A
total genus 123
structure length 301
sequence length 301
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1h5vA00
3VD7A 3S6TA 3VIMA 2NT1A 1V3JA 4AZIA 4AEFA 1CGTA 1E56A 1Q6GA 5CPSA 3EDJA 1BHGA 1RH9A 1PEZA 4YHEA 3F4VA 1CDGA 3OGVA 4A3HA 1GPFA 2BHYA 1XH0A 2BNJA 1UHVA 1X1NA 1JF5A 4DWSA 4V27A 3NJ3A 2BV9A 1XGZA 3WH9A 2VX4A 5HDRA 4UZUA 5AYBA 5A94A 1PZ2A 4MDPA 1OGSA 5ECUA 1EDGA 4KMQA 1S46A 2VX7A 4C7DA 1DTUA 1XD1A 3SCVA 4AZ7A 3WEZA 4PMVA 4DWSD 2EPMX 1NH6A 4CU8A 6TAAA 5I2UA 4U5KA 1QW8A 1UKPA 4UTFA 3O2LA 1CWYA 3WNMA 3L4VA 5D9MA 3W24A 3WQ5A 3VGHA 3L2MA 2YBTA 1GQIA 2DT2A 3VINA 4GZEA 5AYIA 2DSZA 3BAYA 3MUZ1 4E4PA 3VDAA 1SYTA 2WCSA 3WF3A 1DEDA 4EANA 4DUXA 1UWRA 3SCOA 3VOCA 2CHOA 4D6EA 1E4LA 5HOSA 3D5HA 1QHZA 1BG4A 2ZX9A 4OZOA 5AC5A 3GZAA 2XJ7A 5ABEA 1UH2A 3VU2A 2EPLX 1H11A 4Z2JA 1HJWA 1MQQA 1W1YA 4OKDA 2VQTA 4CKQA 1XRVA 1VF8A 1VEMA 4GQRA 2WMJA 2YBUA 4B15A 1JYWA 2CPUA 3PTMA 3WENA 2ZWZA 3L4YA 4EE9A 4AD4A 1RP9A 4Z2IA 5A6KA 1MVYA 5IXEA 4J3UA 3MMUA 1OCQA 4U3CA 1GHRA 2YLAA 4PSPA 4AZ6A 2XTKA 1G9HA 3TTSA 2VNCA 3ARTA 4XB3A 5I79A 3SCTA 4BA0A 4GI6A 1J01A 3LPOA 4TX8A 1PAMA 2JEQA 1BLIA 2QMJA 3K46A 1LWHA 1QBBA 3I3EA 4TXEA 4URIA 1GQJA 2XM2A 3WF4A 1BPLB 4AXNA 2V3DA 4MNLA 1GOKA 4X0NA 1ZJBA 5BCAA 3WFZA 4U2YA 2XFRA 4F9JA 4UQDA 1PIFA 3AROA 2WZEA 3ZSSA 4D6GA 4JZ5A 1VAHA 2VCCA 3UETA 2DSVA 3CZEA 4BZYA 3BLKA 3BMWA 1E43A 2VZSA 1WCGA 1IT0A 1TA3B 1CGXA 1E1FA 3WL0A 1VBRA 2F8QA 1OM0A 1KFWA 1V0LA 1US3A 1WE5A 2GSJA 1CYGA 3IAQA 1GORA 2G4FA 2YJQA 1F4AA 1JYVA 1UH4A 2QF8A 1JZ8A 1FP9A 4H04A 4GINA 2WHJA 3AJ7A 1WDQA 2E9BA 3AI0A 1E5JA 2O9OA 1W3LA 3MU7A 4BS0A 2DGAA 2VURA 4ACYA 1JYXA 4JFWA 4UCFA 2D3NA 3VGEA 4LX4A 3N13A 1UYQA 1MW1A 3SURA 1TVPA 1UR0A 1JDDA 1SFSA 1C8QA 4UQEA 2V3GA 1E6ZA 2EBNA 1HJUA 1FH8A 1PX8A 1V6XA 1LJYA 2J25A 4AZGA 5CPQA 3ZR6A 5M03A 3OLEA 1ODUA 5FCZA 3L4WA 1XSJA 1Q6EA 4TVUA 3BSHA 3ZQ9A 2Y4SA 2HISA 4JCLA 5AC4A 5BXTA 4BQ5A 3WF0A 5IDIA 2WLYA 4ATWA 2Y8KA 4DWSB 4EAMA 4AMCA 4RE3A 4R27A 3BAJA 5EBAA 3AIBA 2J77A 2YA2A 3SUTA 4J7RA 4ZFMA 4P8UA 4ACZB 1HX0A 2FHBA 2D20A 2AOSA 1UKQA 5GNYA 4U31A 2GFTA 3II1A 1QOXA 1EHAA 2Y5EA 2WCAA 4CGTA 3B8SA 2CBUA 3T0BA 4NRSA 3VMPA 1W2VA 2IXVA 1ISVA 3AIWA 1MQRA 4FLQA 1HJXA 5CSUA 3THDA 1CLXA 5FL1A 2ZXQA 2J8GA 2XUCA 3PZ9A 5JIPA 1VB9A 3L4TA 3ZJ8A 1JXJA 1WZLA 3WNKA 4JHOA 4F66A 3VD4A 2WHMA 1B30A 5HPCA 2O9TA 1V3KA 1R87A 3ARUA 3K4AA 4GZIA 1GQKA 3VIPA 3CZGA 1OSEA 4CVUA 1BAGA 2XIIA 1PX4A 3KZSA 1LL7A 4EKJA 2YL6A 5CQ1A 3BAWA 3GBEA 3AHTA 4H7VA 5IFPA 3SCRA 1PX3A 4UQAA 4OOZA 3AMKA 4P7LA 1J0ZA 1HN1A 1EQCA 1GJWA 4PUDA 4B3KA 3ZT6A 1KQZA 1BG9A 4YN5A 1QNRA 1B3VA 2WZIA 3BSGA 5FKYA 3F5KA 2W61A 3DC0A 4H8UA 4ZENA 5CJ5A 1M03A 2A3HA 1WZMA 3WN6A 2WHLA 2WMGA 8CGTA 2DQXA 1M53A 4W93A 1QI4A 1LF1A 1VFOA 4JCMA 3K1DA 3AZSA 3ZR5A 4V28A 3U57A 4UFLA 1M01A 4ZXOA 3BH4A 5IHRA 4AD1A 4FLOA 2YDRA 4WK9A 1RD6A 2J47A 2FH6A 3GH4A 4GPNA 2WCGA 1J11A 1CXEA 2WXDM 2CBVA 4PMZA 2XWEA 2GJRA 5AY7A 1CZ1A 1K9FA 1NOUA 2CNCA 1HVQA 5A8OA 2JE8A 1LWJA 1MXDA 4BQ3A 1C3FA 2WW5A 4LYQA 1QVBA 1FA2A 1FH7A 2WC3A 2VT0A 1QNOA 3VDCA 1OT1A 4KGLA 4W5UA 5E70A 2VR5A 1L0PA 4PMDA 4FLRA 4Q22A 5EMYA 1CGUA 4CD8A 3VD9A 2YA0A 2W67A 1FFQA 3VIHA 2VVNA 1E5NA 2EEXA 1B3YA 4UQ9A 3CHFA 5C8BB 4TTUA 4ZXLA 3EDDA 3T0AA 1V6UA 3WNNA 5A6BA 1V0KA 3WH7A 4GQQA 2WKLA 2VC9A 4CN4A 4W86A 2VZUA 2VCAA 3FY1A 3AHXA 1JZ7A 1W9UA 1CXIA 3FXYA 3VMNA 3WH5A 4Z2HA 1M7XA 2WVUA 5IHSA 3CHDA 1W9VA 4TOQA 4AC1X 4CCDA 1G0CA 5BRPA 2PWHA 2WMIB 5JIWA 1VENA 4MTVA 4KWUA 4DUVA 1H4PA 3MV01 1UWTA 2OYKA 4PTMA 2UY2A 3VGFA 1CBGA 4LYPA 1HL8A 1ZBWA 2DH2A 2YL9A 2E8ZA 1GJUA 1GW1A 4ATLA 4AD0A 2XVNA 3A4XA 5FIPA 2ZUWA 3SUSA 1E6NA 5A2AA 3ARQA 1LL6A 1MW2A 1E6PA 4KRTA 4M29A 3AXHA 3F5JA 3A4AA 4UOJA 1EDTA 1DWHM 4CD4A 3WBAA 5D9NA 4DM2A 2NSXA 1IZKA 1B3XA 3W29A 1V3HA 2ZUUA 4AZCA 4W87A 3ARSA 3GH5A 1HT6A 2ZUSA 3WEOA 3WD1A 1ISYA 4AIUA 5A2BA 1QI3A 3RCNA 3MANA 1JL8A 3OZPA 2JFEX 1TVNA 2TAAA 5BXRA 4W8BA 2BY0A 2WZHA 3MMWA 5CSYA 2QHAA 3L4XA 1VFMA 5FL0A 4TVCA 3U5UA 4HA4A 4E2OA 3IJ7A 4MNJA 2D3LA 1UR2A 1QBAA 3WD4A 1VFUA 2W92A 2VL4A 4XUYA 3GDBA 4MDOA 3MUIA 3WQ8A 3AIVA 4AD3A 3AQUA 4GIAA 2ZOXA 1TE1A 2G3JA 4KH2A 4ZE4A 1E6SM 1J0IA 1E3ZA 3OA5A 3PBGA 4WSKA 4CD5A 2UY5A 5BRQA 5C71A 1DWFM 1F4HA 2RGMA 2BY1A 1GOWA 2J7BA 1E6RA 4F79A 5BXPA 1EQPA 5EFDA 1NQ6A 1BYAA 1E6QM 3UG3A 5D4YA 1UZ4A 2JIEA 1V3LA 3FAWA 1ITCA 4HMCA 3AOFA 4WF7A 3K4DA 5HNNA 4AW7A 2XPKA 2WMFA 5F7UA 4HU8A 1C91A 3WEMA 4ZE5A 1QNQA 2G8ZA 2Y2WA 3CGTA 3AIUA 2E8YA 4P7OA 4HZ6A 3QHMA 3S2CA 3CBWA 4WIWA 4IISA 2BY2A 1I1XA 1OD0A 1UQYA 1BYCA 3SCSA 5E6ZA 3EMZA 5A6JA 3QOKA 4IPNB 3FHQA 2EPNA 3ARXA 1UR4A 1AQHA 4FLSA 4EK7A 4AD5A 3HU7A 1JZ6A 1AMYA 1W32A 2WKGA 2PBOA 1V0NA 4JKKA 2YOCA 3FN9A 3EMCA 3UERA 1EHNA 1NOFA 3I3BA 3SIMA 2D2OA 1VRXA 2J62A 3BAIA 4J28A 3OB8A 1PZ3A 4CCEA 3CZKA 3WH6A 4W5ZA 4PCTA 1D7FA 3RIKA 1UOKA 4OUEA 1WDRA 3PTKA 2CKSA 4HMDA 3PZGA 1O6IA 3WSUA 3ZJ7A 4GI8A 3FNDA 3OG2A 3CUIA 2J7EA 1OT2A 2PB1A 5M17A 3UR7A 2WMHA 3ZOAA 4M80A 1ZJAA 1GOMA 4X0VA 4QDMA 2WHKA 4DWSC 3O6AA 5GQBA 1W9XA 2A3BA 1G1YA 3AMLA 2D0GA 4TTGA 1R8LA 1CECA 1XH2A 3AS0A 3OZOA 4AZHA 2ZUNA 1GUVA 4D6FA 4XZWA 2X0HA 3IJ9A 4Z2LA 1JFXA 1W3HA 3ZT5A 5A6MA 1A47A 1XYFA 3WQ4A 4UOZA 3TOPA 3GNOA 4CUCA 3N04A 2QLYA 2J7DA 3VPLA 4WLCA 4C7FA 1JGIA 3ZO9A 2JF7A 3VGGA 3AIQA 2Z1KA 1UA3A 1H1NA 1FFRA 3EDEA 3NSMA 2FHCA 5JBFA 3WDPP 4AEEA 5C70A 2BHUA 4Q7NA 1JNDA 1G01A 2EXOA 2YKKA 1WNOA 4MJ4A 1JF6A 3N9KA 3PZQA 1XHGA 1ZL1A 5I24A 2WC4A 3EBVA 5A69A 4HA3A 1QI2A 3PZMA 2PF0A 1JZ4A 1UKSA 4PTVA 4PMQA 4WKAA 4B3LA 5LA1A 1GNXA 4PMXA 1HJVA 4MAVA 2OWCA 1E55A 4E8CA 3PZOA 4J3WA 1UWQA 4UFKA 2VMFA 4PMYA 2BHZA 3CZ8A 3AS1A 1ECEA 3I3DA 2UWFA 1DWGM 3MUY1 3K8LA 4HZ8A 3IANA 2GDUA 3WMSA 3W4RA 2WSKA 2DPEA 4A4AA 4E8DA 1NWRA 2W63A 3SUWA 3CHCA 4C7GA 5CGTA 4MB1A 2YL8A 4MAZA 1R86A 3CZLA 1DWIM 3WUFA 1QI5A 1XH1A 1SMDA 2ZWYA 4AY1A 5A6SA 1KGWA 1ZS2A 4RE2A 2G3MA 2JIWA 4U3AA 3L4ZA 4U5IA 1ZBVA 1GHSA 2VRKA 3PZIA 1KXHA 4AZ5A 3W6MA 4QCEA 1DP0A 4QCFA 2QPSA 2YDSA 4LGXA 4V2XA 2GK1B 1FOBA 3MSGA 3W6LA 1MW3A 2CXGA 4D1IA 5JUVA 2OSXA 3CUGA 4XV0A 5A8MA 2J74A 2YL5A 2VZOA 5CLWA 3GBDA 5E6YA 1V3IA 2J8FA 4BF7A 1I75A 2ZX5A 1DWAM 3ZM8A 4MPKA 1E73M 4B9YA 5BROA 1JG9A 1GVIA 3TP4A 2VJXA 2WVSA 1HF6A 1MQPA 1HP4A 4CU7A 3F5LA 4PEEA 2ZICA 1U2YA 2X1IA 3UESA 4Y7EA 2DSKA 3EYPA 3AS3A 4H41A 3W0KA 1CXHA 1LLOA 3LPGA 2YIHA 2J7CA 4WJXA 3SCQA 1GQLA 1RP8A 3BC9A 3CPUA 1FHLA 1CNVA 1M04A 3MMDA 3IK2A 3CHEA 2A3CA 1QHPA 1NP0A 1CENA 1FP8A 3MSDA 3ARRA 2XVLA 2A3EA 3AFBA 5I5RA 2WBGA 1E4NA 3RPMA 1B2YA 1EA9C 4W8AA 1EGZA 3AYSA 1MXGA 4UFMA 1ZB5A 2FGZA 1JXKA 4HP5A 4D6HA 2YDQA 4ACZA 4M56A 3FHAA 4B16A 1V03A 1ISXA 4AWEA 3WD0A 1KWKA 3J7HA 1WZAA 1UUQA 2V5CA 4HOXA 5A8QA 2W91A 2XIBA 1OIFA 1XC6A 1NM9A 4NI3A 3W28A 4JFTA 5A2CA 3RM9A 3AISA 3KE0A 2AAAA 4FMVA 2VOTA 4CN1A 1CLVA 3WQWA 4F9DA 3N15A 4W7WA 3BCFA 1UWUA 1U33A 2IUZA 1BTCA 1EDQA 1BQCA 1JFHA 5ABFB 4WKHA 3L2LA 1HIZA 2VX5A 5TD4A 4H8HA 3WELA 1HJSA 5ABFA 3ARZA 4CD6A 4MNMA 1BSIA 4PTXA 3ZJKA 2XWDA 3RMEA 4JAWA 3A47A 4FK9A 2WM0A 2J4GA 3POCA 1UR1A 3ARPA 2WVVA 3T09A 1K9DA 1UD3A 4MB4A 1UKOA 3VIIA 3ZT7A 3QHOA 4W85A 2FH8A 1E40A 1G94A 2XHYA 1EO7A 2EPOA 4UZSA 1PIGA 3CUJA 3BLPX 1CGYA 1UG6A 5CXPA 2MANA 1CEOA 2D22A 2D1ZA 1X6LA 3GYCA 1E4IA 4M8UA 1JI1A 3TA9A 3A3HA 5D8WA 5DFAA 3RJXA 1UD4A 1VJSA 2PI6A 3NDYA 4PBGA 1KGUA 3AHVA 4W8LA 4HPGA 3ARVA 6A3HA 1K9EA 2PWEA 1W9BM 1HKIA 1XCWA 1JD7A 3RDKA 4TVDA 2C0HA 1LQ0A 1HKKA 2BFGA 4HMEA 1L8NA 4UR9A 3K8MA 1PJ9A 2C7FA 2E9MA 5E9AA 1ISWA 2VO5A 5D8ZA 2BY3A 4QAWA 1P6WA 3PZUA 5M5DA 2ZUMA 2CETA 5A1AA 4J3VA 3AMDA 1UD6A 4JFSA 5DO8A 5IFTA 2BVTA 1NWUA 2XSAA 1SMAA 3GXFA 1GONA 3AMCA 5JBEA 2VTFA 3VM7A 2EPKX 2XSBA 3T0DA 1UWSA 5E0CA 2W62A 2WB5A 3W81A 1W1TA 2XGIA 5LA0A 1JZ2A 4P8XA 4CVWA 3A4WA 2WVVB 4F8XA 1BVZA 4L4PA 4TX6A 3NSNA 4ZEPA 2OWXA 3WDRA 1LL4A 4UFJA 2GJXA 3LPPA 2W66A 1VEPA 1V02E 4YPJA 3B9EA 4M82A 1D3CA 5CG0A 2XG9A 2ZXDA 4UOQA 3WKZA 3GNPA 4P8WA 3TTQA 2VUYA 1EOKA 3RM8A 3W26A 3VIGA 3KL5A 3VNYA 1XCXA 4PCSA 1B90A 4QLLA 3WNPA 1H41A 1W1VA 2VX6A 4OBRA 5GPRA 1W9PA 4LPCA 4N42A 1E71M 3AZTA 4OIFA 3VGBA 1C93A 1QW9A 4GO8A 3CMGA 5D9PA 3AHZA 3QR3A 2VI0A 1TCMA 2CEQA 4YHGA 1BGAA 3KL3A 4CU6A 3SUUA 1G5AA 1HKMA 3T2OA 3W38A 1UA7A 4D72A 1HL9A 1Q4NX 1N82A 4GI9A 2X2YA 1C7TA 3IAPA 1K6AA 3U5YA 2X09A 1KBKA 1JI2A 3ZJ6A 2D24A 2PWGA 4PMNA 1J9YA 2J78A 3SCUA 2F61A 3KEHA 3MKKA 1KGXA 1CIUA 2WSPA 2DT3A 3AIEA 3U7BA 3HJEA 2DEPA 4AYSA 1H0GA 2Y24A 3EDFA 4W84A 2WK2A 3SCPA 2XM1A 1UKTA 3W82A 1OIMA 4OBSA 4XZBA 4GO9A 3MUAA 4AZCB 1KB3A 3LPFA 3M6DA 1XYZA 1H2JA 1UWIA 2ESCA 4CCCA 5DT7A 2WYSA 1U30A 3PTQA 3VIKA 1JD9A 3APGA 1W2PA 3SEPA 3VILA 1J0KA 1NWSA 3N1AA 1FHDA 1QI0A 1HVXA 1V3MA 5CPTA 4WSJA 4PMOA 1A3HA 4HU0A 3GTNA 3N17A 3DHPA 4PSRA 4H2CA 2BXYA 1E0WA 3WDHA 3WIJA 4AISA 4PUEA 1J0YA 1W91A 3VX1A 3N12A 2VQUA 2E3ZA 5CGMA 2B31A 1V02A 3MV11 5I77A 2OLHA 2QV4A 3VUPA 5FD0A 3NUKA 2QMKA 3WMBA 2D0HA 4UFIA 2X0YA 1W3JA 4R5EA 1QHOA 3B9DA 3U7VA 3WUGA 2BS9A 5BXSA 4M81A 4LYRA 3WNOA 4P7RA 3AS2A 1JAEA 1C92A 2FGLA 1BYDA 1KQYA 3ECQA 5EFFA 2X8RA 4IUGA 3WL1A 4HOWA 1LG2A 3CO4A 1NOWA 5HBFA 5I0DA 4K68A 4J27A 1TUXA 1NP2A 1SR0A 1C8XA 1BF2A 4LQ1A 5BWFA 1ESWA 1J18A 1XSIA 4J3XA 3UEQA 4MB3A 3K8KA 2ZX6A 3VIOA 1OBAA 3UG4A 1V08A 1MW0A 3WQ6A 1TG7A 3BAXA 3VGDA 4S3JA 2PWDA 3W27A 2J7FA 1R7OA 1R7AA 2WBKA 3WFLA 1CXLA 1GVYA 1Z32X 4HTYA 1KXVA 4QLJA 3SCNA 1KCKA 3UG5A 2G3IA 1BGGA 4L4OA 2WWCA 1KXQA 2EJ1A 2RGLA 2V3FA 1OWQA 1ITXA 3HMCA 2OSWA 3AXIA 1TZ7A 2GJPA 1B3WA 2W5FA 3AIRA 4HA1A 3MO4A 2VZVA 4W7UA 5GNZA 2D23A 2PWFA 5I78A 5LA2A 3L4UA 3CLWA 2PBGA 3AXXA 2OSYA 3AZRA 5ABGA 1EOMA 3POHA 1FH9A 1TFVA 4JFUA 1NARA 7CGTA 1J0HA 1JNEA 3ZIZA 1Y7VA 5ABHA 5DF0A 3TONA 3DYPA 1AQMA 2CITA 4PYSA 4B9ZA 1E3XA 3RO8A 3DECA 2GUYA 1IV8A 1Q6DA 3CH9A 4A3YA 3W53A 1VBUA 2V3EA 1QNPA 1J10A 1I1WA 1V6WA 3VNZA 4P7NA 1Q6CA 2NT0A 1W9DM 1YHTA 5BYWA 1E9LA 1VEOA 4IPLA 4U33A 1BFNA 2G41A 1WB0A 3CZJA 2DSWA 2CYGA 2WNWA 4W7VA 4GXPA 3FAXA 2YA1A 1JYNA 2OYMA 2ZIDA 1H09A 2OWWA 3BCDA 3VIFA 1V0MA 3THCA 2DIJA 1KCLA 3VMOA 4AZBA 1CXKA 1E6XM 5HPOA 4NRRA 3WUEA 5A6AA 4KRUA 3UCQA 4M24A 3N18A 3WDQA 3CMJA 2HVMA 4UNIA 1KBBA 3ZSTA 4MADA 3VTRA 1RPKA 3G6LA 3OLGA 1JAKA 4P8VA 1ISZA 3ALGA 1KR1A 3BAKA 5D9OA 1YQ2A 4D6IA 4MB5A 1H49A 1UR8A 2O92A 3HN3A 3WF1A 1H3GA 2E9LA 1WO2A 1VJZA 5LYRA 1PBGA 3OGSA 2BXZA 4IM4A 1C8YA 1UZ1A 1WDPA 3EMQA 2DIEA 3WUBA 3WD2A 1VFFA 4J3SA 5DMYA 2ZE0A 4U2ZA 2FHFA 1OGGA 3VKKA 2WMIA 1QPKA 4JKMA 3AYRA 5E0FA 3OLDA 1HKJA 3D3AA 4UQBA 1V6VA 1VIWA 1H5VA 1EIBA 3GXIA 2ZUVA 1NWTA 2E40A 1B0IA 4JIEA 2CERA 3RJYA 2GK1A 2J79A 4MNKA 4CD7A 4JL2A 4TUFA 1UR9A 2DSUA 3E1F1 2XYLA 2PC8A 4P7QA 1E4MM 2J7GA 3T2QA 1J0JA 1KR0A 3BXWA 4RE4A 2XVPA 3NCOA 1EXPA 1B1YA 2CHNA 3FW6A 1JZ5A 4PMRA 4DM1A 2WANA 2ZXBA 1GCYA 3PZNA 3VM5A 3WQVA 1HNYA 5A6BD 5E09A 1LG1A 4LXFA 1HJQA 8A3HA 4W88A 9CGTA 1TMQA 4Z2GA 2V38A 2DT0A 1B3ZA 4S3KA 2WLZA 3TTOA 3W25A 4NSBA 4D71A 2BVYA 3GH7A 4H8VA 2YLLA 2J75A 2EQDA 4QFUA 2UY3A 5I23A 3G6MA 1MFUA 1EH9A 5I6SA 4OJYA 2CIPA 3M7SA 2O9RA 4GKLA 1MFVA 3VD3A 1OINA 3PZVA 2VCBA 5M3WA 5EB8A 3GXDA 2CCRA 3WNLA 6CGTA 3N11A 3KL0A 1GOIA 4QP0A 1KXTA 2C8NA 2UY4A 1OD8A 1CGWA 5I3DA 3WMCA 4HZ7A 1PPIA 3ARYA 2WMKA 2JEPA 5A8PA 3PZTA 3T08A 4PRWA 3WD3A 2VVSA 1XSKA 3ZMRA 1GOOA 2WC7A 3GNRA 1C7SA 3M07A 2A3AA 1UH3A 2ZX7A 1CPUA 1E72M 2Q8XA 3EDKA 3W37A 3LMYA 2VZTA 1CXFA 1QNSA 4HOZA 1E70M 2JALA 1K9TA 1WKYA 3SCWA 4NZCA 1D2KA 3DYMA 3GXMA 4JL1A 3M46A 1WAWA 1B9ZA 1WZKA 1TR1A 2QPUA 2V5DA 2WPGA 4AIEA 2XFYA 3VD5A 2FDMA 4MJ2A 2WWDA 3BMVA 5A6LA 4BCEA 4PN2A 4UQCA 4X9YA 1Q6FA 5KZ6A 3BGAA 4PTWA 2O9PA 1DHKA 2E0PA 4Z2KA 2CBIA 5CLTA 1XV8A 3WDJA 4D6DA 3WY1A 2OYLA 2W4XA 4CN6A 4ATDA 4D6JA 1EO5A 3PHAA 4XX6A 5HXMA 5KEZA 4JFVA 2AMGA 1O7AA 4GZJA 2ZX8A 2BVDA 1BYBA 2J7HA 3VVGA 1WDSA 4D6CA 5A8NA 2VRQA 3OIHA 1X6NA 2ZUTA 1KWGA 2CBJA 3DYOA 1B31A 2WAGA 2GJXB 1WPCA 1W3KA 1E0XA 2GDVA 4ML4A 1OB0A 1C90A 1JDAA 3GM8A 3SUVA 3WF2A 3A6OA 3CUFA 5CZKA 3PN8A 2VR4A 1GOQA 1MYRA 1GZJA 2JF6A 2CKRA 1H0IA 3CUHA 3RM4A 1UD8A 1TA3A 3NDZA 1E0VA 4OOUA 1E15A 4PMUA 1CGVA 3NIYA 1W1PA 2DT1A 3WDIA 3VO0A 3CTTA 4AD2A 3QHNA 3VDHA 2Z1SA 4KGJA 2X05A 2Y8VA 4JHZA 2XGBA 4HPHA 1ZBCA 1ODZA 4W89A 3QGVA 1CTNA 3QOMA 5GNXA 1ZU8A 4RL3A 4BQ2A 3MS8A 4NF7A 4DUWA 1UD2A 2XFFA 1E1EA 2NW0A 3B9AA 2ZXAA 7TAAA 2GVYA 3UR8A 1V6YA 2DH3A 1JIBA 1XD0A 3ALFA 1HXJA 3VDBA 2XVKA 4WKFA 3TTYA 4BQ4A 2CESA 4FF5A 2DDXA 2G3NA 1J12A 1MWOA 4N0RA 5FOOA 1UQZA 3NSXA 4AIOA 7A3HA 3NYDA 2D0FA 1JZ3A 5DT5A 3WH8A 2EO7A 1R85A 1ZBKA 3O9NA 1US2A 3AHYA 4UFHA 4JKLA 3VIJA 3AICA 2E4TA 2IXUA 5JBDA 3OLIA 3KWXA 1OGBA 1IZJA 3VX0A 3IJ8A 1UD5A 3DHUA 3OGRA 1DWJM 1AQ0A 1HP5A 4J3TA 1WP6A 5A3HA 3CIVA 3ARWA 5DEZA 4M1RA 4QLKA 3WBEA 1AVAA 3OBAA 5A95A 3T2PA 1JDCA 3AMGA 2VRJA 2WVTA 2F2HA 3RILA 2XVGA 3JUGA 4D1JA 1BVNP
chains in the Genus database with same CATH superfamily
1V93A 3MP3A 1B9BA 3VIMA 4Q8NA 1E56A 3EDJA 4GYKA 4YHEA 4IPPA 3NURA 4XO6A 3OGVA 2BNJA 1SJAA 2BHYA 1MEIA 1W5PA 4RE0A 4N9EA 1JF5A 4HN8A 3PBMA 3WH9A 1U1UA 2VX4A 2W6RA 2OGJA 4UZUA 2J9XA 5A94A 1PZ2A 4FXSA 5ECUA 4KCWA 1XUUA 4B90A 2VX7A 4Q7IA 1DTUA 3UF9A 3GG7A 4KQNA 4AZ7A 3WEZA 4YTUA 5CCZA 4Y8FA 5I2UA 1QW8A 4LNYA 4UTFA 3O2LA 1VZWA 3WNMA 3VGHA 4Q6JA 3MKCA 1Y5XA 5AYIA 1XIIA 3MUZ1 1SYTA 3FYPA 1UWRA 3VOCA 3QZ6A 2VEFA 3HJZA 3M0IA 4D6EA 3VCRA 2E5BA 3D5HA 2ZX9A 1WX0A 4DRSA 1TZ9A 5ABEA 4IPJA 3L68A 1XLBA 4JQ3A 1MQQA 4LUYA 3P81A 1UASA 4M0XA 4Q8TA 3NOYA 1V4YA 4XZMX 1WXYA 1JYWA 2CPUA 4GYJA 1EIXA 4KFNA 3L4YA 2Q8ZA 1RP9A 5IXEA 4J3UA 4O28A 1GHRA 1QJWA 4G9PA 3NQBA 2VNCA 3ARTA 2Y63A 5I79A 1LP6A 4L9YA 4I9TA 4LAOA 4GH1A 1S2VA 3NG3A 1HL2A 2BOFX 3QMTA 3RCYA 3LI1A 4URIA 2VFHA 4MYAA 3SB0A 3TWBA 3NQMA 1GOKA 4NYYA 3M47A 1KFKA 1ONXA 1Z41A 4DBDA 2XFRA 4ZQCA 1TPFA 4WXYA 3VDGA 5DY2A 3WQDA 2DSVA 1NFPA 3ES7A 3IGUA 4XKYB 1BTMA 2ZADA 1IT0A 4FEZA 1SSDA 1AL8A 3VE7A 5IRPA 4WDXA 2R1LA 1VBRA 3VI2A 1YE6A 4FNPA 1GORA 2YJQA 1SFJA 1UH4A 5HNUA 2YSWA 1FP9A 4H04A 4XBSA 1OFRA 3QV8A 1IEQA 4GINA 2WHJA 3TYUA 4IMDA 1WDQA 3DX5A 4K7VA 2E9BA 3AI0A 2YFNA 4MLJA 3CV7A 3UYIA 4BS0A 1LT8A 4ACYA 3XIMA 2A2IA 6ALDA 3FYOA 1FXPA 1UYQA 1BD0A 1MW1A 5BW6A 3AO0A 4RDVA 2EG6A 4UMBA 2KZHA 4DBSA 4HJWA 4PTNA 3IUIA 4UQEA 2V3GA 1ENUA 2QQ6A 1HJUA 1FH8A 1V6XA 2VOMA 4AZGA 3PR2A 2O0TA 1J96A 1QATA 2I56A 5K3VA 1ODUA 3VNIA 5FCZA 1Q6EA 3EWZA 2BVWA 3NA8A 4BQ5A 5CBJA 5XINA 1JRBA 1R6WA 2Y8KA 2ZFAA 2EHHA 3S47A 4EPKA 4G7EA 3AIBA 3HF3A 3CWOX 1W1IE 4L56A 3RFAA 4J7RA 3FGCB 4H2HA 4ZFMA 2V2HA 1A5MC 1CW2A 1UKQA 3BZGA 2GFTA 2QGYA 2ISFA 3B8SA 3GHUA 3T0BA 5HMDA 3VMPA 1KFCA 4QBXA 3AIWA 3KRBA 2VGIA 1AUSL 1F3XA 2YYUA 4QNEA 4HU3A 4HK5A 4ZSTA 3GC5A 2CU0A 1JEZA 2XUCA 3PZ9A 4BKNA 5JIPA 1VB9A 1BRLA 3ZJ8A 7PTDA 3WNKA 2WHMA 3URNA 1B30A 1EEPA 1EZWA 1F8MA 4IJCA 5FAJA 2GPTA 3H55A 2PWVA 1V3KA 1OFBA 1V51A 4GZIA 1GQKA 1OSEA 2GUUA 1GG1A 3ABXA 3DERA 1A4MA 3IACA 2A4AA 3ZYZA 3B0XA 1E9ZB 1TB3A 1Z89A 4QGCA 4LSBA 1Q6RA 2ZE3A 4GFIA 4RNIA 3PBYA 3B8TA 4DJFC 4MG4A 3PUOA 1HN1A 4FZIA 1G67A 3ZLHA 1GJWA 2FZMA 1WDDA 1B3VA 3BSGA 4S3CA 1SZFA 2W61A 3DC0A 3F5KA 4H8UA 3ZWTA 4E2BA 5CJ5A 3L7RA 5C55A 3P3BA 1P48A 2BODX 4UXDA 2ZKMX 4W93A 4JN8A 3DI0A 2NLIA 3O8AA 4C6PA 5EMLA 4IGHA 3AZSA 3OG3A 4AB4A 2VFFA 4XTDA 1NFBA 1M01A 5IHRA 2YDRA 1V5XA 3LOTA 5D32A 1FHVA 1P6CA 2CBVA 2OFJA 3A12A 1CZ1A 1K9FA 1NOUA 2C1GA 2QZRA 3EWDA 4GC4A 2RDWA 3MVTA 1LWJA 4A8NA 4LYQA 2PCQA 2X7WA 5A5WA 1B4KA 3M5XA 5E9XA 1K8XA 1QNOA 3UT0A 2OQHA 3R79A 4YWSA 1XPYA 2YGYA 2VR5A 3CK5A 4N2YA 5J8LA 3V0SA 1L0PA 4FLRA 2O56A 2OX1A 4JQ2A 3UGRA 1H7XA 2DUXA 3EWCA 1Z8AA 1CGUA 2W67A 1WXJA 2VVNA 2XH7A 1TWIA 4YVVA 3PFMA 4FP1A 4PBEA 4ZA0A 3WNNA 1V6UA 3WH7A 4GIEA 4F4RA 4W86A 2VZUA 1JZ7A 3EXTA 4S2CA 2VEKA 1GEQA 3E02A 3VNDA 1FWGC 3FXYA 3EWXA 1HO1A 3RLHA 1W9VA 3TW9A 3OQ8A 4UIOA 2WMIB 1KTBA 3T0TA 3F1QA 1BWLA 1UWTA 2E28A 4PTMA 3MCNA 2I17A 4ZB5A 2CLMA 1ZBWA 4LEFA 3HQNA 2YL9A 1FCQA 3HIJA 4KETA 1N8IA 3A4XA 5FIPA 1LWIA 4IJRA 4JY9A 4UTTC 1U5VA 5A2AA 1MW2A 3AXHA 3F5JA 2TODA 3WLLA 3LDVA 4UOJA 1EDTA 4JTRA 4CD4A 4C1NB 2ZDRA 3RPTA 5D9NA 2QV5A 4GVFA 3LM7A 4MVAA 1IZKA 2EKGA 4HCDA 1V3HA 2ZUUA 4W87A 3GH5A 3R0UA 3WEOA 1TX2A 3N34A 1JL8A 3OZPA 4IMEA 1TVNA 4WEVX 4I7VA 2TAAA 3MQTA 3VZXA 4I5XA 5BXRA 2BY0A 3MMWA 4K37A 3H2EA 2QHAA 4JQ4A 2PDYA 3PSWA 1D9EA 5JH2A 4TVCA 3U5UA 3CPGA 3IJ7A 2V68A 1YPIA 3T55A 2W92A 1M41A 5ABTA 4DZ5A 3GDBA 5F2MA 5EA9A 1K8CA 5AHLA 2J13A 2E25A 3WQ8A 4K1GA 1LLWA 3K1GA 3WQEA 3C2EA 2VEIA 4A3QA 3BCJA 3OP2A 2VD9A 5D33A 4IIDA 1L6YA 1TUFA 1QK0A 3G0XA 1KRAC 5AYXA 4C90A 3OA5A 3PBGA 4BY3A 3KOWA 5C71A 1AZ1A 3HFTA 4R33A 4PRRA 2J7BA 3NQVA 1E6RA 1EQPA 1ZGDA 5EFDA 1BYAA 3HG4A 2JIEA 1V3LA 4WF7A 1LZOA 4QS6A 3NR0A 4LUSA 5F7UA 1HGYA 4HU8A 3B06A 3LHYA 4HNTA 3VKJA 3S1WA 1S1PA 2PTYA 3T8QA 2G8ZA 3AAMA 2CLLA 2Z24A 4ZO7A 3UCCA 3GXTA 4MZ8A 1YPXA 4ENLA 1OJXA 2V6AA 3CBWA 4RR4A 2BY2A 1UQYA 1OD0A 3DC8A 4WSHA 4IPNB 3FHQA 4FLSA 3N6JA 1EJTC 3LLFA 3NO3A 4ADTA 1KM1A 3GDLA 1W37A 3GYEA 3SY5A 2XZ9A 3NQGA 3UERA 2CZEA 3IGHX 1EJ7L 2D2OA 3TN6A 4AWUA 4W5ZA 3WLQA 3QZEA 1GG0A 2YBVA 1ITUA 3AC0A 3AUOA 1WDRA 2ISVA 4L1WA 4XAPA 3WSUA 3ZJ7A 3CHVA 4B91A 4HPJA 3OG2A 3QY6A 4UTIA 5FACA 3CUIA 2J7EA 3PM6A 3U2EA 4WVXA 4O53A 5JH1A 3UR7A 3SGZA 1QT1A 5BU6A 4O0QA 3ZOAA 4PUUA 1FWAC 3JVAA 4X0VA 4QDMA 2DQWA 4D9PA 2H3DA 1AW1A 4LF2A 3TN4A 4KRZA 3AMLA 1FVPA 2H9AB 4EP8C 1QMLA 4MUPA 3AS0A 3OZOA 3R43A 4YTQA 3BW4A 3DFOA 4RDWA 2ZUNA 4B4HA 1GUVA 4D6FA 2XINA 4Z2LA 1EF3A 2FFCA 4ORIA 4PUNA 4GD0A 2QLYA 3NWRA 4C7FA 2Y1HA 3ZO9A 2JF7A 1UA3A 1KBLA 1FFRA 5AVNA 1XIDA 4ZO8A 2HBXA 5HR7A 3VNMA 1WNOA 1ZL1A 3E0IA 1UPMB 3G8RA 4AHOA 4GA8A 4HA3A 3P84A 1QI2A 1UKSA 4X2PA 3GNNA 3W7OA 1W17A 4AIBA 3LCHA 2PDIA 4WDTA 3QM3A 4R7WA 1HJVA 2WM1A 4E8CA 1DXEA 1JULA 4H6KA 4J3WA 2OLSA 4S3FA 4EX4A 2BHZA 3AS1A 1ECEA 4C6BA 3I3DA 1X1OA 4HZ8A 4ZSUA 4AF0B 3FJNA 1YXYA 3PUDA 2OPJA 2Z25A 2J66A 4A4AA 3W1MA 4JTTA 3SUWA 4C7GA 5EPDA 1H7PA 3QF0A 4MAZA 3CZLA 3FIGA 3CUZA 3C6CA 4B4FA 3ITOA 1SMDA 1IF2A 2ZRWA 4AY1A 4RCXA 5A6SA 3S4TA 1KM6A 3QQWA 3W9ZA 3L9CA 2QF7A 3DFHA 3B3DA 3PZIA 4AZ5A 1F61A 2AKMA 4JS3A 4QCEA 4ASTA 2QPSA 4GVHA 2YDSA 1FOBA 1A5AA 1MW3A 4D1IA 1O4UA 3CUGA 4XV0A 3IPWA 3SN0A 4IJBA 2J74A 2A21A 5CLWA 3FJ6A 3KDNA 3CJPA 1I75A 3IVUA 4MPKA 4KEUA 4L9ZA 3WJWA 1S5NA 1O1ZA 2YCJA 1HF6A 7XIMA 1RCXB 4ZODA 1WYIA 1ADSA 4NYUA 4QM1A 2ZICA 3UESA 4Y7EA 1TQJA 3AS3A 4ERAA 2IQDA 3N4AA 4FS9A 1XIEA 3G24A 1VFTA 3TW7A 2PLKA 1RP8A 3A13A 2YCLA 3A9BA 4LTSA 1L8PA 1FP8A 3N2OA 4MFEA 2DFAA 4IGSA 3AFBA 4PZVA 2ZBTA 4O16A 2RDUA 4ADSA 3TLLA 1EGZA 1PSCA 2OO0A 1GPWA 4LUJA 2HSAA 1JXKA 4GY1A 2ZYFA 1U83A 3E5BA 4Y6GA 3VKBA 4C6MA 4G7FA 4B16A 3LBMA 1YKWA 4B2DA 1VBJA 4AWEA 5JVLA 1K8ZA 2PDNA 4AX7A 5HQMA 4QIUA 3GIPA 2V5CA 5D38A 5A8QA 2W91A 4G1NA 1ZJIA 5AKQA 3AISA 3S2LA 4UTWC 4JQ1A 3W1XA 2AAAA 2ZZ5A 4J5NA 3FEQA 4FMVA 3L0NA 2VOTA 4L1GA 2Q02A 5I3GA 1DJNA 1O95A 1TPB1 2UBPC 4OVXA 4J3ZA 3PTDA 5ABFB 3ITXA 3L2LA 2ZC8A 4CD6A 4DJFD 2CZDA 4O57A 3S2NA 2H8XA 2XWDA 3RMEA 4JAWA 3A47A 5FSDC 2J4GA 3ABSA 3WG6A 4S3GA 2BX7A 9XIMA 1UKOA 1A5LC 1S5TA 1E40A 5CG7A 3VNJA 2PE4A 1W1A1 1RPXA 1FCUA 1RLCL 3UVAA 1CGYA 4BI6A 3JZEA 3SDOA 3EGJA 5LNVA 2BMBA 4K38A 4ZZ9A 2MANA 1E0TA 1CEOA 1XKJA 2D22A 3OVQA 3LM3A 1E4IA 2NVDA 2P3ZA 3TA9A 5DFAA 4MY1A 4AEOA 4PCPA 3CO8A 5J5RA 3TMLA 3BLDA 3W1TA 3PPCA 2PLJA 3T81A 1YX1A 1UW9A 3RDKA 4FNUA 2TRSA 3T78A 2C0HA 2ZRYA 1I8JA 4WRHA 1DJGA 1HKKA 3C3UA 2BFGA 3MBDA 3K8MA 2C7FA 3B9OA 4DAIA 3EWBX 1H5YA 5E9AA 3DGBA 5KINA 2BGSA 3QPZA 5FJUA 4JFSA 3UZJA 1PUDA 1VYPX 1NWUA 3TEVA 2FMNA 3GXFA 2QCLA 2DUAA 3AMCA 1LLZA 1V79A 3VM7A 1UWSA 3MYOA 3BE7A 3W81A 1W1TA 1K70A 1VS1A 2E6FA 3MYPA 3W1AA 5LA0A 1JZ2A 4HSNA 4P8XA 3BJFA 1EP2A 3VC5A 3MJYA 4F8XA 1BVZA 2QEZA 3ITLA 1V02E 4QG8A 2FJKA 1UJQA 1D3CA 5CG0A 2ZXDA 5LSMA 4N6FA 4PODA 2VUYA 1O5RA 4GVIA 1NY1A 3LNMA 4XAZA 1C9WA 3TVAA 4JTDA 2PS2A 4GUFA 3SJNA 4QLLA 3WNPA 1W1VA 3N2TA 1FBAA 1W9PA 3CYJA 4BI7A 5REQB 4OIFA 4QNWA 3VGBA 5T91A 4GO8A 3CMGA 5D9PA 2VI0A 2GGIA 5D05A 1BGAA 3ZZ1A 3KL3A 3THQA 1OCJA 4DJDA 3T2OA 3W38A 5U4NA 4GI9A 1N82A 2X2YA 4Q8QA 3IAPA 2PWGA 4PMNA 3MA8A 4UC5A 1L6GA 2F61A 5FI8A 1E9IA 3KEHA 3GDTA 5CJMA 1XYCA 4GWEA 1KGXA 1XLDA 4PB4A 2WSPA 1F2JA 3LTSA 3LMZA 5TIMA 4GRSA 1EEXA 3DG6A 4LVBA 2XM1A 1UKTA 2Y6ZA 4OBSA 2YW3A 4GO9A 4AZCB 3RRAA 1SFTA 3M6DA 1XXXA 4CCCA 3S8HA 1OFPA 3VOGA 1U30A 3G1RA 4IX2A 1W2PA 1UP0A 3N1AA 1QI0A 1V3MA 2WJZA 2X42A 4HU0A 3PBWA 3CTLA 1BXBA 3NQDA 3DZ1A 2C14A 2DVUA 1M6JA 4DJFA 3TC6A 4AISA 2QJJA 1ADDA 2Y5JA 3VX1A 1I2NA 3GG0A 2VQUA 4CQ9A 4DJEA 3E0LA 3MV11 5C0QA 2D0HA 1F7BA 2Z27A 4RDZA 4R5EA 3B9DA 1XL9A 5BXSA 4QG6A 5DRIA 3WNOA 3TJLA 4OUIA 3T8LA 3TC7A 3BOXA 3ECQA 5EFFA 4IUGA 1EYWA 3CM4A 3GXNA 1CX9A 3CO4A 4NZ1A 3KZPA 4HN4A 5I0DA 4K68A 2NUWA 2PLCA 5AHEA 4XSMA 1C8XA 1LOSA 4LQ1A 4Y9NA 1J18A 4ICMA 5MKGA 4K7YA 4PBFA 4J3XA 4NAEB 4RW5A 1TTJA 3UR5A 3N2MA 1WOBA 4DBUA 4MB3A 3K8KA 3LZ3A 3UG4A 1V08A 3FV9A 3P60A 3WQ6A 1TG7A 3BAXA 3GTIA 3VGDA 1W1B1 2FB2A 2J7FA 1R7AA 1UUMA 3TZNA 1CXLA 1GVYA 2OKTA 2HK0A 1K77A 2OEKA 2VP8A 2PAJA 5CKSA 4O1EA 3UG5A 3CAKA 1R3SA 2DW6A 4Q4KA 1KXQA 4GUJA 4L64A 2RGLA 2FTYA 1OWQA 1SR9A 1ZQ5A 4QHRA 4RUBA 2QGHA 4IICA 2A6LA 3AIRA 3G5EA 2GQ9A 3LGDA 3MO4A 5G4HC 5GNZA 2D23A 4FSAA 2PWFA 3CYVA 4HIBA 5LA2A 1O5QA 3TSMA 3E0WA 1TIMA 2PDFA 2PBGA 1A5NC 1IQ8A 4IXHA 4IIHA 3IJDA 1OCNA 3N2XA 5F4XA 2QDDA 1PIIA 2VXNA 3MDWA 2V0TA 4C6NA 4E3VA 1AQMA 4QQUA 1TMHA 3RO8A 3LBCA 1Q6DA 2OB3A 3GAKA 4QJ5B 4ROPA 5DCDA 1J10A 2VKZG 3E2QA 4LALA 4P7NA 4HHPA 1Q6CA 2NT0A 2OZ0A 4IPLA 4U33A 2IMRA 4EPEC 2ZIDA 2YCIX 1AMKA 4Y9MA 2PA6A 3CAVA 1V0MA 3PAJA 2AQVA 1KCLA 1CXKA 3U0HA 3WUEA 3GNXA 8TIMA 3WDQA 3D46A 2PDJA 3G0UA 2E7FA 4FALA 3VTRA 2OT1A 3OLGA 1JAKA 4P8VA 4UBPC 1ISZA 3LN3A 2Z1WA 1YQ2A 4H19A 1H49A 4INFA 2VYOA 2A7RA 3UWUA 2TMDA 1VJZA 1PBGA 4CEUC 1S5VA 4IM4A 1I4NA 3WD2A 1JDFA 1XYAA 4U2ZA 3AYRA 1FWIC 1FWNA 3UJRA 2JGQA 2ZUVA 3UZZA 3RJYA 5HJLA 1FWEC 4TUFA 1VP5A 5D37A 3QR0A 4O4VA 1YDVA 5CGQA 2G97A 1EF2A 3BXWA 4IF2A 3RLVA 3APTA 1EXPA 2CHNA 3H70A 3MCMA 3WQVA 1HNYA 1LG1A 2QYGA 8A3HA 1SO3A 2YW4A 3PNZA 1ZY9A 1S3HA 1TMQA 3W1RA 1BEUA 1TYGA 2DT0A 3IIPA 2WLZA 4D71A 1L6SA 4NSBA 2BVYA 2YLLA 4O8AA 3ONCA 4H9VA 4JIIX 2WZTA 1JUEA 4NKCA 2CIPA 4CLMA 3IK4A 3M7SA 2WPBA 4O10A 5LNWA 4GKLA 3VD3A 3TYDA 3PZVA 3TLQA 2VCBA 5EB8A 2WSRA 3L5MA 6CGTA 4KWWA 4J2MA 1GVEA 1L6FA 1ZTVA 2C8NA 3DBPA 1RQEA 5I3DA 4HZ7A 2QUNA 2PDXA 5A8PA 1GEHA 3EPMA 3GVRA 1RXOB 4PRWA 3WD3A 2VENA 1GOOA 3W7RA 3S9IA 4NJIA 1SJCA 4C6EA 2R8WA 3M07A 1UH3A 2QCNA 1XPGA 5HUPA 2ODOA 4HA0A 1E70M 4QE5A 1VPYA 4ML9A 1IT8A 1D2KA 3NPWA 3DYMA 2ABBA 1J5SA 3K13A 1I2QA 4GBUA 5D04C 3H2NA 3GVVA 1LUCB 1TR1A 2O7SA 4J9JA 2XFYA 3VD5A 2MUCA 4MJ2A 2GWNA 2XU2A 4RZ4A 3BMVA 3GE7A 4DBEA 4PN2A 5KZ6A 3BGAA 3GTXA 2B4GA 1XLGA 3A64A 3FDGA 1RVGA 2DU2A 1XJBA 1NDWA 3WY1A 4LUSB 1PYMA 2YB4A 3GDMA 1F73A 1FWRA 3BL3A 4Y9OA 5DELA 3KX6A 2ZX8A 1PKMA 3F7JA 1XIBA 2HPMA 3O06A 4LAUA 4UTHA 2ZUTA 1KWGA 2CBJA 1W5NA 3RX3A 1XP3A 3W86A 4ES4A 1E0XA 4AX6A 1T41A 2V5JA 1OB0A 1C90A 2PDGA 3MI6A 4IOTA 2FVLA 4QEHA 4TX9A 3SUVA 3H21A 3CUFA 4KS0A 2Y5SA 3H2OA 2VR4A 4UTKA 2JF6A 1X98A 3ELFA 3RM4A 4GYPA 3DFQA 1E15A 1CGVA 4A2RA 2HK1A 4JPGA 4WR3A 3FJLA 3ANUA 1ZALA 4JTIA 2Y8VA 3TXZA 4MHBA 1V7AA 4HPHA 3M0HA 4W89A 1XIGA 3QGVA 1K1DA 5H8UA 1GYNA 2AAMA 4Q8UA 5HUOA 3QPYA 3MS8A 3P80A 4I7WA 2EKCA 1DJXA 3TFXA 1FWDC 2GVYA 4WD0A 1JIBA 1UC4A 3ALFA 4M6QA 1HXJA 1KLZA 1YPFA 2XVKA 4IFRA 4BQ4A 2REQB 1R3VA 3H12A 3ANVA 2XIJA 4GX9A 1SO6A 3OODA 3CV6A 1F8IA 5FOOA 5M1TA 1PDYA 1UQZA 3RRXA 3N4EA 1OK4A 1IZCA 5LNSA 2AL2A 4ZVJA 4IIGA 2QJIA 1US2A 1QWGA 2BGQA 4UFHA 4JKLA 3UPBA 1V7YA 3VIJA 4HNNA 3STPA 4D8ZA 1IZJA 3IJ8A 3NQEA 4UTJA 2PSNA 3DHUA 4JHMA 5DEZA 5BMWA 4HCLA 3WBEA 1TSIA 3OBAA 4YU1A 2YB1A 4YCPA 1LDCA 4LBRA 2CLKA 1NF0A 2VD8A 4Z0JA 3UPMA 3MT1A 1M65A 1BVNP 4DZHA 3E6EA 4DXXA 3GRIA 4C6IA 3S6TA 4K6AA 4EF8A 4AEFA 3NQCA 1CGTA 1Q6GA 4HYWA 1RH9A 1PEZA 2OEJA 3T4WA 4I6KA 3PVFA 1XH0A 3OO2A 4GNKB 3F4CA 3T7VA 4DWSA 4QJ3B 3IEBA 4DF0A 2BV9A 3OIXA 1JUBA 4XWUA 5AN7A 3VZYA 4G5DA 1S46A 3PJTA 3VK5A 4C7DA 2GVLA 3BK0A 3OZYA 4FIQA 3RGTA 1TPEA 1NH6A 2HJPA 3TW6A 5CC6A 1UKPA 3TIMA 4AH7A 3TQKA 3S2JA 1OG0A 3P7YA 5E5CA 1JQXA 5D9MA 1B3OA 1VRDA 1GQIA 4K36A 2PDKA 5G1TA 3P8JA 3BAYA 4E4PA 3VDAA 2HS6A 1EZ2A 2WCSA 3MDUA 2CHOA 1LRNA 2UZ9A 5GJPA 5HOSA 2OJPA 1XLAA 4OZOA 3N3MA 3QH2A 1SJBA 3T07A 3MP4A 3N3TA 4YCOA 1TPUA 4YLWA 1VF8A 3IV8A 5E1QA 3THUA 4GQRA 3WK0A 2YBUA 4B15A 3N2CA 3FVMA 4H00A 4FX8A 4Z1YA 5F1UA 4EE9A 2I5IA 4Z2IA 3GR7A 1MVYA 1YBQA 3HPSA 1OCQA 3TN3A 2XTKA 2C3ZA 1G9HA 1LBMA 3TTSA 2PGEA 4BA0A 3MB9A 2XISA 3ZVHA 2YXOA 3LPOA 4TX8A 1BLIA 4LUTB 3K46A 2I1OA 5AC6A 5CZJA 4NX0A 3BVJA 4LUIA 4M19A 3FS2A 3KCOA 1BPLB 3IRDA 5FJRA 3B03A 4MNLA 4X0NA 2E6YA 3B0YA 4GCXA 4U2YA 3S9YA 4F9JA 3W7LA 3AROA 5JXQA 4IP7A 8RUCA 1VAHA 2VCCA 2Q71A 3UETA 4BZYA 4JIHA 4GABA 3VOJA 1QPNA 1CGXA 3IGXA 3W87A 1A0DA 3WL0A 2F8QA 3HZ3A 3KVLA 3BSMA 3K5XA 3UR2A 4WUIA 1IEVA 2GSJA 4EOUA 2G4FA 5F2LA 1H1YA 4AAJA 1JCTA 4H6RA 1O5XA 1KNWA 1JZ8A 4JIRA 3AJ7A 4IFKB 3VFCA 3DGRA 3MU7A 5T8GA 3WLOA 4XVDA 2G50A 3ZR4A 3BTNA 1OFQA 1JYXA 4UCFA 2PODA 1XIMA 3P2VA 3UWYA 2Z28A 4Q4OA 3EZ4A 1TVPA 3RLUA 1M7JA 3S1GA 4PL2A 1TCDA 1JDDA 3WFAA 2ACQA 3IIZA 3WO8A 1LJYA 5CPQA 3ZR6A 3FSTA 2D2HA 4LBUA 3KHJA 3TR2A 1Y65A 1Q2SA 1XSJA 5HANA 2XN2A 3BSHA 1S39A 4D8AA 1XYMA 3ZQ9A 2HISA 1Z6KA 4JCLA 5PTDA 5FEXA 2C0AA 4M1BA 3TDFA 4L4LA 4FOJA 1BSLA 1M68A 5IDIA 2WLYA 4Q4MA 5JQ9A 3WLSA 4RE3A 5EBAA 4IG2B 1I0BA 1XBVA 4JTKA 5XIMA 5C9ZA 3P5YA 2J77A 3P67A 3SUTA 1F3EA 4KF1A 3OYZA 4IX0A 2AOSA 5DXYA 2OQLA 4U31A 3II1A 3M4HA 3USZA 2WCAA 3EOOA 4HSOA 2CBUA 2HDJA 5CEWA 2A5HA 1ISVA 1YNYA 4FLQA 3G0SA 2Y7DA 1HJXA 1YLVA 4H3DA 3THDA 2ZXQA 1YNPA 4IFOA 1VBGA 3HURA 3KOZA 3AXMA 2XH2A 3V36A 2H6RA 9XIAA 3L4TA 4BF5A 4JHOA 4X60A 3VD4A 1TPDA 4YS1A 5HPCA 2O9TA 3RX2A 2QR6A 4Q4QA 3K4AA 4XD3A 2PP1A 1UJPA 3R94A 3VIPA 3CZGA 3EX2A 1BAGA 1AH3A 4GK8A 1GKRA 4WY0F 1PX4A 3M64A 3HM7A 3GG1A 3HPXA 4B92A 5CQ1A 5K4ZA 3P82A 5T26A 3B8IA 3LGEA 4JIPA 3SCRA 3GC4A 4UQAA 2QNEA 5K9XA 4OOZA 3TR9A 1U1JA 4XZNX 1J79A 3O16A 4K3ZA 1EQCA 3EA2A 1R9YA 4O54A 1Z42A 3PB0A 4YN5A 1Q6QA 1W5MA 5D2XA 3WN6A 5IBXA 3DFTA 1LF1A 1YDOA 1VFOA 3REQA 2PZ0A 3ZR5A 3M41A 1FWSA 1JPMA 1ZAHA 4MJZA 5EL1A 1N2VA 2IKIA 3LV5A 2QCGA 4GXMA 1RD6A 2C16A 2J47A 3B05A 1PDZA 3GQYA 3GNDA 5GJNA 3GH4A 1J11A 2WXDM 1JPKA 5TQLA 2YCEA 2NUXA 4PMZA 3E74A 2F6UA 4LU0A 1MXDA 5I3IA 1FA2A 1FH7A 1JRCA 2WC3A 2VT0A 1W6TA 3VDCA 2HVOA 4NZ3A 1N8WA 3OVGA 4KGLA 3CQ0A 5HNRA 2ICSA 1N55A 4MIMA 2CLEA 4X22A 4H9TA 2QS8A 2YA0A 3L65A 2Y7EA 1QTWA 1E5NA 3B0PA 2ZRZA 1B3YA 2BG5A 3T0AA 5A6BA 2QIIA 2D2JA 1I2OA 3N19B 3I7QA 4LBSA 3FY1A 5JMUA 4LEQA 1VBHA 3WH5A 4B5VA 3SFWA 5IHSA 3LK6A 3CHDA 5AYZA 1RQHA 1G0CA 1HW6A 5BRPA 2PWHA 1EX5A 3O3RA 5FF4A 3FA3A 3GKAA 1VENA 1TMLA 3DHFA 4DUVA 2ZA2A 2Q6ZA 2OYKA 3V7PA 2IKJA 1DJYA 2UY2A 1CBGA 4LYPA 1P7TB 1RCOB 2E8ZA 4B2DD 1GJUA 2NVAA 4UTWA 4HD5A 4AY7A 1GW1A 4IIBA 4AD0A 2XVNA 5EKYA 1EXBA 3ZS4A 1EJRC 4PCFA 1E6PA 1RALA 4M29A 5DCBA 4ZQPA 3E49A 5HQLA 1DOSA 1DWHM 5FJIA 4K39A 2NSXA 3TWAA 2NQLA 2FZ8A 1B3XA 3VKAA 3ARSA 1HT6A 4ZL1A 1ISYA 3DDMA 4XD6A 4A3UA 3RCNA 4WGHA 2YCLB 3MANA 5HJXA 1UP2A 1R30A 1XISA 1OX5A 3NZ1A 4W8BA 1AD4A 5CSYA 4DPQA 3L4XA 1VFMA 5FL0A 5A6TC 1WV2A 4E2OA 1PVNA 1DL3A 2WNQA 2D3LA 1LYXA 3F4DA 1VFUA 4O12A 4XUYA 1ME9A 3GAYA 3SN1A 3AIVA 4AD3A 3AQUA 3H8AA 3KAOA 1TE1A 2G3JA 1A0EA 1J0IA 2IPWA 3HO8A 4WSKA 4E4UA 3QV7A 4US5D 1DWFM 5EBUA 2CC0A 3QQ0A 2SFPA 3ERPA 1RA0A 2BY1A 3VXGA 1GOWA 4FOKA 5KTLA 4OV4A 4F79A 3C2FA 3FDKA 4GGHA 1E6QM 2HVNA 3FAWA 3AOFA 3CQIA 3ITCA 2WMFA 3U6WA 2OVLA 3WEMA 2GVEA 2Y2WA 2PUZA 3SY1A 1XCFA 2CZFA 4JTHA 3IRSA 4P7OA 5CJNA 3UD6A 3QHMA 4WIWA 2X1SA 4IISA 1O60A 3SCSA 3SR7A 3ITGA 1EP1A 1UR4A 3RITA 1AQHA 4DYKA 4G2DA 3CXOA 3UJFA 5F2GA 3NVTA 1OC7A 4I5RA 4EK7A 1RA5A 1JZ6A 1AMYA 1W32A 1IXPA 2PBOA 1PTDA 1TJ1A 3GFYA 3UJSA 4JY8A 1NOFA 3I3BA 2PU1A 5CZTA 2E68A 4HPNA 4IGNA 4J28A 3QY7A 1JPIA 3MSRA 3WH6A 5G2HA 2X1TA 3S5ZA 2B7PA 4PCTA 3B9NA 4H6QA 3RIKA 1S3TC 1Z9AA 3PTKA 4HMDA 4H83A 4PB5A 4GI8A 1W3TA 3SW6A 3S5SA 1OT2A 3LENA 1Z69A 3CV2A 1NEYA 2WMHA 3H6OA 4X63A 3CWNA 3PANA 1KRMA 1Q6OA 5FJJA 3W7CA 2OX4A 1GOMA 1W31A 4LAKA 2WSQA 3FLUA 3R10A 3TYZA 4C6DA 5G2WA 1W9XA 2A3BA 3ONBA 4TTGA 5I00A 5HWMA 1CECA 3PB2A 2NXGA 1EP3A 4O50A 4H9UA 4AXKA 3WQ4A 3TOPA 2IW0A 4O1DA 4TV5A 4WCJA 4CUCA 1WDWA 3N04A 4KFOA 4M6VA 3W2KA 2J27A 3VGGA 3AIQA 4PB3A 1H1NA 3BLEA 3EDEA 3NSMA 3WDPP 4G6CA 3M0KA 3NL6A 3TYEA 3EEGA 1G01A 2YKKA 3F2BA 4JYEA 4ZOEA 3MI3A 1JF6A 2QAPA 1SW0A 5A69A 3PZMA 4G56A 3F4NA 2Z2UA 3SJ3A 4PMQA 4RKAA 1NIUA 2O4QA 2FTPA 3AALA 4Q33A 1E55A 1WBHA 4MF4A 2YZ5A 1UWQA 2V30A 4UFKA 3I65A 3JU2A 1C8VA 4K1WA 3KDOA 3IVTA 4V1XA 4H7ZA 2ZVIA 3KS6A 1NVMA 3LHUA 2ZZ3A 2GDUA 3WMSA 3W4RA 1GT8A 2WSKA 4MWAB 3GKFA 4MB1A 4IIEA 2FTWA 3DFSA 2I57A 5I3FA 5DLCA 3QPEA 1YDYA 2FFIA 4TU1A 1ITQA 1KGWA 2PF8A 2XFWA 1FKXA 2GWGA 3LU2A 1ZBVA 1GHSA 3TZFA 1KXHA 3W6MA 2JGYA 3KCJA 4QCFA 3LHZA 1MDRA 3HB9A 1VCFA 2GK1B 4PUKA 2CXGA 4OTKA 1SPQA 1GZ1A 3TQVA 5JUVA 1TO3A 5A8MA 3O0KA 2ZZ2A 4ZO6A 4L9XA 1XR2A 3GBDA 2ZX5A 1DWAM 4B9YA 1DPMA 1X8FA 2ZZ7A 1MEHA 2DORA 3E0FA 3UNTA 2AL2B 2X1IA 3I6TA 5H8PA 3QW4B 2DSKA 1GW9A 1XBYA 4H41A 3PJWA 3VNLA 3P61A 4XO7A 4C6QA 3VAVA 2J7CA 4WJXA 1GQLA 2B7QA 3APYA 3SIZA 3O6DA 1Q63A 1UIOA 3MMDA 4FXJA 3CHEA 1W3NA 1XKYA 4BK9A 2QCEA 1Q45A 2XIMA 2WSYA 2ISWA 3MSDA 1IGWA 4ILSA 3NQ2A 2XVLA 2WBGA 1B2YA 1J6OA 2PTWA 2HRWA 1MXGA 2FGZA 4HP5A 1EJVC 1AL7A 3V18A 4HMNA 4QSFA 4ACZA 3QLLA 1RY0A 3HGRA 4IMFA 4HOXA 3VABA 3ATZA 1XC6A 1OF6A 4Z1BA 3V5OA 2F2KA 3PPGA 3KE0A 3WLKX 1IXQA 2FDSA 4CN1A 3WQWA 1OYBA 1NFGA 3BCFA 1UWUA 1Z44A 4KIEA 2KAUC 2Z1VA 5FSEC 2QCDA 4WKHA 3CH0A 2XN0A 4H8HA 3R58A 4DLMA 3EOEA 2DVTA 1OQFA 2G4JA 3OBKA 1K3UA 3QVQA 1TREA 2WM0A 3ARPA 4RDYA 3T09A 4E0CA 1PHWA 2GL5A 4MB4A 3ZT7A 2Y62A 2FH8A 4NVTA 2I5QA 3W2UA 5J04A 1EO7A 2EPOA 1AW2A 4X9SA 2FZBA 3CUJA 3UW6A 2BTMA 3LCGA 4LY8A 3NZRA 2A7NA 2V2DA 5I09A 4F40A 3KVKA 2NV9A 4F0RA 3GYCA 1XRTA 3HA1A 3KP1A 4I90A 1HO4A 1UD4A 4X2RA 1THFD 3NDYA 4PBGA 5KZMA 3AHVA 2F38A 5I7GA 1IXNA 3NQ8A 2BP1A 1G4SA 2PWEA 1ZFJA 4PUJA 3M44A 3COTA 1HKIA 4YYCA 4DZAA 1JD7A 2QVHA 4ALDA 2INFA 1SZGA 5B7ZA 2BOGX 2FZDA 4HMEA 1TTPA 3NEVA 4UR9A 2VC7A 3RPDA 5J5DA 4GH3A 3STGA 1WKFA 4IWWA 2B7OA 3SADA 2Z6IA 2B0MA 4F0KA 4QAWA 5I3KA 3C61A 3LCWA 2HXUA 2CETA 6REQA 1ZZMA 3OYXA 3C2VA 4LH8A 1SMAA 2QUTA 3MBFA 1VLWA 2EPKX 5D2YA 4XBJA 3T0DA 5E0CA 3M9YA 2C18A 2V8ZA 3TOYA 1SGJA 1GVRA 4LYKA 2WVVB 3HGSA 2I14A 4ZEPA 2OWXA 3WDRA 3LG3A 2GJXA 2Z7KA 3LPPA 3GHTA 4MUZA 3B9EA 2BWGA 4UOQA 3EOLA 4IZGA 4P8WA 3TTQA 2AQOA 3MP5A 3RM8A 3W26A 3H2CA 4MYXA 5KZEA 1XCXA 3TAKA 1H41A 3OPSA 2VX6A 3EB2A 3LQGA 3FXGA 4K8GA 5GPRA 2E67A 4LPCA 4N42A 1GQNA 5AC7A 4HK7A 4AF0A 2J88A 5TBOA 3AHZA 1OX4B 2CEQA 3TYCA 4CU6A 1X7FA 1SFLA 1G5AA 1UA7A 4F48A 1HL9A 3R2GA 2Z2AA 1XX1A 3M16A 3U5YA 1KBKA 2GUBA 5I02A 3TJIA 2D24A 3SCUA 3MHGA 3MKKA 1RV8A 1JCXA 1QO5A 1CIUA 4UTUA 3KBWA 2QVNA 3VE9A 1D8WA 1TTIA 3HJEA 5A8GA 3EPOA 4NILA 1EKOA 1GVSA 4W84A 3W07A 1O68A 5FF3A 2WK2A 2L5HA 3SCPA 1D8CA 3URBA 4YXGA 2FJUB 5C6MA 3LSBA 5K7JA 3BPWA 1D7KA 4Y90A 4H8NA 3LPFA 2GGEA 2O4MA 3B4YA 3RF9A 1XQLA 5C5YA 2IQ0A 3ZVIA 4UCGA 3PTQA 1JD9A 3S6DA 3APGA 3EWWA 2PDCA 4JD4A 4J35A 3VILA 4O1BA 4GIRA 1VFHA 1HVXA 5CPTA 2VHLA 4WSJA 4PMOA 4GJIA 3GTNA 1DJZA 1E0WA 4C5YA 4QJ4B 3WDHA 4LRTA 2HWGA 1J0YA 3AWNA 4BF9A 3UJ2A 3N12A 1O12A 3UY7A 1P0KA 1V02A 3CPRA 5I77A 2QV4A 3NUKA 1W3JA 3WUGA 1QW7A 5BWAA 4P7RA 1C92A 4H9YA 4GJ1A 4B5XA 1SZNA 3S46A 5HR6A 3GHRA 3M0LA 1LG2A 1FWHC 3UA3A 5XIAA 1YEYA 1TUXA 4KW2A 1DJWA 3LX9A 3MUCA 4FNQA 3ABRA 4EIVA 3P62A 1ESWA 3DN5A 2EGZA 3B8WA 3AWOA 4Q8VA 2ZX6A 4H1ZA 1DQUA 3W7QA 4QR6A 3WBYA 1WXZA 3W27A 2OXNA 1O94A 4IQDA 3RNDA 4RX0A 3LS9A 2WBKA 4EPDC 3N14A 5EYWA 4RJEA 4HT3A 2I9UA 4QLJA 3XINA 3E2SA 3TQPA 5B7YA 3RK8A 4L4OA 1H7NA 2WWCA 1C29A 1FWJC 3L12A 3HMCA 2YYTA 2ZRVA 4WOZA 5SWUA 2Z00A 1B3WA 5DMMA 4MKVA 4PR4A 2VZVA 4W7UA 1U5JA 3BUVA 5I78A 3Q4DA 2Q01A 5H8MA 2OSYA 4PE8A 3AZRA 4LAMA 4NT0A 2Q09A 2DZVA 1P43A 3O15A 4I3GA 1G4EA 1R5YA 1TFVA 4JFUA 3E96A 1NARA 4Q8MA 3UG8A 5AB3A 3I6RA 3MJMA 2QPXA 1J0HA 2Z29A 3MSYA 1H62A 3W84A 5EMMA 1Y7VA 5ABHA 5DF0A 3TONA 3DYPA 1RBOB 1KO0A 1IR1A 2X1UA 3QN3A 2GUYA 3RU8X 4GXWA 3S0CA 3W53A 3N6QA 2V3EA 1QNPA 4S23A 4RV3A 3M43A 1YHTA 1E9LA 1VEOA 1BFNA 2G41A 1OADA 1G7VA 1EWDA 2CYGA 4W7VA 3EX1A 3FA4A 1D3HA 3Q37A 1J2WA 1JYNA 2OWWA 2ZVRA 3O07A 4EACA 1QPQA 4ZCWA 3OU8A 1S5WA 2DIJA 2JQXA 3RXZA 1HGWA 4AZBA 2W27A 4JX4A 5A6AA 4N02A 3EEZA 1Z48A 3ZSTA 1XLFA 1VJIA 4YVXA 5I3HA 3ALGA 4ZQRA 1KR1A 3BAKA 3BARA 3CQJA 3GDKA 4AYGA 1J2BA 3V5CA 1W1ZA 4LWWA 1WO2A 2ZTKA 4N9BA 2BXZA 1C8YA 3QY8A 5BOEA 4F0LA 3TYAA 1H60A 5G1MA 3NM1A 4XG1A 3DG3A 1PE1A 2DZPA 4XVEA 1DXFA 3T9PA 3HPZA 3W6YA 1OGGA 3VKKA 4DI9A 2OU4A 4U4MA 3VZZA 3GR8A 2PMQA 3D3AA 1R2SA 1S2TA 4FA3A 1KM4A 2F6KA 1VIWA 3WYZA 1H5VA 1AJZA 5U7SA 1B0IA 2CERA 3CB8A 2GK1A 2C79A 4MNKA 4CD7A 4REQB 3A3WA 3EKLA 3G22A 1YDNA 1YW1A 3T40A 2RUSA 3T2QA 3TAOA 1KR0A 2F84A 3UXIA 4RE4A 2XVPA 3NCOA 1UUOA 1B1YA 3G8EA 4DM1A 1OCBA 2ZXBA 1GCYA 3UZYA 3PZNA 3PS7A 4KKXA 1HJQA 1VH7A 4Z2GA 4OV9A 1B3ZA 2GGHA 4S3KA 4OU1A 4F0HA 3GH7A 4BI5A 2XSXA 2PTZA 2QUMA 4FNSA 4ICNA 4QFUA 2UY3A 2VC5A 3G6MA 3SRFA 1EH9A 3E9AA 5I6SA 4OJYA 1Y5VA 2Y0FA 4L4MA 4O0ZA 3ATYA 3NO5A 4Q7BA 1KXTA 7REQA 1OVDA 2VEMA 3UXLA 2WMKA 4JTUA 4BJHA 3AU6A 2ON3A 1RD5A 1XINA 2BZNA 3T08A 1ME7A 1JCLA 2VVSA 2WC7A 3ZFHA 4NZ5A 4AY8A 1Q4WA 2A3AA 1CPUA 3EDKA 3QKZA 2VZTA 3GIYA 4GVGA 4Q32A 5C9UA 1F9CA 4GI4A 1M7PA 4JL1A 3M46A 4C6OA 5AHFA 3E38A 1WAWA 2V5BA 1WZKA 4YNGA 4HNCA 2QPUA 2PRMA 4TMCA 2WWDA 4O17A 3PWGA 2XGZA 5A6LA 4BCEA 4O13A 1AW5A 2X2GA 1NDVA 1DHKA 3LY0A 2E0PA 3N9RA 4Z2KA 5B80A 1UMYA 3F4WA 1XV8A 5CLTA 3KVMA 3WDJA 3UFYA 2OQYA 4L1XA 3SFKA 1W54A 5AFDA 1JCNA 3RG6A 3DHDA 4D6JA 1VGAA 1EO5A 3RU6A 2A3LA 4XX6A 4JFVA 1NU5A 4GZJA 3ABOA 2BVDA 4IIFA 4YTTA 1KCZA 3MWCA 4RPQA 3I7RA 1QR7A 3KBMA 3VVGA 1WDSA 2RHGA 5EY5A 5FF2A 3V4BA 1MNZA 1X6NA 3DYOA 4M7TA 3H4XA 1WPCA 3RO6A 2VGFA 1FUYA 1W3KA 4O1FA 5AYYA 3QMRA 3NQAA 1SZRA 4IMGA 3WF2A 3DBNA 1MYRA 1GZJA 1H0IA 3PY2A 4WDWA 4Z1DA 1E0VA 3R0DA 1P6BA 5LZLA 2POTA 1QOQA 1R3RA 3P0XA 2Z1SA 4KGJA 1OX4A 1ZBCA 3N4FA 3QOMA 5GNXA 2WV8A 3UGVA 2CWXA 3S3GA 4BQ2A 1UD2A 2VEPA 3B9AA 4LAZA 7TAAA 3DFYA 5HINA 4V33A 1V6YA 2CFFA 3SGGA 1XD0A 3ZVHB 3TTYA 3UPWA 3QXBA 5DMNA 4L61A 4FF5A 2WZMA 6TIMA 1LCOA 1MWOA 3OJGA 3GS6A 1REQA 3U8GA 4FXFA 2EJAA 7A3HA 4D2JA 4MMWA 2XIQA 1UWAA 5DT5A 3CL7A 1K03A 3WH8A 3I7SA 1R85A 1ZBKA 4C91A 1S1RA 3O9NA 1Q7ZA 4E38A 1R2TA 2PGFA 4CQAA 2E4TA 5L9FA 5JBDA 4AWTA 4OFCA 3VX0A 4JX5A 4XK2A 4GX8A 3PPHA 1J5TA 2Z26A 1TJ0A 4J3TA 4YTRA 2ACSA 1H7OA 3M6YA 1OHLA 2VUNA 5BMXA 2ACRA 2ASHA 3U4AA 4O11A 3QQ1A 1GJPA 2XVGA 2QUVA 3JUGA 2V2CA 1PB0A 3W2NA 4AZIA 4QAIA 4LUTA 1BHGA 3Q45A 4G1KA 5H91A 4A3HA 4BHYA 2NQ5A 2V9DA 3LERA 1XGZA 1YRRA 5HDRA 2GJNA 3HPFA 4QJ1A 1OGSA 4KMQA 1DJIA 1XD1A 3WJZA 4UR7A 5CC7A 3WLIA 4PMVA 4DWSD 2EPMX 6TAAA 3ITVA 4C6KA 1DJQA 4GNJA 1Q2RA 3L4VA 3W24A 1N7KA 1WKDA 3WQ5A 4GLEA 3L2MA 3UZ5A 3VINA 2DVXA 4UMAA 3IJ6A 5G4EA 1DEDA 4GQGA 3INPA 2VFGA 3NAVA 4NXSA 2ZCGA 1U22A 4PULA 4GNVA 3GVGA 1LRQA 1ONWA 2CLFA 1BG4A 3NL3A 5ECVA 5AC5A 1VYRA 3VU2A 1H11A 2DV0A 2WKJA 4HVXA 1LROA 1HJWA 1W1YA 4CEXC 1ML1A 3L21A 4JOMA 2OG9A 4CKQA 3KS5A 1XRVA 3NZQA 5DRCA 3P0WA 1VEMA 2PDUA 5DN1A 2HS8A 1XYBA 5FJOA 4D8LA 3DIPA 1QAPA 3WENA 1AJ0A 5A6KA 4UR8A 1W56A 3MMUA 4U3CA 4LANA 2AMXA 3IS4A 3LLXA 4AZ6A 1YTDA 3ISIX 2Y61A 3N2BA 4LJ3A 1K7EA 4XB3A 1YNQA 3SCTA 3HBLA 4ZGYA 4GI6A 2EG7A 4LFYA 1J01A 3P93A 1PAMA 2JEQA 1LOLA 2QMJA 4JTCA 3REQB 1UR3M 2D2GA 1LWHA 1QBBA 3WZ0E 1GQJA 4AXNA 2Y7GA 2V3DA 3H53A 4XD5A 4NJGA 1QXLA 3QLDA 2VWSA 4QS5A 1ZJBA 2QJHA 5BCAA 4FR6A 1RUSA 1B57A 4UQDA 1E1CA 2QCCA 3ZSSA 4D6GA 1E9YB 1PKLA 4JZ5A 2G96A 3NDOA 1KLYA 3BMWA 1E43A 2FYMA 2VZSA 1WCGA 3W7GA 1R47A 1YBQB 1E1FA 3RAOA 3I4EA 1OM0A 5D02A 3MZ2A 1KFWA 1V0LA 1US3A 1CYGA 2P5NA 5HATA 1R3WA 2BSLA 1F4AA 2GQAA 1WQ5A 1NF7A 1XICA 3ABQA 3CB3A 1E5JA 1W3LA 4NI8A 3RX4A 4XBKA 4L7ZA 2CW6A 3A3XA 4JXCA 2DGAA 2P0OA 1V8EA 2E6AA 4JFWA 1OFDA 3WQCA 3BJTA 2D3NA 4GFSA 4KESA 1X6UA 4F2UA 3C2RA 3KM8A 2EG8A 1FWFC 3NPXA 1A5KC 4PFMA 4YWIA 4NNAA 1MEWA 2RJHA 2A6NA 4K2SA 1JPDX 1FX6A 1E6ZA 1XIFA 2EBNA 1DV7A 2O55A 4FF7A 3TROA 1WKEA 1A5UA 3GW0A 3OLEA 5CZSA 3L4WA 1KV5A 3KXQA 3NQ6A 3FX4A 1WBJA 3SAZA 1RJRA 3HTWA 4LS0A 3ZLFA 1XLCA 4JN7A 4R27A 2X0SA 4F0SA 2OZ3A 3UU0A 4DIAA 5D09A 1A0CA 1OABA 3SRDA 1QOPA 4P8UA 1HX0A 2FHBA 1XW8A 2D20A 3R8RA 1AD1A 1NJJA 5GNYA 4B5NA 1ELSA 3G1XA 1EHAA 2Y5EA 3KRUA 1OC6A 1DE5A 3SI9A 4LF1A 4ZOBA 1XFBA 3GFXA 3HG5A 2HMCA 5CSUA 5D2VA 4XQ6A 5FL1A 4TR9A 2YXGA 1JGMA 7ENLA 1EFZA 4UTMA 1JXJA 4F66A 1TWDA 3LI0A 4XUGA 1R87A 4HPXA 2Z1BA 3S1VA 4CVUA 1AJ2A 1OF8A 1KM5A 3A21A 5FJPA 2G5WA 1UMLA 2QDGA 1Q8JA 4HK6A 2RFGA 3KZSA 4JN6A 3Q94A 1LL7A 1EX1A 4EKJA 2DUZA 2ZC1A 3ENLA 3BAWA 4WHBA 3GBEA 4IMCA 4FB7A 3AHTA 4H7VA 1WAUA 3LEPA 3AMKA 2E09A 4P7LA 1J0ZA 3GZ3A 4EWJA 4KCUA 4B3KA 1KQZA 1BG9A 2W79A 1QNRA 3L0KA 3D47A 2WZIA 5FKYA 4RK8A 2WMGA 3E0VA 2OMAA 2DQXA 1M53A 1QI4A 2H3BA 4DF1A 3S42A 1EL3A 4JCMA 4JTQA 3FGCA 4V28A 1G4TA 4KWSA 4UFLA 2OLAA 3W22A 3CIWA 2AGTA 4R34A 3BH4A 3WLHA 3WK1A 4WK9A 1A50A 4E5TA 4Q4RA 2FH6A 4GPNA 2WCGA 2XWEA 1MZRA 2V69A 2CNCA 1HVQA 1NELA 2FVKA 2JE8A 3HMJG 6PTDA 3KFTA 4R85A 3WLRA 4BQ3A 1C3FA 2NX3A 1RBLA 3G1FA 1PYFA 3GTFA 1OT1A 1Q85A 1VC4A 4W5UA 3L67A 3BJSA 3N9SA 4Q22A 2RDXA 5IBXC 2X1RA 4NL1A 3VD9A 1A5BA 2PTDA 4K8EA 4FNRA 3P5ZA 4L80A 2BB0A 3VIHA 1JPHA 4WJ8A 5MHBA 1XDMA 4UQ9A 1AG1O 2GGJA 1PZ1A 4XAFA 2H9AA 4GQQA 2WNZA 4CN4A 1GOXA 3DENA 1XQKA 1W9UA 4HHLA 4C1LA 5FEWA 1MUWA 3VMNA 4Z2HA 1M7XA 2WVUA 3MHFA 3TUUA 1DIKA 3EB4A 4DXKA 5JIWA 3QC3A 2NSOA 3OHMB 1VIZA 3R4IA 4R9XA 1HL8A 5E0KA 3STFA 1Y8BA 4ATLA 1TWZA 4DQWA 2IQTA 3ARQA 1LL6A 1UZDA 2E77A 4IQLA 1RLDA 2DZWA 1NDYA 1KV8A 3A4AA 3HV9A 4DM2A 5LHFA 4PH6A 4MOZA 2MNRA 4ONVA 1QWKA 9RUBA 2ZUSA 4JYFA 3WD1A 2XH4A 1PV8A 3O63A 3IIXA 3PSVA 3DXIA 4AIUA 5A2BA 3W01A 7REQB 1TV3A 4LY4A 2JFEX 2A7PA 1HUVA 1ALDA 3M0JA 4HHMA 1S2WA 1YXCA 2WZHA 1EYEA 4BWLA 1UZHA 1XLKA 4HA4A 1JCJA 4MNJA 2NX1A 4Y96A 3G1YA 3WJSA 1IWPA 5FESA 4MDOA 4ZOCA 1B5TA 3B8UA 4N4PA 3W88A 1UB3A 4GACA 1Q13A 4N7QA 1H61A 2PDMA 4RW3A 1FQ0A 2ZOXA 4KH2A 1E3ZA 2DZXA 3IUHA 5AZ0A 2BGNE 1EC9A 2UY5A 5BRQA 3LBOA 3VOIA 1DIOA 3LB0A 4IUOA 4I8YA 3KLKA 1GVOA 3FFSA 1NQ6A 1UZ4A 5LIUX 1XBZA 1ITCA 4HMCA 3GU2A 1BWVA 2HCVA 2WJFA 3TJ4A 1C91A 1DTNA 1H63A 2IKGA 1F3TA 2OTDA 4PTDA 3CGTA 1ZP3A 3AIUA 1I6NA 2P53A 4HZ6A 2DZSA 4L6DA 1QDSA 3S2CA 1VPQA 2VR2A 1BYCA 1AODA 5E6ZA 3EMZA 5A6JA 3CMFA 4WXZA 3EOSA 4IT1A 3HU7A 4QSHA 2WKGA 3D6NA 1V0NA 1LM1A 1VLIA 3BV4A 5D2WA 3RYSA 4IQEA 3WQPA 3T0CA 3SIMA 3W7PA 5EMJA 4RXFA 1HKWA 3BAIA 3CIXA 3BWWA 3EA3A 3CZKA 1K7FA 3OQEA 4WDUA 1T8QA 4OUEA 1UOKA 2Z2BA 1MUCA 1O6IA 3T1GA 3FNDA 4DI8A 3FOKA 5T9BG 4V1YA 2HEJA 2AL1A 4MY9A 4NJJA 3GVQA 2P8BA 4A21A 3NZGA 5M17A 1OK6A 3GG8A 2Q3OA 4I5UA 1XBXA 2CHRA 2GQ3A 1XF0A 3HV8A 1EPVA 1ZJAA 2RKXA 1ZNNA 3OA3A 5IDZA 3TK7A 3A22A 4PRTA 1NQKA 2WHKA 1EGVA 4MGGA 3BLIA 1TZZA 3O6AA 1T40A 2C13A 1TPC1 1R8LA 4QITA 3TFCA 1DIDA 1XH2A 4QQ3A 3BW2A 4AZHA 1F3WA 4GYFA 4DJDC 1TV4A 3IJ9A 3OEXA 3ZT5A 4UOZA 3GNOA 3VPLA 1JGIA 3W75A 5BOOA 3IVSA 5BNKA 2FPTA 4MWAA 3WBWA 4YTSA 5BU9A 3C0QA 5E93A 2FHCA 1K4HA 5JBFA 4AEEA 1PKNA 4S3BA 4Q7NA 1SW3A 2EXOA 3VCNA 3PZQA 5I24A 1W5QA 2WC4A 2RAGA 3EBVA 4JNMA 5F4WA 4AC7C 1H7WA 2PF0A 1LBLA 2P8CA 1JZ4A 2AGKA 3EX3A 4NJHA 1GNXA 3TMQA 4HNLA 3QGKC 3NXLA 1LOQA 1HQTA 3PZOA 2FPYA 1NTHA 3UVIA 2VMFA 1IEIA 4PMYA 3CZ8A 2PZNA 5DANA 3EWUA 1DWGM 3MUY1 3K8LA 1OY0A 3IANA 4NXKA 1DXIA 3UCDA 2DPEA 4N9CA 1NWRA 5CGTA 3WLMA 3C0JA 5DY3A 4U28A 1R86A 4JGDA 3VA8A 1QI5A 1XH1A 4OGZA 3PFRA 4PUWA 1AH4A 1XM3A 1ZS2A 2VC6A 2JIWA 4U3AA 2VFIA 2E5DA 4U5IA 3EX4A 2P50A 3MSGA 1KFBA 1OFAA 2OSXA 3B04A 3PG8A 1S2UA 2YL5A 3LNPA 1JCYA 5E6YA 2NUYA 4C6FA 3CEPA 3R89A 1C9DA 3ZM8A 5HJYA 5BROA 3LHWA 2VJXA 4GE8A 4CU7A 4PEEA 3C86A 1U2YA 4EAYA 2QW5A 1OYAA 3EYPA 3QFEA 4FX7A 3W0KA 1OYCA 1CXHA 3LPGA 4B5SA 1FDJA 1AQFA 2YIHA 3GC2A 5C7HA 3G3MA 3UXDA 3CPUA 1F6KA 3GLCA 1CNVA 3C3NA 2QIWA 3MCOA 3IK2A 3GU9A 2A3CA 1QHPA 3O6YX 1YMYA 5C9WA 1UBPC 5DQPA 3FVDA 4C65A 5I5RA 5CPLA 3RPMA 2DY3A 3CL6A 5FEPA 4UFMA 1PCKA 1ZB5A 1ZAIA 3LCXA 1ZAJA 3B97A 3DI1A 1Y0EA 4DO7A 3FHAA 3NQFA 1S38A 4UTLA 3WD0A 2GOKA 3J7HA 1WZAA 3V3WA 3W83A 4MKSA 1JR1A 1XDLA 2XIBA 1OIFA 1NM9A 4NI3A 4JFTA 3RM9A 3MPGA 2Z4GA 4HNVA 3JZUA 5C2XA 4Q8OA 4R7JA 4LV9A 3VNKA 4O14A 2Y88A 1CLVA 2PRLA 4LT9A 4W7WA 2I5GA 5REQA 1U33A 4ZBCA 8XIAA 7TIMA 4TQTA 1EDQA 1BQCA 3A23A 5IOBA 1HIZA 4ZMGA 5TD4A 3WELA 1HJSA 4IXXA 3ARZA 5ABFA 2J8TA 1DORA 4OWGA 3W7DA 1X96A 1VQTA 1O5KA 4PTXA 1KFJA