1H5VA

Thiopentasaccharide complex of the endoglucanase cel5a from bacillus agaradharens at 1.1 a resolution in the tetragonal crystal form
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
301
structure length
301
Chain Sequence
b'SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRESA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 5A
publication title Atomic Resolution Structure of Endoglucanase Cel5A in Complex with Methyl 4,4II,4III,4Iv-Tetrathio-Alpha-Cellopentoside Highlights the Alternative Binding Modes Targeted by Substrate Mimics
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 123
structure length 301
sequence length 301
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1h5vA00
3FW6A 1TMQA 2VC9A 1VBUA 1I1XA 4X0VA 1E4MM 2NW0A 3WFZA 4CCDA 5I79A 1V3KA 3W26A 4V28A 1UWRA 1GONA 5DFAA 2WMHA 3TTOA 1PIFA 2G3NA 3VVGA 3WF2A 2QV4A 1NH6A 4GQQA 4URIA 1U33A 4L4OA 2WC7A 1JAEA 1HN1A 1MQRA 4TXEA 1EO7A 4HZ6A 1JZ6A 1QW9A 3AIBA 1HJXA 3GM8A 3WEOA 4HA3A 4U5KA 2WMFA 1TVNA 4BQ2A 3WDHA 3MUIA 2D0HA 5C71A 5BXRA 5HDRA 1UR2A 5GNZA 2V3FA 1E72M 3A4WA 1DWIM 2QPUA 3SURA 3ZIZA 4UFJA 1XH1A 1W1TA 3EMCA 1RP8A 2J7GA 4MPKA 3RPMA 1E6SM 3SCQA 2YDQA 4PMDA 2D24A 1HNYA 4X9YA 1QVBA 2PI6A 2DSZA 2W91A 2DH3A 1FOBA 1MW2A 1WZLA 4H8HA 1NQ6A 2D2OA 3WNNA 3ZOAA 4AZBA 3TTSA 5KEZA 2OYMA 3GTNA 5AYBA 3VD7A 1UKTA 1HKMA 4IUGA 1PX4A 2WMIA 1XH2A 3A3HA 1XD1A 4K68A 1IZJA 5KZ6A 4PMQA 1EDQA 1K9TA 1DWGM 1CBGA 4HU8A 3AOFA 3ARYA 1QBAA 2EBNA 3RJYA 4ATLA 3THDA 1GQJA 1JI1A 1HP5A 2W92A 4J3TA 1R7OA 2Y4SA 4PMRA 1DWHM 1JFXA 4ZENA 5A6BD 1CLXA 4QLJA 4S3KA 2GFTA 4FLRA 2YBUA 4JAWA 1IV8A 2WCGA 4RE2A 3CHCA 1W9PA 2ZUVA 4C7FA 1W9DM 2X09A 1GW1A 1CGWA 3AHZA 2VX6A 3T2QA 3ZT5A 1J0JA 3WDQA 1ODZA 3VD4A 1VJSA 2WZHA 3HMCA 3THCA 2BNJA 1OINA 4HA1A 4GZEA 3I3BA 3T2OA 3GH5A 2BS9A 1OB0A 2BXYA 2CNCA 3PBGA 4LYQA 1QI5A 3WDIA 5A2AA 5I78A 2G8ZA 1NWUA 3N17A 4JHZA 3AMDA 4AZ6A 1Q6FA 1E40A 3NDZA 1ZJBA 3HJEA 4H8VA 2W66A 2JFEX 4J3XA 4E8CA 3WNLA 1W2VA 3POCA 3ZM8A 3AHTA 3WD0A 7A3HA 5I0DA 3ZMRA 4Z2JA 1H41A 1NOWA 3MUY1 4H04A 4MNMA 1J01A 5DT5A 4NRRA 2ZWYA 4TX6A 4P8VA 4UOJA 1JZ8A 4UQEA 4Y7EA 1OIMA 1EHAA 1GQLA 2CKRA 2VQTA 3UR7A 2Z1SA 2CIPA 4E2OA 3WUEA 1J18A 4JKKA 3N1AA 2D0FA 2ZICA 5C70A 3FHAA 5F7UA 4W93A 4Q22A 2E9BA 4GQRA 3ZT7A 5A6JA 1HJVA 4W85A 4TX8A 3OG2A 2WXDM 3W29A 1M04A 3WDRA 5D9OA 2DSVA 4LX4A 4IISA 3W82A 1W3LA 3WQ5A 4W8BA 1EXPA 2GK1A 1Z32X 3AMKA 3AIEA 2VZSA 2YL8A 1E73M 2WK2A 1E71M 1OGSA 1VEOA 4MB1A 2NSXA 1B31A 3W53A 3SCSA 3ZR5A 2BVTA 3AFBA 3WH7A 2WPGA 4H41A 3K4DA 2UWFA 2HVMA 3WNKA 3EMZA 3U7VA 2XYLA 3HU7A 4AD3A 3VIPA 1B3XA 3UETA 3W24A 1DWJM 4PBGA 1MQQA 3VM7A 3MV11 2WC3A 1QHPA 3N13A 5FL0A 1WZAA 2J7FA 5EMYA 2WHJA 1CECA 1WB0A 2WKGA 4PRWA 2A3BA 2JIEA 1WE5A 4U2ZA 3VDCA 2WWCA 1BVZA 3SCNA 3LPGA 2WZIA 2E8YA 4BS0A 1UH4A 1XSIA 4ZE4A 4GZIA 5I77A 1BHGA 1E5NA 3UG5A 1CIUA 1V0LA 2ZX7A 1H09A 3CBWA 3FNDA 3WNOA 3G6MA 1WZMA 1UD5A 5EBAA 4WF7A 4BA0A 3EMQA 5GNXA 2D3NA 1MYRA 2ZX8A 2VQUA 2IUZA 3IANA 2CHOA 3GH4A 1BVNP 1VEPA 3VTRA 4EE9A 3OB8A 4H7VA 1I75A 1KFWA 3CZLA 2V3EA 3BLPX 4AEFA 4W8LA 3IJ9A 1BQCA 2BVYA 1KGWA 2V5CA 1ZL1A 3GYCA 3VPLA 2GDUA 2VR4A 2CBJA 2Q8XA 2JF7A 2ZXAA 1HJWA 4B3LA 3AZTA 1FFRA 4BCEA 5FD0A 1E6PA 1UWSA 1JDCA 4W7VA 1LL6A 3EDJA 1E4LA 1ESWA 2WMIB 1WDRA 5IHRA 4J3UA 5FOOA 1V6UA 3APGA 4D6JA 4YN5A 4M24A 1V03A 3ALFA 4DM2A 1V02E 4IM4A 2VZVA 1CXFA 1UR4A 5HBFA 1OD0A 5DO8A 4HMCA 3UCQA 3WD3A 1QW8A 4MNKA 2VMFA 1GVYA 2YOCA 1LLOA 2PF0A 2WMJA 2ESCA 5BCAA 4TVCA 3AXXA 1UKPA 1LG1A 3W27A 4RL3A 3L2LA 3WNMA 5C8BB 3AIRA 1KWKA 3MU7A 1H0GA 2ZUSA 3DYPA 1E3XA 3WEMA 1AQ0A 2E9LA 4GXPA 4TTUA 2D23A 1CXKA 1A3HA 1KXQA 3NSXA 2Y24A 3RM8A 1LL4A 2VZOA 2WW5A 2WANA 1U30A 4GI6A 1WCGA 2X8RA 3VILA 2JE8A 1D3CA 4P8UA 4E8DA 4GO9A 2J47A 3L4WA 1BYCA 4F79A 3VGEA 1G5AA 2VX7A 4H8UA 2OWWA 1XD0A 3VD3A 1QHOA 2YJQA 4XUYA 1P6WA 1TA3A 3FXYA 2J8FA 1NWRA 3U57A 1PEZA 4P8XA 4D1JA 3CZEA 3L4YA 4AZCA 1G9HA 2VZTA 5M3WA 3IJ7A 3WMBA 2C8NA 3EDEA 1LF1A 1J0YA 1VIWA 3AIVA 2XPKA 4U31A 2YIHA 2WKLA 4U5IA 3WD2A 1FHDA 2D0GA 4PCTA 4FLQA 1YQ2A 4QDMA 3SUUA 1GNXA 1NARA 2PWEA 1VFOA 3DYMA 1OT1A 5TD4A 3SCVA 2XVGA 1HT6A 5JBDA 3BSHA 3MUAA 4PTMA 2CESA 2ZUWA 3CZJA 3AICA 2WVVA 2GK1B 4M56A 3VD9A 4QLKA 3BAXA 4JZ5A 1B3ZA 3CLWA 4MNJA 1K6AA 1JFHA 4MB3A 2EQDA 3AXIA 3AXHA 3NIYA 5LA0A 1GZJA 1K9FA 2XUCA 2OSYA 3WBEA 2FGZA 2GVYA 3MSDA 3WMCA 1G94A 1J11A 4XZWA 3BCDA 3W28A 3L4TA 2G3MA 1UD8A 3OZOA 2WVUA 3CH9A 1DP0A 4LXFA 3MO4A 1V6WA 1QBBA 1ECEA 3EDFA 3L4ZA 3UESA 3WN6A 1V0MA 4PTVA 5A8MA 4CGTA 3ZJ7A 4B9YA 4FF5A 4OBSA 2PBGA 1V6YA 1UZ4A 1E6QM 1KXTA 3NCOA 3N11A 4JL2A 5E6ZA 1VFFA 2B31A 3KWXA 1KB3A 4UQCA 1XCXA 2X0YA 1SMDA 1GPFA 2XTKA 1BSIA 5CLTA 3PTQA 1KGXA 1U2YA 3K4AA 1FHLA 1JDDA 4HTYA 2X1IA 2PWFA 4D6FA 2D3LA 2VVNA 2EJ1A 1MQPA 4WJXA 3W38A 3BAKA 3B9DA 3U5UA 3WFLA 2QMKA 1GOOA 1E70M 1UWQA 2F8QA 2EPOA 3I3DA 1HJSA 2XVLA 3CMJA 5AC4A 2DIJA 2EPKX 2J74A 2XM1A 2QF8A 4CU8A 4OKDA 4HMDA 2FGLA 3GNRA 3K8LA 2J7EA 2PBOA 2CBUA 3OZPA 5A69A 5AYIA 4YHEA 5IXEA 4C7GA 3RMEA 2E9MA 2VUYA 4D6CA 1TVPA 2V3GA 3GXMA 3VIFA 5BRQA 2O9PA 1AQHA 2C0HA 2V5DA 3S2CA 1XHGA 1PZ3A 4ATDA 1G01A 5A94A 5ABEA 2FHCA 2OLHA 3KL5A 4YHGA 3AMLA 3MUZ1 3UG4A 1UOKA 4W5ZA 1NP2A 4GI8A 1VF8A 3QGVA 2W62A 1O6IA 1C7SA 3SEPA 5HPCA 2WSPA 3OIHA 4JKMA 1HIZA 4WKHA 1PBGA 1PPIA 2PB1A 3KL3A 1KCKA 2ZIDA 1V6XA 4D6IA 4F66A 2FH6A 3ZJKA 3ARTA 1V3IA 5CPSA 3ZSSA 4MB4A 3W4RA 2F61A 4UZUA 3IAQA 4PEEA 4D6DA 3TA9A 3A4XA 3ZQ9A 1TUXA 2X0HA 5CLWA 3RM4A 4AZ5A 3BAYA 5LA1A 4TUFA 3LPOA 2J75A 3ARVA 4FLOA 5I5RA 3FAXA 3CGTA 5M03A 2WB5A 3ARZA 2ZOXA 1J10A 1Q6CA 1V0KA 3UEQA 4D6GA 5HXMA 1E0VA 3ZR6A 4R27A 2E3ZA 3N18A 3WQVA 4N42A 3AYRA 4PMOA 1R8LA 2D22A 2CPUA 1CEOA 1UKSA 1KBKA 3GH7A 3QHOA 4U2YA 3WQ8A 5BYWA 1FA2A 2EPLX 1VB9A 4KRTA 1BGGA 3CPUA 3MMDA 4AEEA 3VIHA 2WZEA 3WBAA 3GXFA 1RD6A 5A2CA 3FY1A 4JCLA 1CNVA 1JZ3A 4W88A 1TA3B 2J8GA 2DQXA 1SR0A 1BGAA 1ZBWA 4ACZA 3UR8A 1JF5A 3M6DA 1KCLA 1NOFA 4AZCB 5CPTA 1UKQA 2DT0A 2EO7A 4PTWA 1XCWA 2OSWA 3PZMA 5FCZA 2PWGA 3OLGA 1EO5A 3RCNA 2WC4A 1GHSA 1E4IA 2UY2A 1FFQA 2C7FA 1H5VA 2OWCA 4JFUA 4CVWA 4PN2A 2BHZA 3FHQA 1H1NA 3OGVA 1BYAA 3PZGA 3SUWA 2BFGA 3TP4A 2CERA 1C90A 1JIBA 5LA2A 5E70A 3ZT6A 1PIGA 5JIPA 1BLIA 3M46A 3WSUA 2BXZA 1HJQA 3EDKA 1BG4A 3MKKA 1JDAA 1E56A 3OBAA 3GBEA 4Z2HA 1WAWA 4M1RA 2A3EA 1UD2A 3NUKA 2WVVB 2YKKA 2WBKA 1NWSA 1DTUA 4AW7A 3ARRA 4JFVA 2YA0A 1IT0A 1PZ2A 3ARQA 1R86A 1WNOA 2J7CA 1J0IA 1B3WA 1OBAA 3ZO9A 2YDSA 1WKYA 2TAAA 1UH3A 2D1ZA 1R87A 4OOZA 3VMOA 4CN6A 3WY1A 2XJ7A 4MAVA 5EFFA 1C92A 1TCMA 2WM0A 1HVQA 5CXPA 3GNOA 3K46A 3W6LA 2JIWA 3NYDA 4UFKA 3U5YA 4PMZA 1W9BM 1KXHA 3PZTA 2PWDA 1GOKA 3GDBA 1JZ2A 3O9NA 1J0HA 1E55A 3PTMA 3KE0A 3AS0A 1G0CA 1MVYA 4GIAA 3IAPA 1J12A 1QNSA 4M81A 2XVKA 2J77A 1CTNA 1QI0A 3E1F1 1UWIA 3GXDA 3AYSA 4WKAA 2J62A 4CD8A 4GI9A 4BQ4A 3VD5A 3MANA 1NWTA 2WLYA 4PSRA 4Z2GA 4P7RA 7CGTA 4KWUA 3G6LA 4IPLA 1R85A 1CXLA 4NRSA 1H4PA 3IK2A 5EB8A 3CIVA 1MW0A 1GQIA 2CYGA 8CGTA 1EQCA 4PYSA 3BMVA 3PHAA 3SCTA 2D20A 4U3CA 4DM1A 2UY3A 4TVDA 1E6RA 3VGFA 1ZU8A 4EAMA 3RO8A 1BF2A 4Q7NA 5JBFA 2WVTA 4XV0A 3SIMA 1UA3A 3T0AA 3CUJA 3QR3A 1CWYA 1VBRA 5A3HA 1M03A 1OIFA 1CZ1A 4JCMA 5I2UA 1W32A 1W2PA 1CGUA 2QMJA 1UYQA 3PZIA 5CPQA 4AIUA 3CMGA 4Z2LA 1A47A 3N15A 1CXIA 2J7BA 1ZB5A 2FH8A 5E0FA 4HOXA 1SYTA 3B8SA 4XB3A 3NDYA 4AY1A 1Q6EA 1TE1A 1HL8A 2ZUNA 2WWDA 1MXGA 1ZBKA 2VX5A 1BPLB 4GKLA 1CENA 1V08A 3FAWA 5E6YA 3II1A 1CPUA 2UY5A 1SMAA 1C8XA 5DEZA 4RE3A 2JEQA 4QAWA 1UQZA 1EQPA 1K9EA 3MS8A 2AOSA 4J27A 3RM9A 1AMYA 3W81A 3VMNA 1J9YA 2XIIA 1MW1A 3WNPA 1E5JA 4CD7A 1WDSA 4GPNA 3K1DA 1RP9A 3WKZA 4OIFA 1PX3A 1W9XA 4L4PA 4M80A 1H0IA 3WEZA 1GQKA 2O92A 4MB5A 1NM9A 3CHFA 1KR1A 2WVSA 4WSKA 1MWOA 2XWDA 1JNDA 5CSYA 1WO2A 4A3YA 3RJXA 1UHVA 3CZ8A 1D7FA 1DWAM 3OA5A 3BGAA 3AJ7A 1F4HA 2GJXA 3MMUA 1Q6GA 2DSKA 3BMWA 3VO0A 1E3ZA 4UOZA 1BYDA 1GOMA 1KGUA 4ACZB 1W3HA 3N04A 3IJ8A 4GINA 7TAAA 1BYBA 1VFUA 1FH8A 5CZKA 4ZE5A 4CU6A 2J79A 1CDGA 2GDVA 4AD0A 2A3HA 1E0WA 3VMPA 4NF7A 2W63A 3ARUA 4D6HA 2F2HA 3AIQA 2JF6A 3T0DA 3VIIA 3AS2A 1W1VA 2NT0A 1M01A 3S6TA 3CHDA 3CUGA 4AYSA 5A8PA 2BY0A 4CCCA 4NSBA 4QCEA 4WKFA 1JNEA 2CEQA 4DUVA 4U33A 2CBIA 3AIUA 1ISYA 4EANA 3F5KA 4AIEA 3WL0A 2PC8A 3WL1A 1EIBA 2CKSA 3POHA 2VZUA 5LYRA 4JFWA 3OGRA 1E6NA 1K9DA 1KBBA 3VDHA 4AD5A 2YLAA 4R5EA 3CUHA 5D8WA 4CVUA 2DIEA 3BH4A 4FMVA 1E1EA 3KL0A 2WSKA 1TFVA 1B9ZA 2EEXA 3K8MA 3AI0A 3F5JA 2YL6A 4GO8A 1ZBVA 4BQ3A 1ZBCA 1UR9A 5E0CA 2WNWA 5HNNA 3WQ6A 4W89A 5A6MA 2WMGA 1NP0A 2WHKA 1H49A 2E4TA 4MJ2A 2WHLA 4A4AA 2FHBA 2ZUUA 3O2LA 3PZ9A 1J0KA 4PMYA 4DUWA 2BY1A 4J3VA 5IDIA 2PWHA 4UOQA 1W1YA 4AXNA 2VL4A 1QOXA 5A6SA 3T0BA 1UD4A 4UZSA 5BXTA 8A3HA 5ABHA 2DT2A 5BXPA 5BXSA 1OT2A 2VOTA 1HX0A 3VOCA 1M7XA 1BFNA 2NT1A 1W3JA 1ZS2A 1ODUA 1GJUA 4FLSA 4AC1X 2ZXDA 3SCUA 2RGLA 1VJZA 1JD9A 6CGTA 2XHYA 2VTFA 3LMYA 3WD1A 3WUFA 4AD2A 1E6ZA 4OBRA 2XFRA 1C91A 1CGVA 1DEDA 1W3KA 3MV01 3BAIA 1W9UA 2VX4A 3PZQA 4WLCA 1AQMA 4WSJA 4XX6A 3PZOA 4F9DA 1JGIA 3D5HA 2ZXBA 1C7TA 1XSKA 2Z1KA 4ZFMA 3BSGA 1UQYA 4CD5A 6A3HA 1B0IA 1OD8A 1GJWA 3ZJ6A 2WLZA 3VDAA 2A3CA 1PAMA 3W25A 4W7WA 1MXDA 4AMCA 3AS3A 3WF4A 2OYLA 3CZKA 2HISA 4AZGA 5A6AA 3T08A 1XGZA 1I1WA 2DEPA 3ARWA 4UNIA 2X05A 3EDDA 5E9AA 2DSWA 3VKKA 2EXOA 5IFTA 1V6VA 5JIWA 3PZVA 1QNPA 3WIJA 1JG9A 2WCSA 2XIBA 3D3AA 5I24A 1BG9A 3HN3A 4CN1A 1GOIA 1C8QA 4ML4A 2VRKA 3ZSTA 3WH9A 4LYPA 2CBVA 4MAZA 3W37A 1KR0A 2MANA 3NSNA 1HJUA 4W8AA 1ITCA 4OZOA 3BAJA 2XVNA 4OOUA 1JZ5A 1UR8A 1G1YA 5IHSA 3AMCA 2ZWZA 1B1YA 1EGZA 1UR0A 3VUPA 2DH2A 4UQ9A 1KXVA 3AHVA 1E4NA 2BY3A 1UR1A 5AY7A 1XRVA 1LG2A 2CXGA 2V38A 2JALA 2WMKA 3L4VA 4M29A 2XFFA 1WDPA 2A3AA 3OLDA 4JIEA 5D9NA 1QNOA 4H2CA 1BTCA 1UG6A 3L4XA 4CN4A 4N0RA 5I23A 2AAAA 4D6EA 3WF0A 2DPEA 2WBGA 4KMQA 3VX0A 5A2BA 4X0NA 4D72A 3VIKA 3WENA 5GPRA 4OJYA 2BVDA 3WMSA 4HU0A 1R7AA 4UR9A 2GJXB 4QLLA 3AMGA 4KH2A 1B3VA 1XYZA 4TVUA 4J28A 1HF6A 1EHNA 5IFPA 3AQUA 4S3JA 1UA7A 1AVAA 4JKLA 2W61A 1H11A 4CCEA 4UCFA 2VO5A 1E6XM 2OSXA 3SUTA 1GUVA 2VR5A 1EOKA 2EPNA 4JL1A 1KQYA 1V3HA 3CHEA 4DWSD 4HZ8A 4HA4A 3CUFA 5BWFA 3SUSA 3W0KA 2WCAA 3B9EA 1SFSA 5A95A 1JYVA 3AROA 1B30A 2XG9A 2BV9A 3VIGA 5A8OA 4PUEA 3AISA 4LPCA 4J3SA 1MFUA 2J4GA 1UWUA 2Y8KA 4C7DA 4JFTA 4XZBA 1S46A 4E4PA 4V27A 3LPFA 1HKJA 5FIPA 3GXIA 3T09A 3VIJA 1JXJA 2VVSA 4PUDA 4PSPA 3VX1A 3FN9A 4AIOA 1PX8A 2WAGA 5CGTA 1FH9A 3AHYA 2XWEA 6TAAA 1UZ1A 1GORA 4KRUA 1B2YA 4LQ1A 3GZAA 1US2A 3N9KA 1NOUA 2IXUA 1EH9A 2W67A 2OWXA 3CZGA 4UFHA 4AD1A 2XVPA 1Q6DA 3WDJA 3WF1A 1FP9A 1W9VA 2ZX5A 1ISZA 1LWHA 1OM0A 1HVXA 3RILA 1ISXA 3DHPA 5DMYA 1ISWA 3SCRA 3VDBA 3AHXA 4W7UA 3VGDA 3VU2A 4F8XA 2YL5A 2DT3A 4M8UA 5A8NA 1UD6A 1GCYA 4W84A 5ABFA 1OGGA 1WP6A 4MTVA 3UERA 1QPKA 3AS1A 1CXHA 2DT1A 1JYNA 3ECQA 1WPCA 2GJRA 4CD6A 4U3AA 2JEPA 1OCQA 3VNZA 1VENA 2CCRA 4JFSA 5D4YA 4A3HA 4UFLA 1C8YA 3PN8A 4HOZA 3ARPA 1WDQA 1QI3A 3GBDA 2VI0A 2V3DA 4NZCA 3W6MA 2VRQA 3WH8A 2YLLA 1JZ4A 1LL7A 3WUBA 3WF3A 3WELA 1JL8A 4DUXA 5A6KA 2ZX6A 3LPPA 5A6BA 3EBVA 1UUQA 9CGTA 3QOMA 4DWSA 4OUEA 4WIWA 4QFUA 2VCBA 4BQ5A 3F5LA 2X2YA 2O9TA 1E1FA 1GHRA 1B3YA 4P8WA 4PTXA 2YA2A 3ARXA 5CQ1A 3WDPP 4DWSC 1XV8A 5A6LA 1E15A 5CG0A 2FHFA 3VIOA 1TR1A 4CD4A 1GOQA 4P7OA 4Z2KA 5D8ZA 1EDGA 1CXEA 3A4AA 1C93A 1L8NA 2YL9A 3N12A 4QP0A 1N82A 2XSAA 4MJ4A 1EA9C 1HKIA 4AZIA 3OGSA 4D1IA 2DSUA 2J7HA 2ZUMA 2CITA 1JD7A 5D9PA 4ZEPA 1CYGA 5JUVA 2BY2A 1OSEA 1CGYA 4HMEA 4WK9A 2W5FA 3VIMA 1QNRA 1V3MA 5FKYA 1LJYA 2ZX9A 3BLKA 3WQWA 5I3DA 3VINA 2XGIA 4EKJA 5GNYA 1TG7A 1E0XA 1QI2A 1V02A 3VM5A 3L4UA 4P7LA 2WYSA 1J0ZA 1HKKA 1JXKA 3AZRA 3WUGA 3TONA 3BAWA 3A47A 1W91A 1HXJA 5M17A 2J25A 2VRJA 4LGXA 3I3EA 2Y2WA 1KQZA 5A1AA 3WQ4A 3CO4A 1EOMA 3ALGA 4B15A 1UWTA 2Y5EA 1V3LA 4ACYA 2QLYA 1B90A 3B9AA 1JF6A 2G3IA 1XSJA 2DGAA 5GQBA 3PTKA 4B16A 2EPMX 2VCCA 2XGBA 3BC9A 3VGGA 5DT7A 5CSUA 1X6LA 3TOPA 1CGTA 1OWQA 3DHUA 4HOWA 5DF0A 3RDKA 3AIWA 2XM2A 3QHNA 4BZYA 3TTYA 3GNPA 1QNQA 4Z2IA 4JHOA 1GOWA 1IZKA 3BXWA 4UQDA 5ABGA 1XYFA 2J7DA 1FH7A 1JAKA 2ZXQA 2VNCA 4EK7A 1UKOA 4AZ7A 3ZJ8A 1YHTA 3F4VA 2RGMA 4CU7A 4P7QA 2G3JA 2O9OA 3DYOA 2IXVA 5HPOA 2QHAA 4B9ZA 2GJPA 4AZHA 2Y8VA 3WH5A 2G41A 3QHMA 5HOSA 1V3JA 5I6SA 2VURA 1UH2A 3KZSA 1TZ7A 2ZUTA 4YPJA 2DDXA 1PJ9A 1CLVA 1X1NA 3NSMA 1Q4NX 4AD4A 4W87A 1RH9A 1JZ7A 1WZKA 4CUCA 5M5DA 3NJ3A 1D2KA 1DHKA 4FK9A 1W1PA 1H2JA 3KEHA 2ZE0A 3K8KA 1M53A 4J3WA 3BCFA 5ECUA 3ARSA 4CKQA 3QOKA 2W4XA 4MDPA 5CGMA 3MMWA 4GZJA 3DC0A 4B3KA 2VT0A 3J7HA 1CGXA 2XSBA 2E0PA 3M7SA 4PMNA 1GVIA 2XFYA 4MADA 4LYRA 3OLEA 3DECA 3RIKA 1LWJA 4BF7A 2QPSA 3OLIA 4IPNB 3MSGA 2WHMA 1ZJAA 2CHNA 3WD4A 3WH6A 4ATWA 2GUYA 1C3FA 2VJXA 2J78A 4UFMA 5ABFB 3T2PA 3UG3A 4HPHA 4UQAA 1XC6A 1E9LA 5CJ5A 5D9MA 4QCFA 1DWFM 5E09A 3SUVA 5FL1A 4PCSA 3A6OA 5JBEA 3AZSA 3M07A 1L0PA 1V0NA 4HPGA 1HP4A 2O9RA 4PMVA 2CETA 4ZXOA 4P7NA 2E40A 1FP8A 3U7BA 2E8ZA 2G4FA 2VCAA 4F9JA 1H3GA 3O6AA 4TTGA 4MDOA 4HZ7A 3VGBA 1LQ0A 1VAHA 2UY4A 4RE4A 1US3A 4D71A 4ZXLA 3VNYA 4TOQA 1BAGA 3CTTA 3TTQA 4PMXA 4DWSB 4V2XA 1HL9A 4UQBA 1XH0A 1ISVA 1ITXA 3SCWA 4PMUA 1EDTA 3CUIA 4J7RA 2YDRA 3L2MA 2OYKA 4AWEA 1QHZA 1VEMA 4W5UA 1E43A 2FDMA 4NI3A 1JI2A 4KGLA 5BROA 3PZUA 3JUGA 3EYPA 1MW3A 2BHYA 3SCPA 4AISA 3SCOA 5A8QA 3PZNA 4UTFA 1MFVA 2AMGA 4UFIA 2YA1A 1VRXA 5AC5A 1KWGA 2GSJA 1RPKA 1UD3A 4HP5A 4KGJA 2BHUA 5BRPA 1O7AA 1JYWA 2YBTA 1X6NA 1QI4A 4M82A 1JYXA 1F4AA 1VFMA 1Y7VA 4W86A 3VGHA 4MNLA 5EFDA 1OGBA
chains in the Genus database with same CATH superfamily
2CWNA 3ZR4A 1TMQA 3UG8A 4GI4A 3TWAA 4S3AA 2HQAA 4L6HA 2XN1A 4QNWA 4YMZA 1FCUA 1FUYA 1OK6A 2PZ0A 3T0CA 2G37A 4V28A 1UWRA 1PIFA 3P5YA 1L6GA 4MIMA 3WF2A 1RZMA 4GQQA 2NXHA 4L4OA 3WQDA 1R47A 3KHDA 3W00A 4TXEA 1XXXA 1OADA 3K30A 1HJXA 3P0XA 1W5NA 4DO6A 4GHRA 1FXQA 5H1WA 4BQ2A 1UPPA 4HPXA 3MUIA 2D0HA 3HTWA 2OLSA 5XIAA 1LCOA 5GNZA 2GUBA 7XIMA 2V3FA 1BXNA 1V51A 1SFTA 3W07A 1W1TA 1ENUA 1TREA 3IGHX 2YDQA 2D24A 3MHFA 4F4RA 1QO5A 2CLPA 1PTDA 4NAEA 3HJZA 1R5YA 3BICA 1K7EA 2G4JA 4DYEA 2OMAA 1RVGA 1S2CA 3AUJA 3H7VA 1F3EA 4H8HA 2D2OA 3ZOAA 3N2CA 1EEPA 5KEZA 1MI3A 1S3TC 4F0RA 5AC6A 2I9UA 4XZIA 2LLEA 2OYMA 2GWGA 5AYBA 3VD7A 3ZZ1A 1XH2A 1XD1A 5KZ6A 4LBRA 1DWGM 4LB4A 4B4HA 2A85A 1CBGA 3PBMA 1AFSA 2FZ8A 2EBNA 3A64A 4XKMA 2DUZA 1CLKA 3QR1A 1JI1A 2W92A 4J3TA 3LX9A 3R43A 4XZLX 1YX1A 3DFPA 1FWHC 4C6DA 4PMRA 1DWHM 1N8FA 4QLJA 3LDVA 2WCGA 4RE2A 1V7AA 2ZZ6A 3CHCA 4PUNA 1F3XA 4J40A 1JCNA 4OWGA 4XZHA 3ZLGA 5EKYA 3F2BA 3I3BA 5D32A 4JTUA 4K39A 3GH5A 4MLRA 4NXKA 1F74A 1OB0A 3LCLA 3BLOA 3WDIA 2IPGA 5U4NA 3IVUA 1A0EA 2QCNA 4O10A 3N17A 2YXOA 3AMDA 3PWAA 2QV5A 1Q6FA 5F2LA 4KWOA 4J3XA 4E8CA 1V5XA 3PB2A 2A7PA 3ZM8A 1KCXA 3N19B 3QZ6A 3ZMRA 3MP4A 2KZHA 3MSYA 4RXGA 2OPJA 1UUMA 3LQGA 3ZWTA 5D05A 5HWMA 1S38A 1SUXA 4RR4A 1EHAA 3GXNA 4DF2A 5B80A 1KTCA 3LK6A 1PCWA 5D2XA 4JKKA 1SR9A 1EF2A 3GR4A 2IS7A 2GVEA 4M7SA 4DZAA 4I5RA 1SFLA 2ZICA 2JKEA 4C6FA 4Q22A 4GQRA 3ZT7A 5A6JA 1SW0A 1GK8A 1SSGA 3WO8A 4JGDA 1LROA 4W85A 1TIMA 1XYBA 3OG2A 4DQWA 3FA3A 3WK2A 3K5XA 1XI3A 3ABZA 3WQ5A 3C8FA 3CIWA 4UXDA 4C1LA 5JQ9A 4NL1A 3IARA 3KVMA 4KEVA 2WK2A 1OFEA 4MB1A 5E9XA 1B31A 1XLMA 3S5SA 3ZR5A 2WPGA 4PUKA 3U7VA 2XYLA 4QE5A 1REQA 4JTEA 3VIPA 3L68A 1DWJM 2I5QA 2CLKA 1LP6A 4YNGA 2GVJA 1HQTA 4DZIA 3VM7A 3ITCA 3E9AA 6REQA 4OHQA 2NXGA 1WZAA 3SAZA 1FWNA 2VDGA 3P62A 2QCHA 4PRWA 1XLFA 1FXPA 3Q2DA 4MFDA 1WE5A 4Y6GA 4NUWA 2WWCA 1BVZA 2VWSA 4BS0A 3C3UA 2ICSA 1TZZA 5DMMA 4GZIA 5I77A 3VC6A 3UG5A 1CIUA 3WJZA 2CLHA 3NPUA 3G8RA 3WNOA 4LVDA 1WZMA 4QEEA 3STEA 3N6JA 1UD5A 1CB7B 2D3NA 5KZEA 2VQUA 2IUZA 3LXAA 3N9RA 5I02A 4GGHA 2GWNA 3OB8A 3AU2A 3TYDA 3UWUA 5D38A 1O5KA 2W3ZA 2V3EA 3BLPX 3FXGA 1TPWA 4KS0A 2BVYA 1R3RA 2PP1A 2VGGA 2V5CA 1FHUA 2CBJA 1XRTA 5CEWA 2J66A 3W7QA 1HJWA 4OECA 4UBPC 4AHPA 1HL2A 1FFRA 4IQEA 5CPLA 1FQ0A 4HNNA 2YW4A 1M7PA 3EWUA 3M5VA 1WDRA 4PEKA 4L1GA 1WOBA 3IK4A 4YN5A 4IQJA 5H8PA 3MHGA 1O66A 1UWAA 3PUDA 4R33A 5DO8A 5CBIA 3UCQA 4IP4A 3DFHA 2WSQA 1QW8A 1GVYA 1LLOA 5HMSA 2PF0A 2NQ5A 3T1GA 5BCAA 2VFFA 3U2EA 3DUGA 4RL3A 5SWUA 3LOTA 1T6MA 5LHEA 1DKWA 1FDZA 3MU7A 4HZMA 4RZ6A 2XSXA 1YW1A 4DYJA 3IIOA 1ZAIA 4RW5A 3WEMA 1AQ0A 4Q4QA 2GLKA 4GXPA 5D09A 3TSMA 2Y7DA 3INPA 4GCAA 4HYWA 3D47A 2C71A 4WY0F 1VYPX 2A4AA 4GI6A 4LUJA 3UR2A 1D3CA 1S5VA 1YDNA 2WNZA 3DG3A 1G67A 3HURA 3L0KA 5KETA 4WZHA 3R89A 2VX7A 4MYXA 1QHOA 2DORA 3UJ2A 1P6WA 1Q85A 1VCVA 3D46A 2J8FA 4FS9A 4D1JA 2ZZ1A 3BV7A 2OGJA 4H9YA 2VZTA 5M3WA 3EDEA 3PBVA 3AIVA 2PA6A 4U31A 3XISA 3NAVA 2WKLA 5CAKA 1FHDA 4PCTA 1XIJA 3ZVHA 1EUNA 1SJBA 1YQ2A 3UZXA 5AYYA 1ZAHA 2ZE3A 2DUAA 2ZDRA 3BLLA 3SUUA 4O19A 5TD4A 4FOUA 3BARA 3BSHA 4PTMA 4Q8NA 3WLKX 1E9IA 2ZUWA 4E2VA 1J4EA 2WVVA 4IGHA 4Y9AA 3QKZA 3Q37A 1S2VA 2FVKA 2WOQA 2FQIA 5EBUA 1SSDA 2E67A 2QZRA 1EWDA 1TV2A 4MB3A 3B8TA 3NIYA 2FPTA 2ADAA 2OSYA 5KZDA 3WBEA 2FGZA 3RUBL 4ENLA 2GVYA 4NX0A 1J11A 1XIFA 1PKYA 4K1GA 4GBUA 1F2JA 4ILSA 1RBOB 3OZOA 2WVUA 3MO4A 5AC8A 5EA9A 4LW7A 1ECEA 4KIEA 3WN6A 1V0MA 5A8MA 1AZ2A 1FHVA 3ZJ7A 1UCWA 1VFSA 1I2PA 2ZRXA 6XIMA 1UZ4A 2F6UA 4QTGA 2I56A 3VI2A 4IT1A 3H8AA 3GRIA 1M7JA 1XCXA 2NQZA 4Y2WA 2BSLA 1GPFA 4F3HA 1WOAA 1VS1A 3PTQA 1U2YA 5DQPA 3K4AA 1FHLA 1GEQA 1TKKA 2X1IA 1YRRA 2EKCA 3BTNA 3RX2A 2PRHA 3H54A 2R91A 5F4SA 2VVNA 3E6EA 1MQPA 4S3FA 3IEBA 4R3UA 1Q63A 4NP7A 1VHNA 2X1UA 3CK5A 4G1NA 3K8LA 3WJWA 2CBUA 1F6PA 5AYIA 5CJMA 3B0YA 1X96A 5I07A 3RMEA 2E9MA 3VKBA 4C60A 4TX9A 2V3GA 5LIYX 4RJEA 2V5DA 3KTCA 4HGXA 1XHGA 1PZ3A 1X7IA 1P0EA 1PHWA 2OLHA 2P5NA 2NLIA 3M5ZA 5AHNA 2W27A 4C6QA 3HB9A 3VXGA 3LRKA 4GUIA 1VF8A 3QGVA 1RSCA 1U1UA 3SEPA 1C7SA 3W1RA 2WSPA 3REQB 3EOSA 1PBGA 4KCUA 3ZS4A 4L61A 2PB1A 4BEUA 3W74A 2ZIDA 3LLDA 4F66A 3A3WA 4JX4A 3ZJKA 3ZSSA 4UR7A 1JCTA 4YTUA 4JTSA 2F61A 2WJEA 4PEEA 4DI8A 4FNPA 4D6DA 3N2OA 3TA9A 3S1XA 3QRHA 3MB9A 1BXBA 3RM4A 1SW7A 3GC4A 2ISSA 1SVDA 4S3GA 2G3FA 4FLOA 3GUGA 5CSRA 1J10A 1V0KA 3UEQA 5HXMA 3WQVA 4N42A 4GIRA 3AYRA 1BKHA 4L9YA 4KCTA 3T8LA 3MCOA 4U2YA 4GG9A 4BI6A 3GX9A 3M0YA 1DQWA 1AD1A 2OT1A 2EPHA 3GXFA 2F2KA 4JCLA 3KP1A 1LOSA 2DQXA 4F0SA 1FWRA 2HEJA 1JF5A 3IPWA 3M6DA 1KCLA 3SRHA 1UKQA 2DT0A 2WV8A 2OSWA 4FX6M 4JIQA 3OLGA 1EO5A 1XICA 4H4IA 4NG3A 1GHSA 1E4IA 1FFQA 3PTDA 2C7FA 3FSTA 4R85A 4PA8A 2WJZA 3N4EA 4U4MA 3NTYA 2OWCA 3ITTA 4ZQCA 2V5JA 3PZGA 3WK1A 4C1KA 3TP4A 4L5ZA 3KRUA 5E70A 1LUCB 3ZT6A 1IR1A 4GZ7A 4IF2A 4HKPA 3QV8A 3NOEA 4S3DA 2HPMA 2RDTA 5HNTA 4R7WA 5EMJA 1A3WA 4M1RA 4NVTA 5C9WA 5BZAA 3KCLA 2Y88A 3R8HA 4JX6A 1IT0A 1TQJA 1XISA 3ARQA 2J7CA 1B3WA 3IACA 1OFRA 2H3BA 3ZO9A 2YDSA 1F6KA 4XK2A 3TC7A 1UH3A 3GNDA 3BLFA 1AJZA 4Q4SA 3P81A 1VLWA 3TJLA 4D8ZA 3H53A 4IIHA 3VNJA 1GTHA 4WRHA 1MDLA 2X16A 1HVQA 3TFCA 2HNEA 2IPFA 3GNOA 3CIXA 3LNPA 4PMZA 1W9BM 3QVQA 4ZOCA 2UZ9A 3MTWA 2V5LA 3O9NA 4ZOAA 1J0HA 4GFIA 4J4KA 1RA5A 4GIAA 2A2IA 2HWGA 1QI0A 5CPNA 3GXDA 3RAOA 4IH3A 3BG3A 2J62A 4CD8A 4GI9A 3ITXA 2WLYA 3S5YA 2OO6A 4GYJA 4ORIA 4MWAE 3VE7A 4ZSUA 4INFA 1LOQA 1H4PA 3IK2A 4B5SA 3SN4A 4UCGA 1NVMA 3CIVA 3U4AA 1AK5A 4Z1YA 4IFRA 3E0IA 2E68A 4EXBA 4BJHA 3O6DA 2DZTA 1FWJC 4I9TA 3OJGA 5J5DA 4IPIA 4DXVA 2NX1A 2UY3A 3VGFA 1ICSA 2ZDSA 2RKXA 1AH3A 2QXWA 4Q7NA 2P3ZA 3SIMA 2YX0A 3CUJA 3LLFA 3NZQA 4JTLA 3QR3A 1EYEA 3HPSA 3V1PA 2DUXA 2Y7FA 4Q8TA 1TPDA 2PGFA 5AZ0A 1CGUA 4DF1A 4AIUA 2VHLA 2QDHA 4LB3A 4KCWA 4NKCA 1CXIA 3GTIA 4GRSA 3TWBA 1Z9AA 4XB3A 3NDYA 4AY1A 4QISA 1HL8A 1F76A 4DELA 1MXGA 1ZBKA 2FGBA 1CENA 3FAWA 1M6JA 3P82A 4AF0B 5DEZA 2QW5A 4RE3A 4QAWA 1EQPA 1K9EA 3SM0A 1LLWA 3GG8A 1MW1A 3O05A 4AX6A 1WDSA 3QTGA 5G1TA 1Q7ZA 2JGQA 1XFBA 2FMOA 3CWHA 1RP9A 5F4WA 1PX3A 4E8GA 4L4PA 1GQKA 2RUSA 2OOFA 4OGZA 2O92A 4QBXA 1WUFA 3CHFA 4WSKA 1T40A 1MWOA 5D33A 2XWDA 4G6CA 1CT5A 1JNDA 2QS8A 2XFWA 4UTLA 1WO2A 4P61A 4A3YA 1UHVA 5BOEA 3CWOX 2FFCA 3BGAA 3W1NA 5EMMA 4OV9A 3T8QA 3U0HA 2IQDA 3VO0A 1T5AA 3DFQA 3VZXA 1IHIA 3EOOA 4QR6A 1W3HA 3H2OA 3HGRA 2VEPA 4IICA 3VFCA 7TAAA 1BYBA 1VFUA 1FH8A 3HG2A 2Q6ZA 4CU6A 3KP0A 2A3HA 5E5CA 3BDKA 2VGIA 1JRCA 2W63A 3TQPA 4D6HA 3AIQA 2JF6A 3LCGA 3VIIA 2NT0A 3CUGA 4AYSA 2BY0A 4NSBA 4QCEA 4OE7A 1LT7A 2O7QA 4U33A 2BGNE 3CL6A 4EANA 3OOQA 4AIEA 4PR4A 3WL0A 1I2NA 5LZLA 3R6IA 2Z1XA 1LTDA 1RLDA 3OGRA 1K9DA 4N4PA 2PDKA 4R5EA 3NYZA 3BMXA 2VR2A 3MP5A 1KNWA 3QYSA 4JQAA 3P14A 3CNYA 1B9ZA 2R1MA 3SGZA 2KX9A 1X6UA 4JBRA 1GKQA 2V0TA 4C1NB 4UR8A 3U48A 4LY4A 1RQHA 4EVZA 2NX9A 4MJ2A 4O17A 1VR6A 4A4AA 1A5CA 4LUSB 4DUWA 2BY1A 1M7OA 1DE6A 3ITOA 4HU3A 1NEYA 5BXTA 4CQ9A 4Q3MA 1OT2A 1HX0A 3VOCA 1M7XA 2NT1A 5DXYA 5I03A 3V35A 3EWCA 4L4MA 4FLSA 5DRCA 1QFEA 3S9ZA 1RQBA 6REQB 2RGLA 5AOUA 1JD9A 6CGTA 1JCJA 1YTKA 1Q3NA 3EKZA 1YADA 2XFRA 2C1GA 1CGVA 1W3KA 3P8IA 1W5PA 5JH2A 3EWWA 3SBFA 4XX6A 2Z1WA 1XSKA 4ZFMA 2O4MA 3BSGA 4CD5A 1B0IA 3WJSA 1IXQA 4QS5A 1M9HA 4O0QA 4JPGA 1LT8A 4W7WA 3WX7A 4DYKA 2YCLA 4O54A 3CZKA 2HISA 1P0DA 2DEPA 5T8GA 4I9AA 2DSWA 3N2TA 2EXOA 1GVEA 1JG9A 1A3XA 8XIMA 3D3AA 4RDYA 4XISA 2XIJA 2Q8ZA 2CXEA 3HN3A 1OC6A 1TPC1 4E2DA 1GVQA 1QXLA 3WH9A 4EWND 3NZPA 4JNMA 1KR0A 3O0KA 2MANA 1HJUA 3UJRA 1ZHAA 4JXCA 3LMZA 1JR1A 5I3KA 1JZ5A 1JUKA 1G1YA 4AVNA 3S1UA 3CXOA 3WLLA 2ZWZA 2P76A 6XIAA 1UR0A 4UQ9A 4GISA 4US5D 1E51A 3E74A 5CJNA 3ELFA 2TYSA 1MNZA 1UJQA 1J79A 2PZNA 4QDWA 3WLHA 2WMKA 4M29A 2XFFA 2E5DA 1WKDA 1TPEA 1I2OA 1KD0A 1QNOA 2E28A 3NVDA 4JIHA 3NPXA 3DKLA 3WF0A 3HOJA 2DPEA 2WBGA 1PZ0A 5A2BA 4NXSA 3SRDA 4D72A 1RBAA 2GVLA 5HR6A 4XBJA 5GPRA 3WMSA 1X1OA 3KBSA 2QNEA 4JTHA 4J28A 5IFPA 1EHNA 1TPB1 1QJWA 4O4WA 3G0SA 1W1ZA 3GFXA 1IQ8A 5I3FA 3HO8A 3WLNA 5D2WA 4WHBA 4TIMA 2Y5JA 2Y89A 3L65A 2BOEX 5BWFA 1XLCA 3EWDA 1SFSA 4G56A 1B30A 2XG9A 2VDIA 2BV9A 3VIGA 4QGCA 5A8OA 5G1YA 3M1ZA 3GTHA 4J3SA 1RJQA 3JS3A 4LY8A 4LRTA 2DZSA 1S46A 4AWTA 5A8GA 3LPFA 2INFA 1G69A 3MW7A 3GXIA 1JXJA 3FS2A 1XCFA 1RV8A 1KTBA 1SJCA 1PX8A 2WAGA 2I57A 4FNRA 5CGTA 4H8NA 3WQOA 2XWEA 1XRFA 2PDQA 6TAAA 2Z0IA 4B5TA 1R3TA 1UZ1A 5CH9A 1B2YA 3QKEA 1EPXA 2A7NA 3N9KA 5FJRA 2IXUA 1EH9A 1F9CA 2W67A 2OWXA 1JGMA 2HS6A 3UZWA 3IIPA 2P1FA 2C0AA 5A5WA 4QQ3A 1HVXA 5HMDA 2ZZ5A 1ISWA 4W7UA 1X8CA 5A8NA 3KBJA 4W84A 4MFEA 1K77A 2XN2A 1IEIA 4HSHA 3UERA 4F2UA 1CXHA 1JYNA 1XF0A 1YNQA 4PFMA 2J6XA 4CD6A 2RDUA 3RHGA 3VNZA 2B7NA 1AW1A 4QG6A 3LERA 2V5BA 2OCZA 1C8YA 3W1XA 2HCVA 1MRAA 4PCPA 1Z48A 4NASA 1Q8JA 1QI3A 1R38A 8TIMA 2V67A 3RF9A 2A0NA 3M5XA 3WLTA 1Q6RA 1W6TA 2CLMA 1LL7A 1QOPA 3WF3A 2E09A 4S38A 1UUQA 9CGTA 2WZMA 4FSAA 3RU6A 4O1EA 2VCBA 4JNZA 4BQ5A 5D2YA 3M44A 1NTHA 1GW9A 1SJAA 4P8WA 4PTXA 5CQ1A 5CG0A 2FHFA 2C16A 2OZ8A 3VIOA 1GOQA 2X7WA 2DZBA 4LAZA 3TLLA 1CXEA 1P43A 3NVTA 4OVXA 1XYAA 1L8NA 2YL9A 3N12A 2I14A 2PE4A 3LI0A 3KLLA 2QJMA 4XO7A 5D9PA 2J24A 5JUVA 1XIIA 1Q6OA 1CGYA 1QW7A 4HMEA 4UC5A 2W5FA 2R1LA 1E0TA 4LUYA 2WJFA 2HE8A 1V3MA 1NU5A 2ZX9A 3FJLA 3WQFA 3H4XA 3IV3A 4FNQA 1PUDA 3P67A 2FZMA 5GNYA 1E0XA 3FIGA 1TPVA 1QWKA 2HTMA 3C56A 4XD6A 3AZRA 4KT2A 3TMQA 3P93A 3ISIX 1TV3A 3SFKA 2VRJA 1ONRA 1KV8A 4C6IA 2C91A 2HV5A 4O15A 4XKYB 3UF9A 4DJED 1EOMA 2DVXA 4B15A 1UWTA 3AWNA 2VFHA 3A5VA 2BOFX 3A3XA 3QFWA 1JF6A 1XSJA 1C9WA 5J04A 5GQBA 3PTKA 4B16A 4M19A 3UWWA 2VCCA 2OEMA 3G24A 1J5TA 4KEMA 5AFDA 5CSUA 1X6LA 3O1NA 4HB7A 4D2JA 5F2MA 4EOUA 3F4WA 1A5NC 1XLBA 3HIJA 1S2AA 3TTYA 4LAOA 4Z2IA 1IZKA 1FH7A 1JAKA 1QPRA 2VNCA 3SGGA 3F4VA 1WYIA 3QY6A 4C6LA 4A22A 4J5NA 3DYOA 3P80A 1YEYA 2ANUA 5HPOA 4WGHA 3QF0A 2QHAA 1T99A 5HNRA 1F3WA 4AZHA 3WH5A 2G41A 3KZSA 1KO0A 1YXDA 1PJ9A 1AH4A 4IIDA 1KLYA 1RH9A 3GS6A 1W0MA 3MWCA 5C7HA 3LBMA 3C2EA 3SQMA 5IRPA 1QO2A 4IOTA 4CEUC 1UUOA 2ZE0A 3IUIA 2WQDA 3K8KA 1M53A 4I7UA 4J3WA 5ECUA 4GFSA 2QYGA 3FJNA 3MUCA 2RJGA 3MMWA 3IRSA 4F2TA 3IJDA 4TV6A 1YBQA 4Q4RA 5FAJA 4C5YA 3KBVA 3WJYA 3DECA 1LWJA 1KV5A 2A5HA 3HQNA 4IPNB 1L6WA 3WD4A 1PXGA 4N2YA 5BMXA 3FGCA 5K2ZA 4GJIA 4UFMA 1R3SA 2A3LA 3LEPA 3T2PA 5CJ5A 2XH2A 3V0TA 4FXRA 2EF9A 5JBEA 4REQB 3AZSA 2HNHA 1FBAA 2E40A 3TK7A 1FP8A 3M0IA 3UT0A 3G2GA 1UIOA 4QSHA 4P2VA 2VCAA 4F9JA 2Y6ZA 2C6QA 2XZ9A 4HHMA 1TELA 5F1UA 1UC4A 4JNYA 3VGBA 4JY8A 1US3A 4ZXLA 5ECVA 4A3RA 1BAGA 1XYLA 4Q32A 1XDLA 1DJIA 4WSHA 1XH0A 3RLHA 3KBNA 7TIMA 2BP1A 1DPMA 2YDRA 2G50A 1MEWA 3EKGA 1O1HA 4KGLA 3URQA 1K6WA 4HK6A 1MW3A 3TQ0A 2FIQA 4AISA 1MFVA 2AMGA 2QDEA 1RPKA 4A8NA 1P4CA 1E0UA 2Y63A 1QI4A 4DN1A 4FF7A 4C6JA 1VFMA 1T96A 3EB3A 3GIPA 1JQVA 5EFDA 1OGBA 4KERA 5C9ZA 2E6DA 4UTJA 3O6CA 2QCMA 4QXIA 3S5ZA 4UNKA 3TW7A 4CCDA 2GSHA 1I9CB 3Q4DA 3WLMA 5T26A 3SRKA 2WMHA 5CPOA 4ZTXA 3ITLA 4IIEA 2ZVRA 3L0GA 2ATSA 4E0CA 1CCWB 1U33A 3DX5A 2WC7A 1JAEA 1EO7A 1XKYA 2ZA1A 3AIBA 1F7BA 5DLCA 5BOOA 1GWJA 2Q3OA 3B8DA 3QBUA 4U5KA 2WMFA 5B7ZA 2NWRA 5BXRA 1JCMP 5HDRA 1A5OC 2QDDA 3SR7A 1E72M 5DCDA 1DWIM 2QPUA 1R6WA 5DY3A 3GDLA 4UFJA 3LU2A 3EOLA 4ZQRA 4AB4A 3R11A 1H60A 4XIMA 1OZQA 1QVBA 3BLDA 3RXZA 2DH3A 3UWVA 1MW2A 3KOFA 4AZBA 5TF0A 3TH6A 3QFEA 1Q13A 1M5WA 1S5TA 2AGTA 5H8UA 3S83A 5AYZA 1UKTA 3VCCA 1HKMA 5AHFA 1PX4A 3A3HA 4RXFA 4PMQA 3PNZA 1RJRA 3AOFA 3TR2A 3ITVA 3WQGA 1J2WA 1GQJA 1XGEA 2O56A 3M6YA 4ZSTA 1HP5A 1M65A 2FB3A 1W5MA 2J9ZA 1JFXA 3LV6A 3PULA 4UMCA 4GUGA 2AQWA 2YBUA 1DHPA 4FALA 5LNUA 1FTXA 2ZUVA 3ATYA 3CL7A 1UMYA 3AHZA 1CGWA 3ZT5A 3CYVA 3VD4A 1RCXB 2GGIA 5REQA 1LQAA 3HMCA 2BNJA 3GY1A 4KQNA 3T2OA 1FWAC 4H01A 3QMTA 1V4YA 3PJTA 3UGRA 2CNCA 4LYQA 3QR0A 3E3HA 2PF8A 5FF2A 1BRLB 1JUEA 2G8ZA 3V1HA 3A12A 4JHZA 1AJ0A 1HFBA 3A13A 2G95A 3SDOA 2Q09A 3PJUA 1FWGC 3WNLA 3F2CA 1EP2A 7A3HA 4J2PA 3O8AA 3MZ2A 2Z6IA 1H41A 4CNNA 3MUY1 2IPJA 3RLVA 1B5TA 3JZEA 5DT5A 4WY0A 4P8VA 4DXKA 3XIMA 5GJPA 5H8MA 3GUWA 4UTWA 4E2OA 2FZ9A 4ZTYA 2D0FA 4EX4A 4YWSA 3H22A 5F7UA 5L9FA 2WNQA 4C65A 3VFLA 5CC5A 4JHMA 5L6UA 4MY8A 4B5NA 1PYMA 1HJVA 1JRBA 1UZHA 4IMDA 1FKXA 2DSVA 4JYFA 4ZCWA 1W56A 4MWAA 3ABXA 4IISA 3W82A 1W3LA 3O07A 2ODOA 5CPMA 4PUUA 1EXPA 2GK1A 3AMKA 2VZSA 2P50A 1KM2A 1O12A 1OGSA 3H24A 5ENLA 3HF3A 3SCSA 4Q4MA 2BVTA 3WH7A 4IJRA 4H41A 3UJSA 2ZZ3A 3UP8A 2A1YA 3BWWA 3AXKA 2ZTJA 3RGTA 2H8XA 4AD3A 1EJUC 4HNLA 1TMLA 3NZGA 2R6OA 1T8QA 1MQQA 4DZHA 2WC3A 2ONEA 2DZXA 1NDWA 2FYMA 2GGEA 2PPGA 5G5IA 4WGXA 3IJQA 2WHJA 3S5NA 4O18A 1WB0A 4OTKA 2EAWA 4G7EA 2V69A 2A3BA 2JIEA 1OFPA 4M51A 4IPJA 1D7KA 3SCNA 3RRXA 2QJIA 2WZIA 3W76A 4H9VA 2QPXA 3V4BA 1GG0A 2A79A 4ZE4A 5FF7A 4UTMA 3FV9A 3NWRA 3L0NA 7ODCA 1V0LA 3CQIA 2NQLA 1P7TB 3CBWA 3FNDA 4DHGA 3R10A 2Y8UA 4MJMA 4PCNA 1XLDA 1MYRA 4NZFA 2ZX8A 3EWYA 2OODA 1HUVA 2INZA 4LNYA 3GH4A 3KOWA 4EE9A 5IDZA 4H7VA 3KXQA 4AY7A 2P0IA 3BV4A 2NV2A 4W8LA 5F2IA 1BQCA 1QASA 4XWUA 4YXGA 1ZL1A 3NEVA 1PKLA 4Z08A 2ZXAA 3KCOA 3G77A 3AZTA 3RYSA 3R1ZA 1JEZA 3PK7A 1YDYA 3ZXWA 4BCEA 4IMGA 4O50A 1LL6A 1DJYA 1WA3A 1ESWA 2WMIB 5IHRA 2NWSA 1V6UA 1B4KA 3LHUA 4M24A 4EPDC 1V03A 4QEHA 1DXFA 3VNMA 4IM4A 2J9YA 1ME8A 4RLIA 3FYPA 3QQ0A 1UR4A 2RFGA 3WD3A 4PUMA 3NO5A 3COTA 2VMFA 2YOCA 5DELA 2CW6A 3QJAA 4TVCA 1LG1A 3C0JA 3GNNA 3W27A 4I6VA 1OCBA 3BG9A 3GQYA 2HSAA 3PSVA 1WKFA 3NXFA 4C5ZA 4MSSA 3W7LA 3PPFA 2R94A 4IFOA 2E5CA 2EHHA 2E9LA 2ZC1A 1VYRA 4TTUA 1SO6A 1A5UA 1KXQA 3HZ3A 3MSRA 5HJLA 2X41A 1WCGA 1XBXA 4QM1A 3VILA 1K03A 3RNDA 3GR7A 4GO9A 3E49A 4M6QA 3KZPA 3SY1A 3L4WA 1EIXA 1WDDA 4HSOA 4PE8A 4LC8A 3VGEA 3ONCA 2OWWA 4XUYA 2YJQA 4RW3A 4KWWA 1TA3A 1SZNA 3TYCA 2DQWA 4FA3A 1NWRA 3DCPA 3N4FA 4H1ZA 3L4YA 5HAOA 3PPCA 3IVSA 4LS1A 5AVHA 1ZCOA 3EPNA 3T4WA 3WMBA 5D02A 4LFYA 1LF1A 3GU1A 2MUCA 3W1TA 4B5UA 1J0YA 2I16A 4AHOA 2P53A 1N8WA 5CBBA 2D0GA 4LVAA 1I45A 4FLQA 3OYXA 2XH7A 4IMFA 3R13A 1KRMA 4QDMA 2C14A 3DYMA 3NQEA 4NNAA 1W31A 5JBDA 2CESA 4RPQA 4EIVA 4AYGA 3AICA 2OB3A 3USZA 4NQ1A 1SO4A 4QLKA 3BAXA 1B3ZA 5CC6A 5I3GA 4MNJA 1BWLA 2KAUC 4XIAA 2FPYA 3OU8A 1JFHA 3G1VA 3AXHA 2FTWA 3NQVA 1K9FA 1FWIC 1TWWA 2XH0A 3BOFA 3PBUA 3B04A 5XINA 5ABTA 1SGJA 4S2BA 3MC5A 3DC8A 4LVFA 3W28A 5BW6A 3L4TA 2E1WA 5FEXA 2PLMA 4GIYA 4Y96A 4LANA 3EDFA 3L4ZA 3WMLA 3DBPA 3UESA 2PTZA 4QE4A 4B9YA 4I9JA 4OBSA 4AG0A 1OABA 4ZBCA 1KXTA 4C90A 3T55A 1BWVA 1UP0A 3CU2A 2X1RA 1GT8A 5F1VA 3KWXA 1KB3A 2X0YA 3O0FA 3F4NA 1SMDA 3PFMA 1KM0A 5CLTA 3UFYA 3VABA 5GJNA 1QK0A 1EXBA 4HTYA 1V79A 3BL3A 4IQLA 3TYBA 3LGEA 4N02A 1NJJA 4QHRA 3GVQA 4LBSA 2AL2B 4ICNA 4WVXA 5TNVA 3S2LA 5AC4A 2DIJA 2EPKX 2ZCGA 2J74A 3UR5A 4LEFA 4XSMA 2QF8A 2TMDA 3DGBA 1VPXA 2OZ3A 2PBOA 1EPVA 2PDUA 4GUHA 4C7GA 3PPGA 3OBKA 3GFZA 3GXMA 5BRQA 1TJPA 1DJHA 2O9PA 1PWLA 3QV7A 2R9RA 3UY8A 2D2JA 1D8WA 3TN4A 3PBWA 1G01A 4FI4A 2FTYA 5ABEA 2FHCA 2R24A 3KL5A 4YHGA 3AMLA 1UOKA 3V7PA 1ITQA 4F2BA 4GI8A 2CZ5A 2D73A 2VYOA 2W62A 1B57A 1KKOA 3TTEA 1PKMA 4MY9A 4CLMA 3BJTA 4WKHA 1OX4B 3L66A 2GDQA 3KL3A 1V6XA 2HPIA 2PTWA 4D6IA 2WZTA 3LS9A 3N6QA 1L2UA 2FH6A 4GYPA 3UYCA 2VGBA 1V3IA 4MB4A 5HMFA 3NURA 3MHUA 4MWAD 1TUXA 3H2EA 5CLWA 4AZ5A 5HJXA 1PO9A 4ZR8A 4RX0A 3ARVA 5I5RA 4N9BA 2WB5A 1W3NA 4B5WA 3M9YA 3GDMA 3ZR6A 2E3ZA 3N18A 2OEJA 3TSDA 2QVHA 4JOMA 4PBEA 1EJSC 7REQA 1CEOA 3GH7A 1KBKA 3QHOA 4GX8A 5LXEA 1FA2A 3W9ZA 1VB9A 3MMDA 2YXXA 3VIHA 5A2CA 3FY1A 3RCYA 1JZ3A 3S2JA 1MRQA 3WLSA 1H51A 2Y5SA 3T42A 3N6HA 3CAKA 3L5MA 6PTDA 4AZCB 1NFBA 3OG3A 2EO7A 4PTWA 1TYGA 3C0LA 2PCEA 4ECLA 5FCZA 3M47A 3EKLA 1ME9A 3RCNA 4A8IA 2NLYA 1H5VA 3CWNA 4JFUA 2CLIA 2BHZA 1H1NA 3KTXA 3OGVA 1BYAA 1FCVA 1C90A 5E0KA 3KX6A 1PIGA 1BLIA 3E2QA 3M46A 3TW6A 3M7WA 3H12A 5H6HA 3OYZA 4Z2HA 1WAWA 3STPA 3NUKA 4XVEA 3ID7A 2WBKA 1NWSA 4Q7BA 5DCBA 5DCEA 4JFVA 2YZRA 1G4SA 3U2ZA 1AL7A 2PU1A 3MZNA 1J0IA 3U3HA 2CFFA 1ONWA 3TYAA 5LIWX 4IGNA 3M43A 2PMQA 2TAAA 2D1ZA 4KPLA 5FA5A 1R87A 4OOZA 3VMOA 2FDSA 3B05A 4CN6A 1ZAJA 2XJ7A 3WBXA 3KOYA 1BSLA 5G2HA 4A6GA 1IIGA 2OLAA 4NY2A 2QCDA 4PODA 4XG1A 3EPMA 3K46A 3O06A 5FJOA 1W37A 1RLCL 3U5YA 4D9PA 2IPWA 1T41A 3EGJA 4MUZA 3V3WA 1GOKA 1A4LA 3VNLA 1E55A 3PTMA 1G0CA 1MVYA 1RQEA 4Y9OA 5JMUA 4PTNA 4V1XA 5I3JA 4IG2B 4M81A 3DG6A 2QCGA 4PB5A 2J77A 1CTNA 2REQB 3E1F1 4BY3A 1O5XA 1Q7MA 3CB8A 2R14A 4WKAA 5HQEA 4LTSA 3VD5A 1NWTA 1RHCA 7CGTA 3CEPA 3CYJA 1OJXA 3SECA 1R85A 3IGSA 1CXLA 4H7ZA 1MW0A 1GQIA 1VCFA 8CGTA 2DW7A 1EQCA 3B0VC 4ZQOA 4C6BA 4CQBA 3BMVA 3PHAA 3SCTA 2D20A 4RPPA 4MVAA 4TVDA 1NFPA 1XWYA 2MNRA 3RO8A 3UVAA 1BF2A 5JBFA 4CQDA 2WVTA 2C15A 3E2RA 1CWYA 4TMBA 1M03A 2V63A 4JCMA 5DBTA 2X0SA 4KEUA 5I2UA 2QGHA 5I06A 1WDWA 1UYQA 1XPYA 3PZIA 5CPQA 1F8IA 2Z6JA 3A4JA 4GH3A 4DLMA 2GVGA 2QUTA 1ZB5A 2FH8A 4FXSA 5E0FA 1YKWA 2XH4A 5CC7A 1CB2A 3HPZA 1TE1A 2ZUNA 2WWDA 3Q58A 2PODA 3EA2A 4DJFA 4O28A 2VX5A 4GKLA 5HK4A 4HA0A 3S46A 4LUTA 3V5CA 1V08A 1LBLA 3IWPA 3II1A 3QGKC 1C8XA 3U9IA 2GQAA 4DJFC 4G9PA 4JEJA 3HPFA 3RM9A 1AMYA 4GY7A 5C54A 4F0LA 2XIIA 4I7VA 5JXQA 3URNA 3W7OA 4CD7A 4IUOA 1K1DA 3GVGA 1W17A 4DJDA 5C9RA 1QDSA 2R1NA 4XZMX 4MB5A 4ZO6A 3SSJA 5CSYA 2VC6A 3V16A 2RAGA 1DWAM 4JTDA 3AJ7A 5I00A 1K8ZA 3FYYA 5AZ1A 3GYEA 1E3ZA 2PU0A 3H7UA 5MKGB 4CNUA 1GOMA 1NDZA 1KGUA 4ACZB 1IGSA 3W7MA 3N04A 3IJ8A 2PDXA 4GINA 3DENA 5CZKA 3NL2A 3GKFA 5KSWA 2Z27A 4XO6A 4ZO9A 4ZQNA 1T7LA 1XPGA 4AD0A 1E0WA 4B90A 4NF7A 1MZRA 1NSJA 5AN7A 2VENA 1W1VA 2Y7GA 3CHDA 3S6TA 3W23A 2OJPA 4A2RA 5A8PA 1RALA 4WKFA 1JNEA 2CEQA 3VYLA 4HJFA 4UUIA 1R3QA 1O1ZA 3V36A 3PAOA 3LRLA 1ISYA 5D37A 1JJKA 2W0UA 3SFWA 2PC8A 3WL1A 3RITA 1RCQA 1EIBA 1RCOB 2VZUA 5LYRA 3OHMB 2BDQA 2F6XA 1IGWA 4WD0A 5D8WA 4CVUA 3KWSA 3T0TA 4H2HA 2WSKA 4NZ1A 1G4PA 4OU1A 4GWEA 1TFVA 3AI0A 1P0KA 2A6LA 1ML1A 4GO8A 4G7FA 5HANA 1ZBCA 5E0CA 1EKOA 3W7EA 1H1ZA 2NZLA 3UXDA 5A6MA 1NP0A 2WHKA 1H49A 2E4TA 2FHBA 3PZ9A 1J0KA 2IKIA 4PMYA 5IDIA 4J3VA 4ZVJA 3W7HA 1NIUA 2YFOA 3G5EA 4UOQA 1W1YA 1OZMA 1RPXA 1PE1A 1QOXA 2QKFA 4RKAA 3T0BA 3UXAA 4WDUA 4UZSA 2E6FA 2VOTA 1BEUA 4IZGA 1BFNA 3LTPA 1ODUA 1GJUA 2ALRA 2ALDA 3DERA 1S2UA 1RY0A 3QW4B 3M16A 1C9DA 1OC7A 2VTFA 3WD1A 3WUFA 4AD2A 3JU2A 3BK0A 3GAYA 1WV2A 3S1WA 1GVRA 1C91A 1RAKA 2EG7A 4GACA 2PRMA 3BAIA 4HQVA 4WLCA 1AQMA 3A9IA 2VUNA 3PZOA 1VIZA 2PDJA 3R25A 6A3HA 1OD8A 2WLZA 1MXDA 3S2MA 4YCOA 3BGGA 4IHCA 1Q2SA 4ICCX 1I1WA 1QPQA 5EMKA 4DIAA 5E9AA 4MKNA 4LVGA 3R0KA 4BI5A 5IFTA 2F9RA 3HFYA 5G4WA 3WIJA 3CTLA 3G0XA 2XIBA 3BE7A 4NAFB 3S0CA 3TEVA 3QV6A 2XZ7A 4LYPA 2CBVA 2GOKA 3TN6A 5EMUA 3C3NA 3WLQA 3F1QA 3NSNA 2TPSA 5LXXA 1WUEA 3BAJA 4UWMA 1DJQA 2XVNA 4OOUA 3VCNA 1J5SA 1F5ZA 4YTSA 3KDOA 5LNRA 2Z24A 2DZUA 3AMCA 3BVJA 4KW2A 4HPNA 1UR3M 1NAL1 2GJLA 3KDNA 3W7RA 5AY7A 5LNWA 1XRVA 3VKCA 3S42A 3P74A 3DH7A 2IW0A 3L4VA 1XINA 2A3AA 3VCRA 3GKAA 1I0BA 3RPDA 4H2CA 1LRTA 3VNKA 2QDGA 1UW9A 2QUVA 3W7CA 1UG6A 4CN4A 2O55A 4ZB0A 2QAFA 4X0NA 4OJYA 3DFOA 1SM9A 3PPHA 2GJXB 4QLLA 3AMGA 4UR9A 1B3VA 3R8GA 1W8GA 4JICA 3MI3A 4RK8A 4WDTA 3AQUA 5DBUA 5HQMA 4JKLA 2W61A 4CCEA 5AHIA 2EGZA 1E6XM 3I6TA 1GUVA 2VKZG 1I0DA 2EPNA 1KQYA 1AL8A 1QWGA 3W1UA 4UTTC 3VA8A 3W0KA 1K7FA 2WCAA 1QATA 5A95A 4S39A 1WAUA 3OP2A 4PUEA 3OVQA 2Y8KA 1H5YA 4B91A 4IFKA 4BF9A 1TR9A 4J2MA 2NSOA 1S1RA 5HQLA 3VIJA 4TMCA 1P0NA 2HZGA 3LGDA 3FN9A 4AIOA 3USBA 1FH9A 3AHYA 4H9TA 2AMXA 1GORA 3FDGA 4LQ1A 4KWSA 1LBMA 3GZAA 2RH9A 1US2A 3TR9A 4A2SA 3TROA 3CZGA 4AD1A 2C18A 2QCLA 3WF1A 4RZ4A 1FP9A 1U5HA 5BNKA 1H62A 5DMYA 3WZ0E 1J6OA 4HPJA 1YXYA 1J96A 2YL5A 3PJXA 3N14A 2NVCA 2QGYA 5ABFA 1WP6A 4X9SA 1QPKA 3AS1A 2BMBA 3JZUA 2FZNA 2HXUA 3SQSA 1J6PA 2IKHA 3FCPA 2DU2A 1J8VA 1UJPA 2NXIA 2PRLA 1OCQA 1A49A 2VFEA 3IRDA 3C4UA 4JFSA 1ZNNA 4UIOA 4S3BA 3EB2A 3ZYZA 3ARPA 3H55A 4JDYA 4DJDD 1KFEA 2V3DA 4NZCA 3WH8A 4POCA 2HJPA 1UZDA 4M5PA 2P0OA 1YDVA 3SJNA 5A6KA 2ZX6A 5A6BA 3EBVA 1NF0A 3QOMA 4DWSA 4OUEA 4QFUA 3W2MA 4I7WA 2X2YA 3RX4A 1VJIA 2B81A 2IMRA 1GHRA 3DBNA 3WBWA 1W8SA 2YA2A 1XLAA 3ARXA 3H70A 3WDPP 3W72A 4DWSC 5A6LA 1E15A 5I3HA 5MHBA 4CD4A 5HATA 4P7OA 1KM6A 5CBJA 3RG6A 1I6NA 3C2VA 4IP5A 2QCCA 4B5XA 3LBOA 3B0UX 1N82A 1A0DA 1OFAA 4K3ZA 3G8EA 1YDOA 1EA9C 1DIDA 4AZIA 1OFBA 2DSUA 2CITA 1JD7A 1IZCA 4NJHA 2J8TA 4ZEPA 2SFPA 3I6EA 4WK9A 3LSCA 4O1AA 3L7RA 4RV3A 3T9PA 2VFDA 2A6NA 1Q65A 3BLKA 4GJJA 1OG0A 3TXVA 3W2JA 2A7RA 1AD4A 4GLEA 2HRWA 1QI2A 3L4UA 4P7LA 2WYSA 4GVHA 1KA9F 1R0MA 2G96A 5F2GA 3JR2A 3G3DA 2G97A 3BAWA 3A47A 3QMRA 4Q4OA 4BWLC 4DUOA 5F4XA 3S4TA 2OG9A 2J25A 1XQKA 4KFOA 3B8UA 4ZOEA 1PCKA 2Y2WA 3MI6A 1AMKA 5DY2A 3UZZA 1Y5XA 3TDFA 2QLYA 1VC4A 4QJ4B 4AFYA 3FLUA 2OR2A 2DGAA 3PP7A 4XQ6A 1QMLA 2XGBA 3BC9A 5DT7A 2OT0A 1AQFA 1ECQA 4X22A 5DF0A 3QHNA 4F0KA 1A5AA 1XJBA 1AZ1A 1QNQA 4AY8A 1UOZA 1TV8A 4UQDA 5ABGA 2J7DA 2ABBA 1OQFA 3W2KA 3KRBA 3TC6A 3UBPC 1YHTA 4Y90A 4NIRA 4C6CA 2OTDA 3VC5A 3VOFA 2IXVA 1PKNA 4GMEA 4MGGA 4Q8WA 3RN6A 4ERGA 4TQTA 3P6LA 1V3JA 2VURA 1XBVA 3C5QA 4YPJA 3NSMA 5BOFA 3VKJA 1JZ7A 5GJMA 1Q6LA 2V6AA 4PGLA 3TQVA 1D2KA 3S2NA 4LNCA 1RUSA 3M0LA 3G1YA 4AH7A 3FDKA 1H2JA 3GVWA 2E1DA 4DLFA 4E4UA 1F3TA 1OCJA 3KBMA 1VHCA 1ZP3A 3KFTA 4N7QA 3ARSA 4CKQA 4O52A 3OPSA 4O1BA 2BLEA 1KFBA 2W4XA 3E0WA 5CGMA 1S5NA 3DC0A 4B3KA 3FFSA 4CQ8A 4NJJA 2NVDA 2XSBA 4GA8A 4OQVA 3M7SA 3SJ3A 1GVIA 1MEIA 2XFYA 3TN5A 3FYOA 5DX7A 3RIKA 3GXPA 4MJZA 3OLIA 2PGEA 2WHMA 3VK5A 1TJ2A 1ZJAA 3WH6A 5E1QA 4RNFA 4WR3A 3P61A 1DORA 1VQTA 2QCDB 1E9LA 2PTXA 1DWFM 3ABOA 5EL1A 5AHMA 4PCSA 3A6OA 3M07A 2F84A 1F8MA 1E1CB 1V0NA 4OUIA 4HPGA 1ZZMA 2CETA 3P60A 3KHJA 3LM7A 4NI8A 4LAUA 3U7BA 2E8ZA 3GVRA 1DIEA 3O6AA 3UJEA 3I65A 4HZ7A 3MYPA 4MYAA 2EJAA 1VAHA 2UY4A 1N55A 4Q8OA 4D71A 1DIOA 4PC8A 4TOQA 3TTQA 4L9XA 1HL9A 3VDGA 1ISVA 3B03A 4XAGA 5KTLA 4PMUA 3UXIA 3V5OA 4LU0A 1YPIA 1LRNA 1QHZA 2W79A 4Q6JA 3IJ6A 3PWGA 2GQ8A 1HW6A 4GD0A 1KFKA 4LALA 1JI2A 2BTMA 3UA3A 2AL1A 2F6KA 4UFIA 4M3PA 1VRXA 1KWGA 2GSJA 1KM1A 3F4DA 1UD3A 4HP5A 5BRPA 3MDUA 1O7AA 1JYWA 4I9MA 2YBTA 4KF1A 1SO5A 4EAYA 4HJWA 4Y9MA 4Z1DA 1JPKA 1VH7A 1VLIA 3FW6A 3TNOA 3GWQA 4GX9A 3N73A 4JIIX 3W1MA 1VBUA 5AHEA 4FIRA 4X0VA 3P2VA 1DQUA 2NW0A 3GTFA 2XIMA 5I79A 3PR2A 3PS7A 1GONA 1ZENA 4O0ZA 3UCDA 3GNXA 3TTOA 1FCBA 1QU4A 2TRSA 1NH6A 3CV6A 2DP3A 3T7VA 2Q71A 2DJXA 3PG9A 3GE7A 1HN1A 4FX7A 2CWXA 1QW9A 4L7ZA 3GM8A 3WEOA 1IYXA 5MF5A 3N2XA 1U5VA 2NQJA 5C55A 1TVNA 3TJ4A 2POZA 1HO1A 4E6MA 5C71A 3E96A 3APYA 1UR2A 2Y70A 3A4WA 4WOQA 3KCJA 3ZIZA 5J8LA 8XIAA 1H61A 4H9UA 3TYZA 3EMCA 1RP8A 2J7GA 3G1XA 2H9AA 3RPMA 1EYWA 1XR2A 3T40A 5FEPA 4PMDA 1HNYA 4GYKA 3S9IA 1DXEA 2PI6A 2DSZA 1EA0A 4I8YA 2PLJA 5DMLA 1NQ6A 1Y5VA 3TTSA 3N3MA 4X61A 2IKGA 2C13A 4PRTA 2NV1A 4IUGA 4K68A 1IZJA 2DJLA 3CT2A 4DAIA 4DPQA 1VGAA 3R0UA 2ZZ7A 3DFTA 3DN5A 3ARYA 3RJYA 4ATLA 2OOGA 4XBSA 1R46A 4X2RA 2IQ0A 2Y4SA 4ZENA 5A6BD 2GFTA 4FLRA 3ITGA 1IV8A 5DMNA 1W9PA 3GIYA 3E0LA 2FTPA 2Z00A 4C7FA 3TVAA 1JVNA 1DQXA 2X09A 1GW1A 3W88A 3WDQA 3W22A 3EWZA 4AIBA 1TQXA 2WZHA 2GUUA 3VUSA 3THCA 1K3UA 2FKPA 4DZ5A 4YIWA 4R34A 2BS9A 3UZYA 3NPVA 2NVAA 2HMCA 1A5BA 3GU2A 2IKJA 5I78A 3THUA 4ZOBA 3UPMA 1E40A 4H8VA 4M0XA 2JFEX 4NILA 1HTIA 3W86A 1EJXC 3ZWSA 1W2VA 3POCA 2D69A 3O15A 5I0DA 5PTDA 4Z2JA 4R7OA 1L9WA 4MNMA 2GYIA 4E38A 1J01A 3W87A 2ZWYA 2HDJA 4IX2A 3C0QA 4AXKA 4UQEA 2C19A 4Y7EA 1OIMA 1EJTC 1GQLA 4GXMA 2VQTA 1IWBA 1R3VA 1GPWA 2CIPA 3WUEA 3N1AA 4JR5A 4MG4A 1M68A 3FHAA 4W93A 1Q66A 3FK4A 1EEXA 1UROA 1XBZA 2WXDM 3W29A 2Z26A 4QS6A 3WDRA 4Q8PA 4LX4A 4IMCA 1LRQA 1Z3NA 4XAFA 3FKKA 2YL8A 1E73M 1J2BA 2NSXA 3WLJA 4IIFA 2V2HA 4MUPA 3AFBA 2J13A 3K4DA 2UWFA 3M64A 2Z25A 1HKWA 2HVMA 2DV0A 5FI8A 3EMZA 4K7YA 3HU7A 4ZB5A 3PAJA 1Z69A 1OY0A 4JN6A 3UETA 3W24A 4PTDA 1ZJHA 3LZ3A 3QY8A 3B9NA 3TUUA 3MV11 1QHPA 1TSIA 2HK1A 3YPIA 3BJSA 5FL0A 2J7FA 5EMYA 4L9ZA 2OVLA 2QIIA 2I5IA 1CECA 2WKGA 3A9BA 1TUFA 3E12A 4U2ZA 3VDCA 2A21A 3GR8A 2O7SA 2E8YA 5KINA 2XN0A 1B4EA 1UH4A 4CQAA 1XSIA 1JDEA 4YVXA 1BHGA 1VFTA 1E5NA 2ZX7A 1H09A 3G6MA 4C91A 4GC3A 5EBAA 4BA0A 5GNXA 3KOXA 4XBKA 3IANA 4QG9A 2CHOA 3RRAA 4LEQA 3G1HA 1VEPA 4AX7A 4B4FA 4CEXC 4EF9A 1I75A 1KFWA 3LENA 1DJNA 4KIRA 2V8ZA 3V18A 3GYCA 2D2HA 3VPLA 2GDUA 2WO5A 1MXSA 6TIMA 4ZGYA 2JF7A 4NAEB 1XIBA 4B3LA 1KFLA 1YPXA 4A8RA 1UWSA 5D30A 4W7VA 5KZMA 3QQ1A 5C6MA 3EDJA 4DVOA 3SO7A 2B7OA 1KRAC 4J3UA 4HHLA 5FOOA 3APGA 1GVOA 3ALFA 4UB9A 4W4QA 4ZZ9A 1V02E 1UB3A 2Y85A 3CQKA 3KVLA 1OD0A 1RR2A 3GHTA 4NU7A 3U2CA 3H7RA 3H2AA 3STFA 3REQA 1YLVA 2PDIA 4I3GA 4KEZA 5JU6A 1IXOA 3N25A 5T91A 1UKPA 3L2LA 3WNMA 5C8BB 3O7UA 1Q7QA 1R2SA 4KFNA 1R30A 1U22A 2PTYA 4AWSA 3UNTA 1E3XA 1WKEA 3HQPA 4HBKA 5A6TC 1A3HA 2FVMA 3RM8A 4YJ5A 2VDHA 1FX6A 2WW5A 4JTFA 1Y8BA 2VEMA 1U30A 2HROA 3LHWA 4P8UA 3E38A 5CC3A 4AVOA 2J47A 1O4UA 4QJ3B 4F79A 1TPH1 1G5AA 4HNTA 4H8UA 3QC3A 3QMSA 4ASTA 5I3IA 1K70A 1WBHA 3B4YA 3W01A 5CZSA 1PEZA 4P8XA 1OFOA 4DBSA 3GO2A 3SN1A 3LXBA 3CPRA 1IT8A 4H19A 2XPKA 2YIHA 4GQ0A 5M1TA 1OCNA 3C61A 1A5LC 5JH1A 3OVRA 2QCEA 1WXZA 4E5TA 1NARA 1LUCA 1ZTVA 3SCVA 3BZGA 2XVGA 3FOKA 3OO2A 2YPIA 3MUAA 1Q4WA 4YWIA 5AB3A 3CZJA 2Z4GA 3GXTA 3LGGA 4GK8A 3VD9A 4UNLA 3TU9A 3BOLA 4JZ5A 3CLWA 1X8FA 2EQDA 2G0WA 1KRBC 1GZJA 1P48A 3QN3A 4CCZA 3MSDA 1G94A 3IIXA 1REQB 3T6CA 2G3MA 1UD8A 1W1B1 3EWBX 3W1PA 3H4GA 3CH9A 1DP0A 1FWDC 1IXPA 1DTNA 4GIEA 1S5MA 4S1FA 3T78A 4PTVA 3WJXA 1U1JA 4CGTA 8RUCA 1XC4A 3K4WA 4FF5A 3H6OA 4KFPA 1E6QM 3NCOA 3N11A 5CG7A 2ZA2A 5E6ZA 4R9XA 5K4XA 4UQCA 4HNUA 3WQCA 1O5QA 1OFDA 2XTKA 1BSIA 3AALA 1KGXA 3THQA 4HNVA 2FLIA 2NX3A 2W9MA 3TQKA 2EJ1A 4WJXA 3W38A 2XDFA 5IBXC 3MBDA 3B9DA 1PIIA 3U5UA 1GOOA 4ROPA 1UWQA 2EPOA 1SZFA 1HJSA 2XVLA 2XM1A 4YTQA 4XTIA 3DFSA 4A35A 1EX5A 2J7EA 1XRSA 2VP8A 1XBYA 3GIQA 3KAOA 3TW9A 2TSYA 1TX0A 1X38A 1E9YB 4UMBA 4D6CA 1TVPA 3VIFA 4TU1A 1PZ1A 2QQ6A 1AQHA 3UU0A 3HFTA 1VKFA 2PCQA 3MDWA 5K3VA 4DBEA 3FVMA 1LYXA 1QK2A 4JTGA 5A94A 3WFAA 1EP1A 2Q3RA 3W1QA 3UG4A 3TSBA 3AYVA 1NP2A 4K37A 5DXXA 2GZXA 1DBTA 1O6IA 1XM3A 5HPCA 3CAQA 1VPQA 4LV9A 3M0MA 3B40A 2P3EA 4E2BA 3CB3A 2VEIA 5CPSA 3KS5A 3NXLA 1C29A 4UZUA 3IAQA 5H91A 4AF0A 1GYLA 5HINA 3ZQ9A 2X1TA 2X0HA 3PWIA 4PB3A 5LA1A 4GJ1A 1SQ7A 3OBEA 1A5KC 4GQGA 4A29A 3CPGA 3FAXA 3CGTA 5M03A 3ARZA 2ZOXA 3G18A 1Q6CA 1EGMA 2DFAA 4DBUA 1R8LA 4WEVX 2FVLA 2D22A 1TWZA 2XIOA 5EPDA 5K7JA 3CPUA 2WZEA 3Q94A 1JDFA 3BO9A 3WBAA 2F7FA 1CNVA 2BWGA 2J8GA 3TN3A 4KKXA 2BG5A 3VNIA 1QOQA 2WJDA 3UR8A 3K1GA 4H6RA 1XCWA 3EX3A 1GYMA 3R12A 5T9BG 2WC4A 1XIGA 2UY2A 3MYOA 4QE1A 2ACUA 1IF2A 3ZVHB 4JDBA 4GYFA 4CVWA 3FHQA 2YFNA 2CHRA 2YCJA 2ZZ4A 2BFGA 3EXTA 3JRKA 1KM5A 2OXNA 4L1WA 2ZVIA 5JIPA 3L5AA 2E6YA 2BXZA 1HJQA 3EDKA 3MKKA 1Q2RA 1HKVA 4QNEA 3EXSA 3QTPA 4ES4A 4HNOA 3B0PA 3M0XA 3UYIA 4MY1A 3BJFA 5LKYA 2WVVB 3B3DA 2D2GA 4GUFA 4AW7A 3ARRA 4FNTA 3M5YA 1WNOA 4A21A 1OBAA 3P8JA 1FWBC 1PTAA 2QJHA 4G1KA 4AQLA 3WY1A 5KMYA 2EKGA 4MAVA 5EU9A 4C1NA 1TCMA 1AA1B 2WM0A 5CXPA 2C1IA 1L6YA 3LZ5A 3W6LA 3TZFA 2JIWA 1KXHA 1FWFC 3AAMA 3PZTA 4LUSA 3UWZA 2PWDA 4DY1A 1JZ2A 3KE0A 3AS0A 1C8VA 2J27A 3IAPA 4J9JA 2OQHA 4GNVA 1J12A 4N9EA 2XVKA 1XLIA 4X63A 3DIPA 2YXGA 4M6PA 5D2TA 4Y8FA 3AC0A 1IXNA 3AYSA 2NQ9A 3MANA 4RZBA 4Z2GA 1GOXA 4P7RA 1DJWA 3QXBA 3ENLA 4WDWA 3W2LA 4IPLA 4NRSA 5EB8A 5IOBA 2WM1A 4QQUA 3H21A 4DF0A 2CYGA 4PYSA 1R3YA 2PWUA 1AJ2A 3S1GA 2WSYA 1W5OA 3C2OA 1E6RA 2BZNA 3KRZA 1P6CA 3MCNA 3SSZA 4XV0A 3B9OA 1UA3A 4O8RA 4GE8A 1A5SA 2YYTA 1F05A 1YTDA 1CZ1A 3URBA 1SPQA 3MVIA 1BD0A 3GU9A 3RMJA 3UXKA 2J9XA 3CMGA 4FAMA 4Z2LA 1A47A 3N15A 4YS1A 3R0DA 2H9AB 2J7BA 5AKQA 2YW3A 4HOXA 1SZGA 1SYTA 2CC0A 4Q8MA 3B8SA 1M3UA 2ISFA 1XLKA 3TCEA 4NNBA 4ERAA 1YPFA 3I4KA 4QRNA 3NQ2A 2Z29A 3G1FA 2YBVA 1QCWA 1DVJA 1B54A 5E6YA 2XIQA 1CPUA 2UY5A 3EAUA 1UIPA 1SMAA 1S2WA 3CV2A 2JEQA 3S5OA 5C5YA 3MS8A 2FJUB 4J27A 3CHVA 4IL2A 3VMNA 2PAJA 4GQBA 2V2CA 3WNPA 3ZVIA 1E5JA 3R94A 1FWWA 3N2BA 1HO4A 1VFHA 4BI7A 4V1YA 3L9CA 3K1DA 3W1AA 1VRDA 5CAHA 3WKZA 4OIFA 6ENLA 4M80A 3UWEA 4Z1CA 1H0IA 3WEZA 3FX4A 1KRCC 1NM9A 3F2DA 1ZCCA 2WVSA 4WQ6A 4BKNA 3MY9