1H641

Crystal structure of the sm-related protein of p. abyssi: the biological unit is a heptamer
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
b'ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDNVLAISPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SNRNP SM-LIKE PROTEIN
molecule tags Sm-like protein
source organism Pyrococcus abyssi
publication title Crystal Structures of the Pyrococcus Abyssi Sm Core and its Complex with RNA.Common Features of RNA Binding in Archaea and Eukarya
pubmed doi rcsb
total genus 13
structure length 71
sequence length 71
chains with identical sequence 2, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2001-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1h64100
2RA2A 4MMLA 3JB9J 3JB9G 2FB7A 4JLIA 4M7DG 2DXUA 4M78D 4XTZA 4M7DE 4J6WA 4C8QB 2EJGA 2DVEA 3M4GA 4Y91A 5LJ5h 4XTYA 2E41A 2RD1A 5GANg 1M8VA 4N0AA 5GAN8 1WPYA 2Y90A 1I8FA 4C92C 4M78F 4XTUA 5CAIA 4RCCA 4HT9A 2DTIA 4M77E 1TH7A 1WQWA 3JB9F 4C92B 1JRIA 4M75D 5GMKi 3L2ZA 2CGHA 2VC8A 4C8QD 5GAMh 4F7UE 3JCMW 5LJ5j 1I81A 4N0AC 4NOYA 5LJ3h 1WQ7A 3BFMA 2DZCA 5GAOl 3JB9H 3RERA 3RKYA 1Y96A 4PJOE 4XU3A 4PJOA 4M77G 3JCMb 4C8QF 1LOJA 4JUVA 5GAOn 4J6XA 3RIRA 3V8KA 4F7UB 4HT8A 3HFOA 4C92G 4M7AB 2K57A 2DKGA 2RB6A 2RM4A 5GAN6 5I21A 4M77A 4PJOG 2I2LA 2DJZA 4PJOC 3BW1A 3RUXA 4XTWA 3V7RA 3V7SA 4PJOB 3JCMh 3JCMQ 1Y96B 2EJ9A 5DY9A 3QSUA 4M7DB 3SWNB 3JCMV 3PGGA 2DZ9A 4M77C 3V8LA 3EFSA 1YCYA 2VXFA 3JCMJ 5GAOp 5GANf 4J6YA 4WF2A 3JCMc 4F7UF 4RCBA 5GAOq 4EMKA 3RKWA 1B34B 4A54A 5GAN5 4X9CA 3L1AA 2QTXA 4J5YA 3FJPA 3HFNA 5GAMf 5GANe 5LJ3j 4XU2A 4M75G 4XTVA 4OP0A 3JCMP 3BDUA 4C92F 3V7CA 5GAMe 5LJ5e 3HSBA 2YLCA 4M7AG 5GAMd 2DTOA 3QO3A 4M75B 4EMHA 4EMKC 4F7UG 1BIAA 4MMKA 4M77D 5GMKh 1X01A 5GAN3 4M7DF 5LJ5f 4XU1A 3QHSA 3EFRA 5GAN4 2E65A 5GMKe 1HK9A 3JCMd 2E64A 4M78E 4M77F 5LJ5g 5GANh 4M7DD 4QVCA 5GAOm 5GAOr 4PJOD 3FIFA 3JCMg 5GMKj 1U1TA 1KQ2A 4M7AE 1H641 3BY7A 5GMKl 5LJ5d 5GAMj 4JRKA 5LJ3f 4C8QC 4PJOF 3JB9D 4M75C 4EMKB 2ZGWA 4M78G 2YLBA 4M75F 1D3BA 2EWNA 4M78C 3SB2A 3V8JA 4QVDA 5LJ3e 4NL3A 3AHUA 5LJ3d 4C8QG 1LNXA 1N9RA 1LJOA 2E1HA 1BIBA 4HA8A 3SWNC 5GANj 4M7DC 5GAMg 3RKXA 4C8QA 2DXTA 2EAYA 4M75A 4M77B 4NL2A 4PNOA 5LJ3g 2FYKA 4EMGA 1M5Q1 3QUIA 4V2SA 5GANd 4M78A 3JCMX 3JB9I 1I5LA 1I4K1 1D3BB 3JCMf 1JBMA 4X9DA 1N9SA 4M7AD 3SWNA 4M7DA 3JCMe 4XTXA 3GIBA 1U1SA 4DQ2A 4A53A 4M7AF 2DEQA 4M7AC 2JN0A 1HXDA 4M78B 4JRIA 2EJFA 1B34A 1WNLA 3FB9A 5GAN2 4C92D 5GAN7 4XU0A 2YHTA 3INZA 4C8QE 2DTHA 4M75E 3VU3C 5GMKm 4F7UA 1KQ1A 2VXEA 4C92E 1MGQA 3RESA 4C92A 4M7AA 2E10A 4XQ3A 2HNIA
chains in the Genus database with same CATH superfamily
1VQ9A 1VYVA 1KC8R 4OF1A 4JLIA 3CPFA 2CUDA 4C8QB 4JJBA 4A63B 1UGRB 3CMAQ 1M90C 5GAN8 4PLIA 5CAIA 1NLOC 2DTIA 1B3QA 4LD9K 3LGFA 4F17A 1ZSGA 3G1JA 2VGMA 4DA4A 1YI2T 4GLKA 4PJOA 2KAFA 1WI7A 1U06A 2RF0A 1UGQB 4HT8A 2YUOA 2DBMA 4OMQA 5I21A 1PM3A 1RUWA 1H3ZA 1WHHA 1GCPA 2C06A 3UF4A 4ORZA 3HRUA 4TVRA 1RAFB 1NBEB 3CCLT 3NHNA 3SWNB 2QQAA 2E6NA 4MDWA 2DL5A 2KMTA 2R58A 5GANf 3CCSQ 2FPEA 3A8GB 1VQ6A 1C6VX 2H3JA 2COYA 2PVGB 1TU0B 4X9CA 2HEQA 4J5YA 3QWYA 3G6EA 1VQKQ 3CD6T 3EGXB 4XTVA 3FRNA 1YJNT 1ACMB 3LGLA 2YLCA 4B9XA 2NLUA 5FU6B 2DTOA 4J9GA 5GAN3 3EGDA 4MMKA 1Q7YU 1Z9QA 3LW5E 2RI2A 4OMNA 2HQXA 4M77F 2X4XA 1K9MU 3CBPA 2VYTA 1ZLMA 5LJ5d 4ATOA 3DB3A 2MYSA 1PG5B 2RI3A 2O4XB 4HVUA 1LNXA 4ZTFA 1E6HA 1BIBA 3EFOA 2CZ7B 4KRTA 4IUPA 2HZYA 1W2BA 1MUZA 2VVKA 1I07A 2EVRA 2RO0A 2EQUA 4BE1A 2JTMA 4PJJA 1X6BA 3G71Q 2O88A 2AIRB 4CI0C 3OYYA 2OI3A 4F7UA 4BY6B 1TUGB 2CP7A 2HNIA 2F2WA 1SPKA 1X2KA 1SEMA 2EJGA 3M0RA 3M4GA 6AT1B 4C0DC 3I55Q 1QCOA 1M8VA 4RCCA 3ZFJA 1MMDA 3QJ6A 4AFZC 3OW2A 3MP1A 1H8KA 2DZCA 4OB1B 2EPDA 2H8HA 2FVUA 3RKYA 1K9MC 1VQLA 1YBYA 4QW2A 2I0NA 2HL5C 2K57A 2ZCFB 2F5KA 1D1CA 5ECAA 3C94A 2OJ2A 4M77A 4EPCA 2HDAA 3MHXA 1G2BA 4PJLA 3NFCA 4DEXA 2QTVA 4KH1B 1VQOA 4OMOA 3CCRQ 2QA4A 1G3TA 1TXQA 4M7DB 2LDMA 5FROA 3P8DA 5L23A 4JRPA 3A8OB 3L1AA 3E2UA 2CS7A 3CCST 2IIMA 3KXTA 1MV3A 4E47A 3J80E 4M7AG 3LWHA 2F1LA 4FT2A 5GMKh 4XU1A 1M8MA 5KYYB 3VS5A 1IO6A 1LVKA 5GAOm 1U1TA 3CMET 2DIGA 1KK7A 2V8KA 1MMNA 1A0NB 4ME7A 4PJOF 2K7AA 3V8JA 4ZGEB 1AZEA 4E2FB 2WSCE 1OOTA 2AHJB 1CKBA 4EIKA 3OW2P 4WTOB 2LCCA 3JRZA 4J8OA 1VQPQ 3VYGA 5IH2A 1YHQA 1NJIR 4C5IA 1K0XA 5DM7R 4M7AF 1WNLA 5GAN7 4OGEA 2BZYA 1GFCA 3VS3A 1KQ1A 2E6ZA 4LUEA 1VQ5T 5CKBA 3VS7A 4A4KA 3EFOB 1AWWA 4Y91A 1K4US 4E7ZA 4N0AA 3PT9A 4E7JA 1FYNA 2HL3A 2A3LA 3JB9F 3L2ZA 4F7UE 2XHCA 1VQOQ 5A0GA 1XJWB 1SG5A 1J3TA 4M77G 2Y4YA 2ECZA 2RI5A 2HMAA 1M27C 3EG9A 3CCVA 1K9MR 1G5VA 1HJDA 4X34A 1KD1R 2HBWA 4M7AB 3EGDB 3OYLA 1KHIA 1KD1U 5GAN6 4B9WA 2JW4A 1YCSB 2DEUA 2E5KA 3V7SA 3JCMQ 5GJVB 2EBPA 5HK0A 2D6FA 2DXBA 4GBQA 4XU2A 2HQHA 2DFUA 4OP0A 3FC3A 1MV0B 3V7CA 3MCAB 3S3MA 3HKSA 2EKOA 1EX4A 4A4EA 1F1BB 3CBMA 3UATA 3I56T 1Q81C 3JSCA 3LWIA 3OYGA 2EGEA 1SSHA 5J3BA 1IHWA 1Q86C 1D3BA 4ZGDB 2PU9B 3SEMA 2JTFA 3OA6A 1WIEA 4GLMA 5A0LA 1QQJA 2QYZA 1TTHB 1XNIA 2LX9A 2BUDA 1I0CA 3JB9I 4NS5A 1VQ8Q 3JCMf 3WXMB 1E6GA 4PFPA 4HCBA 4D6WA 3VJPA 3L2RA 3JCMe 4PK4A 2K3BA 2ED1A 2L3SA 3CCLQ 2YHTA 2P0PA 1MGQA 3M57A 4XQ3A 1KG1A 1NE8A 4XTZA 3CMAT 4KGVB 1WHJA 4R0KA 1AOJA 4PKCC 2QXFA 3OYKA 3DLMA 4QT7A 2ZPEB 3A8HB 5GMKi 1VIFA 2KROA 1K73U 2ZPBB 3JB9H 2DF6A 2QEXA 2D0NA 1Y96A 3CCJQ 4MDXA 2KBTA 4XU3A 2DILA 1YJNA 2KRNA 3CCUA 2G3RA 1VQ8T 3H0HA 4N4HA 2W10A 3PFSA 2VB6A 1M1KC 2RM4A 3OS5A 4PJOG 2W0ZA 2DJZA 4Z8AA 3D7SB 2D9TA 1Y96B 3M53A 4QQ6A 4KUDK 1N6AA 2K4YA 2DAQA 4C0GA 4JS4A 5L8RE 3PGGA 2ZPHB 2P84A 1BK2A 4RTYA 2VXFA 2K5FA 4QQDA 1M1FA 2K3YA 4P5NA 2GNCA 4M75G 5IXBA 1H3HA 2GBQA 2DO3A 4ZN3A 2ABLA 2PVDB 3CCVT 4KH0B 1BI0A 3OQ5A 5IHKA 1MNEA 3T9NA 5CQXA 5GAOr 2DD5A 4KBMB 1FMWA 1OU8A 3RMSA 5KYYA 4OB2B 2L3RA 4JLGA 4EMKB 4FYYB 4C8QG 3OYFA 3CCQQ 2PTKA 2J6OA 1BU1A 2BE7D 2DL7A 4A4HA 1I4K1 2FRWA 1GL5A 1VQ4A 4CC2A 3X26B 2YT6A 5FRNA 2E12A 3G4ST 2FL7A 1UJ0A 4XU0A 1KC8C 4AG2C 3EG9B 2VXEA 4FT4A 3RESA 4C92A 3M59A 3QJYA 1M90R 3FJ5A 1OV3A 2BZXA 5CKEA 4FL6A 2R5MA 1WJQA 3FDRA 3GF5A 3O8VA 3CXCP 3S3OA 4C92B 1QW1A 2KXDA 3CC2A 2P0QA 3JCMW 4C8QD 1I81A 2QA4T 4N0AC 2DL4A 4JUVA 1HYOA 3CXCS 4II1A 3HFOA 4C92G 1Y0MA 1RAGB 2X4YA 1Y7XA 1BI3A 4PJOC 3DKMA 1W2BS 4DBQA 3CC4A 5CKFA 2JM9A 2A08A 1MNDA 4N4IA 3MKDA 1D1BA 1JJ2S 1BYMA 4J6YA 1KQSP 4EMKA 5GAN5 1IGUA 4RTZA 2FO0A 4PFOA 3BDLA 4E7IA 2GQIA 3VS6A 1Q82R 2P4RA 1Z9ZA 3TSZA 3M5AA 4IIOA 3L2UA 3RNJA 3CC2Q 5AT1B 5GMKj 5IHIA 1AWJA 1VQNQ 1VUBA 1SF9A 3PVLA 3H9NA 7AT1B 3R6NA 1OPLA 5A2QE 2AT1B 4F14A 1NPPA 3QDRB 4ZGJB 1KJWA 2K3XA 4M75A 5FU7C 3RR6A 2L89A 2XDBA 3VS4A 1I5LA 5CVIA 4M7DA 2QQRA 3HL8A 4XTXA 3JAME 1DJ7B 1JQQA 5C6SA 1T0HA 3FB9A 3REBB 5IXFA 2NUTA 4JZ4A 1YJNQ 2K5LA 1W1FA 1ABOA 2DBKA 2KGTA 2DYBA 3JB9G 1YHQQ 4Q5WA 3I56A 2EYXA 3SHWA 2HSPA 4M78F 1BI2A 1GCQA 4HCCA 4WCIA 2EW3A 2JZ2A 5HCKA 3EHRA 2LNVA 5CCAA 1HD3A 1VQNT 4BB7A 2X35A 3MEAA 2RQVA 2O2OA 3RIRA 4F7UB 3PE0A 1FWZA 3CC7Q 3I5SA 2QI2A 1E7OA 3OYDA 2SEMA 2YDLA 4A4FA 2EQIA 1D0XA 5DY9A 2EYYA 4Z02A 5KCOA 2DZ9A 4M77C 1JXOA 1OU9A 3NTKA 2JS2A 2JT4A 2QGFB 4E7SA 1UHFA 4LDWA 1G3SA 1LPLA 2O01E 2LQWA 1VQNA 2M1HA 2VV5A 5KH6A 1NYFA 1HK9A 3OMGA 3SDZA 2O9VA 3CCEQ 1VQ9T 1QLYA 1QVGA 3G7ZA 1JJ2A 2EFIA 5LJ3f 1WXTA 1VQMT 1AHJB 1WZOA 2NWMA 1XQHA 2VWFA 1WGSA 5FWCA 2JMCA 5LJ3e 3CCMQ 2F2VA 3TCJA 2J7IA 2PVOB 2FYKA 2E3IA 3LH5A 2DJQA 2CT4A 4AMCA 2DRKA 3ZBDA 1QCNA 5KE2A 4R56A 2AKLA 3MEUA 1TUCA 4M75E 2DERA 3WVDB 1TWBA 2EYWA 4DBFA 2E10A 3H0IA 1Y07A 1XOVA 3OYCA 1X69A 5LJ5h 2OTJA 3I5RA 1JXMA 1CSKA 3CCRA 2QA4Q 4HT9A 1K0SA 2L0AA 1JRIA 5GAMh 1M3AA 1K73R 5GAOl 3S6WA 5CKDA 3EHQA 3FLGA 2RB6A 5KYXA 1UB4A 3V7RA 2M9UA 1KD1C 2HAXA 2FEIA 3OSVA 2CP0A 2DETA 3C95A 3VYHB 4E7HA 2CT3A 1K8AU 2C0IA 2PQWA 1M3CA 1OPKA 1S72T 2LP5A 1W2BP 1VQKT 3CD6Q 1VQLT 3OS2A 9ATCB 5GAMf 4RTTA 1PD0A 1ZHIA 3JV3A 1RACB 2DX1A 2IVWA 2BZ8A 3HSBA 4EMKC 3CC2T 5DLQE 1JB0E 3NTIA 1BI1A 2E65A 2V8IA 2KRSA 1YJ9T 2WSFE 2X51A 4M7DD 5GANh 2DNUA 1EZZB 2A7YA 2BKDN 1M1GA 4PJMA 1YJ9A 1D1AA 2LTOA 3CCET 2LCSA 4JRKA 3NTHA 1EIFA 4CC4B 4M75C 5A0DA 4M78G 2PNIA 2YLBA 3HRSA 3GBQA 4M75F 2CREA 2YRCA 5C0MA 1LJOA 3SWNC 4J9CA 4M7DC 2LT1A 2AKKA 4NL2A 3QUIA 2L8DA 4DBRA 3URGA 1LCKA 2FZKB 4K11A 4RTVA 4M7AD 3GP8A 3EGUA 1BB9A 1S72Q 1M9SA 3CMEA 2DK3A 1WXUA 2FPDA 1IREB 1FMVA 2F2XA 2QAZA 5GMKm 4IUQA 1YITQ 3JB9J 2M0OA 3CQTA 4M7DG 4M7DE 3CCSA 2EQKA 4XTYA 2LT4A 2H3EB 3OMCA 3CXCA 4M77E 1YJ9Q 3CBOA 1WLPB 4J9IA 2KR3A 3M0UA 2Z0WA 8AT1B 5LJ5j 2CUBA 1WQ7A 4D8DA 3MJXA 1YNZA 3UT1A 3M9QA 5KYWA 4ANJA 3CCQA 1PKSA 1NZ9A 4AFSC 2K79A 2GGRA 2YRDA 1IB8A 3CCQT 2SRCA 2VASA 2CDTA 3CCRT 2GFUA 2EJ9A 2J6KA 3M0SA 3QYGB 3JCMV 2ZPFB 1BBZA 1FMKA 4LDVA 2CP3A 1RABB 2EYZA 1X75C 4MZTA 4QVZA 4A54A 3VS1A 2RQWA 2RK1A 3FJPA 3WVEB 5M9OA 3JCMP 1RAEB 4C92F 4MZPA 2QEXT 4EMHA 4M77D 5IT9E 5LJ5f 3VRZA 3EFRA 2GTJA 1VQMQ 5LJ5g 4OMPA 2NYSA 3BY7A 3OS0A 3QDFA 2CZ6B 2NUZA 4QVDA 2DMOA 4PJNA 2IG0A 3I9QA 1HSQA 2RK2A 2KT8A 4BDYA 2VGNA 4HA8A 1VIEA 3CCMT 1N8RU 1UGPB 4UC4A 2DRMA 1ZUYA 4Z89A 3LH0A 4FW1A 1FXXA 3MO8A 1U1SA 4F16A 2DEQA 1OZ3A 1M4ZA 3I35A 1B34A 1VQ4T 2RJEA 2QEXQ 3CCJA 5IHNA 3H0FA 1YWOA 4A4GA 3CCVQ 4M7AA 3EH1A 4L6V5 2CP6A 2QGGA 3M58A 2DVEA 1NM7A 4OMMA 4BD3A 1VQ5Q 3KBGA 3M0TA 1YWPA 1R0BG 1VQ6T 2E4HA 3QWXX 1TH7A 3QZ5B 1I1JA 1IGQA 2RNAA 2VC8A 1SHFA 2XD0A 1V76A 2RPNA 4PJOE 2ZAEA 3JCMb 5GAOn 3CC7T 2WACA 1NEGA 3V8KA 3R6OA 8ATCB 1Q82C 3C4SA 2JM8A 2NUPA 2DXCA 1R0CB 4DOVA 3DB4A 3QSUA 2L5QA 2XKOC 1G8XA 4JRQA 3OYJA 1QVFA 4IIMA 1IRXA 2QK0A 3RKWA 3M0PA 2QTXA 4HXJA 1RADB 4E7KA 5GAMd 1X6OA 2LMJA 1AT1B 3OS1A 4MZMA 4HVWA 3LLRA 4FSSA 4PJOD 1TS9A 2PZ1A 5GAMj 4HVVA 2HBPA 2ZGWA 3AHUA 4NL3A 3PMIA 5LJ3d 3MEVA 1G83A 2HCKA 1W4SA 1KQ2A 2JMAA 4BE0A 3M0QA 4RKUE 2CYZB 1U3OA 4ZNXA 2OAUA 2X3WD 2L2PA 3EG0A 1G3YA 3HTRA 4FM4B 3J7AF 4J9FA 4D8KA 1IHVA 2C0OA 2XU8A 4DBHA 2MOXA 3INZA 1RI9A 2LQNA 3EAEA 1R77A 1AZGB 4FW2A 2FB7A 1T3SA 1MMGA 1OYXA 2Y90A 1I8FA 3ULRB 2JXBA 5AYFA 4C5HA 2KE9A 2CZ1B 3ASKA 2PUKB 3G4SA 2M16A 1K1ZA 4M4ZA 3QKJA 1GCQC 1BCMA 2OTJQ 2KVQG 2COZA 3HRTA 3M56A 1YJWA 3HP9A 5KE3A 2KYMA 3X28B 2GF7A 2M51A 2CH4W 1ZQ1A 1T3LA 3N5BB 3VUBA 4B6MA 2MF2A 1WJSA 4J7IA 4FIBA 1VYTA 3Q1JA 3OBYA 3NGPA 2EKHA 1YCYA 1PKTA 4IKFA 5CQYA 2MWPA 1OULA 1QP2A 2X9HA 5EG2A 1M3BA 2RHUA 2RHYA 3CPWA 5GAMe 2KY9A 3QO3A 4M75B 1RAHB 1RLPC 2RQTA 5D7UA 3I55A 5EC7A 4QVCA 3RBBB 1ZUKA 2RJDA 2B86A 4J9BA 1PSFA 2HQEA 5GMKl 3OY9A 3L2VA 1OI1A 1UGSB 1C1AA 3UDCA 2L3QA 1QVFS 1ZBJA 1YI2A 3ZEHA 4BDZA 1YJWQ 2JTEA 1I5OB 2DXTA 2JNGA 5LJ3g 1N8RR 2K9GA 4PNOA 1QWEA 4Y28E 1QVFP 1NJIC 3REAB 1OX9A 3ME9A 4DQ2A 4FYVB 3MP8A 2CP5A 4JZ3A 3P8HA 2ZPGB 4LE9A 2OAWA 2BTTA 2P0KA 3MP6A 2YWWA 4OB3B 3VS0A 1IZ6A 2FPFA 1B07A 4QKUA 1UE9A 2JUFA 4CC3A 3QZ9B 2EQJA 1D09B 1V1CA 1K9AA 2A28A 2GFAA 3M4YA 3E19A 3FEOA 1YJWT 1PHTA 3OW2S 3QXEB 3CCMA 2NUTB 1VQPA 1G3WA 1UHCA 2J05A 1VQPT 3G71A 1TSFA 4RTUA 4XTWA 2PUOB 2WSEE 1AD5A 1O75A 2YUNA 3C0CA 1QVPA 4KT0E 2ZZDA 3JCMc 1OZ2A 4KULA 2LX7A 1K8AC 1KIKA 5IAYA 1YITA 3DLLA 1S72A 2DM1A 1VQ4Q 1YITT 1PC0A 1UECA 2KSSA 5DLOA 4LDXA 5D6YA 1W6XA 1SRLA 4XK8E 1AWOA 3OYIA 2XMFA 4J9DA 3FIFA 1VQ9Q 1Q86R 2JVVA 1ABQA 2X3XD 1SKUB 1UJYA 1YIJA 2ZPIB 3CCJT 2RHIA 3E9GA 1Q81U 3E1SA 4PFZA 3H6ZA 1Q81R 3LX7A 4M78C 1S1NA 3EGXA 1WXBA 2FRYA 4ZN1A 4M77B 1YN8A 4V2SA 1VYUA 2O31A 3RDVA 4JJCA 4EMGA 2A36A 1YP5A 1N8RC 2DIQA 1PD1A 3OB9A 3SWNA 2DVJA 3GIBA 1NG2A 2QDLA 1HXDA 2D8HA 2QQBA 3EG3A 4M78B 4AFQC 2EQMA 4OMFB 4LD6A 4X1VA 2CKKA 2M02A 2V1QA 1FX7A 4LNPA 2RA2A 1X27A 5D6WA 1M1KR 5CKHA 2E41A 5HKCA 4LXCA 4C0DB 4BE2A 2LVMA 4XTUA 1GBRA 1UEBA 1C0MA 2AK5A 2FZGB 4M75D 2CSIA 2ESWA 1VA7A 1V29B 1PWTA 1QP3A 1VQMA 1VQ5A 1WJRA 1QWFA 2RQRA 3ER0A 1JJ2P 2RQUA 3OYHA 1UTIA 2MMPA 5CR2A 3QYHB 4KGXB 4JS5A 1Y57A 2O9SA 3HHTB 4ELZC 3SD4A 3TQ7P 4HKEA 2F5TX 2LZ6B 5GANe 3HFNA 3CCLA 3P8BB 1ZSZB 1VQLQ 2B8AA 4O6JA 2MI6A 4M7DF 1VQ8A 5J39A 4BI4A 3JCMd 2GCXA 1KHCA 1KC8U 1ZX6A 3TSWA 3CPWS 1H641 2XICA 4J7FA 1Q86U 2K2VA 4DEYA 2YXYA 1SRMA 1N9RA 3TEEA 3RKXA 3JCMX 2RJCA 1UDLA 2MAMA 1KFZA 4X9DA 2IPOB 3VUZA 5D6XA 4IUTA 2X4JA 5FRMA 2LQKA 4A53A 4O5VA 1RAAB 1D0ZA 4OB0B 3PNWC 4C92D 1PRLC 2QQ9A 3PIPA 2DPPB 2DTHA 3GPLA 3OYMA 1WDXA 1KQSS 4ZTJA 3A8LB 1TG0A 3I55T 1M90U 4J6WA 3TU4K 4IUUA 2RD1A 2ED0A 1TUDA 2V1RA 1P92A 4C92C 2YUPA 1ZBXA 5GJWB 1VQOT 5I22A 1K73C 2CSQA 1WQWA 2J6FA 4BUGA 1WHLA 4LN2A 1O9SA 2CGHA 2J06A 5CK9A 4NOYA 1NYGA 1JEGA 4DOWA 1K76A 4KUIA 1M1KU 3CPWP 3NMZC 5CO7A 1H92A 3OBWA 3BW1A 1WHKA 1Q82U 2GTOA 1MMAA 3JCMh 1WYXA 1U5SA 1RLQC 2LCLA 3VV0A 2JS0A 2R57A 3IQLA 1UGVA 3CCUT 4ELYC 3QPHA 4RCBA 1N5ZA 5LJ3j 1AVZC 2V26A 4FU6A 2L3PA 5CIUA 3BDUA 1ZA2B 2G6FX 1Q7YC 5LJ5e 3OSSC 2F69A 1GRIA 2KDSA 1VQ6Q 4AG1C 5GMKe 3CMAA 5FLXE 4RG8A 3S3NA 1W70A 4IUVA 3OYAA 3HPWA 3CMEQ 1TOVA 1VOMA 2YUQA 3JCMg 1IXDA 2LJ3A 3JB9D 3EG1A 5FU6C 4RG2A 2EWNA 3MEWA 3QBYA 3LYIA 4LUDA 2DLPA 3VS2A 4JJDA 4M78A 5HY6A 1AWXA 1GBQA 2O4XA 2EGCA 2QG9B 4N4GA 2ATCB 4RUGA 3ZL7C 4CRIA 2KEAA 4AFUC 5IN1A 2OX7A 4C8QE 3VU3C 4JPBW 3EH2A 2E3HA 2LJ0A 3G4SQ 3OYEA 1NEBA 2RH2A 3X20B 1OQKA 3CCEA 4R55A 3C12A 3CC4Q 1WFWA 3QIIA 2DL8A 1UG1A 3TREA 1ZSZA 2RHXA 1JO8A 4C8QF 1NJIU 1AEYA 4J6XA 2ROLA 4C0FA 2COWA 5HK3A 3PVQA 4EDUA 1WHGA 2AZSA 3AT1B 4PL6A 3RUXA 2MK5A 2RJFA 5FU7B 1KSWA 4HCKA 3G71T 5GAOp 4IURA 1B34B 1OEBA 3CCUQ 1YIJT 2KNBB 2XDPA 4L5GA 1NPRA 3J81E 1Q95G 1OX8A 1QMCA 2E5QA 3GLXA 1K8AR 3RMQA 3M55A 1SHGA 3CC4T 2FZCB 2HSEB 1BKBA 2XI9A 3L42A 3X25B 2M0YA 4C8QC 3G6ET 3CD6A 2V8JA 1U8RA 2JOYA 2XG8D 3SFMA 2K6DA 1M2VB 2E1HA 5I2MA 5GANj 3KFVA 4E6RA 2EAYA 1WA7A 5KYXB 1R8OB 1QKXA 1N9SA 4ESRA 3VRYA 1X6GA 1CKAA 1Y71A 2OTLT 3O5ZA 2JN0A 3X24B 4Z88A 2NUPB 3QG1A 4J9EA 1KQSA 4F04B 2HD0A 2JJ9A 2LQ8A 3A8MB 4OMLA 1WPYA 2MWOA 2A0FB 3UA7A 3GOXA 4LDUA 1WHMA 2BE9B 2KQWA 2DA9A 1WX6A 3UPUA 4L59A 3H8ZA 2P4TA 1LOJA 2D0QB 2DKGA 4FYXB 3A5ZB 4JDSA 4PJOB 2QDYB 3A98A 4KGZB 3V8LA 3EFSA 3THKA 3NPFA 2LNHB 4WF2A 3PMTA 5GAOq 3L2WA 2QASA 2EIFA 2FHDA 1XTDA 3A1PA 5KYNA 4BACA 2D8JA 3EG2A 4F7UG 4BI3A 1N27A 1M2OA 1RI0A 3QHSA 5GAN4 2LJ1A 1X43A 3E9FA 2MPXC 1PNJA 3META 4M78E 2KYBA 4LDYA 3CC7A 2GQVA 3KUFA 3SB2A 2K5IA 2DE0X 2A37A 3OYBA 2ROTA 2HKNA 4Y92A 4FCYA 2CZ0B 1PSEA 5FW9A 4J83A 1JU5C 1M5Q1 1D3BB 1JBMA 3M54A 4GY5A 3BE3A 1M2VA 4RTWA 5KYUB 2DL3A 1BCOA 2EJFA 5GAN2 1ARKA 1SSFA 2XIDA 1ZUUA 4YTLA 1MHNA 1M30A 2Y4XA 4QQGA 4OVAA 5I11A 2HKQB 3PIOA 4MMLA 2E70A 2DXUA 2KI7A 4M78D 2YSQA 1YHQT 2YRVA 5GANg 3GNGA 5KCHA 2CH4A 1ZA1B 1YI2Q 2VKNA 1T0JA 4C5EA 3RERA 5LJ3h 3BFMA 1UUEA 5I2SA 2DD4A 2AZVA 4BY6C 4XAXB 4AT1B 2FG0A 2MIOA 2RMOA 2OTJT 1ZSZC 2I2LA 1EFNA 5KYWB 4J9HA 5FWBA 4HCZA 4VUBA 1Q7YR 5LL6S 2EGAA 3CEYA 1VQ7T 2ENMA 3F70A 3JCMJ 1YIJQ 4BI8B 4F7UF 2KXCA 4E7LA 1VQ7A 4JJNK 1RL2A 1GXIE 4C5GA 2QQSA 2OTLA 2EYQA 1PRMC 1QVGS 1GFDA 3U23A 2BIVA 5J26A 3TVTA 1BIAA 2C0TA 3H41A 1X01A 2D1XA 1UFFA 1QCFA 2K2MA 2E64A 4PLLA 2X4WA 3G6EQ 1VQKA 2KT1A 4FSXA 1QVGP 5KYUA 4M7AE 2R5AA 1PCXA 2XDDA 3I56Q 1B7TA 3UWNA 2LC4A 2RN8A 3L2QA 1NLPC 3OYNA 2KK4A 2XK0A 5GAMg 4CC7A 4C8QA 4RMOA 2LRQA 2VUBA 5GANd 3UA6A 2CP2A 4FYWB 2MCNA 3VKIA 2RHZA 4RTXA 1YFNA 4OGCA 1VQ7Q 4M7AC 2DYIA 4JRIA 1QKWA 1X2QA 3PTAA 1D0YA 2OTLQ 1RAIB 4C0ZA 2KRMA 3MPUB 4C92E 3GNFB
chains in the Genus database with same CATH topology
1VQ9A 3A8LB 4OF1A 4JLIA 3CPFA 3M58A 3I55T 4J6WA 4C8QB 1M90U 2DVEA 3TU4K 4IUUA 2RD1A 1UGRB 4FL6A 5CKEA 2R5MA 1WJQA 4BD3A 1M90C 3KBGA 1P92A 5GAN8 3FDRA 4C92C 4PLIA 1ZBXA 3GF5A 5CAIA 1VQOT 1VQ6T 1K73C 2DTIA 1TH7A 3O8VA 1WQWA 4BUGA 4C92B 3S3OA 4LD9K 1QW1A 3CC2A 3QZ5B 2P0QA 3LGFA 1O9SA 2CGHA 2VC8A 2VGMA 4C8QD 4DA4A 3JCMW 5CK9A 1I81A 2QA4T 2XD0A 4N0AC 4NOYA 1YI2T 4PJOE 4GLKA 4DOWA 4PJOA 3JCMb 4KUIA 4JUVA 2KAFA 5GAOn 1M1KU 3CC7T 2WACA 3CXCS 3V8KA 1UGQB 3R6OA 4II1A 5CO7A 3HFOA 4C92G 4HT8A 1Q82C 3C4SA 2X4YA 5I21A 1Y7XA 3OBWA 1BI3A 4PJOC 1H3ZA 3BW1A 3DKMA 1Q82U 2C06A 1W2BS 3JCMh 2DXCA 4DOVA 3CC4A 5CKFA 3HRUA 4TVRA 3CCLT 3DB4A 3QSUA 2LCLA 2QQAA 3SWNB 2L5QA 2R57A 2E6NA 2XKOC 4N4IA 3VV0A 4JRQA 1JJ2S 3OYJA 4MDWA 3CCUT 2KMTA 2R58A 4ELYC 1QVFA 5GANf 1BYMA 4J6YA 3A8GB 1VQ6A 3QPHA 4RCBA 2H3JA 4EMKA 3RKWA 5GAN5 2PVGB 4X9CA 2QTXA 4J5YA 5LJ3j 3G6EA 3CD6T 4FU6A 4XTVA 5CIUA 3BDUA 3FRNA 3BDLA 1YJNT 4E7IA 5LJ5e 3LGLA 3OSSC 1Q7YC 2YLCA 4B9XA 4E7KA 2F69A 2NLUA 5FU6B 5GAMd 1X6OA 2DTOA 5GAN3 4MMKA 1Q7YU 3LW5E 2KDSA 2RI2A 3M5AA 5GMKe 3OS1A 2HQXA 3CMAA 4MZMA 5FLXE 4RG8A 3L2UA 3S3NA 3LLRA 4M77F 4IUVA 3OYAA 3HPWA 4PJOD 3JCMg 5GMKj 2X4XA 1K9MU 3CBPA 2VYTA 5LJ5d 5GAMj 4ATOA 1VUBA 2HBPA 3DB3A 3JB9D 2ZGWA 5FU6C 5A2QE 4RG2A 2EWNA 2RI3A 3AHUA 2O4XB 4NL3A 3PMIA 5LJ3d 1LNXA 1NPPA 3MEVA 3MEWA 4ZTFA 3QBYA 1BIBA 3LYIA 3QDRB 4ZGJB 1W4SA 2K3XA 4M75A 5FU7C 1KQ2A 2CZ7B 2L89A 2XDBA 4BE0A 4RKUE 4IUPA 2CYZB 4M78A 5HY6A 1W2BA 1I5LA 2OAUA 5CVIA 1G3YA 2O4XA 3J7AF 4FM4B 2RO0A 2QQRA 3HL8A 4XTXA 3JAME 4M7DA 1DJ7B 2EQUA 4N4GA 4BE1A 2JTMA 2XU8A 4CRIA 5C6SA 3FB9A 5IN1A 4CI0C 3INZA 4C8QE 3OYYA 3VU3C 4F7UA 3EAEA 4BY6B 2K5LA 3OYEA 2RH2A 2HNIA 3X20B 3JB9G 2FB7A 4Q5WA 3I56A 2EJGA 3M4GA 4C0DC 3CCEA 4R55A 1M8VA 1OYXA 3C12A 2Y90A 1I8FA 4M78F 1BI2A 5AYFA 4C5HA 4RCCA 2CZ1B 3ZFJA 4HCCA 3ASKA 2PUKB 3QJ6A 3G4SA 3QIIA 2JZ2A 2M16A 3OW2A 2LNVA 3MP1A 3QKJA 2DZCA 5CCAA 4OB1B 1VQNT 3RKYA 2FVUA 3TREA 2RHXA 4BB7A 2X35A 3MEAA 4C8QF 1K9MC 1VQLA 1YBYA 1NJIU 4J6XA 2KVQG 4QW2A 3RIRA 4C0FA 4F7UB 5HK3A 3HRTA 3M56A 1FWZA 4EDUA 1YJWA 2QI2A 2K57A 2ZCFB 2F5KA 3C94A 3HP9A 4PL6A 4M77A 4EPCA 5KE3A 3X28B 3MHXA 3RUXA 3OYDA 2GF7A 3NFCA 1VQOA 1ZQ1A 4A4FA 4M7DE 2RJFA 3N5BB 5FU7B 3VUBA 2QA4A 5DY9A 1G3TA 1WJSA 2MF2A 4M7DB 4J7IA 4Z02A 4FIBA 5KCOA 2DZ9A 3Q1JA 2LDMA 3OBYA 4M77C 3G71T 4IKFA 1YCYA 3NTKA 5FROA 5GAOp 5CQYA 4IURA 3P8DA 2MWPA 1QP2A 1B34B 4JRPA 5EG2A 4LDWA 3A8OB 1G3SA 3L1AA 2CS7A 2RHUA 2O01E 3CCST 2RHYA 1YIJT 3CPWA 2XDPA 3KXTA 4E47A 5GAMe 3J80E 4M7AG 1VQNA 3LWHA 2KY9A 2M1HA 3QO3A 4M75B 4FT2A 4L5GA 5GMKh 2VV5A 1NPRA 4XU1A 5KH6A 3J81E 1HK9A 3OMGA 3SDZA 3I55A 2E5QA 3GLXA 3RMQA 1VQ9T 3M55A 4QVCA 2RJDA 3CC4T 5GAOm 1QVGA 3G7ZA 1BKBA 1U1TA 2XI9A 1JJ2A 3CMET 1PSFA 2DIGA 2EFIA 2HQEA 2V8KA 3L42A 1OI1A 5LJ3f 3X25B 4ME7A 5GMKl 1AHJB 4C8QC 3L2VA 1VQMT 1XQHA 4PJOF 3G6ET 3CD6A 1WGSA 1UGSB 2V8JA 1U8RA 4M7AA 3UDCA 2JOYA 3V8JA 4ZGEB 5LJ3e 2XG8D 4KUDK 1QVFS 1YI2A 2WSCE 3SFMA 3ZEHA 4BDZA 2AHJB 2E1HA 5I2MA 3TCJA 5GANj 2PVOB 2DXTA 2EAYA 2JNGA 5LJ3g 4PNOA 1R8OB 2FYKA 4Y28E 1NJIC 1N9SA 2LCCA 3ME9A 3JRZA 4J8OA 3VYGA 1YHQA 4C5IA 4DQ2A 5DM7R 3MP8A 4M7AF 1Y71A 3P8HA 1WNLA 3ZBDA 2ZPGB 5GAN7 2OTLT 4OGEA 5KE2A 4R56A 3MEUA 4M75E 3WVDB 1KQ1A 2E6ZA 2P0KA 2JN0A 2E10A 3MP6A 1Y07A 3X24B 5CKBA 4OB3B 1VQ5T 1XOVA 4A4KA 1IZ6A 3QG1A 3OYCA 1KQSA 5LJ5h 2JUFA 3QZ9B 2HD0A 4Y91A 2OTJA 2EQJA 2LQ8A 3A8MB 4N0AA 3PT9A 1WPYA 4E7JA 2MWOA 3CCRA 2A3LA 3GOXA 4HT9A 3JB9F 4LDUA 1JRIA 2GFAA 3M4YA 3L2ZA 3E19A 2KQWA 3FEOA 5GAMh 4F7UE 1YJWT 2XHCA 3UPUA 5A0GA 5GAOl 3OW2S 3S6WA 4L59A 3QXEB 5CKDA 3H8ZA 2P4TA 3CCMA 4M77G 1VQPA 2Y4YA 1LOJA 2RI5A 1G3WA 3CCVA 1G5VA 3FLGA 4X34A 4M7AB 1VQPT 2D0QB 2DKGA 2RB6A 3OYLA 1KHIA 1KD1U 5GAN6 3G71A 4B9WA 1UB4A 4XTWA 3A5ZB 4JDSA 3V7SA 2QDYB 2M9UA 3V7RA 3JCMQ 1KD1C 2PUOB 4PJOB 2HAXA 2WSEE 3OSVA 1O75A 3C95A 1QVPA 3V8LA 3VYHB 4E7HA 3EFSA 4KT0E 5HK0A 1K8AU 2PQWA 2ZZDA 3JCMc 4WF2A 1S72T 1OZ2A 3PMTA 4KULA 5GAOq 3L2WA 2D6FA 1K8AC 1VQKT 5IAYA 1VQLT 3OS2A 2DXBA 1YITA 3DLLA 5GAMf 2EIFA 1ZHIA 4XU2A 2FHDA 1XTDA 2IVWA 1S72A 4OP0A 3FC3A 3V7CA 1YITT 3HSBA 3MCAB 4BACA 3S3MA 4EMKC 3HKSA 4F7UG 3CC2T 2KSSA 4BI3A 1N27A 1RI0A 5DLQE 5DLOA 3QHSA 1JB0E 5GAN4 3NTIA 1BI1A 2EKOA 5D6YA 4LDXA 2E65A 3OY9A 1Q86C 2V8IA 4XK8E 1YJ9T 3E9FA 3OYIA 3META 2WSFE 4M78E 4A4EA 5GANh 4M7DD 3CBMA 2A7YA 2BKDN 1M1GA 3FIFA 4LDYA 3I56T 2GQVA 3CC7A 2JVVA 3JSCA 1YJ9A 3LWIA 1Q81C 3KUFA 2LTOA 3OYGA 3CCET 1YIJA 2ZPIB 4JRKA 3CCJT 3NTHA 1EIFA 2RHIA 3E9GA 1Q81U 5J3BA 4M75C 3E1SA 5A0DA 3H6ZA 4M78G 2YLBA 3HRSA 1D3BA 2K5IA 3LX7A 4M78C 4M75F 2PU9B 3SB2A 4ZGDB 2JTFA 3OA6A 3OYBA 5C0MA 5A0LA 1LJOA 3SWNC 2CZ0B 4M7DC 1PSEA 4ZN1A 2LT1A 4J83A 2LX9A 1XNIA 4M77B 4NL2A 4V2SA 2BUDA 1M5Q1 3QUIA 2L8DA 4EMGA 3JB9I 4NS5A 1KQSS 3URGA 1N8RC 3JCMf 1D3BB 2DIQA 4ZTJA 1JBMA 3WXMB 4HCBA 3M54A 4GY5A 4M7AD 3GP8A 3OB9A 3SWNA 4D6WA 1M9SA 3VJPA 3L2RA 3JCMe 3CMEA 2DK3A 3GIBA 2QQBA 1HXDA 4M78B 2EJFA 5GAN2 2EQMA 1SSFA 2XIDA 1IREB 4YTLA 1MHNA 2YHTA 4OMFB 4LD6A 2Y4XA 2P0PA 4IUQA 4OVAA 4QQGA 5GMKm 2CKKA 1MGQA 3M57A 1FX7A 3PIOA 4XQ3A 1KG1A 2RA2A 2M0OA 4MMLA 3JB9J 1NE8A 5D6WA 2E70A 4M7DG 2DXUA 4M78D 4XTZA 5CKHA 3CCSA 1YHQT 3CMAT 2YRVA 5GANg 3GNGA 2EQKA 2E41A 4XTYA 2LT4A 5KCHA 5HKCA 4PKCC 4C0DB 4BE2A 2QXFA 2LVMA 3OYKA 3OMCA 4XTUA 1UEBA 3DLMA 4M77E 3CXCA 3CBOA 2ZPEB 3A8HB 4M75D 4C5EA 5GMKi 1VIFA 5LJ5j 1K73U 3RERA 2ZPBB 1WQ7A 3BFMA 5LJ3h 3JB9H 1V29B 5I2SA 2QEXA 1Y96A 3UT1A 4MDXA 3M9QA 4XU3A 1QP3A 2DD4A 4BY6C 3CCUA 1YJNA 1VQMA 1VQ5A 4XAXB 2G3RA 3CCQA 1WJRA 1NZ9A 1VQ8T 4N4HA 3ER0A 3PFSA 2OTJT 1M1KC 2RM4A 3CCQT 3OS5A 3OYHA 4PJOG 2MMPA 2I2LA 2DJZA 5CR2A 3QYHB 3CCRT 2D9TA 1Y96B 2GFUA 2EJ9A 3M53A 4HCZA 4QQ6A 1N6AA 2K4YA 4VUBA 5LL6S 4JS5A 2DAQA 4C0GA 3QYGB 4JS4A 3CEYA 5L8RE 3JCMV 3PGGA 1VQ7T 2ZPHB 3HHTB 3F70A 2ZPFB 4ELZC 2VXFA 3JCMJ 4LDVA 2K5FA 4QQDA 3SD4A 1M1FA 4BI8B 2K3YA 4P5NA 4F7UF 4E7LA 4MZTA 1X75C 4A54A 4QVZA 4JJNK 1VQ7A 4HKEA 2RK1A 2F5TX 3CCLA 1RL2A 3FJPA 3HFNA 4C5GA 5GANe 3P8BB 3WVEB 1GXIE 4M75G 5M9OA 2QQSA 2B8AA 2EYQA 3JCMP 2OTLA 4C92F 2DO3A 4ZN3A 4O6JA 2MI6A 4MZPA 2PVDB 1QVGS 2BIVA 5J26A 2QEXT 3CCVT 4EMHA 1BIAA 4M7DF 4M77D 5IT9E 1X01A 5LJ5f 1BI0A 3EFRA 3OQ5A 5J39A 1VQ8A 4BI4A 3JCMd 2GCXA 1KHCA 2E64A 3T9NA 4PLLA 2X4WA 5CQXA 5LJ5g 1VQKA 1KC8U 5GAOr 4FSXA 3CPWS 4M7AE 1H641 2R5AA 2XICA 3BY7A 4J7FA 2XDDA 3OS0A 1Q86U 2K2VA 2DD5A 4KBMB 3RMSA 3UWNA 4OB2B 2L3RA 2CZ6B 2LC4A 4JLGA 4EMKB 3L2QA 4QVDA 2IG0A 2RK2A 4C8QG 4BDYA 2VGNA 3OYNA 1N9RA 3TEEA 2KK4A 4HA8A 3OYFA 1VIEA 2XK0A 3CCMT 1UGPB 5GAMg 1N8RU 3RKXA 4C8QA 4RMOA 2LRQA 4UC4A 2VUBA 5GANd 3JCMX 2RJCA 4A4HA 1I4K1 2MAMA 4X9DA 3VUZA 3LH0A 5D6XA 3VKIA 4IUTA 1FXXA 2RHZA 2X4JA 3MO8A 1U1SA 1VQ4A 5FRMA 2LQKA 4OGCA 3X26B 4A53A 5FRNA 2DEQA 1OZ3A 4O5VA 1M4ZA 4M7AC 2E12A 4OB0B 4JRIA 3G4ST 1B34A 3PNWC 1VQ4T 2FL7A 4C92D 2RJEA 4XU0A 2QQ9A 3PIPA 3CCJA 1KC8C 2DPPB 3PTAA 2DTHA 3GPLA 4C0ZA 3OYMA 2VXEA 4C92E 4FT4A 3RESA 4A4GA 4C92A 3M59A 3GNFB 3QJYA 4L6V5
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RA2 A;  4MML A;  3JB9 J;  3JB9 G;  2FB7 A;  4JLI A;  4M7D G;  2DXU A;  4M78 D;  4XTZ A;  4M7D E;  4J6W A;  4C8Q B;  2EJG A;  2DVE A;  3M4G A;  4Y91 A;  5LJ5 h;  4XTY A;  2E41 A;  2RD1 A;  5GAN g;  1M8V A;  4N0A A;  5GAN 8;  1WPY A;  2Y90 A;  1I8F A;  4C92 C;  4M78 F;  4XTU A;  5CAI A;  4RCC A;  4HT9 A;  2DTI A;  4M77 E;  1TH7 A;  1WQW A;  3JB9 F;  4C92 B;  1JRI A;  4M75 D;  5GMK i;  3L2Z A;  2CGH A;  2VC8 A;  4C8Q D;  5GAM h;  4F7U E;  3JCM W;  5LJ5 j;  1I81 A;  4N0A C;  4NOY A;  5LJ3 h;  1WQ7 A;  3BFM A;  2DZC A;  5GAO l;  3JB9 H;  3RER A;  3RKY A;  1Y96 A;  4PJO E;  4XU3 A;  4PJO A;  4M77 G;  3JCM b;  4C8Q F;  1LOJ A;  4JUV A;  5GAO n;  4J6X A;  3RIR A;  3V8K A;  4F7U B;  4HT8 A;  3HFO A;  4C92 G;  4M7A B;  2K57 A;  2DKG A;  2RB6 A;  2RM4 A;  5GAN 6;  5I21 A;  4M77 A;  4PJO G;  2I2L A;  2DJZ A;  4PJO C;  3BW1 A;  3RUX A;  4XTW A;  3V7R A;  3V7S A;  4PJO B;  3JCM h;  3JCM Q;  1Y96 B;  2EJ9 A;  5DY9 A;  3QSU A;  4M7D B;  3SWN B;  3JCM V;  3PGG A;  2DZ9 A;  4M77 C;  3V8L A;  3EFS A;  1YCY A;  2VXF A;  3JCM J;  5GAO p;  5GAN f;  4J6Y A;  4WF2 A;  3JCM c;  4F7U F;  4RCB A;  5GAO q;  4EMK A;  3RKW A;  1B34 B;  4A54 A;  5GAN 5;  4X9C A;  3L1A A;  2QTX A;  4J5Y A;  3FJP A;  3HFN A;  5GAM f;  5GAN e;  5LJ3 j;  4XU2 A;  4M75 G;  4XTV A;  4OP0 A;  3JCM P;  3BDU A;  4C92 F;  3V7C A;  5GAM e;  5LJ5 e;  3HSB A;  2YLC A;  4M7A G;  5GAM d;  2DTO A;  3QO3 A;  4M75 B;  4EMH A;  4EMK C;  4F7U G;  1BIA A;  4MMK A;  4M77 D;  5GMK h;  1X01 A;  5GAN 3;  4M7D F;  5LJ5 f;  4XU1 A;  3QHS A;  3EFR A;  5GAN 4;  2E65 A;  5GMK e;  1HK9 A;  3JCM d;  2E64 A;  4M78 E;  4M77 F;  5LJ5 g;  5GAN h;  4M7D D;  4QVC A;  5GAO m;  5GAO r;  4PJO D;  3FIF A;  3JCM g;  5GMK j;  1U1T A;  1KQ2 A;  4M7A E;  1H64 1;  3BY7 A;  5GMK l;  5LJ5 d;  5GAM j;  4JRK A;  5LJ3 f;  4C8Q C;  4PJO F;  3JB9 D;  4M75 C;  4EMK B;  2ZGW A;  4M78 G;  2YLB A;  4M75 F;  1D3B A;  2EWN A;  4M78 C;  3SB2 A;  3V8J A;  4QVD A;  5LJ3 e;  4NL3 A;  3AHU A;  5LJ3 d;  4C8Q G;  1LNX A;  1N9R A;  1LJO A;  2E1H A;  1BIB A;  4HA8 A;  3SWN C;  5GAN j;  4M7D C;  5GAM g;  3RKX A;  4C8Q A;  2DXT A;  2EAY A;  4M75 A;  4M77 B;  4NL2 A;  4PNO A;  5LJ3 g;  2FYK A;  4EMG A;  1M5Q 1;  3QUI A;  4V2S A;  5GAN d;  4M78 A;  3JCM X;  3JB9 I;  1I5L A;  1I4K 1;  1D3B B;  3JCM f;  1JBM A;  4X9D A;  1N9S A;  4M7A D;  3SWN A;  4M7D A;  3JCM e;  4XTX A;  3GIB A;  1U1S A;  4DQ2 A;  4A53 A;  4M7A F;  2DEQ A;  4M7A C;  2JN0 A;  1HXD A;  4M78 B;  4JRI A;  2EJF A;  1B34 A;  1WNL A;  3FB9 A;  5GAN 2;  4C92 D;  5GAN 7;  4XU0 A;  2YHT A;  3INZ A;  4C8Q E;  2DTH A;  4M75 E;  3VU3 C;  5GMK m;  4F7U A;  1KQ1 A;  2VXE A;  4C92 E;  1MGQ A;  3RES A;  4C92 A;  4M7A A;  2E10 A;  4XQ3 A;  2HNI A; 
#chains in the Genus database with same CATH topology
 1VQ9 A;  1VYV A;  1KC8 R;  4OF1 A;  4JLI A;  3CPF A;  2CUD A;  4C8Q B;  4JJB A;  4A63 B;  1UGR B;  3CMA Q;  1M90 C;  5GAN 8;  4PLI A;  5CAI A;  1NLO C;  2DTI A;  1B3Q A;  4LD9 K;  3LGF A;  4F17 A;  1ZSG A;  3G1J A;  2VGM A;  4DA4 A;  1YI2 T;  4GLK A;  4PJO A;  2KAF A;  1WI7 A;  1U06 A;  2RF0 A;  1UGQ B;  4HT8 A;  2YUO A;  2DBM A;  4OMQ A;  5I21 A;  1PM3 A;  1RUW A;  1H3Z A;  1WHH A;  1GCP A;  2C06 A;  3UF4 A;  4ORZ A;  3HRU A;  4TVR A;  1RAF B;  1NBE B;  3CCL T;  3NHN A;  3SWN B;  2QQA A;  2E6N A;  4MDW A;  2DL5 A;  2KMT A;  2R58 A;  5GAN f;  3CCS Q;  2FPE A;  3A8G B;  1VQ6 A;  1C6V X;  2H3J A;  2COY A;  2PVG B;  1TU0 B;  4X9C A;  2HEQ A;  4J5Y A;  3QWY A;  3G6E A;  1VQK Q;  3CD6 T;  3EGX B;  4XTV A;  3FRN A;  1YJN T;  1ACM B;  3LGL A;  2YLC A;  4B9X A;  2NLU A;  5FU6 B;  2DTO A;  4J9G A;  5GAN 3;  3EGD A;  4MMK A;  1Q7Y U;  1Z9Q A;  3LW5 E;  2RI2 A;  4OMN A;  2HQX A;  4M77 F;  2X4X A;  1K9M U;  3CBP A;  2VYT A;  1ZLM A;  5LJ5 d;  4ATO A;  3DB3 A;  2MYS A;  1PG5 B;  2RI3 A;  2O4X B;  4HVU A;  1LNX A;  4ZTF A;  1E6H A;  1BIB A;  3EFO A;  2CZ7 B;  4KRT A;  4IUP A;  2HZY A;  1W2B A;  1MUZ A;  2VVK A;  1I07 A;  2EVR A;  2RO0 A;  2EQU A;  4BE1 A;  2JTM A;  4PJJ A;  1X6B A;  3G71 Q;  2O88 A;  2AIR B;  4CI0 C;  3OYY A;  2OI3 A;  4F7U A;  4BY6 B;  1TUG B;  2CP7 A;  2HNI A;  2F2W A;  1SPK A;  1X2K A;  1SEM A;  2EJG A;  3M0R A;  3M4G A;  6AT1 B;  4C0D C;  3I55 Q;  1QCO A;  1M8V A;  4RCC A;  3ZFJ A;  1MMD A;  3QJ6 A;  4AFZ C;  3OW2 A;  3MP1 A;  1H8K A;  2DZC A;  4OB1 B;  2EPD A;  2H8H A;  2FVU A;  3RKY A;  1K9M C;  1VQL A;  1YBY A;  4QW2 A;  2I0N A;  2HL5 C;  2K57 A;  2ZCF B;  2F5K A;  1D1C A;  5ECA A;  3C94 A;  2OJ2 A;  4M77 A;  4EPC A;  2HDA A;  3MHX A;  1G2B A;  4PJL A;  3NFC A;  4DEX A;  2QTV A;  4KH1 B;  1VQO A;  4OMO A;  3CCR Q;  2QA4 A;  1G3T A;  1TXQ A;  4M7D B;  2LDM A;  5FRO A;  3P8D A;  5L23 A;  4JRP A;  3A8O B;  3L1A A;  3E2U A;  2CS7 A;  3CCS T;  2IIM A;  3KXT A;  1MV3 A;  4E47 A;  3J80 E;  4M7A G;  3LWH A;  2F1L A;  4FT2 A;  5GMK h;  4XU1 A;  1M8M A;  5KYY B;  3VS5 A;  1IO6 A;  1LVK A;  5GAO m;  1U1T A;  3CME T;  2DIG A;  1KK7 A;  2V8K A;  1MMN A;  1A0N B;  4ME7 A;  4PJO F;  2K7A A;  3V8J A;  4ZGE B;  1AZE A;  4E2F B;  2WSC E;  1OOT A;  2AHJ B;  1CKB A;  4EIK A;  3OW2 P;  4WTO B;  2LCC A;  3JRZ A;  4J8O A;  1VQP Q;  3VYG A;  5IH2 A;  1YHQ A;  1NJI R;  4C5I A;  1K0X A;  5DM7 R;  4M7A F;  1WNL A;  5GAN 7;  4OGE A;  2BZY A;  1GFC A;  3VS3 A;  1KQ1 A;  2E6Z A;  4LUE A;  1VQ5 T;  5CKB A;  3VS7 A;  4A4K A;  3EFO B;  1AWW A;  4Y91 A;  1K4U S;  4E7Z A;  4N0A A;  3PT9 A;  4E7J A;  1FYN A;  2HL3 A;  2A3L A;  3JB9 F;  3L2Z A;  4F7U E;  2XHC A;  1VQO Q;  5A0G A;  1XJW B;  1SG5 A;  1J3T A;  4M77 G;  2Y4Y A;  2ECZ A;  2RI5 A;  2HMA A;  1M27 C;  3EG9 A;  3CCV A;  1K9M R;  1G5V A;  1HJD A;  4X34 A;  1KD1 R;  2HBW A;  4M7A B;  3EGD B;  3OYL A;  1KHI A;  1KD1 U;  5GAN 6;  4B9W A;  2JW4 A;  1YCS B;  2DEU A;  2E5K A;  3V7S A;  3JCM Q;  5GJV B;  2EBP A;  5HK0 A;  2D6F A;  2DXB A;  4GBQ A;  4XU2 A;  2HQH A;  2DFU A;  4OP0 A;  3FC3 A;  1MV0 B;  3V7C A;  3MCA B;  3S3M A;  3HKS A;  2EKO A;  1EX4 A;  4A4E A;  1F1B B;  3CBM A;  3UAT A;  3I56 T;  1Q81 C;  3JSC A;  3LWI A;  3OYG A;  2EGE A;  1SSH A;  5J3B A;  1IHW A;  1Q86 C;  1D3B A;  4ZGD B;  2PU9 B;  3SEM A;  2JTF A;  3OA6 A;  1WIE A;  4GLM A;  5A0L A;  1QQJ A;  2QYZ A;  1TTH B;  1XNI A;  2LX9 A;  2BUD A;  1I0C A;  3JB9 I;  4NS5 A;  1VQ8 Q;  3JCM f;  3WXM B;  1E6G A;  4PFP A;  4HCB A;  4D6W A;  3VJP A;  3L2R A;  3JCM e;  4PK4 A;  2K3B A;  2ED1 A;  2L3S A;  3CCL Q;  2YHT A;  2P0P A;  1MGQ A;  3M57 A;  4XQ3 A;  1KG1 A;  1NE8 A;  4XTZ A;  3CMA T;  4KGV B;  1WHJ A;  4R0K A;  1AOJ A;  4PKC C;  2QXF A;  3OYK A;  3DLM A;  4QT7 A;  2ZPE B;  3A8H B;  5GMK i;  1VIF A;  2KRO A;  1K73 U;  2ZPB B;  3JB9 H;  2DF6 A;  2QEX A;  2D0N A;  1Y96 A;  3CCJ Q;  4MDX A;  2KBT A;  4XU3 A;  2DIL A;  1YJN A;  2KRN A;  3CCU A;  2G3R A;  1VQ8 T;  3H0H A;  4N4H A;  2W10 A;  3PFS A;  2VB6 A;  1M1K C;  2RM4 A;  3OS5 A;  4PJO G;  2W0Z A;  2DJZ A;  4Z8A A;  3D7S B;  2D9T A;  1Y96 B;  3M53 A;  4QQ6 A;  4KUD K;  1N6A A;  2K4Y A;  2DAQ A;  4C0G A;  4JS4 A;  5L8R E;  3PGG A;  2ZPH B;  2P84 A;  1BK2 A;  4RTY A;  2VXF A;  2K5F A;  4QQD A;  1M1F A;  2K3Y A;  4P5N A;  2GNC A;  4M75 G;  5IXB A;  1H3H A;  2GBQ A;  2DO3 A;  4ZN3 A;  2ABL A;  2PVD B;  3CCV T;  4KH0 B;  1BI0 A;  3OQ5 A;  5IHK A;  1MNE A;  3T9N A;  5CQX A;  5GAO r;  2DD5 A;  4KBM B;  1FMW A;  1OU8 A;  3RMS A;  5KYY A;  4OB2 B;  2L3R A;  4JLG A;  4EMK B;  4FYY B;  4C8Q G;  3OYF A;  3CCQ Q;  2PTK A;  2J6O A;  1BU1 A;  2BE7 D;  2DL7 A;  4A4H A;  1I4K 1;  2FRW A;  1GL5 A;  1VQ4 A;  4CC2 A;  3X26 B;  2YT6 A;  5FRN A;  2E12 A;  3G4S T;  2FL7 A;  1UJ0 A;  4XU0 A;  1KC8 C;  4AG2 C;  3EG9 B;  2VXE A;  4FT4 A;  3RES A;  4C92 A;  3M59 A;  3QJY A;  1M90 R;  3FJ5 A;  1OV3 A;  2BZX A;  5CKE A;  4FL6 A;  2R5M A;  1WJQ A;  3FDR A;  3GF5 A;  3O8V A;  3CXC P;  3S3O A;  4C92 B;  1QW1 A;  2KXD A;  3CC2 A;  2P0Q A;  3JCM W;  4C8Q D;  1I81 A;  2QA4 T;  4N0A C;  2DL4 A;  4JUV A;  1HYO A;  3CXC S;  4II1 A;  3HFO A;  4C92 G;  1Y0M A;  1RAG B;  2X4Y A;  1Y7X A;  1BI3 A;  4PJO C;  3DKM A;  1W2B S;  4DBQ A;  3CC4 A;  5CKF A;  2JM9 A;  2A08 A;  1MND A;  4N4I A;  3MKD A;  1D1B A;  1JJ2 S;  1BYM A;  4J6Y A;  1KQS P;  4EMK A;  5GAN 5;  1IGU A;  4RTZ A;  2FO0 A;  4PFO A;  3BDL A;  4E7I A;  2GQI A;  3VS6 A;  1Q82 R;  2P4R A;  1Z9Z A;  3TSZ A;  3M5A A;  4IIO A;  3L2U A;  3RNJ A;  3CC2 Q;  5AT1 B;  5GMK j;  5IHI A;  1AWJ A;  1VQN Q;  1VUB A;  1SF9 A;  3PVL A;  3H9N A;  7AT1 B;  3R6N A;  1OPL A;  5A2Q E;  2AT1 B;  4F14 A;  1NPP A;  3QDR B;  4ZGJ B;  1KJW A;  2K3X A;  4M75 A;  5FU7 C;  3RR6 A;  2L89 A;  2XDB A;  3VS4 A;  1I5L A;  5CVI A;  4M7D A;  2QQR A;  3HL8 A;  4XTX A;  3JAM E;  1DJ7 B;  1JQQ A;  5C6S A;  1T0H A;  3FB9 A;  3REB B;  5IXF A;  2NUT A;  4JZ4 A;  1YJN Q;  2K5L A;  1W1F A;  1ABO A;  2DBK A;  2KGT A;  2DYB A;  3JB9 G;  1YHQ Q;  4Q5W A;  3I56 A;  2EYX A;  3SHW A;  2HSP A;  4M78 F;  1BI2 A;  1GCQ A;  4HCC A;  4WCI A;  2EW3 A;  2JZ2 A;  5HCK A;  3EHR A;  2LNV A;  5CCA A;  1HD3 A;  1VQN T;  4BB7 A;  2X35 A;  3MEA A;  2RQV A;  2O2O A;  3RIR A;  4F7U B;  3PE0 A;  1FWZ A;  3CC7 Q;  3I5S A;  2QI2 A;  1E7O A;  3OYD A;  2SEM A;  2YDL A;  4A4F A;  2EQI A;  1D0X A;  5DY9 A;  2EYY A;  4Z02 A;  5KCO A;  2DZ9 A;  4M77 C;  1JXO A;  1OU9 A;  3NTK A;  2JS2 A;  2JT4 A;  2QGF B;  4E7S A;  1UHF A;  4LDW A;  1G3S A;  1LPL A;  2O01 E;  2LQW A;  1VQN A;  2M1H A;  2VV5 A;  5KH6 A;  1NYF A;  1HK9 A;  3OMG A;  3SDZ A;  2O9V A;  3CCE Q;  1VQ9 T;  1QLY A;  1QVG A;  3G7Z A;  1JJ2 A;  2EFI A;  5LJ3 f;  1WXT A;  1VQM T;  1AHJ B;  1WZO A;  2NWM A;  1XQH A;  2VWF A;  1WGS A;  5FWC A;  2JMC A;  5LJ3 e;  3CCM Q;  2F2V A;  3TCJ A;  2J7I A;  2PVO B;  2FYK A;  2E3I A;  3LH5 A;  2DJQ A;  2CT4 A;  4AMC A;  2DRK A;  3ZBD A;  1QCN A;  5KE2 A;  4R56 A;  2AKL A;  3MEU A;  1TUC A;  4M75 E;  2DER A;  3WVD B;  1TWB A;  2EYW A;  4DBF A;  2E10 A;  3H0I A;  1Y07 A;  1XOV A;  3OYC A;  1X69 A;  5LJ5 h;  2OTJ A;  3I5R A;  1JXM A;  1CSK A;  3CCR A;  2QA4 Q;  4HT9 A;  1K0S A;  2L0A A;  1JRI A;  5GAM h;  1M3A A;  1K73 R;  5GAO l;  3S6W A;  5CKD A;  3EHQ A;  3FLG A;  2RB6 A;  5KYX A;  1UB4 A;  3V7R A;  2M9U A;  1KD1 C;  2HAX A;  2FEI A;  3OSV A;  2CP0 A;  2DET A;  3C95 A;  3VYH B;  4E7H A;  2CT3 A;  1K8A U;  2C0I A;  2PQW A;  1M3C A;  1OPK A;  1S72 T;  2LP5 A;  1W2B P;  1VQK T;  3CD6 Q;  1VQL T;  3OS2 A;  9ATC B;  5GAM f;  4RTT A;  1PD0 A;  1ZHI A;  3JV3 A;  1RAC B;  2DX1 A;  2IVW A;  2BZ8 A;  3HSB A;  4EMK C;  3CC2 T;  5DLQ E;  1JB0 E;  3NTI A;  1BI1 A;  2E65 A;  2V8I A;  2KRS A;  1YJ9 T;  2WSF E;  2X51 A;  4M7D D;  5GAN h;  2DNU A;  1EZZ B;  2A7Y A;  2BKD N;  1M1G A;  4PJM A;  1YJ9 A;  1D1A A;  2LTO A;  3CCE T;  2LCS A;  4JRK A;  3NTH A;  1EIF A;  4CC4 B;  4M75 C;  5A0D A;  4M78 G;  2PNI A;  2YLB A;  3HRS A;  3GBQ A;  4M75 F;  2CRE A;  2YRC A;  5C0M A;  1LJO A;  3SWN C;  4J9C A;  4M7D C;  2LT1 A;  2AKK A;  4NL2 A;  3QUI A;  2L8D A;  4DBR A;  3URG A;  1LCK A;  2FZK B;  4K11 A;  4RTV A;  4M7A D;  3GP8 A;  3EGU A;  1BB9 A;  1S72 Q;  1M9S A;  3CME A;  2DK3 A;  1WXU A;  2FPD A;  1IRE B;  1FMV A;  2F2X A;  2QAZ A;  5GMK m;  4IUQ A;  1YIT Q;  3JB9 J;  2M0O A;  3CQT A;  4M7D G;  4M7D E;  3CCS A;  2EQK A;  4XTY A;  2LT4 A;  2H3E B;  3OMC A;  3CXC A;  4M77 E;  1YJ9 Q;  3CBO A;  1WLP B;  4J9I A;  2KR3 A;  3M0U A;  2Z0W A;  8AT1 B;  5LJ5 j;  2CUB A;  1WQ7 A;  4D8D A;  3MJX A;  1YNZ A;  3UT1 A;  3M9Q A;  5KYW A;  4ANJ A;  3CCQ A;  1PKS A;  1NZ9 A;  4AFS C;  2K79 A;  2GGR A;  2YRD A;  1IB8 A;  3CCQ T;  2SRC A;  2VAS A;  2CDT A;  3CCR T;  2GFU A;  2EJ9 A;  2J6K A;  3M0S A;  3QYG B;  3JCM V;  2ZPF B;  1BBZ A;  1FMK A;  4LDV A;  2CP3 A;  1RAB B;  2EYZ A;  1X75 C;  4MZT A;  4QVZ A;  4A54 A;  3VS1 A;  2RQW A;  2RK1 A;  3FJP A;  3WVE B;  5M9O A;  3JCM P;  1RAE B;  4C92 F;  4MZP A;  2QEX T;  4EMH A;  4M77 D;  5IT9 E;  5LJ5 f;  3VRZ A;  3EFR A;  2GTJ A;  1VQM Q;  5LJ5 g;  4OMP A;  2NYS A;  3BY7 A;  3OS0 A;  3QDF A;  2CZ6 B;  2NUZ A;  4QVD A;  2DMO A;  4PJN A;  2IG0 A;  3I9Q A;  1HSQ A;  2RK2 A;  2KT8 A;  4BDY A;  2VGN A;  4HA8 A;  1VIE A;  3CCM T;  1N8R U;  1UGP B;  4UC4 A;  2DRM A;  1ZUY A;  4Z89 A;  3LH0 A;  4FW1 A;  1FXX A;  3MO8 A;  1U1S A;  4F16 A;  2DEQ A;  1OZ3 A;  1M4Z A;  3I35 A;  1B34 A;  1VQ4 T;  2RJE A;  2QEX Q;  3CCJ A;  5IHN A;  3H0F A;  1YWO A;  4A4G A;  3CCV Q;  4M7A A;  3EH1 A;  4L6V 5;  2CP6 A;  2QGG A;  3M58 A;  2DVE A;  1NM7 A;  4OMM A;  4BD3 A;  1VQ5 Q;  3KBG A;  3M0T A;  1YWP A;  1R0B G;  1VQ6 T;  2E4H A;  3QWX X;  1TH7 A;  3QZ5 B;  1I1J A;  1IGQ A;  2RNA A;  2VC8 A;  1SHF A;  2XD0 A;  1V76 A;  2RPN A;  4PJO E;  2ZAE A;  3JCM b;  5GAO n;  3CC7 T;  2WAC A;  1NEG A;  3V8K A;  3R6O A;  8ATC B;  1Q82 C;  3C4S A;  2JM8 A;  2NUP A;  2DXC A;  1R0C B;  4DOV A;  3DB4 A;  3QSU A;  2L5Q A;  2XKO C;  1G8X A;  4JRQ A;  3OYJ A;  1QVF A;  4IIM A;  1IRX A;  2QK0 A;  3RKW A;  3M0P A;  2QTX A;  4HXJ A;  1RAD B;  4E7K A;  5GAM d;  1X6O A;  2LMJ A;  1AT1 B;  3OS1 A;  4MZM A;  4HVW A;  3LLR A;  4FSS A;  4PJO D;  1TS9 A;  2PZ1 A;  5GAM j;  4HVV A;  2HBP A;  2ZGW A;  3AHU A;  4NL3 A;  3PMI A;  5LJ3 d;  3MEV A;  1G83 A;  2HCK A;  1W4S A;  1KQ2 A;  2JMA A;  4BE0 A;  3M0Q A;  4RKU E;  2CYZ B;  1U3O A;  4ZNX A;  2OAU A;  2X3W D;  2L2P A;  3EG0 A;  1G3Y A;  3HTR A;  4FM4 B;  3J7A F;  4J9F A;  4D8K A;  1IHV A;  2C0O A;  2XU8 A;  4DBH A;  2MOX A;  3INZ A;  1RI9 A;  2LQN A;  3EAE A;  1R77 A;  1AZG B;  4FW2 A;  2FB7 A;  1T3S A;  1MMG A;  1OYX A;  2Y90 A;  1I8F A;  3ULR B;  2JXB A;  5AYF A;  4C5H A;  2KE9 A;  2CZ1 B;  3ASK A;  2PUK B;  3G4S A;  2M16 A;  1K1Z A;  4M4Z A;  3QKJ A;  1GCQ C;  1BCM A;  2OTJ Q;  2KVQ G;  2COZ A;  3HRT A;  3M56 A;  1YJW A;  3HP9 A;  5KE3 A;  2KYM A;  3X28 B;  2GF7 A;  2M51 A;  2CH4 W;  1ZQ1 A;  1T3L A;  3N5B B;  3VUB A;  4B6M A;  2MF2 A;  1WJS A;  4J7I A;  4FIB A;  1VYT A;  3Q1J A;  3OBY A;  3NGP A;  2EKH A;  1YCY A;  1PKT A;  4IKF A;  5CQY A;  2MWP A;  1OUL A;  1QP2 A;  2X9H A;  5EG2 A;  1M3B A;  2RHU A;  2RHY A;  3CPW A;  5GAM e;  2KY9 A;  3QO3 A;  4M75 B;  1RAH B;  1RLP C;  2RQT A;  5D7U A;  3I55 A;  5EC7 A;  4QVC A;  3RBB B;  1ZUK A;  2RJD A;  2B86 A;  4J9B A;  1PSF A;  2HQE A;  5GMK l;  3OY9 A;  3L2V A;  1OI1 A;  1UGS B;  1C1A A;  3UDC A;  2L3Q A;  1QVF S;  1ZBJ A;  1YI2 A;  3ZEH A;  4BDZ A;  1YJW Q;  2JTE A;  1I5O B;  2DXT A;  2JNG A;  5LJ3 g;  1N8R R;  2K9G A;  4PNO A;  1QWE A;  4Y28 E;  1QVF P;  1NJI C;  3REA B;  1OX9 A;  3ME9 A;  4DQ2 A;  4FYV B;  3MP8 A;  2CP5 A;  4JZ3 A;  3P8H A;  2ZPG B;  4LE9 A;  2OAW A;  2BTT A;  2P0K A;  3MP6 A;  2YWW A;  4OB3 B;  3VS0 A;  1IZ6 A;  2FPF A;  1B07 A;  4QKU A;  1UE9 A;  2JUF A;  4CC3 A;  3QZ9 B;  2EQJ A;  1D09 B;  1V1C A;  1K9A A;  2A28 A;  2GFA A;  3M4Y A;  3E19 A;  3FEO A;  1YJW T;  1PHT A;  3OW2 S;  3QXE B;  3CCM A;  2NUT B;  1VQP A;  1G3W A;  1UHC A;  2J05 A;  1VQP T;  3G71 A;  1TSF A;  4RTU A;  4XTW A;  2PUO B;  2WSE E;  1AD5 A;  1O75 A;  2YUN A;  3C0C A;  1QVP A;  4KT0 E;  2ZZD A;  3JCM c;  1OZ2 A;  4KUL A;  2LX7 A;  1K8A C;  1KIK A;  5IAY A;  1YIT A;  3DLL A;  1S72 A;  2DM1 A;  1VQ4 Q;  1YIT T;  1PC0 A;  1UEC A;  2KSS A;  5DLO A;  4LDX A;  5D6Y A;  1W6X A;  1SRL A;  4XK8 E;  1AWO A;  3OYI A;  2XMF A;  4J9D A;  3FIF A;  1VQ9 Q;  1Q86 R;  2JVV A;  1ABQ A;  2X3X D;  1SKU B;  1UJY A;  1YIJ A;  2ZPI B;  3CCJ T;  2RHI A;  3E9G A;  1Q81 U;  3E1S A;  4PFZ A;  3H6Z A;  1Q81 R;  3LX7 A;  4M78 C;  1S1N A;  3EGX A;  1WXB A;  2FRY A;  4ZN1 A;  4M77 B;  1YN8 A;  4V2S A;  1VYU A;  2O31 A;  3RDV A;  4JJC A;  4EMG A;  2A36 A;  1YP5 A;  1N8R C;  2DIQ A;  1PD1 A;  3OB9 A;  3SWN A;  2DVJ A;  3GIB A;  1NG2 A;  2QDL A;  1HXD A;  2D8H A;  2QQB A;  3EG3 A;  4M78 B;  4AFQ C;  2EQM A;  4OMF B;  4LD6 A;  4X1V A;  2CKK A;  2M02 A;  2V1Q A;  1FX7 A;  4LNP A;  2RA2 A;  1X27 A;  5D6W A;  1M1K R;  5CKH A;  2E41 A;  5HKC A;  4LXC A;  4C0D B;  4BE2 A;  2LVM A;  4XTU A;  1GBR A;  1UEB A;  1C0M A;  2AK5 A;  2FZG B;  4M75 D;  2CSI A;  2ESW A;  1VA7 A;  1V29 B;  1PWT A;  1QP3 A;  1VQM A;  1VQ5 A;  1WJR A;  1QWF A;  2RQR A;  3ER0 A;  1JJ2 P;  2RQU A;  3OYH A;  1UTI A;  2MMP A;  5CR2 A;  3QYH B;  4KGX B;  4JS5 A;  1Y57 A;  2O9S A;  3HHT B;  4ELZ C;  3SD4 A;  3TQ7 P;  4HKE A;  2F5T X;  2LZ6 B;  5GAN e;  3HFN A;  3CCL A;  3P8B B;  1ZSZ B;  1VQL Q;  2B8A A;  4O6J A;  2MI6 A;  4M7D F;  1VQ8 A;  5J39 A;  4BI4 A;  3JCM d;  2GCX A;  1KHC A;  1KC8 U;  1ZX6 A;  3TSW A;  3CPW S;  1H64 1;  2XIC A;  4J7F A;  1Q86 U;  2K2V A;  4DEY A;  2YXY A;  1SRM A;  1N9R A;  3TEE A;  3RKX A;  3JCM X;  2RJC A;  1UDL A;  2MAM A;  1KFZ A;  4X9D A;  2IPO B;  3VUZ A;  5D6X A;  4IUT A;  2X4J A;  5FRM A;  2LQK A;  4A53 A;  4O5V A;  1RAA B;  1D0Z A;  4OB0 B;  3PNW C;  4C92 D;  1PRL C;  2QQ9 A;  3PIP A;  2DPP B;  2DTH A;  3GPL A;  3OYM A;  1WDX A;  1KQS S;  4ZTJ A;  3A8L B;  1TG0 A;  3I55 T;  1M90 U;  4J6W A;  3TU4 K;  4IUU A;  2RD1 A;  2ED0 A;  1TUD A;  2V1R A;  1P92 A;  4C92 C;  2YUP A;  1ZBX A;  5GJW B;  1VQO T;  5I22 A;  1K73 C;  2CSQ A;  1WQW A;  2J6F A;  4BUG A;  1WHL A;  4LN2 A;  1O9S A;  2CGH A;  2J06 A;  5CK9 A;  4NOY A;  1NYG A;  1JEG A;  4DOW A;  1K76 A;  4KUI A;  1M1K U;  3CPW P;  3NMZ C;  5CO7 A;  1H92 A;  3OBW A;  3BW1 A;  1WHK A;  1Q82 U;  2GTO A;  1MMA A;  3JCM h;  1WYX A;  1U5S A;  1RLQ C;  2LCL A;  3VV0 A;  2JS0 A;  2R57 A;  3IQL A;  1UGV A;  3CCU T;  4ELY C;  3QPH A;  4RCB A;  1N5Z A;  5LJ3 j;  1AVZ C;  2V26 A;  4FU6 A;  2L3P A;  5CIU A;  3BDU A;  1ZA2 B;  2G6F X;  1Q7Y C;  5LJ5 e;  3OSS C;  2F69 A;  1GRI A;  2KDS A;  1VQ6 Q;  4AG1 C;  5GMK e;  3CMA A;  5FLX E;  4RG8 A;  3S3N A;  1W70 A;  4IUV A;  3OYA A;  3HPW A;  3CME Q;  1TOV A;  1VOM A;  2YUQ A;  3JCM g;  1IXD A;  2LJ3 A;  3JB9 D;  3EG1 A;  5FU6 C;  4RG2 A;  2EWN A;  3MEW A;  3QBY A;  3LYI A;  4LUD A;  2DLP A;  3VS2 A;  4JJD A;  4M78 A;  5HY6 A;  1AWX A;  1GBQ A;  2O4X A;  2EGC A;  2QG9 B;  4N4G A;  2ATC B;  4RUG A;  3ZL7 C;  4CRI A;  2KEA A;  4AFU C;  5IN1 A;  2OX7 A;  4C8Q E;  3VU3 C;  4JPB W;  3EH2 A;  2E3H A;  2LJ0 A;  3G4S Q;  3OYE A;  1NEB A;  2RH2 A;  3X20 B;  1OQK A;  3CCE A;  4R55 A;  3C12 A;  3CC4 Q;  1WFW A;  3QII A;  2DL8 A;  1UG1 A;  3TRE A;  1ZSZ A;  2RHX A;  1JO8 A;  4C8Q F;  1NJI U;  1AEY A;  4J6X A;  2ROL A;  4C0F A;  2COW A;  5HK3 A;  3PVQ A;  4EDU A;  1WHG A;  2AZS A;  3AT1 B;  4PL6 A;  3RUX A;  2MK5 A;  2RJF A;  5FU7 B;  1KSW A;  4HCK A;  3G71 T;  5GAO p;  4IUR A;  1B34 B;  1OEB A;  3CCU Q;  1YIJ T;  2KNB B;  2XDP A;  4L5G A;  1NPR A;  3J81 E;  1Q95 G;  1OX8 A;  1QMC A;  2E5Q A;  3GLX A;  1K8A R;  3RMQ A;  3M55 A;  1SHG A;  3CC4 T;  2FZC B;  2HSE B;  1BKB A;  2XI9 A;  3L42 A;  3X25 B;  2M0Y A;  4C8Q C;  3G6E T;  3CD6 A;  2V8J A;  1U8R A;  2JOY A;  2XG8 D;  3SFM A;  2K6D A;  1M2V B;  2E1H A;  5I2M A;  5GAN j;  3KFV A;  4E6R A;  2EAY A;  1WA7 A;  5KYX B;  1R8O B;  1QKX A;  1N9S A;  4ESR A;  3VRY A;  1X6G A;  1CKA A;  1Y71 A;  2OTL T;  3O5Z A;  2JN0 A;  3X24 B;  4Z88 A;  2NUP B;  3QG1 A;  4J9E A;  1KQS A;  4F04 B;  2HD0 A;  2JJ9 A;  2LQ8 A;  3A8M B;  4OML A;  1WPY A;  2MWO A;  2A0F B;  3UA7 A;  3GOX A;  4LDU A;  1WHM A;  2BE9 B;  2KQW A;  2DA9 A;  1WX6 A;  3UPU A;  4L59 A;  3H8Z A;  2P4T A;  1LOJ A;  2D0Q B;  2DKG A;  4FYX B;  3A5Z B;  4JDS A;  4PJO B;  2QDY B;  3A98 A;  4KGZ B;  3V8L A;  3EFS A;  3THK A;  3NPF A;  2LNH B;  4WF2 A;  3PMT A;  5GAO q;  3L2W A;  2QAS A;  2EIF A;  2FHD A;  1XTD A;  3A1P A;  5KYN A;  4BAC A;  2D8J A;  3EG2 A;  4F7U G;  4BI3 A;  1N27 A;  1M2O A;  1RI0 A;  3QHS A;  5GAN 4;  2LJ1 A;  1X43 A;  3E9F A;  2MPX C;  1PNJ A;  3MET A;  4M78 E;  2KYB A;  4LDY A;  3CC7 A;  2GQV A;  3KUF A;  3SB2 A;  2K5I A;  2DE0 X;  2A37 A;  3OYB A;  2ROT A;  2HKN A;  4Y92 A;  4FCY A;  2CZ0 B;  1PSE A;  5FW9 A;  4J83 A;  1JU5 C;  1M5Q 1;  1D3B B;  1JBM A;  3M54 A;  4GY5 A;  3BE3 A;  1M2V A;  4RTW A;  5KYU B;  2DL3 A;  1BCO A;  2EJF A;  5GAN 2;  1ARK A;  1SSF A;  2XID A;  1ZUU A;  4YTL A;  1MHN A;  1M30 A;  2Y4X A;  4QQG A;  4OVA A;  5I11 A;  2HKQ B;  3PIO A;  4MML A;  2E70 A;  2DXU A;  2KI7 A;  4M78 D;  2YSQ A;  1YHQ T;  2YRV A;  5GAN g;  3GNG A;  5KCH A;  2CH4 A;  1ZA1 B;  1YI2 Q;  2VKN A;  1T0J A;  4C5E A;  3RER A;  5LJ3 h;  3BFM A;  1UUE A;  5I2S A;  2DD4 A;  2AZV A;  4BY6 C;  4XAX B;  4AT1 B;  2FG0 A;  2MIO A;  2RMO A;  2OTJ T;  1ZSZ C;  2I2L A;  1EFN A;  5KYW B;  4J9H A;  5FWB A;  4HCZ A;  4VUB A;  1Q7Y R;  5LL6 S;  2EGA A;  3CEY A;  1VQ7 T;  2ENM A;  3F70 A;  3JCM J;  1YIJ Q;  4BI8 B;  4F7U F;  2KXC A;  4E7L A;  1VQ7 A;  4JJN K;  1RL2 A;  1GXI E;  4C5G A;  2QQS A;  2OTL A;  2EYQ A;  1PRM C;  1QVG S;  1GFD A;  3U23 A;  2BIV A;  5J26 A;  3TVT A;  1BIA A;  2C0T A;  3H41 A;  1X01 A;  2D1X A;  1UFF A;  1QCF A;  2K2M A;  2E64 A;  4PLL A;  2X4W A;  3G6E Q;  1VQK A;  2KT1 A;  4FSX A;  1QVG P;  5KYU A;  4M7A E;  2R5A A;  1PCX A;  2XDD A;  3I56 Q;  1B7T A;  3UWN A;  2LC4 A;  2RN8 A;  3L2Q A;  1NLP C;  3OYN A;  2KK4 A;  2XK0 A;  5GAM g;  4CC7 A;  4C8Q A;  4RMO A;  2LRQ A;  2VUB A;  5GAN d;  3UA6 A;  2CP2 A;  4FYW B;  2MCN A;  3VKI A;  2RHZ A;  4RTX A;  1YFN A;  4OGC A;  1VQ7 Q;  4M7A C;  2DYI A;  4JRI A;  1QKW A;  1X2Q A;  3PTA A;  1D0Y A;  2OTL Q;  1RAI B;  4C0Z A;  2KRM A;  3MPU B;  4C92 E;  3GNF B; 
#chains in the Genus database with same CATH homology
 1VQ9 A;  3A8L B;  4OF1 A;  4JLI A;  3CPF A;  3M58 A;  3I55 T;  4J6W A;  4C8Q B;  1M90 U;  2DVE A;  3TU4 K;  4IUU A;  2RD1 A;  1UGR B;  4FL6 A;  5CKE A;  2R5M A;  1WJQ A;  4BD3 A;  1M90 C;  3KBG A;  1P92 A;  5GAN 8;  3FDR A;  4C92 C;  4PLI A;  1ZBX A;  3GF5 A;  5CAI A;  1VQO T;  1VQ6 T;  1K73 C;  2DTI A;  1TH7 A;  3O8V A;  1WQW A;  4BUG A;  4C92 B;  3S3O A;  4LD9 K;  1QW1 A;  3CC2 A;  3QZ5 B;  2P0Q A;  3LGF A;  1O9S A;  2CGH A;  2VC8 A;  2VGM A;  4C8Q D;  4DA4 A;  3JCM W;  5CK9 A;  1I81 A;  2QA4 T;  2XD0 A;  4N0A C;  4NOY A;  1YI2 T;  4PJO E;  4GLK A;  4DOW A;  4PJO A;  3JCM b;  4KUI A;  4JUV A;  2KAF A;  5GAO n;  1M1K U;  3CC7 T;  2WAC A;  3CXC S;  3V8K A;  1UGQ B;  3R6O A;  4II1 A;  5CO7 A;  3HFO A;  4C92 G;  4HT8 A;  1Q82 C;  3C4S A;  2X4Y A;  5I21 A;  1Y7X A;  3OBW A;  1BI3 A;  4PJO C;  1H3Z A;  3BW1 A;  3DKM A;  1Q82 U;  2C06 A;  1W2B S;  3JCM h;  2DXC A;  4DOV A;  3CC4 A;  5CKF A;  3HRU A;  4TVR A;  3CCL T;  3DB4 A;  3QSU A;  2LCL A;  2QQA A;  3SWN B;  2L5Q A;  2R57 A;  2E6N A;  2XKO C;  4N4I A;  3VV0 A;  4JRQ A;  1JJ2 S;  3OYJ A;  4MDW A;  3CCU T;  2KMT A;  2R58 A;  4ELY C;  1QVF A;  5GAN f;  1BYM A;  4J6Y A;  3A8G B;  1VQ6 A;  3QPH A;  4RCB A;  2H3J A;  4EMK A;  3RKW A;  5GAN 5;  2PVG B;  4X9C A;  2QTX A;  4J5Y A;  5LJ3 j;  3G6E A;  3CD6 T;  4FU6 A;  4XTV A;  5CIU A;  3BDU A;  3FRN A;  3BDL A;  1YJN T;  4E7I A;  5LJ5 e;  3LGL A;  3OSS C;  1Q7Y C;  2YLC A;  4B9X A;  4E7K A;  2F69 A;  2NLU A;  5FU6 B;  5GAM d;  1X6O A;  2DTO A;  5GAN 3;  4MMK A;  1Q7Y U;  3LW5 E;  2KDS A;  2RI2 A;  3M5A A;  5GMK e;  3OS1 A;  2HQX A;  3CMA A;  4MZM A;  5FLX E;  4RG8 A;  3L2U A;  3S3N A;  3LLR A;  4M77 F;  4IUV A;  3OYA A;  3HPW A;  4PJO D;  3JCM g;  5GMK j;  2X4X A;  1K9M U;  3CBP A;  2VYT A;  5LJ5 d;  5GAM j;  4ATO A;  1VUB A;  2HBP A;  3DB3 A;  3JB9 D;  2ZGW A;  5FU6 C;  5A2Q E;  4RG2 A;  2EWN A;  2RI3 A;  3AHU A;  2O4X B;  4NL3 A;  3PMI A;  5LJ3 d;  1LNX A;  1NPP A;  3MEV A;  3MEW A;  4ZTF A;  3QBY A;  1BIB A;  3LYI A;  3QDR B;  4ZGJ B;  1W4S A;  2K3X A;  4M75 A;  5FU7 C;  1KQ2 A;  2CZ7 B;  2L89 A;  2XDB A;  4BE0 A;  4RKU E;  4IUP A;  2CYZ B;  4M78 A;  5HY6 A;  1W2B A;  1I5L A;  2OAU A;  5CVI A;  1G3Y A;  2O4X A;  3J7A F;  4FM4 B;  2RO0 A;  2QQR A;  3HL8 A;  4XTX A;  3JAM E;  4M7D A;  1DJ7 B;  2EQU A;  4N4G A;  4BE1 A;  2JTM A;  2XU8 A;  4CRI A;  5C6S A;  3FB9 A;  5IN1 A;  4CI0 C;  3INZ A;  4C8Q E;  3OYY A;  3VU3 C;  4F7U A;  3EAE A;  4BY6 B;  2K5L A;  3OYE A;  2RH2 A;  2HNI A;  3X20 B;  3JB9 G;  2FB7 A;  4Q5W A;  3I56 A;  2EJG A;  3M4G A;  4C0D C;  3CCE A;  4R55 A;  1M8V A;  1OYX A;  3C12 A;  2Y90 A;  1I8F A;  4M78 F;  1BI2 A;  5AYF A;  4C5H A;  4RCC A;  2CZ1 B;  3ZFJ A;  4HCC A;  3ASK A;  2PUK B;  3QJ6 A;  3G4S A;  3QII A;  2JZ2 A;  2M16 A;  3OW2 A;  2LNV A;  3MP1 A;  3QKJ A;  2DZC A;  5CCA A;  4OB1 B;  1VQN T;  3RKY A;  2FVU A;  3TRE A;  2RHX A;  4BB7 A;  2X35 A;  3MEA A;  4C8Q F;  1K9M C;  1VQL A;  1YBY A;  1NJI U;  4J6X A;  2KVQ G;  4QW2 A;  3RIR A;  4C0F A;  4F7U B;  5HK3 A;  3HRT A;  3M56 A;  1FWZ A;  4EDU A;  1YJW A;  2QI2 A;  2K57 A;  2ZCF B;  2F5K A;  3C94 A;  3HP9 A;  4PL6 A;  4M77 A;  4EPC A;  5KE3 A;  3X28 B;  3MHX A;  3RUX A;  3OYD A;  2GF7 A;  3NFC A;  1VQO A;  1ZQ1 A;  4A4F A;  4M7D E;  2RJF A;  3N5B B;  5FU7 B;  3VUB A;  2QA4 A;  5DY9 A;  1G3T A;  1WJS A;  2MF2 A;  4M7D B;  4J7I A;  4Z02 A;  4FIB A;  5KCO A;  2DZ9 A;  3Q1J A;  2LDM A;  3OBY A;  4M77 C;  3G71 T;  4IKF A;  1YCY A;  3NTK A;  5FRO A;  5GAO p;  5CQY A;  4IUR A;  3P8D A;  2MWP A;  1QP2 A;  1B34 B;  4JRP A;  5EG2 A;  4LDW A;  3A8O B;  1G3S A;  3L1A A;  2CS7 A;  2RHU A;  2O01 E;  3CCS T;  2RHY A;  1YIJ T;  3CPW A;  2XDP A;  3KXT A;  4E47 A;  5GAM e;  3J80 E;  4M7A G;  1VQN A;  3LWH A;  2KY9 A;  2M1H A;  3QO3 A;  4M75 B;  4FT2 A;  4L5G A;  5GMK h;  2VV5 A;  1NPR A;  4XU1 A;  5KH6 A;  3J81 E;  1HK9 A;  3OMG A;  3SDZ A;  3I55 A;  2E5Q A;  3GLX A;  3RMQ A;  1VQ9 T;  3M55 A;  4QVC A;  2RJD A;  3CC4 T;  5GAO m;  1QVG A;  3G7Z A;  1BKB A;  1U1T A;  2XI9 A;  1JJ2 A;  3CME T;  1PSF A;  2DIG A;  2EFI A;  2HQE A;  2V8K A;  3L42 A;  1OI1 A;  5LJ3 f;  3X25 B;  4ME7 A;  5GMK l;  1AHJ B;  4C8Q C;  3L2V A;  1VQM T;  1XQH A;  4PJO F;  3G6E T;  3CD6 A;  1WGS A;  1UGS B;  2V8J A;  1U8R A;  4M7A A;  3UDC A;  2JOY A;  3V8J A;  4ZGE B;  5LJ3 e;  2XG8 D;  4KUD K;  1QVF S;  1YI2 A;  2WSC E;  3SFM A;  3ZEH A;  4BDZ A;  2AHJ B;  2E1H A;  5I2M A;  3TCJ A;  5GAN j;  2PVO B;  2DXT A;  2EAY A;  2JNG A;  5LJ3 g;  4PNO A;  1R8O B;  2FYK A;  4Y28 E;  1NJI C;  1N9S A;  2LCC A;  3ME9 A;  3JRZ A;  4J8O A;  3VYG A;  1YHQ A;  4C5I A;  4DQ2 A;  5DM7 R;  3MP8 A;  4M7A F;  1Y71 A;  3P8H A;  1WNL A;  3ZBD A;  2ZPG B;  5GAN 7;  2OTL T;  4OGE A;  5KE2 A;  4R56 A;  3MEU A;  4M75 E;  3WVD B;  1KQ1 A;  2E6Z A;  2P0K A;  2JN0 A;  2E10 A;  3MP6 A;  1Y07 A;  3X24 B;  5CKB A;  4OB3 B;  1VQ5 T;  1XOV A;  4A4K A;  1IZ6 A;  3QG1 A;  3OYC A;  1KQS A;  5LJ5 h;  2JUF A;  3QZ9 B;  2HD0 A;  4Y91 A;  2OTJ A;  2EQJ A;  2LQ8 A;  3A8M B;  4N0A A;  3PT9 A;  1WPY A;  4E7J A;  2MWO A;  3CCR A;  2A3L A;  3GOX A;  4HT9 A;  3JB9 F;  4LDU A;  1JRI A;  2GFA A;  3M4Y A;  3L2Z A;  3E19 A;  2KQW A;  3FEO A;  5GAM h;  4F7U E;  1YJW T;  2XHC A;  3UPU A;  5A0G A;  5GAO l;  3OW2 S;  3S6W A;  4L59 A;  3QXE B;  5CKD A;  3H8Z A;  2P4T A;  3CCM A;  4M77 G;  1VQP A;  2Y4Y A;  1LOJ A;  2RI5 A;  1G3W A;  3CCV A;  1G5V A;  3FLG A;  4X34 A;  4M7A B;  1VQP T;  2D0Q B;  2DKG A;  2RB6 A;  3OYL A;  1KHI A;  1KD1 U;  5GAN 6;  3G71 A;  4B9W A;  1UB4 A;  4XTW A;  3A5Z B;  4JDS A;  3V7S A;  2QDY B;  2M9U A;  3V7R A;  3JCM Q;  1KD1 C;  2PUO B;  4PJO B;  2HAX A;  2WSE E;  3OSV A;  1O75 A;  3C95 A;  1QVP A;  3V8L A;  3VYH B;  4E7H A;  3EFS A;  4KT0 E;  5HK0 A;  1K8A U;  2PQW A;  2ZZD A;  3JCM c;  4WF2 A;  1S72 T;  1OZ2 A;  3PMT A;  4KUL A;  5GAO q;  3L2W A;  2D6F A;  1K8A C;  1VQK T;  5IAY A;  1VQL T;  3OS2 A;  2DXB A;  1YIT A;  3DLL A;  5GAM f;  2EIF A;  1ZHI A;  4XU2 A;  2FHD A;  1XTD A;  2IVW A;  1S72 A;  4OP0 A;  3FC3 A;  3V7C A;  1YIT T;  3HSB A;  3MCA B;  4BAC A;  3S3M A;  4EMK C;  3HKS A;  4F7U G;  3CC2 T;  2KSS A;  4BI3 A;  1N27 A;  1RI0 A;  5DLQ E;  5DLO A;  3QHS A;  1JB0 E;  5GAN 4;  3NTI A;  1BI1 A;  2EKO A;  5D6Y A;  4LDX A;  2E65 A;  3OY9 A;  1Q86 C;  2V8I A;  4XK8 E;  1YJ9 T;  3E9F A;  3OYI A;  3MET A;  2WSF E;  4M78 E;  4A4E A;  5GAN h;  4M7D D;  3CBM A;  2A7Y A;  2BKD N;  1M1G A;  3FIF A;  4LDY A;  3I56 T;  2GQV A;  3CC7 A;  2JVV A;  3JSC A;  1YJ9 A;  3LWI A;  1Q81 C;  3KUF A;  2LTO A;  3OYG A;  3CCE T;  1YIJ A;  2ZPI B;  4JRK A;  3CCJ T;  3NTH A;  1EIF A;  2RHI A;  3E9G A;  1Q81 U;  5J3B A;  4M75 C;  3E1S A;  5A0D A;  3H6Z A;  4M78 G;  2YLB A;  3HRS A;  1D3B A;  2K5I A;  3LX7 A;  4M78 C;  4M75 F;  2PU9 B;  3SB2 A;  4ZGD B;  2JTF A;  3OA6 A;  3OYB A;  5C0M A;  5A0L A;  1LJO A;  3SWN C;  2CZ0 B;  4M7D C;  1PSE A;  4ZN1 A;  2LT1 A;  4J83 A;  2LX9 A;  1XNI A;  4M77 B;  4NL2 A;  4V2S A;  2BUD A;  1M5Q 1;  3QUI A;  2L8D A;  4EMG A;  3JB9 I;  4NS5 A;  1KQS S;  3URG A;  1N8R C;  3JCM f;  1D3B B;  2DIQ A;  4ZTJ A;  1JBM A;  3WXM B;  4HCB A;  3M54 A;  4GY5 A;  4M7A D;  3GP8 A;  3OB9 A;  3SWN A;  4D6W A;  1M9S A;  3VJP A;  3L2R A;  3JCM e;  3CME A;  2DK3 A;  3GIB A;  2QQB A;  1HXD A;  4M78 B;  2EJF A;  5GAN 2;  2EQM A;  1SSF A;  2XID A;  1IRE B;  4YTL A;  1MHN A;  2YHT A;  4OMF B;  4LD6 A;  2Y4X A;  2P0P A;  4IUQ A;  4OVA A;  4QQG A;  5GMK m;  2CKK A;  1MGQ A;  3M57 A;  1FX7 A;  3PIO A;  4XQ3 A;  1KG1 A;  2RA2 A;  2M0O A;  4MML A;  3JB9 J;  1NE8 A;  5D6W A;  2E70 A;  4M7D G;  2DXU A;  4M78 D;  4XTZ A;  5CKH A;  3CCS A;  1YHQ T;  3CMA T;  2YRV A;  5GAN g;  3GNG A;  2EQK A;  2E41 A;  4XTY A;  2LT4 A;  5KCH A;  5HKC A;  4PKC C;  4C0D B;  4BE2 A;  2QXF A;  2LVM A;  3OYK A;  3OMC A;  4XTU A;  1UEB A;  3DLM A;  4M77 E;  3CXC A;  3CBO A;  2ZPE B;  3A8H B;  4M75 D;  4C5E A;  5GMK i;  1VIF A;  5LJ5 j;  1K73 U;  3RER A;  2ZPB B;  1WQ7 A;  3BFM A;  5LJ3 h;  3JB9 H;  1V29 B;  5I2S A;  2QEX A;  1Y96 A;  3UT1 A;  4MDX A;  3M9Q A;  4XU3 A;  1QP3 A;  2DD4 A;  4BY6 C;  3CCU A;  1YJN A;  1VQM A;  1VQ5 A;  4XAX B;  2G3R A;  3CCQ A;  1WJR A;  1NZ9 A;  1VQ8 T;  4N4H A;  3ER0 A;  3PFS A;  2OTJ T;  1M1K C;  2RM4 A;  3CCQ T;  3OS5 A;  3OYH A;  4PJO G;  2MMP A;  2I2L A;  2DJZ A;  5CR2 A;  3QYH B;  3CCR T;  2D9T A;  1Y96 B;  2GFU A;  2EJ9 A;  3M53 A;  4HCZ A;  4QQ6 A;  1N6A A;  2K4Y A;  4VUB A;  5LL6 S;  4JS5 A;  2DAQ A;  4C0G A;  3QYG B;  4JS4 A;  3CEY A;  5L8R E;  3JCM V;  3PGG A;  1VQ7 T;  2ZPH B;  3HHT B;  3F70 A;  2ZPF B;  4ELZ C;  2VXF A;  3JCM J;  4LDV A;  2K5F A;  4QQD A;  3SD4 A;  1M1F A;  4BI8 B;  2K3Y A;  4P5N A;  4F7U F;  4E7L A;  4MZT A;  1X75 C;  4A54 A;  4QVZ A;  4JJN K;  1VQ7 A;  4HKE A;  2RK1 A;  2F5T X;  3CCL A;  1RL2 A;  3FJP A;  3HFN A;  4C5G A;  5GAN e;  3P8B B;  3WVE B;  1GXI E;  4M75 G;  5M9O A;  2QQS A;  2B8A A;  2EYQ A;  3JCM P;  2OTL A;  4C92 F;  2DO3 A;  4ZN3 A;  4O6J A;  2MI6 A;  4MZP A;  2PVD B;  1QVG S;  2BIV A;  5J26 A;  2QEX T;  3CCV T;  4EMH A;  1BIA A;  4M7D F;  4M77 D;  5IT9 E;  1X01 A;  5LJ5 f;  1BI0 A;  3EFR A;  3OQ5 A;  5J39 A;  1VQ8 A;  4BI4 A;  3JCM d;  2GCX A;  1KHC A;  2E64 A;  3T9N A;  4PLL A;  2X4W A;  5CQX A;  5LJ5 g;  1VQK A;  1KC8 U;  5GAO r;  4FSX A;  3CPW S;  4M7A E;  1H64 1;  2R5A A;  2XIC A;  3BY7 A;  4J7F A;  2XDD A;  3OS0 A;  1Q86 U;  2K2V A;  2DD5 A;  4KBM B;  3RMS A;  3UWN A;  4OB2 B;  2L3R A;  2CZ6 B;  2LC4 A;  4JLG A;  4EMK B;  3L2Q A;  4QVD A;  2IG0 A;  2RK2 A;  4C8Q G;  4BDY A;  2VGN A;  3OYN A;  1N9R A;  3TEE A;  2KK4 A;  4HA8 A;  3OYF A;  1VIE A;  2XK0 A;  3CCM T;  1UGP B;  5GAM g;  1N8R U;  3RKX A;  4C8Q A;  4RMO A;  2LRQ A;  4UC4 A;  2VUB A;  5GAN d;  3JCM X;  2RJC A;  4A4H A;  1I4K 1;  2MAM A;  4X9D A;  3VUZ A;  3LH0 A;  5D6X A;  3VKI A;  4IUT A;  1FXX A;  2RHZ A;  2X4J A;  3MO8 A;  1U1S A;  1VQ4 A;  5FRM A;  2LQK A;  4OGC A;  3X26 B;  4A53 A;  5FRN A;  2DEQ A;  1OZ3 A;  4O5V A;  1M4Z A;  4M7A C;  2E12 A;  4OB0 B;  4JRI A;  3G4S T;  1B34 A;  3PNW C;  1VQ4 T;  2FL7 A;  4C92 D;  2RJE A;  4XU0 A;  2QQ9 A;  3PIP A;  3CCJ A;  1KC8 C;  2DPP B;  3PTA A;  2DTH A;  3GPL A;  4C0Z A;  3OYM A;  2VXE A;  4C92 E;  4FT4 A;  3RES A;  4A4G A;  4C92 A;  3M59 A;  3GNF B;  3QJY A;  4L6V 5; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...