1H641

Crystal structure of the sm-related protein of p. abyssi: the biological unit is a heptamer
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDNVLAISPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Pyrococcus Abyssi Sm Core and its Complex with RNA.Common Features of RNA Binding in Archaea and Eukarya
pubmed doi rcsb
molecule keywords SNRNP SM-LIKE PROTEIN
molecule tags Sm-like protein
source organism Pyrococcus abyssi
total genus 13
structure length 71
sequence length 71
chains with identical sequence 2, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2001-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1h64100
1LOJA 1WPYA 4JUVA 3JB9D 4XU0A 3QSUA 5GAN5 5GAN6 4M78F 4M78B 2DZCA 1BIBA 4J5YA 3HFOA 5LJ3d 4JRKA 1TH7A 4DQ2A 3JB9I 4QVDA 5LJ3f 1MGQA 2DVEA 3RIRA 5GAOl 4PNOA 4J6YA 4M7DF 2K57A 4HA8A 1Y96A 4Y91A 3V8KA 4PJOD 2HNIA 2EAYA 2YLBA 3QO3A 4N0AA 2RB6A 3SB2A 2E10A 4M75F 3RKXA 4M7DA 2ZGWA 1N9SA 4M77D 4OP0A 5GAN2 5GANj 2FYKA 1HK9A 4N0AC 3V7CA 5LJ5j 2DZ9A 4RCCA 5LJ3e 1M5Q1 4M75A 3M4GA 3L2ZA 4V2SA 1H641 3SWNA 5LJ3g 4PJOB 5GANd 2RD1A 4M78D 3PGGA 4EMGA 5GANh 1WNLA 1LNXA 4C8QE 5LJ5d 5GANf 5GAOp 4C92E 4F7UE 5LJ5h 5LJ5f 5GMKj 3JCMb 2YHTA 4J6WA 4C8QC 2DEQA 4M7DD 3QHSA 3JCMc 4C92C 3FJPA 4C8QG 4C92G 4F7UG 2QTXA 1M8VA 3V7RA 3JCMJ 4M75D 1Y96B 5GMKh 1HXDA 5GANg 4RCBA 5GAN3 4M7AE 4XTUA 2EJFA 1YCYA 5LJ5g 4M7DB 4MMKA 3JB9H 4A54A 2FB7A 1N9RA 5I21A 3JB9G 1U1TA 2DTOA 4M75B 1BIAA 4M7AG 3SWNB 4EMKC 3GIBA 3JCMP 1KQ1A 4JRIA 4NL2A 4EMHA 5GAMj 2VXFA 4C8QF 1I81A 4C92F 2RM4A 3INZA 4F7UF 5GAN4 3RKYA 3JCMd 5GAOq 5GAMd 3BY7A 3BDUA 4XTWA 3JCMh 3QUIA 5GAN7 4C8QA 3JCMf 5GAMh 5GAOm 4C92A 5GAMf 4XQ3A 4F7UA 2DTIA 2VC8A 4M77G 4XTVA 2E1HA 1I4K1 4XTZA 2DTHA 3EFRA 4HT8A 4A53A 2Y90A 3L1AA 1B34B 4MMLA 5GANe 1D3BA 1KQ2A 3HFNA 4M78G 1LJOA 5GAMe 5LJ5e 1I8FA 4XU2A 4XU3A 3JCMg 3HSBA 2EWNA 5GAMg 1B34A 2CGHA 4M7AA 2EJ9A 3V8LA 3BW1A 4EMKA 5DY9A 3FIFA 4C8QD 4M7AC 4C92D 4JLIA 5GAN8 2RA2A 2JN0A 3JCMW 3RERA 4XU1A 4X9CA 4PJOE 5GMKe 5GAOr 1U1SA 1JBMA 1WQWA 1WQ7A 2DXUA 3EFSA 2E65A 4M77E 4XTYA 1JRIA 4WF2A 4C8QB 2DJZA 4M77A 4X9DA 4C92B 4F7UB 5LJ3j 4PJOC 4PJOG 2DKGA 3V8JA 1I5LA 3RKWA 4M7AD 4M77C 4QVCA 5CAIA 5GMKl 2E41A 4M78E 2YLCA 3JCMQ 3BFMA 2VXEA 4M78A 5LJ3h 1D3BB 3JB9F 2I2LA 3RUXA 3JB9J 4M7AF 4M7AB 4M78C 2E64A 3FB9A 4NL3A 3JCMX 4J6XA 4M7DE 4EMKB 3JCMe 3VU3C 3RESA 5GAOn 4HT9A 3V7SA 4NOYA 4M75E 3JCMV 4M7DC 4PJOF 3AHUA 5GMKi 5GMKm 4M7DG 4M75C 4M77F 1X01A 2EJGA 4M77B 4XTXA 3SWNC 4PJOA 4M75G 2DXTA
chains in the Genus database with same CATH superfamily
2B8AA 1LOJA 2OTLT 1ZSGA 1QCFA 4NS5A 5GAN5 3CD6A 2DZCA 4PJLA 1TS9A 2QEXA 1AVZC 5LJ3d 4HCBA 1C0MA 4E7LA 5LJ3f 1I07A 4LDUA 2JW4A 4LN2A 5KCHA 2YLBA 5FW9A 2V26A 1VQPA 2RQRA 2QGFB 5FU6B 2DZ9A 2YXYA 1ZSZB 2P0PA 3L2ZA 1H641 1GXIE 1KIKA 2JMCA 4FW2A 1LNXA 1WHGA 3HRTA 1YI2T 2RHUA 2XIDA 1PRMC 2E6NA 2IPOB 2CZ7B 4C92G 1UFFA 2JUFA 2RI5A 2V1QA 5KYUB 2RHXA 3EG2A 4HVWA 2CUDA 3HKSA 1NJIU 4CC4B 3A8HB 2O4XB 3M59A 2VC8A 3LWIA 9ATCB 1NBEB 3A8LB 3HFNA 2EQMA 5D6WA 3VRYA 1I8FA 3OMGA 2MYSA 4E7IA 3H0IA 4LD9K 2PUOB 4EMKA 1ARKA 4PLLA 3JCMW 1Y07A 3OSSC 1U06A 1S1NA 2YRCA 2COWA 3EHQA 1ZSZC 2RQVA 4KUDK 2DJZA 5KYYA 3TVTA 2DKGA 3CC7Q 1VQMT 5LJ3h 1I1JA 3GNGA 3J7AF 1WJSA 1PG5B 3ME9A 3UPUA 5CQYA 2GGRA 3CCLT 1VQ7Q 1OYXA 1TUDA 1AOJA 2FZKB 2PVGB 2RF0A 2XU8A 3JB9D 1ZUKA 4DBHA 3CCJQ 5ECAA 1M4ZA 5KH6A 2HNIA 2X4XA 2RB6A 3RKXA 2DFUA 4RTXA 1VQMA 2SRCA 3M4GA 4JJNK 5GANh 2HL5C 1YNZA 3C95A 4JLGA 1QMCA 4PK4A 4J9DA 1T3LA 4BDYA 1ZBJA 2K9GA 4B6MA 2M16A 5LJ5g 2PU9B 1R0BG 3CCJA 1N9RA 1M90U 1RAFB 5IHIA 1FMVA 3CCVQ 4FSXA 1IXDA 3CC2Q 1AD5A 2XICA 2RM4A 2L5QA 2X3WD 3TQ7P 3CPWP 2MMPA 4X1VA 2X35A 3CMAQ 2COYA 2E1HA 3S6WA 4JRPA 2W10A 3NTKA 2DERA 3HSBA 5GAMg 1NLOC 1B34A 2CP0A 4BE1A 1NLPC 3DB3A 3CCRT 2LMJA 1RAHB 5I2MA 3CCVA 2DYBA 3CC2A 1N5ZA 3G4ST 2HQXA 2PTKA 3QIIA 2J7IA 1N27A 4FSSA 4QVCA 1UGQB 4UC4A 1TTHB 1W6XA 1RLQC 3UT1A 3THKA 1WHHA 1VQ9Q 1RL2A 3OYMA 2LQWA 1XTDA 2GQIA 3A8OB 1SG5A 1NZ9A 2M9UA 1LPLA 4ZTJA 2AZSA 5J3BA 2QQAA 2DRKA 4QVZA 1E6HA 3JAME 1RI0A 1VQ6Q 3CMET 3PE0A 4A4EA 2K5LA 3BE3A 2JS2A 3NPFA 3A5ZB 2DA9A 2M0YA 3CCUT 5GAN2 3S3MA 1VQ9A 4N0AC 2A36A 3V7CA 3G7ZA 2NUZA 4DOVA 4JJDA 4FCYA 4C8QE 2QQ9A 2LQNA 2LCCA 4F16A 5GMKj 3MP1A 3QYHB 1Q7YC 4QKUA 4IUPA 1VQ6A 1AWJA 3LW5E 4IURA 1HXDA 4MDXA 1JQQA 2HKNA 4MMKA 5KCOA 1VQOQ 2D0QB 4J7FA 4LXCA 3S3OA 2K4YA 2R58A 3WVDB 3C12A 1LVKA 1VQ4Q 2L2PA 4RTZA 2P4TA 2VXFA 3MJXA 1D1CA 5GAN4 1WGSA 3JCMh 3TREA 4F7UA 1QVGP 2O31A 2MF2A 4B9WA 2J05A 1M3BA 1MUZA 1OX8A 2ROTA 3A8GB 1GFCA 2KXCA 2O01E 1SSHA 1VQOA 3CBOA 4KULA 2DF6A 2LJ3A 4C8QB 1VQ4A 2EGAA 5IHKA 1ZA2B 2PQWA 1I5LA 2E41A 3H0FA 2HSEB 2EYXA 4F04B 2DXBA 3RUXA 4J9HA 1HD3A 3HTRA 3JCMX 4ZNXA 1O75A 1YJNQ 1IRXA 1VIFA 3CEYA 3EH2A 5GMKi 3MP6A 2CZ6B 2BIVA 1KC8C 1D0YA 1ZBXA 4M78B 2DL3A 2LQ8A 3RNJA 4RTYA 3RIRA 1QQJA 4HA8A 1Y57A 4PJOD 2AHJB 3CC4Q 3QO3A 1IGQA 3I56Q 4N0AA 3NTIA 2ZGWA 1N9SA 1K76A 4LDWA 1HK9A 1JO8A 1ZA1B 4TVRA 5IH2A 2MPXC 3UA6A 3PGGA 5M9OA 1PM3A 1WNLA 2NWMA 3REBB 1BI2A 4A63B 1QLYA 3NGPA 2AIRB 4C8QC 3OYJA 1AWOA 3PMIA 3QHSA 4QQGA 3FJPA 4C0DB 4F7UG 1M8VA 2FPDA 3EAEA 3EG1A 5CKDA 3O8VA 2SEMA 3M57A 1R77A 1KK7A 2YUQA 2IG0A 1M1GA 2DJQA 3OYAA 2DPPB 3I56A 1KQ1A 2ABLA 4EMHA 3ZBDA 2LP5A 3CXCP 4C5EA 4RMOA 2JTMA 1M2VA 2CSQA 3EG3A 3H41A 3I55T 2J6KA 1RLPC 3WXMB 1QVFA 4DOWA 1W4SA 2CP5A 2LJ1A 5KYWB 2Y90A 1KQ2A 1D3BA 5GAMe 3H9NA 1VQNQ 1M2OA 3NMZC 2XDPA 3QYGB 1ZLMA 2KGTA 1T3SA 3KUFA 2RA2A 3M58A 3EHRA 4XU1A 1N8RU 2PZ1A 4OMQA 4IIMA 1D1BA 2P0QA 5DM7R 4CC3A 3C4SA 3V8JA 3OYNA 2EGEA 3GNFB 2QG9B 2IIMA 3KBGA 2LZ6B 4AFZC 2RQWA 3JB9J 3HL8A 4C0DC 4R56A 3VU3C 5CQXA 2MI6A 1K9AA 4KGXB 3SHWA 3OB9A 2EJGA 1OU9A 4PJOA 4FYYB 4IIOA 4RTUA 2A3LA 4JUVA 2EBPA 1XOVA 4JJBA 3JB9I 1MGQA 3L2RA 2ZZDA 4C0FA 4J9EA 4ATOA 1H3HA 3DB4A 3VS5A 1ZUYA 2F2WA 4E47A 1CKAA 1SPKA 2LX7A 1M5Q1 3QZ9B 4V2SA 2DBMA 5FWBA 2V1RA 5GAOp 5C0MA 3CQTA 2YHTA 1V1CA 1JJ2S 2DD5A 1K8AU 5J26A 2CP7A 2ZPGB 5GAN3 2PUKB 4J9GA 1WX6A 3ZEHA 2O2OA 3QWXX 3MCAB 2AZVA 2VGNA 2WSFE 5CKEA 4C8QF 2A7YA 5IT9E 1D0ZA 3QUIA 2ZPBB 1BI1A 3EGXA 2ZPEB 2OTJQ 4E7HA 2ECZA 2MWOA 2L89A 3L1AA 2X4WA 1OULA 1TU0B 3JRZA 3HP9A 2X9HA 1SHGA 1VQLQ 3EGDA 4PL6A 5GMKe 3CXCS 2RI3A 2BZYA 4E7SA 3EFSA 4M77E 2E65A 4XTYA 3PIOA 1YWPA 4PJOG 2I0NA 3PVLA 1J3TA 2XKOC 1AZEA 4FYVB 1NJIC 1H92A 1YWOA 1Q86R 4L6V5 1VQ8Q 2DETA 1WHLA 2DO3A 1UG1A 3CD6T 1VQLA 3OW2A 2JNGA 3VJPA 1X01A 2QEXT 3M9QA 1YFNA 4N4GA 2RN8A 4A4GA 1OI1A 4IKFA 4JZ3A 2CS7A 1MV0B 1AWXA 1WA7A 1UHFA 1E6GA 1UDLA 2EAYA 2KY9A 2E10A 2EYYA 1ZX6A 2XDDA 1UUEA 1KD1U 2EYZA 2LNHB 1VQ8A 3URGA 3SFMA 5KE3A 3JCMb 5KYXA 1Y7XA 5IAYA 4EPCA 2GQVA 4LUDA 1TWBA 3EFOB 5GANg 3CPFA 3TEEA 2L0AA 3SWNB 1NEGA 1NYGA 3CBMA 3CCQQ 2DRMA 1JXOA 3M0RA 1KQSA 1SRLA 1R0CB 3FRNA 4FW1A 2X4YA 3AT1B 1GCQC 3VS6A 3BDUA 1UGPB 2HD0A 2DTIA 2C06A 1WYXA 4ANJA 1B34B 4FYXB 5I2SA 4E7ZA 4IUUA 3V8LA 4IUVA 1XJWB 2QASA 5GAN8 1X2KA 5GAOr 2HZYA 1WHKA 2KT8A 3CCQA 2LT4A 2GF7A 1OOTA 4M77C 2QQRA 4QW2A 2RJFA 4OMOA 4JZ4A 4R0KA 1OPLA 3ZFJA 2M1HA 1RAAB 4HT9A 2K5IA 3OYYA 4M75E 5CVIA 2EYWA 1WJQA 2D8JA 4OMMA 2BE9B 2E6ZA 2CZ0B 2EQUA 3SWNC 5IXFA 1IO6A 5FU6C 3CC7T 1BK2A 4C0ZA 1MMAA 2W0ZA 2RI2A 4AMCA 1RAIB 1PC0A 1D09B 3V8KA 5L8RE 5J39A 4YTLA 1K9MR 1GFDA 1VQ7T 1RAEB 2K3YA 4ORZA 1M1KR 5LJ5j 3GPLA 2EFIA 1TSFA 2L8DA 3OYLA 3H0HA 4EMGA 2A0FB 2FHDA 2KR3A 2E3HA 4E7KA 4DBQA 3CCJT 3I5RA 3M55A 4FU6A 3QZ5B 3QBYA 2PVDB 3CC7A 3UF4A 4M7AE 2KE9A 3JB9H 2DXCA 1WJRA 1GBQA 1QCNA 2J06A 4J83A 3HHTB 1KHCA 2DTOA 4M75B 3UDCA 5GAMj 5KYNA 1FXXA 2Y4YA 1MHNA 3DLLA 1FMKA 5CKBA 1B7TA 5CKFA 1VQ7A 2OX7A 2V8JA 1G5VA 2RJEA 2GTOA 3RMSA 1Q82R 4DBRA 4OMLA 1WLPB 1Y71A 2K6DA 3JCMg 4E2FB 2JM8A 3CCVT 3CC2T 1NG2A 4JS5A 3A8MB 2D0NA 1WI7A 1JBMA 4HVUA 4BE2A 3CMAT 1YIJQ 1S72Q 4LDYA 4M77A 2NLUA 1ZQ1A 4HCCA 1IREB 2KMTA 3JCMQ 3UWNA 1KFZA 4M7AB 3L42A 1V76A 5GAOn 1PHTA 3I5SA 4NOYA 2J6FA 2CYZB 4M75C 4M77F 1ZSZA 1PCXA 1XQHA 2DXTA 3FJ5A 2DL8A 2GFUA 3REAB 4KH0B 4Z8AA 3QPHA 1YIJA 2VV5A 3RBBB 4KT0E 3HFOA 1VQ9T 1RI9A 3CMAA 3OMCA 1NJIR 4Y91A 2VYTA 5IXBA 5KYUA 4KGVB 2WACA 5LJ5d 1VQ6T 1W2BA 4F14A 5LJ5f 1IB8A 3P8DA 1OV3A 2DILA 2O4XA 4QQDA 3CCMQ 1M3CA 1YP5A 1VYUA 2CSIA 1M27C 2NUPB 1NM7A 5EC7A 2FB7A 1HJDA 4ZN1A 2OJ2A 1AEYA 2HL3A 5FU7B 3M0UA 2Y4XA 4LUEA 2RHYA 3MEAA 5GAMd 5GAMf 2EKHA 4M77G 4JDSA 4XTVA 2O88A 1TUCA 2A37A 1YITQ 2LCSA 3CCMA 1VQOT 2FRWA 1Z9QA 2RH2A 4QT7A 1VQ4T 2QYZA 2EKOA 5CR2A 5HK3A 1KJWA 3QXEB 2DL5A 4BACA 2L3SA 2D9TA 1C1AA 1EIFA 3G6EQ 3ULRB 1U1SA 2YT6A 3CCSQ 2K3BA 4FIBA 1VQ5Q 1YHQQ 4K11A 2DD4A 2JVVA 3OS2A 2JM9A 5CAIA 5A0LA 4M78E 2L3RA 1IGUA 2C0IA 3QDRB 1YITA 4J6XA 4M7DE 4A4KA 2FPEA 3LX7A 1Q86C 1YJ9Q 1WZOA 1IZ6A 2FO0A 2XK0A 1K73U 4IUQA 5FU7C 2XDBA 3CCSA 4C0GA 3OW2P 1X27A 1M90R 2A08A 1WFWA 2DX1A 1TH7A 4PFPA 4DQ2A 2DVEA 2NUTB 1YJNT 4PNOA 4DEYA 1GL5A 2XHCA 1NPPA 2YSQA 1TOVA 4M75F 1SEMA 3NFCA 1QWEA 2VGMA 1MMDA 2HQEA 3KXTA 4QQ6A 6AT1B 3U23A 3G71Q 1YJ9A 4C92E 2CUBA 2DLPA 2WSEE 3PNWC 1VQKQ 2C0TA 1MMGA 2RHIA 1JJ2P 1YN8A 1AZGB 3V7RA 3I56T 1Y96B 4II1A 3UA7A 2H3EB 4PJNA 4XTUA 2EJFA 4M7DB 5GJVB 3OSVA 1SSFA 2DL4A 1K0XA 3E9FA 4CC7A 4ZGEB 1YJNA 4CI0C 3Q1JA 3EG0A 4L5GA 3VUZA 2VWFA 4JPBW 5GAN7 1TUGB 4A4FA 3G71A 2HSPA 3EG9B 2RQTA 4HVVA 1VQKA 1Q7YU 5LJ5e 4L59A 3EGDB 3BW1A 1X43A 5DY9A 4C8QD 2HAXA 1Q81U 5CK9A 3CC4A 2X3XD 1RADB 2YRDA 2DXUA 5D6YA 2V8KA 4C92B 3WVEB 2YWWA 2EQIA 3RKWA 2CH4W 2PNIA 3X20B 2CT4A 2VXEA 5CKHA 2DM1A 1VQNT 1H8KA 4M78C 2E64A 3TCJA 3MHXA 3RESA 2HQHA 3EGUA 3V7SA 2MAMA 4M7DC 1P92A 1NEBA 1SRMA 2JOYA 1M9SA 2EIFA 4Q5WA 5KE2A 5FRNA 2KT1A 4D8DA 1WPYA 2LX9A 3QJYA 5DLQE 2CKKA 1BIBA 1OU8A 2MOXA 2AKKA 4DEXA 1QVPA 4QVDA 5GAOl 4O6JA 1OQKA 4J6YA 1X6OA 1BCOA 4EDUA 2O9VA 2CP6A 4BE0A 1K9MC 3CPWA 2DK3A 2J6OA 1VQNA 1M1KC 2CZ1B 2RD1A 2RJCA 4DA4A 3OW2S 4MZTA 1WIEA 2DEQA 4C92C 3A1PA 2L3PA 2VB6A 2QTXA 1WXBA 5GMKh 4GLMA 3TU4K 1K73R 3M54A 2VVKA 2YUPA 2F1LA 3GIBA 4E6RA 8ATCB 2BZ8A 1UJYA 2KYBA 1I81A 2KYMA 3VS7A 2QQBA 3DKMA 2K7AA 2RQUA 2DIQA 4C8QA 5I11A 4HT8A 4KRTA 1Q82C 4A53A 1ABOA 4MMLA 1NPRA 1O9SA 1AHJB 3JSCA 4P5NA 3LH5A 2CT3A 3H8ZA 1UEBA 3MEVA 1PKSA 3VV0A 4ZGJB 3CCEQ 2X51A 1FX7A 1WQ7A 2RJDA 4GLKA 2OTJT 4X9DA 5LJ3j 3VUBA 1D0XA 3M0TA 4M78A 2F2XA 4JRQA 1YBYA 2DBKA 2E5KA 2I2LA 3PFSA 1VQLT 1BI3A 4J9FA 4EMKB 2OAWA 3FC3A 2F69A 5KYYB 1N6AA 4HCZA 4Y28E 2BE7D 2DEUA 4ELYC 1T0HA 1M30A 2LRQA 3RR6A 4M78F 1GRIA 1Z9ZA 3SEMA 1QP2A 1NE8A 2OTJA 4M7DF 2E5QA 2K57A 1UGSB 1VQ8T 2XG8D 4O5VA 4CC2A 5GANj 5LJ3g 2RPNA 1QVGA 2JT4A 2GTJA 2ESWA 3C0CA 2RNAA 4MZPA 3LGFA 2XI9A 4J6WA 2DIGA 2HDAA 5GJWB 2CREA 4C8QG 2M02A 3LLRA 3PVQA 1N8RR 3M0PA 2QA4Q 5KYWA 3M5AA 4FT2A 1K0SA 2VASA 3OYKA 1U1TA 2QDYB 4Y92A 4EMKC 1PD1A 3M53A 2LTOA 2C0OA 2L3QA 1VA7A 4C92F 1X69A 2RK2A 1D1AA 4XTZA 5LL6S 3L2UA 4OB3B 1PWTA 1VQPQ 3RDVA 2RO0A 4ZTFA 1YJWQ 1I0CA 4M78G 4JJCA 2EQJA 4PKCC 2EWNA 2QA4A 2BTTA 3DLMA 3CCQT 3MEWA 4C5GA 3X28B 3BDLA 1E7OA 4ESRA 1M1FA 1G2BA 1LCKA 4JS4A 2K2MA 3PMTA 2YLCA 3BFMA 2OTLQ 2XD0A 1PRLC 3P8BB 1G3WA 3OA6A 3LH0A 2EW3A 1YJWA 1MMNA 4D6WA 5HY6A 1M3AA 2K79A 2KRNA 2BZXA 1K8AR 4LDVA 1PSEA 2QDLA 5IN1A 1UE9A 1KSWA 2QTVA 5GAN6 4OB2B 4OMNA 2FPFA 1F1BB 1YI2Q 1M90C 3X26B 2BUDA 3O5ZA 2OTLA 4OGCA 3CXCA 4OGEA 3SB2A 4M77D 1SKUB 2FYKA 2F2VA 5I22A 2HEQA 3OQ5A 1VIEA 1W1FA 1GCPA 1VOMA 2DYIA 3MP8A 5GANd 2HMAA 1T0JA 5GANf 1DJ7B 2LCLA 4F7UE 2ZCFB 2P84A 4N4IA 1KHIA 1JEGA 5CCAA 3UATA 1YI2A 3OS5A 1QWFA 2DE0X 2YRVA 5D7UA 4A54A 2ROLA 4J9BA 5I21A 3E19A 1Y0MA 3C94A 4OF1A 3VS0A 3OYEA 1QW1A 4B9XA 3INZA 3RKYA 2JMAA 4XQ3A 1MNDA 4J9IA 2FVUA 1I4K1 1X2QA 1BB9A 1W2BS 3EFRA 4KGZB 2JTFA 2LQKA 1VQMQ 3QKJA 4VUBA 3OY9A 3P8HA 2EJ9A 3VYHB 3R6OA 2X4JA 4PFZA 2D8HA 3OBWA 4LE9A 3RERA 3KFVA 2KROA 4X9CA 3LGLA 1GBRA 2RMOA 3CCLQ 1GCQA 1JRIA 3D7SB 4WF2A 4F7UB 2RHZA 1HSQA 1KD1R 5A0DA 3VYGA 4FM4B 4XAXB 2LDMA 3N5BB 3MPUB 3NHNA 4NL3A 1QVFP 1PNJA 5EG2A 2OI3A 3JCMV 1BYMA 4LD6A 1YIJT 1S72T 3M4YA 1C6VX 1IHWA 2OAUA 3CCLA 3QSUA 3QJ6A 4J5YA 1SF9A 4R55A 5FROA 4GY5A 3NTHA 3EFOA 2KSSA 2ED1A 3OBYA 4BI8B 1OX9A 1U5SA 4KH1B 5LJ3e 3SWNA 2KI7A 4E7JA 4PFOA 4KBMB 2XMFA 3L2VA 2D1XA 2LT1A 1S72A 3L2QA 4MZMA 2RK1A 4M75D 2E12A 2QI2A 1UHCA 1OZ3A 1K73C 4LNPA 1X6GA 2HKQB 3PIPA 1FYNA 4JRIA 1M8MA 1UGVA 2GBQA 4C5HA 1H3ZA 3CCRQ 3CCMT 2BKDN 3JCMd 2KDSA 4AT1B 5GAOm 3JCMf 3VRZA 3IQLA 3G1JA 3G4SQ 2DNUA 1ZHIA 5A0GA 2EYQA 4AFUC 5GANe 1OPKA 1WXUA 1TXQA 4AFSC 4ELZC 4XU3A 4RTVA 3OYIA 4HCKA 2V8IA 2JZ2A 3FIFA 2QXFA 4M7AC 3OYBA 3SD4A 3J80E 3VS2A 4RUGA 4PJOE 2DAQA 1M2VB 2KVQG 1UJ0A 4RKUE 4M7AD 1YITT 3CCRA 4FYWB 2KAFA 2KXDA 3S3NA 1HYOA 1UB4A 4BD3A 4OB1B 2YUNA 4FL6A 1D3BB 3JB9F 3CMEQ 3G4SA 2E3IA 5A2QE 4BI3A 1CKBA 3X25B 3G6ET 1B07A 3CCST 1EX4A 1UGRB 2CDTA 1YHQT 3R6NA 1VQ5T 3CCUQ 2F5TX 2ZPIB 2WSCE 1RUWA 1UECA 4KUIA 4XU0A 2KRMA 3PTAA 1W70A 3J81E 4GBQA 3JV3A 2AKLA 1Q81C 2EGCA 1VYTA 2AK5A 1G83A 2LVMA 2LNVA 1WHMA 4BY6B 1QVFS 1U3OA 2KEAA 3CMEA 1V29B 1WXTA 1YJ9T 3MO8A 1PSFA 4RCCA 4M75A 2KRSA 4PJOB 7AT1B 3T9NA 3A98A 2HBWA 1WDXA 3CCUA 5LJ5h 3G6EA 3JCMc 1VQ5A 5FLXE 1YHQA 2QQSA 2FL7A 2PVOB 1BCMA 3F70A 4HKEA 1ACMB 1N8RC 1CSKA 3JB9G 2LJ0A 3G71T 1EZZB 2ED0A 3M56A 1VQKT 4F7UF 4BUGA 1IHVA 2LC4A 3CPWS 5GAOq 3HRUA 3GLXA 5GAMh 4AFQC 5CIUA 1FWZA 1AT1B 1BKBA 4RTWA 1WHJA 3CC4T 2R5AA 2M51A 4M7AA 4J8OA 2A28A 4BY6C 3ER0A 1VYVA 2GCXA 2JN0A 5C6SA 4J7IA 5CO7A 5DLOA 3FLGA 3ASKA 4PJOC 3EGXB 4IUTA 1K1ZA 3I9QA 1KQSP 2CP3A 3X24B 1QCOA 3OS0A 4M7AF 4RTTA 3FB9A 1BI0A 4A4HA 3JCMe 1QKWA 4WCIA 2ENMA 3OYDA 1JU5C 8AT1B 5L23A 5GMKm 1K8AC 3SDZA 2JXBA 2G6FX 4M75G 3VKIA 3VS4A 1PKTA 2G3RA 2JJ9A 2DVJA 2NUPA 2MCNA 4OB0B 1KG1A 2VKNA 2FZCB 2ATCB 4OP0A 3VS3A 2CP2A 5D6XA 3E9GA 4ZGDB 3GOXA 5HK0A 2JS0A 4C5IA 4M78D 4WTOB 5IHNA 1Q86U 4PLIA 4RG8A 3TSWA 1PD0A 1RABB 4M7DD 1G3YA 5FWCA 3I55Q 3GP8A 2D6FA 3JCMJ 2EPDA 2R5MA 4HXJA 1YCYA 4OMPA 3M0QA 2IVWA 2VUBA 1X6BA 2EQKA 1BIAA 4M7AG 5HKCA 1JXMA 4Z88A 1G3TA 3PT9A 3TSZA 2P0KA 3BY7A 4N4HA 5KYXB 2KNBB 4J9CA 3GBQA 1QVGS 1ZUUA 2COZA 2DL7A 2KQWA 2DTHA 2QGGA 1KC8U 3MKDA 2O9SA 3VS1A 3I55A 2FZGB 4XU2A 1G8XA 2HCKA 2CGHA 1BBZA 2Z0WA 4BDZA 1Q95G 2YDLA 2QAZA 4C92D 4MDWA 2F5KA 4XK8E 2ZPFB 2E70A 1WQWA 4M4ZA 1JB0E 3E1SA 3RMQA 3L2WA 2YUOA 4OMFB 2R57A 2MWPA 2ZPHB 1KD1C 2GNCA 3OYHA 4DBFA 2NUTA 1BU1A 2HBPA 2EVRA 2K5FA 2H3JA 3FDRA 3CCET 4PJOF 4PJJA 4CRIA 3ZL7C 3M0SA 5AYFA 4PJMA 4EIKA 2K2VA 3LYIA 4AG2C 3QG1A 1KQSS 2NYSA 4JRKA 1TG0A 1B3QA 1MNEA 2AT1B 3META 1YCSB 1Y96A 1OZ2A 1EFNA 4M7DA 4Z89A 1R8OB 4X34A 2CH4A 3HRSA 3QDFA 2FRYA 1Q7YR 2B86A 3CCEA 2MIOA 2FEIA 4BB7A 4FT4A 2E4HA 1Q81R 1RACB 3EG9A 2DMOA 3CBPA 3HPWA 3OYCA 3MEUA 4RCBA 4RG2A 3I35A 4BI4A 2KK4A 1K4US 3FEOA 1QP3A 1UTIA 4OVAA 3JCMP 4NL2A 4ZN3A 4LDXA 1NYFA 1OEBA 2P4RA 1SHFA 1MV3A 1VUBA 1G3SA 2K3XA 5FRMA 1RAGB 4XTWA 1K9MU 4D8KA 4ME7A 4C92A 3E2UA 1A0NB 1M1KU 3OYFA 2QA4T 2QK0A 4Z02A 1W2BP 2KBTA 1LJOA 2FG0A 2ZAEA 5HCKA 1X75C 4JLIA 3QWYA 1U8RA 2GFAA 4F17A 3OYGA 3CD6Q 2QEXQ 2H8HA 1QKXA 1VQPT 5GMKl 1I5OB 1YJWT 2MK5A 1FMWA 1ABQA 3OS1A 3LWHA 2JTEA 2M0OA 1AWWA 3H6ZA 1XNIA 1Q82U 3AHUA 4M7DG 1KC8R 5AT1B 4XTXA 4M77B 3GF5A 1JJ2A 3EH1A 4AG1C
chains in the Genus database with same CATH topology
2A3LA 1LOJA 2B8AA 2OAUA 4JUVA 3CCSA 2OTLT 3CCLA 2XDBA 4C0GA 3QSUA 3QJ6A 1XOVA 4NS5A 5GAN5 3CD6A 2DZCA 2QEXA 4J5YA 5LJ3d 4HCBA 1TH7A 4DQ2A 3JB9I 4R55A 4E7LA 5LJ3f 1MGQA 2DVEA 5FROA 1YJNT 3L2RA 4GY5A 2ZZDA 4PNOA 4LDUA 3NTHA 4C0FA 2KSSA 2XHCA 1NPPA 2YLBA 5KCHA 3OBYA 4ATOA 3DB4A 4M75F 4BI8B 1VQPA 3NFCA 4E47A 5FU6B 2DZ9A 2VGMA 5LJ3e 1M5Q1 2P0PA 3L2ZA 3QZ9B 1H641 2HQEA 3SWNA 3KXTA 4QQ6A 4V2SA 1GXIE 4E7JA 1LNXA 5GAOp 1YJ9A 4C92E 3HRTA 5C0MA 4KBMB 1YI2T 2RHUA 2XIDA 2YHTA 2WSEE 3PNWC 3L2VA 2E6NA 2LT1A 1S72A 3L2QA 1JJ2S 2DD5A 2CZ7B 2RHIA 1K8AU 5J26A 4MZMA 4C92G 2RK1A 3V7RA 4M75D 1Y96B 3I56T 2E12A 2QI2A 2ZPGB 4II1A 2JUFA 5GAN3 1OZ3A 2RI5A 4XTUA 2EJFA 1K73C 4M7DB 2PUKB 2RHXA 3ZEHA 3OSVA 1SSFA 3PIPA 3E9FA 3MCAB 4JRIA 2VGNA 4ZGEB 4CI0C 1YJNA 3Q1JA 2WSFE 5CKEA 4L5GA 3HKSA 3VUZA 4C5HA 4C8QF 1NJIU 1H3ZA 2A7YA 3CCMT 3A8HB 2BKDN 2O4XB 3JCMd 5IT9E 2KDSA 5GAOm 5GAN7 3QUIA 2ZPBB 3M59A 3JCMf 4A4FA 3G71A 1BI1A 2VC8A 2ZPEB 3LWIA 4E7HA 1VQKA 2MWOA 1ZHIA 2L89A 3L1AA 5A0GA 2EYQA 5GANe 3A8LB 1Q7YU 3HFNA 2EQMA 4ELZC 5D6WA 2X4WA 1I8FA 3OMGA 4XU3A 5LJ5e 3OYIA 4E7IA 4L59A 3JRZA 3HP9A 2PUOB 3BW1A 2V8IA 2JZ2A 5DY9A 3FIFA 2QXFA 4C8QD 4EMKA 3OYBA 3SD4A 1Q81U 2HAXA 4M7AC 5CK9A 4PLLA 3CC4A 3JCMW 1Y07A 3J80E 4PL6A 3OSSC 4PJOE 5GMKe 3CXCS 2DAQA 2RI3A 2DXUA 3EFSA 2E65A 4M77E 4XTYA 2KVQG 5D6YA 2V8KA 2DJZA 3WVEB 4C92B 3PIOA 4RKUE 4KUDK 4PJOG 2DKGA 1YITT 3CCRA 3RKWA 4M7AD 2KAFA 3S3NA 3X20B 1UB4A 1VQMT 4BD3A 2XKOC 2VXEA 4OB1B 4FL6A 5CKHA 1D3BB 5LJ3h 3JB9F 3GNGA 1VQNT 3J7AF 3G4SA 4M78C 2E64A 5A2QE 4BI3A 1NJIC 3TCJA 3MHXA 3RESA 1WJSA 3X25B 3ME9A 4L6V5 3V7SA 3G6ET 3UPUA 5CQYA 2MAMA 3CCST 4M7DC 3CCLT 1UGRB 1P92A 2DO3A 1YHQT 1VQ5T 3CD6T 1VQLA 3OW2A 2JOYA 2JNGA 1OYXA 1X01A 2F5TX 3VJPA 2ZPIB 1M9SA 2QEXT 2EIFA 3M9QA 2WSCE 4Q5WA 5KE2A 5FRNA 4N4GA 4A4GA 1WPYA 2PVGB 1OI1A 2XU8A 2LX9A 4KUIA 4XU0A 3QJYA 3JB9D 2CS7A 5DLQE 3PTAA 3J81E 2CKKA 1BIBA 1Q81C 2LVMA 1QVPA 4QVDA 5GAOl 2LNVA 4O6JA 4J6YA 1M4ZA 4BY6B 1X6OA 5KH6A 2HNIA 2X4XA 2EAYA 2KY9A 1QVFS 3CMEA 2RB6A 4EDUA 2E10A 3RKXA 1V29B 1YJ9T 2XDDA 4BE0A 1VQMA 3MO8A 1K9MC 1KD1U 1PSFA 3CPWA 2DK3A 4RCCA 1VQNA 4M75A 3M4GA 1M1KC 4PJOB 4JJNK 1VQ8A 4IKFA 2CZ1B 3URGA 2RD1A 3T9NA 5GANh 4LD9K 2RJCA 4DA4A 3CCUA 3SFMA 5LJ5h 3G6EA 3C95A 5KE3A 3JCMb 3OW2S 4JLGA 4MZTA 1Y7XA 2DEQA 5IAYA 4C92C 3JCMc 1VQ5A 5FLXE 4EPCA 1YHQA 2GQVA 2QQSA 2FL7A 2PVOB 2QTXA 5GMKh 4BDYA 3F70A 4HKEA 5GANg 3TU4K 1N8RC 2M16A 3CPFA 5LJ5g 2PU9B 3CCJA 3M54A 1N9RA 3TEEA 3JB9G 1M90U 3SWNB 3GIBA 3G71T 4FSXA 3CBMA 1KQSA 1I81A 2XICA 3FRNA 2QQBA 2RM4A 2L5QA 2X4YA 2LC4A 3DKMA 3M56A 4BUGA 4F7UF 5GAOq 3CPWS 3BDUA 2MMPA 1UGPB 3HRUA 2DIQA 2X35A 3GLXA 2HD0A 4C8QA 5GAMh 2DTIA 5CIUA 1FWZA 2E1HA 2C06A 3S6WA 1BKBA 4HT8A 1Q82C 4A53A 3CC4T 4JRPA 1B34B 1NPRA 2R5AA 1O9SA 3NTKA 4MMLA 5I2SA 4M7AA 3HSBA 4IUUA 5GAMg 1B34A 4J8OA 1AHJB 3JSCA 4P5NA 4IUVA 3V8LA 4BY6C 4BE1A 3H8ZA 3ER0A 5GAN8 1UEBA 3DB3A 3MEVA 2GCXA 2JN0A 3CCRT 5C6SA 3VV0A 4J7IA 4ZGJB 5GAOr 5CO7A 5I2MA 1FX7A 5DLOA 3CCVA 1WQ7A 2RJDA 3FLGA 4GLKA 3CC2A 3ASKA 4X9DA 5LJ3j 3CCQA 3VUBA 2HQXA 3G4ST 3QIIA 4PJOC 2LT4A 4IUTA 1N27A 2GF7A 4M77C 2QQRA 4QVCA 4QW2A 1VQKT 1UGQB 2RJFA 4UC4A 4M78A 4JRQA 3X24B 1YBYA 3PFSA 2I2LA 3UT1A 3OS0A 4M7AF 3FB9A 1BI3A 1RL2A 1VQLT 1BI0A 4A4HA 4EMKB 3JCMe 3ZFJA 3OYMA 2M1HA 4HT9A 1XTDA 2K5IA 3OYYA 4M75E 5CVIA 3OYDA 3A8OB 1WJQA 2M9UA 1NZ9A 2F69A 5GMKm 3FC3A 4ZTJA 5J3BA 2E6ZA 2QQAA 2CZ0B 2EQUA 3SDZA 3SWNC 1K8AC 4M75G 4QVZA 1N6AA 5FU6C 3CC7T 4HCZA 4Y28E 3VKIA 3JAME 4ELYC 1RI0A 2G3RA 4C0ZA 2LRQA 4M78F 3CMET 2RI2A 4A4EA 2K5LA 1QP2A 1NE8A 2OTJA 4M7DF 2E5QA 2K57A 1UGSB 3A5ZB 3V8KA 5L8RE 1VQ8T 2XG8D 4OB0B 1KG1A 4O5VA 4YTLA 5J39A 3CCUT 4OP0A 1VQ7T 5GAN2 3S3MA 2K3YA 5GANj 1VQ9A 4N0AC 5D6XA 3E9GA 3V7CA 5LJ5j 3G7ZA 4DOVA 4ZGDB 3GPLA 2EFIA 5LJ3g 3GOXA 5HK0A 2L8DA 4C5IA 1QVGA 4M78D 3OYLA 4EMGA 4C8QE 2QQ9A 3LGFA 2FHDA 4MZPA 4E7KA 1Q86U 2XI9A 4PLIA 2LCCA 5GMKj 1Q7YC 3MP1A 3QYHB 4RG8A 4J6WA 2DIGA 3CCJT 4M7DD 1G3YA 4IUPA 3M55A 4FU6A 4C8QG 3GP8A 3LLRA 3QZ5B 2D6FA 3JCMJ 1VQ6A 3QBYA 2PVDB 3LW5E 4IURA 1HXDA 3CC7A 4M7AE 4MDXA 2R5MA 3M5AA 4FT2A 1YCYA 4MMKA 3JB9H 2DXCA 1WJRA 5KCOA 2IVWA 2VUBA 2D0QB 4J7FA 3OYKA 4J83A 3S3OA 1U1TA 2EQKA 1KHCA 2DTOA 2K4YA 1BIAA 2QDYB 2R58A 3HHTB 4M75B 3WVDB 3C12A 4EMKC 5HKCA 3UDCA 4M7AG 5GAMj 3M53A 1FXXA 2LTOA 2Y4YA 1G3TA 2P4TA 1MHNA 2VXFA 4C92F 3DLLA 5CKBA 3PT9A 2RK2A 5GAN4 1WGSA 5CKFA 2P0KA 3BY7A 4N4HA 1VQ7A 3JCMh 3TREA 2V8JA 4F7UA 1QVGS 1G5VA 2KQWA 2RJEA 4XTZA 5LL6S 3RMSA 3L2UA 2MF2A 2DTHA 4OB3B 4B9WA 1KC8U 1Y71A 2RO0A 4ZTFA 3I55A 4M78G 2EQJA 4PKCC 4XU2A 3JCMg 2EWNA 3CCVT 2CGHA 2QA4A 4BDZA 3A8GB 3DLMA 3CC2T 3CCQT 2O01E 4C92D 3MEWA 4MDWA 4JS5A 4C5GA 2F5KA 1VQOA 3X28B 3BDLA 4XK8E 3A8MB 2ZPFB 3CBOA 1JBMA 2E70A 4KULA 1WQWA 4BE2A 3CMAT 1JB0E 1M1FA 4C8QB 4LDYA 1VQ4A 4M77A 4JS4A 2NLUA 3E1SA 3RMQA 1ZQ1A 3L2WA 2PQWA 1I5LA 4HCCA 1IREB 2KMTA 4OMFB 2E41A 3PMTA 2R57A 2YLCA 3UWNA 3JCMQ 3BFMA 2MWPA 2ZPHB 2DXBA 1KD1C 3RUXA 2XD0A 3P8BB 4M7AB 3OYHA 3L42A 3JCMX 1G3WA 1O75A 3OA6A 2HBPA 5GAOn 3LH0A 2K5FA 2H3JA 3FDRA 4NOYA 1YJWA 4D6WA 1VIFA 5HY6A 3CEYA 3CCET 4PJOF 5GMKi 3MP6A 2CZ6B 2CYZB 4LDVA 2BIVA 4M75C 4M77F 1PSEA 1KC8C 4CRIA 1XQHA 5IN1A 2DXTA 5AYFA 2GFUA 2K2VA 3LYIA 3QG1A 3QPHA 1YIJA 5GAN6 2VV5A 4OB2B 1ZBXA 4M78B 2LQ8A 1KQSS 4KT0E 3HFOA 1VQ9T 4JRKA 3CMAA 3OMCA 1M90C 3X26B 3RIRA 2BUDA 3META 2OTLA 4HA8A 1Y96A 4Y91A 4PJOD 2VYTA 1OZ2A 2AHJB 4OGCA 3QO3A 4OGEA 3SB2A 4N0AA 3CXCA 3NTIA 4M7DA 2ZGWA 1N9SA 4M77D 2FYKA 1HK9A 4LDWA 1R8OB 1VIEA 3OQ5A 4X34A 4TVRA 3MP8A 5GANd 3HRSA 3PGGA 5M9OA 1WNLA 2WACA 5LJ5d 5GANf 1DJ7B 1VQ6T 2LCLA 1W2BA 4F7UE 3CCEA 1BI2A 5LJ5f 3P8DA 2ZCFB 2O4XA 4QQDA 4C8QC 3OYJA 3PMIA 3QHSA 4QQGA 4BB7A 4FT4A 3FJPA 4N4IA 4C0DB 1KHIA 3CBPA 3HPWA 4F7UG 1M8VA 5CCAA 3EAEA 3OYCA 3MEUA 5CKDA 3O8VA 1YI2A 4RCBA 3M57A 4RG2A 3OS5A 4BI4A 2KK4A 2YRVA 3FEOA 2IG0A 4A54A 2FB7A 1M1GA 5I21A 3OYAA 4ZN1A 1QP3A 3E19A 4OVAA 2DPPB 3I56A 3JCMP 1KQ1A 3C94A 4NL2A 4OF1A 4ZN3A 4LDXA 4EMHA 1QW1A 3ZBDA 3OYEA 5FU7B 4B9XA 4C5EA 4RMOA 2Y4XA 1VUBA 1G3SA 2JTMA 2K3XA 3INZA 5FRMA 2RHYA 3MEAA 3RKYA 5GAMd 4XTWA 1K9MU 3I55T 4ME7A 4C92A 5GAMf 4XQ3A 1M1KU 3WXMB 4M77G 4JDSA 4XTVA 2FVUA 3OYFA 4DOWA 1I4K1 2QA4T 1QVFA 1W4SA 1W2BS 3EFRA 2JTFA 4Z02A 3CCMA 1VQOT 2Y90A 1KQ2A 1D3BA 2LQKA 3QKJA 1LJOA 5GAMe 4VUBA 2RH2A 3OY9A 3P8HA 2EJ9A 2XDPA 3QYGB 1VQ4T 3VYHB 2EKOA 3R6OA 2X4JA 5HK3A 5CR2A 1X75C 3QXEB 3OBWA 4JLIA 3KUFA 3M58A 2RA2A 4BACA 2D9TA 4XU1A 4X9CA 1U8RA 1N8RU 1EIFA 2GFAA 3LGLA 1U1SA 3RERA 4FIBA 1JRIA 4WF2A 3OYGA 2DD4A 2P0QA 4F7UB 5DM7R 2JVVA 3C4SA 2RHZA 3V8JA 3OYNA 3GNFB 3OS2A 5CAIA 5GMKl 1VQPT 5A0LA 4M78E 1YJWT 2L3RA 5A0DA 3OS1A 3LWHA 3KBGA 3VYGA 4FM4B 4XAXB 2LDMA 2M0OA 3JB9J 3N5BB 3HL8A 3QDRB 4C0DC 4R56A 4NL3A 1YITA 4J6XA 4M7DE 3VU3C 4A4KA 3H6ZA 5EG2A 3LX7A 5CQXA 1Q86C 1XNIA 3JCMV 1Q82U 1BYMA 2MI6A 4LD6A 3AHUA 1YIJT 1S72T 4M7DG 3OB9A 1IZ6A 2XK0A 2EJGA 4XTXA 4M77B 3GF5A 1K73U 3M4YA 1JJ2A 4PJOA 4IUQA 5FU7C 2OTJT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LOJ A;  1WPY A;  4JUV A;  3JB9 D;  4XU0 A;  3QSU A;  5GAN 5;  5GAN 6;  4M78 F;  4M78 B;  2DZC A;  1BIB A;  4J5Y A;  3HFO A;  5LJ3 d;  4JRK A;  1TH7 A;  4DQ2 A;  3JB9 I;  4QVD A;  5LJ3 f;  1MGQ A;  2DVE A;  3RIR A;  5GAO l;  4PNO A;  4J6Y A;  4M7D F;  2K57 A;  4HA8 A;  1Y96 A;  4Y91 A;  3V8K A;  4PJO D;  2HNI A;  2EAY A;  2YLB A;  3QO3 A;  4N0A A;  2RB6 A;  3SB2 A;  2E10 A;  4M75 F;  3RKX A;  4M7D A;  2ZGW A;  1N9S A;  4M77 D;  4OP0 A;  5GAN 2;  5GAN j;  2FYK A;  1HK9 A;  4N0A C;  3V7C A;  5LJ5 j;  2DZ9 A;  4RCC A;  5LJ3 e;  1M5Q 1;  4M75 A;  3M4G A;  3L2Z A;  4V2S A;  1H64 1;  3SWN A;  5LJ3 g;  4PJO B;  5GAN d;  2RD1 A;  4M78 D;  3PGG A;  4EMG A;  5GAN h;  1WNL A;  1LNX A;  4C8Q E;  5LJ5 d;  5GAN f;  5GAO p;  4C92 E;  4F7U E;  5LJ5 h;  5LJ5 f;  5GMK j;  3JCM b;  2YHT A;  4J6W A;  4C8Q C;  2DEQ A;  4M7D D;  3QHS A;  3JCM c;  4C92 C;  3FJP A;  4C8Q G;  4C92 G;  4F7U G;  2QTX A;  1M8V A;  3V7R A;  3JCM J;  4M75 D;  1Y96 B;  5GMK h;  1HXD A;  5GAN g;  4RCB A;  5GAN 3;  4M7A E;  4XTU A;  2EJF A;  1YCY A;  5LJ5 g;  4M7D B;  4MMK A;  3JB9 H;  4A54 A;  2FB7 A;  1N9R A;  5I21 A;  3JB9 G;  1U1T A;  2DTO A;  4M75 B;  1BIA A;  4M7A G;  3SWN B;  4EMK C;  3GIB A;  3JCM P;  1KQ1 A;  4JRI A;  4NL2 A;  4EMH A;  5GAM j;  2VXF A;  4C8Q F;  1I81 A;  4C92 F;  2RM4 A;  3INZ A;  4F7U F;  5GAN 4;  3RKY A;  3JCM d;  5GAO q;  5GAM d;  3BY7 A;  3BDU A;  4XTW A;  3JCM h;  3QUI A;  5GAN 7;  4C8Q A;  3JCM f;  5GAM h;  5GAO m;  4C92 A;  5GAM f;  4XQ3 A;  4F7U A;  2DTI A;  2VC8 A;  4M77 G;  4XTV A;  2E1H A;  1I4K 1;  4XTZ A;  2DTH A;  3EFR A;  4HT8 A;  4A53 A;  2Y90 A;  3L1A A;  1B34 B;  4MML A;  5GAN e;  1D3B A;  1KQ2 A;  3HFN A;  4M78 G;  1LJO A;  5GAM e;  5LJ5 e;  1I8F A;  4XU2 A;  4XU3 A;  3JCM g;  3HSB A;  2EWN A;  5GAM g;  1B34 A;  2CGH A;  4M7A A;  2EJ9 A;  3V8L A;  3BW1 A;  4EMK A;  5DY9 A;  3FIF A;  4C8Q D;  4M7A C;  4C92 D;  4JLI A;  5GAN 8;  2RA2 A;  2JN0 A;  3JCM W;  3RER A;  4XU1 A;  4X9C A;  4PJO E;  5GMK e;  5GAO r;  1U1S A;  1JBM A;  1WQW A;  1WQ7 A;  2DXU A;  3EFS A;  2E65 A;  4M77 E;  4XTY A;  1JRI A;  4WF2 A;  4C8Q B;  2DJZ A;  4M77 A;  4X9D A;  4C92 B;  4F7U B;  5LJ3 j;  4PJO C;  4PJO G;  2DKG A;  3V8J A;  1I5L A;  3RKW A;  4M7A D;  4M77 C;  4QVC A;  5CAI A;  5GMK l;  2E41 A;  4M78 E;  2YLC A;  3JCM Q;  3BFM A;  2VXE A;  4M78 A;  5LJ3 h;  1D3B B;  3JB9 F;  2I2L A;  3RUX A;  3JB9 J;  4M7A F;  4M7A B;  4M78 C;  2E64 A;  3FB9 A;  4NL3 A;  3JCM X;  4J6X A;  4M7D E;  4EMK B;  3JCM e;  3VU3 C;  3RES A;  5GAO n;  4HT9 A;  3V7S A;  4NOY A;  4M75 E;  3JCM V;  4M7D C;  4PJO F;  3AHU A;  5GMK i;  5GMK m;  4M7D G;  4M75 C;  4M77 F;  1X01 A;  2EJG A;  4M77 B;  4XTX A;  3SWN C;  4PJO A;  4M75 G;  2DXT A; 
#chains in the Genus database with same CATH topology
 2B8A A;  1LOJ A;  2OTL T;  1ZSG A;  1QCF A;  4NS5 A;  5GAN 5;  3CD6 A;  2DZC A;  4PJL A;  1TS9 A;  2QEX A;  1AVZ C;  5LJ3 d;  4HCB A;  1C0M A;  4E7L A;  5LJ3 f;  1I07 A;  4LDU A;  2JW4 A;  4LN2 A;  5KCH A;  2YLB A;  5FW9 A;  2V26 A;  1VQP A;  2RQR A;  2QGF B;  5FU6 B;  2DZ9 A;  2YXY A;  1ZSZ B;  2P0P A;  3L2Z A;  1H64 1;  1GXI E;  1KIK A;  2JMC A;  4FW2 A;  1LNX A;  1WHG A;  3HRT A;  1YI2 T;  2RHU A;  2XID A;  1PRM C;  2E6N A;  2IPO B;  2CZ7 B;  4C92 G;  1UFF A;  2JUF A;  2RI5 A;  2V1Q A;  5KYU B;  2RHX A;  3EG2 A;  4HVW A;  2CUD A;  3HKS A;  1NJI U;  4CC4 B;  3A8H B;  2O4X B;  3M59 A;  2VC8 A;  3LWI A;  9ATC B;  1NBE B;  3A8L B;  3HFN A;  2EQM A;  5D6W A;  3VRY A;  1I8F A;  3OMG A;  2MYS A;  4E7I A;  3H0I A;  4LD9 K;  2PUO B;  4EMK A;  1ARK A;  4PLL A;  3JCM W;  1Y07 A;  3OSS C;  1U06 A;  1S1N A;  2YRC A;  2COW A;  3EHQ A;  1ZSZ C;  2RQV A;  4KUD K;  2DJZ A;  5KYY A;  3TVT A;  2DKG A;  3CC7 Q;  1VQM T;  5LJ3 h;  1I1J A;  3GNG A;  3J7A F;  1WJS A;  1PG5 B;  3ME9 A;  3UPU A;  5CQY A;  2GGR A;  3CCL T;  1VQ7 Q;  1OYX A;  1TUD A;  1AOJ A;  2FZK B;  2PVG B;  2RF0 A;  2XU8 A;  3JB9 D;  1ZUK A;  4DBH A;  3CCJ Q;  5ECA A;  1M4Z A;  5KH6 A;  2HNI A;  2X4X A;  2RB6 A;  3RKX A;  2DFU A;  4RTX A;  1VQM A;  2SRC A;  3M4G A;  4JJN K;  5GAN h;  2HL5 C;  1YNZ A;  3C95 A;  4JLG A;  1QMC A;  4PK4 A;  4J9D A;  1T3L A;  4BDY A;  1ZBJ A;  2K9G A;  4B6M A;  2M16 A;  5LJ5 g;  2PU9 B;  1R0B G;  3CCJ A;  1N9R A;  1M90 U;  1RAF B;  5IHI A;  1FMV A;  3CCV Q;  4FSX A;  1IXD A;  3CC2 Q;  1AD5 A;  2XIC A;  2RM4 A;  2L5Q A;  2X3W D;  3TQ7 P;  3CPW P;  2MMP A;  4X1V A;  2X35 A;  3CMA Q;  2COY A;  2E1H A;  3S6W A;  4JRP A;  2W10 A;  3NTK A;  2DER A;  3HSB A;  5GAM g;  1NLO C;  1B34 A;  2CP0 A;  4BE1 A;  1NLP C;  3DB3 A;  3CCR T;  2LMJ A;  1RAH B;  5I2M A;  3CCV A;  2DYB A;  3CC2 A;  1N5Z A;  3G4S T;  2HQX A;  2PTK A;  3QII A;  2J7I A;  1N27 A;  4FSS A;  4QVC A;  1UGQ B;  4UC4 A;  1TTH B;  1W6X A;  1RLQ C;  3UT1 A;  3THK A;  1WHH A;  1VQ9 Q;  1RL2 A;  3OYM A;  2LQW A;  1XTD A;  2GQI A;  3A8O B;  1SG5 A;  1NZ9 A;  2M9U A;  1LPL A;  4ZTJ A;  2AZS A;  5J3B A;  2QQA A;  2DRK A;  4QVZ A;  1E6H A;  3JAM E;  1RI0 A;  1VQ6 Q;  3CME T;  3PE0 A;  4A4E A;  2K5L A;  3BE3 A;  2JS2 A;  3NPF A;  3A5Z B;  2DA9 A;  2M0Y A;  3CCU T;  5GAN 2;  3S3M A;  1VQ9 A;  4N0A C;  2A36 A;  3V7C A;  3G7Z A;  2NUZ A;  4DOV A;  4JJD A;  4FCY A;  4C8Q E;  2QQ9 A;  2LQN A;  2LCC A;  4F16 A;  5GMK j;  3MP1 A;  3QYH B;  1Q7Y C;  4QKU A;  4IUP A;  1VQ6 A;  1AWJ A;  3LW5 E;  4IUR A;  1HXD A;  4MDX A;  1JQQ A;  2HKN A;  4MMK A;  5KCO A;  1VQO Q;  2D0Q B;  4J7F A;  4LXC A;  3S3O A;  2K4Y A;  2R58 A;  3WVD B;  3C12 A;  1LVK A;  1VQ4 Q;  2L2P A;  4RTZ A;  2P4T A;  2VXF A;  3MJX A;  1D1C A;  5GAN 4;  1WGS A;  3JCM h;  3TRE A;  4F7U A;  1QVG P;  2O31 A;  2MF2 A;  4B9W A;  2J05 A;  1M3B A;  1MUZ A;  1OX8 A;  2ROT A;  3A8G B;  1GFC A;  2KXC A;  2O01 E;  1SSH A;  1VQO A;  3CBO A;  4KUL A;  2DF6 A;  2LJ3 A;  4C8Q B;  1VQ4 A;  2EGA A;  5IHK A;  1ZA2 B;  2PQW A;  1I5L A;  2E41 A;  3H0F A;  2HSE B;  2EYX A;  4F04 B;  2DXB A;  3RUX A;  4J9H A;  1HD3 A;  3HTR A;  3JCM X;  4ZNX A;  1O75 A;  1YJN Q;  1IRX A;  1VIF A;  3CEY A;  3EH2 A;  5GMK i;  3MP6 A;  2CZ6 B;  2BIV A;  1KC8 C;  1D0Y A;  1ZBX A;  4M78 B;  2DL3 A;  2LQ8 A;  3RNJ A;  4RTY A;  3RIR A;  1QQJ A;  4HA8 A;  1Y57 A;  4PJO D;  2AHJ B;  3CC4 Q;  3QO3 A;  1IGQ A;  3I56 Q;  4N0A A;  3NTI A;  2ZGW A;  1N9S A;  1K76 A;  4LDW A;  1HK9 A;  1JO8 A;  1ZA1 B;  4TVR A;  5IH2 A;  2MPX C;  3UA6 A;  3PGG A;  5M9O A;  1PM3 A;  1WNL A;  2NWM A;  3REB B;  1BI2 A;  4A63 B;  1QLY A;  3NGP A;  2AIR B;  4C8Q C;  3OYJ A;  1AWO A;  3PMI A;  3QHS A;  4QQG A;  3FJP A;  4C0D B;  4F7U G;  1M8V A;  2FPD A;  3EAE A;  3EG1 A;  5CKD A;  3O8V A;  2SEM A;  3M57 A;  1R77 A;  1KK7 A;  2YUQ A;  2IG0 A;  1M1G A;  2DJQ A;  3OYA A;  2DPP B;  3I56 A;  1KQ1 A;  2ABL A;  4EMH A;  3ZBD A;  2LP5 A;  3CXC P;  4C5E A;  4RMO A;  2JTM A;  1M2V A;  2CSQ A;  3EG3 A;  3H41 A;  3I55 T;  2J6K A;  1RLP C;  3WXM B;  1QVF A;  4DOW A;  1W4S A;  2CP5 A;  2LJ1 A;  5KYW B;  2Y90 A;  1KQ2 A;  1D3B A;  5GAM e;  3H9N A;  1VQN Q;  1M2O A;  3NMZ C;  2XDP A;  3QYG B;  1ZLM A;  2KGT A;  1T3S A;  3KUF A;  2RA2 A;  3M58 A;  3EHR A;  4XU1 A;  1N8R U;  2PZ1 A;  4OMQ A;  4IIM A;  1D1B A;  2P0Q A;  5DM7 R;  4CC3 A;  3C4S A;  3V8J A;  3OYN A;  2EGE A;  3GNF B;  2QG9 B;  2IIM A;  3KBG A;  2LZ6 B;  4AFZ C;  2RQW A;  3JB9 J;  3HL8 A;  4C0D C;  4R56 A;  3VU3 C;  5CQX A;  2MI6 A;  1K9A A;  4KGX B;  3SHW A;  3OB9 A;  2EJG A;  1OU9 A;  4PJO A;  4FYY B;  4IIO A;  4RTU A;  2A3L A;  4JUV A;  2EBP A;  1XOV A;  4JJB A;  3JB9 I;  1MGQ A;  3L2R A;  2ZZD A;  4C0F A;  4J9E A;  4ATO A;  1H3H A;  3DB4 A;  3VS5 A;  1ZUY A;  2F2W A;  4E47 A;  1CKA A;  1SPK A;  2LX7 A;  1M5Q 1;  3QZ9 B;  4V2S A;  2DBM A;  5FWB A;  2V1R A;  5GAO p;  5C0M A;  3CQT A;  2YHT A;  1V1C A;  1JJ2 S;  2DD5 A;  1K8A U;  5J26 A;  2CP7 A;  2ZPG B;  5GAN 3;  2PUK B;  4J9G A;  1WX6 A;  3ZEH A;  2O2O A;  3QWX X;  3MCA B;  2AZV A;  2VGN A;  2WSF E;  5CKE A;  4C8Q F;  2A7Y A;  5IT9 E;  1D0Z A;  3QUI A;  2ZPB B;  1BI1 A;  3EGX A;  2ZPE B;  2OTJ Q;  4E7H A;  2ECZ A;  2MWO A;  2L89 A;  3L1A A;  2X4W A;  1OUL A;  1TU0 B;  3JRZ A;  3HP9 A;  2X9H A;  1SHG A;  1VQL Q;  3EGD A;  4PL6 A;  5GMK e;  3CXC S;  2RI3 A;  2BZY A;  4E7S A;  3EFS A;  4M77 E;  2E65 A;  4XTY A;  3PIO A;  1YWP A;  4PJO G;  2I0N A;  3PVL A;  1J3T A;  2XKO C;  1AZE A;  4FYV B;  1NJI C;  1H92 A;  1YWO A;  1Q86 R;  4L6V 5;  1VQ8 Q;  2DET A;  1WHL A;  2DO3 A;  1UG1 A;  3CD6 T;  1VQL A;  3OW2 A;  2JNG A;  3VJP A;  1X01 A;  2QEX T;  3M9Q A;  1YFN A;  4N4G A;  2RN8 A;  4A4G A;  1OI1 A;  4IKF A;  4JZ3 A;  2CS7 A;  1MV0 B;  1AWX A;  1WA7 A;  1UHF A;  1E6G A;  1UDL A;  2EAY A;  2KY9 A;  2E10 A;  2EYY A;  1ZX6 A;  2XDD A;  1UUE A;  1KD1 U;  2EYZ A;  2LNH B;  1VQ8 A;  3URG A;  3SFM A;  5KE3 A;  3JCM b;  5KYX A;  1Y7X A;  5IAY A;  4EPC A;  2GQV A;  4LUD A;  1TWB A;  3EFO B;  5GAN g;  3CPF A;  3TEE A;  2L0A A;  3SWN B;  1NEG A;  1NYG A;  3CBM A;  3CCQ Q;  2DRM A;  1JXO A;  3M0R A;  1KQS A;  1SRL A;  1R0C B;  3FRN A;  4FW1 A;  2X4Y A;  3AT1 B;  1GCQ C;  3VS6 A;  3BDU A;  1UGP B;  2HD0 A;  2DTI A;  2C06 A;  1WYX A;  4ANJ A;  1B34 B;  4FYX B;  5I2S A;  4E7Z A;  4IUU A;  3V8L A;  4IUV A;  1XJW B;  2QAS A;  5GAN 8;  1X2K A;  5GAO r;  2HZY A;  1WHK A;  2KT8 A;  3CCQ A;  2LT4 A;  2GF7 A;  1OOT A;  4M77 C;  2QQR A;  4QW2 A;  2RJF A;  4OMO A;  4JZ4 A;  4R0K A;  1OPL A;  3ZFJ A;  2M1H A;  1RAA B;  4HT9 A;  2K5I A;  3OYY A;  4M75 E;  5CVI A;  2EYW A;  1WJQ A;  2D8J A;  4OMM A;  2BE9 B;  2E6Z A;  2CZ0 B;  2EQU A;  3SWN C;  5IXF A;  1IO6 A;  5FU6 C;  3CC7 T;  1BK2 A;  4C0Z A;  1MMA A;  2W0Z A;  2RI2 A;  4AMC A;  1RAI B;  1PC0 A;  1D09 B;  3V8K A;  5L8R E;  5J39 A;  4YTL A;  1K9M R;  1GFD A;  1VQ7 T;  1RAE B;  2K3Y A;  4ORZ A;  1M1K R;  5LJ5 j;  3GPL A;  2EFI A;  1TSF A;  2L8D A;  3OYL A;  3H0H A;  4EMG A;  2A0F B;  2FHD A;  2KR3 A;  2E3H A;  4E7K A;  4DBQ A;  3CCJ T;  3I5R A;  3M55 A;  4FU6 A;  3QZ5 B;  3QBY A;  2PVD B;  3CC7 A;  3UF4 A;  4M7A E;  2KE9 A;  3JB9 H;  2DXC A;  1WJR A;  1GBQ A;  1QCN A;  2J06 A;  4J83 A;  3HHT B;  1KHC A;  2DTO A;  4M75 B;  3UDC A;  5GAM j;  5KYN A;  1FXX A;  2Y4Y A;  1MHN A;  3DLL A;  1FMK A;  5CKB A;  1B7T A;  5CKF A;  1VQ7 A;  2OX7 A;  2V8J A;  1G5V A;  2RJE A;  2GTO A;  3RMS A;  1Q82 R;  4DBR A;  4OML A;  1WLP B;  1Y71 A;  2K6D A;  3JCM g;  4E2F B;  2JM8 A;  3CCV T;  3CC2 T;  1NG2 A;  4JS5 A;  3A8M B;  2D0N A;  1WI7 A;  1JBM A;  4HVU A;  4BE2 A;  3CMA T;  1YIJ Q;  1S72 Q;  4LDY A;  4M77 A;  2NLU A;  1ZQ1 A;  4HCC A;  1IRE B;  2KMT A;  3JCM Q;  3UWN A;  1KFZ A;  4M7A B;  3L42 A;  1V76 A;  5GAO n;  1PHT A;  3I5S A;  4NOY A;  2J6F A;  2CYZ B;  4M75 C;  4M77 F;  1ZSZ A;  1PCX A;  1XQH A;  2DXT A;  3FJ5 A;  2DL8 A;  2GFU A;  3REA B;  4KH0 B;  4Z8A A;  3QPH A;  1YIJ A;  2VV5 A;  3RBB B;  4KT0 E;  3HFO A;  1VQ9 T;  1RI9 A;  3CMA A;  3OMC A;  1NJI R;  4Y91 A;  2VYT A;  5IXB A;  5KYU A;  4KGV B;  2WAC A;  5LJ5 d;  1VQ6 T;  1W2B A;  4F14 A;  5LJ5 f;  1IB8 A;  3P8D A;  1OV3 A;  2DIL A;  2O4X A;  4QQD A;  3CCM Q;  1M3C A;  1YP5 A;  1VYU A;  2CSI A;  1M27 C;  2NUP B;  1NM7 A;  5EC7 A;  2FB7 A;  1HJD A;  4ZN1 A;  2OJ2 A;  1AEY A;  2HL3 A;  5FU7 B;  3M0U A;  2Y4X A;  4LUE A;  2RHY A;  3MEA A;  5GAM d;  5GAM f;  2EKH A;  4M77 G;  4JDS A;  4XTV A;  2O88 A;  1TUC A;  2A37 A;  1YIT Q;  2LCS A;  3CCM A;  1VQO T;  2FRW A;  1Z9Q A;  2RH2 A;  4QT7 A;  1VQ4 T;  2QYZ A;  2EKO A;  5CR2 A;  5HK3 A;  1KJW A;  3QXE B;  2DL5 A;  4BAC A;  2L3S A;  2D9T A;  1C1A A;  1EIF A;  3G6E Q;  3ULR B;  1U1S A;  2YT6 A;  3CCS Q;  2K3B A;  4FIB A;  1VQ5 Q;  1YHQ Q;  4K11 A;  2DD4 A;  2JVV A;  3OS2 A;  2JM9 A;  5CAI A;  5A0L A;  4M78 E;  2L3R A;  1IGU A;  2C0I A;  3QDR B;  1YIT A;  4J6X A;  4M7D E;  4A4K A;  2FPE A;  3LX7 A;  1Q86 C;  1YJ9 Q;  1WZO A;  1IZ6 A;  2FO0 A;  2XK0 A;  1K73 U;  4IUQ A;  5FU7 C;  2XDB A;  3CCS A;  4C0G A;  3OW2 P;  1X27 A;  1M90 R;  2A08 A;  1WFW A;  2DX1 A;  1TH7 A;  4PFP A;  4DQ2 A;  2DVE A;  2NUT B;  1YJN T;  4PNO A;  4DEY A;  1GL5 A;  2XHC A;  1NPP A;  2YSQ A;  1TOV A;  4M75 F;  1SEM A;  3NFC A;  1QWE A;  2VGM A;  1MMD A;  2HQE A;  3KXT A;  4QQ6 A;  6AT1 B;  3U23 A;  3G71 Q;  1YJ9 A;  4C92 E;  2CUB A;  2DLP A;  2WSE E;  3PNW C;  1VQK Q;  2C0T A;  1MMG A;  2RHI A;  1JJ2 P;  1YN8 A;  1AZG B;  3V7R A;  3I56 T;  1Y96 B;  4II1 A;  3UA7 A;  2H3E B;  4PJN A;  4XTU A;  2EJF A;  4M7D B;  5GJV B;  3OSV A;  1SSF A;  2DL4 A;  1K0X A;  3E9F A;  4CC7 A;  4ZGE B;  1YJN A;  4CI0 C;  3Q1J A;  3EG0 A;  4L5G A;  3VUZ A;  2VWF A;  4JPB W;  5GAN 7;  1TUG B;  4A4F A;  3G71 A;  2HSP A;  3EG9 B;  2RQT A;  4HVV A;  1VQK A;  1Q7Y U;  5LJ5 e;  4L59 A;  3EGD B;  3BW1 A;  1X43 A;  5DY9 A;  4C8Q D;  2HAX A;  1Q81 U;  5CK9 A;  3CC4 A;  2X3X D;  1RAD B;  2YRD A;  2DXU A;  5D6Y A;  2V8K A;  4C92 B;  3WVE B;  2YWW A;  2EQI A;  3RKW A;  2CH4 W;  2PNI A;  3X20 B;  2CT4 A;  2VXE A;  5CKH A;  2DM1 A;  1VQN T;  1H8K A;  4M78 C;  2E64 A;  3TCJ A;  3MHX A;  3RES A;  2HQH A;  3EGU A;  3V7S A;  2MAM A;  4M7D C;  1P92 A;  1NEB A;  1SRM A;  2JOY A;  1M9S A;  2EIF A;  4Q5W A;  5KE2 A;  5FRN A;  2KT1 A;  4D8D A;  1WPY A;  2LX9 A;  3QJY A;  5DLQ E;  2CKK A;  1BIB A;  1OU8 A;  2MOX A;  2AKK A;  4DEX A;  1QVP A;  4QVD A;  5GAO l;  4O6J A;  1OQK A;  4J6Y A;  1X6O A;  1BCO A;  4EDU A;  2O9V A;  2CP6 A;  4BE0 A;  1K9M C;  3CPW A;  2DK3 A;  2J6O A;  1VQN A;  1M1K C;  2CZ1 B;  2RD1 A;  2RJC A;  4DA4 A;  3OW2 S;  4MZT A;  1WIE A;  2DEQ A;  4C92 C;  3A1P A;  2L3P A;  2VB6 A;  2QTX A;  1WXB A;  5GMK h;  4GLM A;  3TU4 K;  1K73 R;  3M54 A;  2VVK A;  2YUP A;  2F1L A;  3GIB A;  4E6R A;  8ATC B;  2BZ8 A;  1UJY A;  2KYB A;  1I81 A;  2KYM A;  3VS7 A;  2QQB A;  3DKM A;  2K7A A;  2RQU A;  2DIQ A;  4C8Q A;  5I11 A;  4HT8 A;  4KRT A;  1Q82 C;  4A53 A;  1ABO A;  4MML A;  1NPR A;  1O9S A;  1AHJ B;  3JSC A;  4P5N A;  3LH5 A;  2CT3 A;  3H8Z A;  1UEB A;  3MEV A;  1PKS A;  3VV0 A;  4ZGJ B;  3CCE Q;  2X51 A;  1FX7 A;  1WQ7 A;  2RJD A;  4GLK A;  2OTJ T;  4X9D A;  5LJ3 j;  3VUB A;  1D0X A;  3M0T A;  4M78 A;  2F2X A;  4JRQ A;  1YBY A;  2DBK A;  2E5K A;  2I2L A;  3PFS A;  1VQL T;  1BI3 A;  4J9F A;  4EMK B;  2OAW A;  3FC3 A;  2F69 A;  5KYY B;  1N6A A;  4HCZ A;  4Y28 E;  2BE7 D;  2DEU A;  4ELY C;  1T0H A;  1M30 A;  2LRQ A;  3RR6 A;  4M78 F;  1GRI A;  1Z9Z A;  3SEM A;  1QP2 A;  1NE8 A;  2OTJ A;  4M7D F;  2E5Q A;  2K57 A;  1UGS B;  1VQ8 T;  2XG8 D;  4O5V A;  4CC2 A;  5GAN j;  5LJ3 g;  2RPN A;  1QVG A;  2JT4 A;  2GTJ A;  2ESW A;  3C0C A;  2RNA A;  4MZP A;  3LGF A;  2XI9 A;  4J6W A;  2DIG A;  2HDA A;  5GJW B;  2CRE A;  4C8Q G;  2M02 A;  3LLR A;  3PVQ A;  1N8R R;  3M0P A;  2QA4 Q;  5KYW A;  3M5A A;  4FT2 A;  1K0S A;  2VAS A;  3OYK A;  1U1T A;  2QDY B;  4Y92 A;  4EMK C;  1PD1 A;  3M53 A;  2LTO A;  2C0O A;  2L3Q A;  1VA7 A;  4C92 F;  1X69 A;  2RK2 A;  1D1A A;  4XTZ A;  5LL6 S;  3L2U A;  4OB3 B;  1PWT A;  1VQP Q;  3RDV A;  2RO0 A;  4ZTF A;  1YJW Q;  1I0C A;  4M78 G;  4JJC A;  2EQJ A;  4PKC C;  2EWN A;  2QA4 A;  2BTT A;  3DLM A;  3CCQ T;  3MEW A;  4C5G A;  3X28 B;  3BDL A;  1E7O A;  4ESR A;  1M1F A;  1G2B A;  1LCK A;  4JS4 A;  2K2M A;  3PMT A;  2YLC A;  3BFM A;  2OTL Q;  2XD0 A;  1PRL C;  3P8B B;  1G3W A;  3OA6 A;  3LH0 A;  2EW3 A;  1YJW A;  1MMN A;  4D6W A;  5HY6 A;  1M3A A;  2K79 A;  2KRN A;  2BZX A;  1K8A R;  4LDV A;  1PSE A;  2QDL A;  5IN1 A;  1UE9 A;  1KSW A;  2QTV A;  5GAN 6;  4OB2 B;  4OMN A;  2FPF A;  1F1B B;  1YI2 Q;  1M90 C;  3X26 B;  2BUD A;  3O5Z A;  2OTL A;  4OGC A;  3CXC A;  4OGE A;  3SB2 A;  4M77 D;  1SKU B;  2FYK A;  2F2V A;  5I22 A;  2HEQ A;  3OQ5 A;  1VIE A;  1W1F A;  1GCP A;  1VOM A;  2DYI A;  3MP8 A;  5GAN d;  2HMA A;  1T0J A;  5GAN f;  1DJ7 B;  2LCL A;  4F7U E;  2ZCF B;  2P84 A;  4N4I A;  1KHI A;  1JEG A;  5CCA A;  3UAT A;  1YI2 A;  3OS5 A;  1QWF A;  2DE0 X;  2YRV A;  5D7U A;  4A54 A;  2ROL A;  4J9B A;  5I21 A;  3E19 A;  1Y0M A;  3C94 A;  4OF1 A;  3VS0 A;  3OYE A;  1QW1 A;  4B9X A;  3INZ A;  3RKY A;  2JMA A;  4XQ3 A;  1MND A;  4J9I A;  2FVU A;  1I4K 1;  1X2Q A;  1BB9 A;  1W2B S;  3EFR A;  4KGZ B;  2JTF A;  2LQK A;  1VQM Q;  3QKJ A;  4VUB A;  3OY9 A;  3P8H A;  2EJ9 A;  3VYH B;  3R6O A;  2X4J A;  4PFZ A;  2D8H A;  3OBW A;  4LE9 A;  3RER A;  3KFV A;  2KRO A;  4X9C A;  3LGL A;  1GBR A;  2RMO A;  3CCL Q;  1GCQ A;  1JRI A;  3D7S B;  4WF2 A;  4F7U B;  2RHZ A;  1HSQ A;  1KD1 R;  5A0D A;  3VYG A;  4FM4 B;  4XAX B;  2LDM A;  3N5B B;  3MPU B;  3NHN A;  4NL3 A;  1QVF P;  1PNJ A;  5EG2 A;  2OI3 A;  3JCM V;  1BYM A;  4LD6 A;  1YIJ T;  1S72 T;  3M4Y A;  1C6V X;  1IHW A;  2OAU A;  3CCL A;  3QSU A;  3QJ6 A;  4J5Y A;  1SF9 A;  4R55 A;  5FRO A;  4GY5 A;  3NTH A;  3EFO A;  2KSS A;  2ED1 A;  3OBY A;  4BI8 B;  1OX9 A;  1U5S A;  4KH1 B;  5LJ3 e;  3SWN A;  2KI7 A;  4E7J A;  4PFO A;  4KBM B;  2XMF A;  3L2V A;  2D1X A;  2LT1 A;  1S72 A;  3L2Q A;  4MZM A;  2RK1 A;  4M75 D;  2E12 A;  2QI2 A;  1UHC A;  1OZ3 A;  1K73 C;  4LNP A;  1X6G A;  2HKQ B;  3PIP A;  1FYN A;  4JRI A;  1M8M A;  1UGV A;  2GBQ A;  4C5H A;  1H3Z A;  3CCR Q;  3CCM T;  2BKD N;  3JCM d;  2KDS A;  4AT1 B;  5GAO m;  3JCM f;  3VRZ A;  3IQL A;  3G1J A;  3G4S Q;  2DNU A;  1ZHI A;  5A0G A;  2EYQ A;  4AFU C;  5GAN e;  1OPK A;  1WXU A;  1TXQ A;  4AFS C;  4ELZ C;  4XU3 A;  4RTV A;  3OYI A;  4HCK A;  2V8I A;  2JZ2 A;  3FIF A;  2QXF A;  4M7A C;  3OYB A;  3SD4 A;  3J80 E;  3VS2 A;  4RUG A;  4PJO E;  2DAQ A;  1M2V B;  2KVQ G;  1UJ0 A;  4RKU E;  4M7A D;  1YIT T;  3CCR A;  4FYW B;  2KAF A;  2KXD A;  3S3N A;  1HYO A;  1UB4 A;  4BD3 A;  4OB1 B;  2YUN A;  4FL6 A;  1D3B B;  3JB9 F;  3CME Q;  3G4S A;  2E3I A;  5A2Q E;  4BI3 A;  1CKB A;  3X25 B;  3G6E T;  1B07 A;  3CCS T;  1EX4 A;  1UGR B;  2CDT A;  1YHQ T;  3R6N A;  1VQ5 T;  3CCU Q;  2F5T X;  2ZPI B;  2WSC E;  1RUW A;  1UEC A;  4KUI A;  4XU0 A;  2KRM A;  3PTA A;  1W70 A;  3J81 E;  4GBQ A;  3JV3 A;  2AKL A;  1Q81 C;  2EGC A;  1VYT A;  2AK5 A;  1G83 A;  2LVM A;  2LNV A;  1WHM A;  4BY6 B;  1QVF S;  1U3O A;  2KEA A;  3CME A;  1V29 B;  1WXT A;  1YJ9 T;  3MO8 A;  1PSF A;  4RCC A;  4M75 A;  2KRS A;  4PJO B;  7AT1 B;  3T9N A;  3A98 A;  2HBW A;  1WDX A;  3CCU A;  5LJ5 h;  3G6E A;  3JCM c;  1VQ5 A;  5FLX E;  1YHQ A;  2QQS A;  2FL7 A;  2PVO B;  1BCM A;  3F70 A;  4HKE A;  1ACM B;  1N8R C;  1CSK A;  3JB9 G;  2LJ0 A;  3G71 T;  1EZZ B;  2ED0 A;  3M56 A;  1VQK T;  4F7U F;  4BUG A;  1IHV A;  2LC4 A;  3CPW S;  5GAO q;  3HRU A;  3GLX A;  5GAM h;  4AFQ C;  5CIU A;  1FWZ A;  1AT1 B;  1BKB A;  4RTW A;  1WHJ A;  3CC4 T;  2R5A A;  2M51 A;  4M7A A;  4J8O A;  2A28 A;  4BY6 C;  3ER0 A;  1VYV A;  2GCX A;  2JN0 A;  5C6S A;  4J7I A;  5CO7 A;  5DLO A;  3FLG A;  3ASK A;  4PJO C;  3EGX B;  4IUT A;  1K1Z A;  3I9Q A;  1KQS P;  2CP3 A;  3X24 B;  1QCO A;  3OS0 A;  4M7A F;  4RTT A;  3FB9 A;  1BI0 A;  4A4H A;  3JCM e;  1QKW A;  4WCI A;  2ENM A;  3OYD A;  1JU5 C;  8AT1 B;  5L23 A;  5GMK m;  1K8A C;  3SDZ A;  2JXB A;  2G6F X;  4M75 G;  3VKI A;  3VS4 A;  1PKT A;  2G3R A;  2JJ9 A;  2DVJ A;  2NUP A;  2MCN A;  4OB0 B;  1KG1 A;  2VKN A;  2FZC B;  2ATC B;  4OP0 A;  3VS3 A;  2CP2 A;  5D6X A;  3E9G A;  4ZGD B;  3GOX A;  5HK0 A;  2JS0 A;  4C5I A;  4M78 D;  4WTO B;  5IHN A;  1Q86 U;  4PLI A;  4RG8 A;  3TSW A;  1PD0 A;  1RAB B;  4M7D D;  1G3Y A;  5FWC A;  3I55 Q;  3GP8 A;  2D6F A;  3JCM J;  2EPD A;  2R5M A;  4HXJ A;  1YCY A;  4OMP A;  3M0Q A;  2IVW A;  2VUB A;  1X6B A;  2EQK A;  1BIA A;  4M7A G;  5HKC A;  1JXM A;  4Z88 A;  1G3T A;  3PT9 A;  3TSZ A;  2P0K A;  3BY7 A;  4N4H A;  5KYX B;  2KNB B;  4J9C A;  3GBQ A;  1QVG S;  1ZUU A;  2COZ A;  2DL7 A;  2KQW A;  2DTH A;  2QGG A;  1KC8 U;  3MKD A;  2O9S A;  3VS1 A;  3I55 A;  2FZG B;  4XU2 A;  1G8X A;  2HCK A;  2CGH A;  1BBZ A;  2Z0W A;  4BDZ A;  1Q95 G;  2YDL A;  2QAZ A;  4C92 D;  4MDW A;  2F5K A;  4XK8 E;  2ZPF B;  2E70 A;  1WQW A;  4M4Z A;  1JB0 E;  3E1S A;  3RMQ A;  3L2W A;  2YUO A;  4OMF B;  2R57 A;  2MWP A;  2ZPH B;  1KD1 C;  2GNC A;  3OYH A;  4DBF A;  2NUT A;  1BU1 A;  2HBP A;  2EVR A;  2K5F A;  2H3J A;  3FDR A;  3CCE T;  4PJO F;  4PJJ A;  4CRI A;  3ZL7 C;  3M0S A;  5AYF A;  4PJM A;  4EIK A;  2K2V A;  3LYI A;  4AG2 C;  3QG1 A;  1KQS S;  2NYS A;  4JRK A;  1TG0 A;  1B3Q A;  1MNE A;  2AT1 B;  3MET A;  1YCS B;  1Y96 A;  1OZ2 A;  1EFN A;  4M7D A;  4Z89 A;  1R8O B;  4X34 A;  2CH4 A;  3HRS A;  3QDF A;  2FRY A;  1Q7Y R;  2B86 A;  3CCE A;  2MIO A;  2FEI A;  4BB7 A;  4FT4 A;  2E4H A;  1Q81 R;  1RAC B;  3EG9 A;  2DMO A;  3CBP A;  3HPW A;  3OYC A;  3MEU A;  4RCB A;  4RG2 A;  3I35 A;  4BI4 A;  2KK4 A;  1K4U S;  3FEO A;  1QP3 A;  1UTI A;  4OVA A;  3JCM P;  4NL2 A;  4ZN3 A;  4LDX A;  1NYF A;  1OEB A;  2P4R A;  1SHF A;  1MV3 A;  1VUB A;  1G3S A;  2K3X A;  5FRM A;  1RAG B;  4XTW A;  1K9M U;  4D8K A;  4ME7 A;  4C92 A;  3E2U A;  1A0N B;  1M1K U;  3OYF A;  2QA4 T;  2QK0 A;  4Z02 A;  1W2B P;  2KBT A;  1LJO A;  2FG0 A;  2ZAE A;  5HCK A;  1X75 C;  4JLI A;  3QWY A;  1U8R A;  2GFA A;  4F17 A;  3OYG A;  3CD6 Q;  2QEX Q;  2H8H A;  1QKX A;  1VQP T;  5GMK l;  1I5O B;  1YJW T;  2MK5 A;  1FMW A;  1ABQ A;  3OS1 A;  3LWH A;  2JTE A;  2M0O A;  1AWW A;  3H6Z A;  1XNI A;  1Q82 U;  3AHU A;  4M7D G;  1KC8 R;  5AT1 B;  4XTX A;  4M77 B;  3GF5 A;  1JJ2 A;  3EH1 A;  4AG1 C; 
#chains in the Genus database with same CATH homology
 2A3L A;  1LOJ A;  2B8A A;  2OAU A;  4JUV A;  3CCS A;  2OTL T;  3CCL A;  2XDB A;  4C0G A;  3QSU A;  3QJ6 A;  1XOV A;  4NS5 A;  5GAN 5;  3CD6 A;  2DZC A;  2QEX A;  4J5Y A;  5LJ3 d;  4HCB A;  1TH7 A;  4DQ2 A;  3JB9 I;  4R55 A;  4E7L A;  5LJ3 f;  1MGQ A;  2DVE A;  5FRO A;  1YJN T;  3L2R A;  4GY5 A;  2ZZD A;  4PNO A;  4LDU A;  3NTH A;  4C0F A;  2KSS A;  2XHC A;  1NPP A;  2YLB A;  5KCH A;  3OBY A;  4ATO A;  3DB4 A;  4M75 F;  4BI8 B;  1VQP A;  3NFC A;  4E47 A;  5FU6 B;  2DZ9 A;  2VGM A;  5LJ3 e;  1M5Q 1;  2P0P A;  3L2Z A;  3QZ9 B;  1H64 1;  2HQE A;  3SWN A;  3KXT A;  4QQ6 A;  4V2S A;  1GXI E;  4E7J A;  1LNX A;  5GAO p;  1YJ9 A;  4C92 E;  3HRT A;  5C0M A;  4KBM B;  1YI2 T;  2RHU A;  2XID A;  2YHT A;  2WSE E;  3PNW C;  3L2V A;  2E6N A;  2LT1 A;  1S72 A;  3L2Q A;  1JJ2 S;  2DD5 A;  2CZ7 B;  2RHI A;  1K8A U;  5J26 A;  4MZM A;  4C92 G;  2RK1 A;  3V7R A;  4M75 D;  1Y96 B;  3I56 T;  2E12 A;  2QI2 A;  2ZPG B;  4II1 A;  2JUF A;  5GAN 3;  1OZ3 A;  2RI5 A;  4XTU A;  2EJF A;  1K73 C;  4M7D B;  2PUK B;  2RHX A;  3ZEH A;  3OSV A;  1SSF A;  3PIP A;  3E9F A;  3MCA B;  4JRI A;  2VGN A;  4ZGE B;  4CI0 C;  1YJN A;  3Q1J A;  2WSF E;  5CKE A;  4L5G A;  3HKS A;  3VUZ A;  4C5H A;  4C8Q F;  1NJI U;  1H3Z A;  2A7Y A;  3CCM T;  3A8H B;  2BKD N;  2O4X B;  3JCM d;  5IT9 E;  2KDS A;  5GAO m;  5GAN 7;  3QUI A;  2ZPB B;  3M59 A;  3JCM f;  4A4F A;  3G71 A;  1BI1 A;  2VC8 A;  2ZPE B;  3LWI A;  4E7H A;  1VQK A;  2MWO A;  1ZHI A;  2L89 A;  3L1A A;  5A0G A;  2EYQ A;  5GAN e;  3A8L B;  1Q7Y U;  3HFN A;  2EQM A;  4ELZ C;  5D6W A;  2X4W A;  1I8F A;  3OMG A;  4XU3 A;  5LJ5 e;  3OYI A;  4E7I A;  4L59 A;  3JRZ A;  3HP9 A;  2PUO B;  3BW1 A;  2V8I A;  2JZ2 A;  5DY9 A;  3FIF A;  2QXF A;  4C8Q D;  4EMK A;  3OYB A;  3SD4 A;  1Q81 U;  2HAX A;  4M7A C;  5CK9 A;  4PLL A;  3CC4 A;  3JCM W;  1Y07 A;  3J80 E;  4PL6 A;  3OSS C;  4PJO E;  5GMK e;  3CXC S;  2DAQ A;  2RI3 A;  2DXU A;  3EFS A;  2E65 A;  4M77 E;  4XTY A;  2KVQ G;  5D6Y A;  2V8K A;  2DJZ A;  3WVE B;  4C92 B;  3PIO A;  4RKU E;  4KUD K;  4PJO G;  2DKG A;  1YIT T;  3CCR A;  3RKW A;  4M7A D;  2KAF A;  3S3N A;  3X20 B;  1UB4 A;  1VQM T;  4BD3 A;  2XKO C;  2VXE A;  4OB1 B;  4FL6 A;  5CKH A;  1D3B B;  5LJ3 h;  3JB9 F;  3GNG A;  1VQN T;  3J7A F;  3G4S A;  4M78 C;  2E64 A;  5A2Q E;  4BI3 A;  1NJI C;  3TCJ A;  3MHX A;  3RES A;  1WJS A;  3X25 B;  3ME9 A;  4L6V 5;  3V7S A;  3G6E T;  3UPU A;  5CQY A;  2MAM A;  3CCS T;  4M7D C;  3CCL T;  1UGR B;  1P92 A;  2DO3 A;  1YHQ T;  1VQ5 T;  3CD6 T;  1VQL A;  3OW2 A;  2JOY A;  2JNG A;  1OYX A;  1X01 A;  2F5T X;  3VJP A;  2ZPI B;  1M9S A;  2QEX T;  2EIF A;  3M9Q A;  2WSC E;  4Q5W A;  5KE2 A;  5FRN A;  4N4G A;  4A4G A;  1WPY A;  2PVG B;  1OI1 A;  2XU8 A;  2LX9 A;  4KUI A;  4XU0 A;  3QJY A;  3JB9 D;  2CS7 A;  5DLQ E;  3PTA A;  3J81 E;  2CKK A;  1BIB A;  1Q81 C;  2LVM A;  1QVP A;  4QVD A;  5GAO l;  2LNV A;  4O6J A;  4J6Y A;  1M4Z A;  4BY6 B;  1X6O A;  5KH6 A;  2HNI A;  2X4X A;  2EAY A;  2KY9 A;  1QVF S;  3CME A;  2RB6 A;  4EDU A;  2E10 A;  3RKX A;  1V29 B;  1YJ9 T;  2XDD A;  4BE0 A;  1VQM A;  3MO8 A;  1K9M C;  1KD1 U;  1PSF A;  3CPW A;  2DK3 A;  4RCC A;  1VQN A;  4M75 A;  3M4G A;  1M1K C;  4PJO B;  4JJN K;  1VQ8 A;  4IKF A;  2CZ1 B;  3URG A;  2RD1 A;  3T9N A;  5GAN h;  4LD9 K;  2RJC A;  4DA4 A;  3CCU A;  3SFM A;  5LJ5 h;  3G6E A;  3C95 A;  5KE3 A;  3JCM b;  3OW2 S;  4JLG A;  4MZT A;  1Y7X A;  2DEQ A;  5IAY A;  4C92 C;  3JCM c;  1VQ5 A;  5FLX E;  4EPC A;  1YHQ A;  2GQV A;  2QQS A;  2FL7 A;  2PVO B;  2QTX A;  5GMK h;  4BDY A;  3F70 A;  4HKE A;  5GAN g;  3TU4 K;  1N8R C;  2M16 A;  3CPF A;  5LJ5 g;  2PU9 B;  3CCJ A;  3M54 A;  1N9R A;  3TEE A;  3JB9 G;  1M90 U;  3SWN B;  3GIB A;  3G71 T;  4FSX A;  3CBM A;  1KQS A;  1I81 A;  2XIC A;  3FRN A;  2QQB A;  2RM4 A;  2L5Q A;  2X4Y A;  2LC4 A;  3DKM A;  3M56 A;  4BUG A;  4F7U F;  5GAO q;  3CPW S;  3BDU A;  2MMP A;  1UGP B;  3HRU A;  2DIQ A;  2X35 A;  3GLX A;  2HD0 A;  4C8Q A;  5GAM h;  2DTI A;  5CIU A;  1FWZ A;  2E1H A;  2C06 A;  3S6W A;  1BKB A;  4HT8 A;  1Q82 C;  4A53 A;  3CC4 T;  4JRP A;  1B34 B;  1NPR A;  2R5A A;  1O9S A;  3NTK A;  4MML A;  5I2S A;  4M7A A;  3HSB A;  4IUU A;  5GAM g;  1B34 A;  4J8O A;  1AHJ B;  3JSC A;  4P5N A;  4IUV A;  3V8L A;  4BY6 C;  4BE1 A;  3H8Z A;  3ER0 A;  5GAN 8;  1UEB A;  3DB3 A;  3MEV A;  2GCX A;  2JN0 A;  3CCR T;  5C6S A;  3VV0 A;  4J7I A;  4ZGJ B;  5GAO r;  5CO7 A;  5I2M A;  1FX7 A;  5DLO A;  3CCV A;  1WQ7 A;  2RJD A;  3FLG A;  4GLK A;  3CC2 A;  3ASK A;  4X9D A;  5LJ3 j;  3CCQ A;  3VUB A;  2HQX A;  3G4S T;  3QII A;  4PJO C;  2LT4 A;  4IUT A;  1N27 A;  2GF7 A;  4M77 C;  2QQR A;  4QVC A;  4QW2 A;  1VQK T;  1UGQ B;  2RJF A;  4UC4 A;  4M78 A;  4JRQ A;  3X24 B;  1YBY A;  3PFS A;  2I2L A;  3UT1 A;  3OS0 A;  4M7A F;  3FB9 A;  1BI3 A;  1RL2 A;  1VQL T;  1BI0 A;  4A4H A;  4EMK B;  3JCM e;  3ZFJ A;  3OYM A;  2M1H A;  4HT9 A;  1XTD A;  2K5I A;  3OYY A;  4M75 E;  5CVI A;  3OYD A;  3A8O B;  1WJQ A;  2M9U A;  1NZ9 A;  2F69 A;  5GMK m;  3FC3 A;  4ZTJ A;  5J3B A;  2E6Z A;  2QQA A;  2CZ0 B;  2EQU A;  3SDZ A;  3SWN C;  1K8A C;  4M75 G;  4QVZ A;  1N6A A;  5FU6 C;  3CC7 T;  4HCZ A;  4Y28 E;  3VKI A;  3JAM E;  4ELY C;  1RI0 A;  2G3R A;  4C0Z A;  2LRQ A;  4M78 F;  3CME T;  2RI2 A;  4A4E A;  2K5L A;  1QP2 A;  1NE8 A;  2OTJ A;  4M7D F;  2E5Q A;  2K57 A;  1UGS B;  3A5Z B;  3V8K A;  5L8R E;  1VQ8 T;  2XG8 D;  4OB0 B;  1KG1 A;  4O5V A;  4YTL A;  5J39 A;  3CCU T;  4OP0 A;  1VQ7 T;  5GAN 2;  3S3M A;  2K3Y A;  5GAN j;  1VQ9 A;  4N0A C;  5D6X A;  3E9G A;  3V7C A;  5LJ5 j;  3G7Z A;  4DOV A;  4ZGD B;  3GPL A;  2EFI A;  5LJ3 g;  3GOX A;  5HK0 A;  2L8D A;  4C5I A;  1QVG A;  4M78 D;  3OYL A;  4EMG A;  4C8Q E;  2QQ9 A;  3LGF A;  2FHD A;  4MZP A;  4E7K A;  1Q86 U;  2XI9 A;  4PLI A;  2LCC A;  5GMK j;  1Q7Y C;  3MP1 A;  3QYH B;  4RG8 A;  4J6W A;  2DIG A;  3CCJ T;  4M7D D;  1G3Y A;  4IUP A;  3M55 A;  4FU6 A;  4C8Q G;  3GP8 A;  3LLR A;  3QZ5 B;  2D6F A;  3JCM J;  1VQ6 A;  3QBY A;  2PVD B;  3LW5 E;  4IUR A;  1HXD A;  3CC7 A;  4M7A E;  4MDX A;  2R5M A;  3M5A A;  4FT2 A;  1YCY A;  4MMK A;  3JB9 H;  2DXC A;  1WJR A;  5KCO A;  2IVW A;  2VUB A;  2D0Q B;  4J7F A;  3OYK A;  4J83 A;  3S3O A;  1U1T A;  2EQK A;  1KHC A;  2DTO A;  2K4Y A;  1BIA A;  2QDY B;  2R58 A;  3HHT B;  4M75 B;  3WVD B;  3C12 A;  4EMK C;  5HKC A;  3UDC A;  4M7A G;  5GAM j;  3M53 A;  1FXX A;  2LTO A;  2Y4Y A;  1G3T A;  2P4T A;  1MHN A;  2VXF A;  4C92 F;  3DLL A;  5CKB A;  3PT9 A;  2RK2 A;  5GAN 4;  1WGS A;  5CKF A;  2P0K A;  3BY7 A;  4N4H A;  1VQ7 A;  3JCM h;  3TRE A;  2V8J A;  4F7U A;  1QVG S;  1G5V A;  2KQW A;  2RJE A;  4XTZ A;  5LL6 S;  3RMS A;  3L2U A;  2MF2 A;  2DTH A;  4OB3 B;  4B9W A;  1KC8 U;  1Y71 A;  2RO0 A;  4ZTF A;  3I55 A;  4M78 G;  2EQJ A;  4PKC C;  4XU2 A;  3JCM g;  2EWN A;  3CCV T;  2CGH A;  2QA4 A;  4BDZ A;  3A8G B;  3DLM A;  3CC2 T;  3CCQ T;  2O01 E;  4C92 D;  3MEW A;  4MDW A;  4JS5 A;  4C5G A;  2F5K A;  1VQO A;  3X28 B;  3BDL A;  4XK8 E;  3A8M B;  2ZPF B;  3CBO A;  1JBM A;  2E70 A;  4KUL A;  1WQW A;  4BE2 A;  3CMA T;  1JB0 E;  1M1F A;  4C8Q B;  4LDY A;  1VQ4 A;  4M77 A;  4JS4 A;  2NLU A;  3E1S A;  3RMQ A;  1ZQ1 A;  3L2W A;  2PQW A;  1I5L A;  4HCC A;  1IRE B;  2KMT A;  4OMF B;  2E41 A;  3PMT A;  2R57 A;  2YLC A;  3UWN A;  3JCM Q;  3BFM A;  2MWP A;  2ZPH B;  2DXB A;  1KD1 C;  3RUX A;  2XD0 A;  3P8B B;  4M7A B;  3OYH A;  3L42 A;  3JCM X;  1G3W A;  1O75 A;  3OA6 A;  2HBP A;  5GAO n;  3LH0 A;  2K5F A;  2H3J A;  3FDR A;  4NOY A;  1YJW A;  4D6W A;  1VIF A;  5HY6 A;  3CEY A;  3CCE T;  4PJO F;  5GMK i;  3MP6 A;  2CZ6 B;  2CYZ B;  4LDV A;  2BIV A;  4M75 C;  4M77 F;  1PSE A;  1KC8 C;  4CRI A;  1XQH A;  5IN1 A;  2DXT A;  5AYF A;  2GFU A;  2K2V A;  3LYI A;  3QG1 A;  3QPH A;  1YIJ A;  5GAN 6;  2VV5 A;  4OB2 B;  1ZBX A;  4M78 B;  2LQ8 A;  1KQS S;  4KT0 E;  3HFO A;  1VQ9 T;  4JRK A;  3CMA A;  3OMC A;  1M90 C;  3X26 B;  3RIR A;  2BUD A;  3MET A;  2OTL A;  4HA8 A;  1Y96 A;  4Y91 A;  4PJO D;  2VYT A;  1OZ2 A;  2AHJ B;  4OGC A;  3QO3 A;  4OGE A;  3SB2 A;  4N0A A;  3CXC A;  3NTI A;  4M7D A;  2ZGW A;  1N9S A;  4M77 D;  2FYK A;  1HK9 A;  4LDW A;  1R8O B;  1VIE A;  3OQ5 A;  4X34 A;  4TVR A;  3MP8 A;  5GAN d;  3HRS A;  3PGG A;  5M9O A;  1WNL A;  2WAC A;  5LJ5 d;  5GAN f;  1DJ7 B;  1VQ6 T;  2LCL A;  1W2B A;  4F7U E;  3CCE A;  1BI2 A;  5LJ5 f;  3P8D A;  2ZCF B;  2O4X A;  4QQD A;  4C8Q C;  3OYJ A;  3PMI A;  3QHS A;  4QQG A;  4BB7 A;  4FT4 A;  3FJP A;  4N4I A;  4C0D B;  1KHI A;  3CBP A;  3HPW A;  4F7U G;  1M8V A;  5CCA A;  3EAE A;  3OYC A;  3MEU A;  5CKD A;  3O8V A;  1YI2 A;  4RCB A;  3M57 A;  4RG2 A;  3OS5 A;  4BI4 A;  2KK4 A;  2YRV A;  3FEO A;  2IG0 A;  4A54 A;  2FB7 A;  1M1G A;  5I21 A;  3OYA A;  4ZN1 A;  1QP3 A;  3E19 A;  4OVA A;  2DPP B;  3I56 A;  3JCM P;  1KQ1 A;  3C94 A;  4NL2 A;  4OF1 A;  4ZN3 A;  4LDX A;  4EMH A;  1QW1 A;  3ZBD A;  3OYE A;  5FU7 B;  4B9X A;  4C5E A;  4RMO A;  2Y4X A;  1VUB A;  1G3S A;  2JTM A;  2K3X A;  3INZ A;  5FRM A;  2RHY A;  3MEA A;  3RKY A;  5GAM d;  4XTW A;  1K9M U;  3I55 T;  4ME7 A;  4C92 A;  5GAM f;  4XQ3 A;  1M1K U;  3WXM B;  4M77 G;  4JDS A;  4XTV A;  2FVU A;  3OYF A;  4DOW A;  1I4K 1;  2QA4 T;  1QVF A;  1W4S A;  1W2B S;  3EFR A;  2JTF A;  4Z02 A;  3CCM A;  1VQO T;  2Y90 A;  1KQ2 A;  1D3B A;  2LQK A;  3QKJ A;  1LJO A;  5GAM e;  4VUB A;  2RH2 A;  3OY9 A;  3P8H A;  2EJ9 A;  2XDP A;  3QYG B;  1VQ4 T;  3VYH B;  2EKO A;  3R6O A;  2X4J A;  5HK3 A;  5CR2 A;  1X75 C;  3QXE B;  3OBW A;  4JLI A;  3KUF A;  3M58 A;  2RA2 A;  4BAC A;  2D9T A;  4XU1 A;  4X9C A;  1U8R A;  1N8R U;  1EIF A;  2GFA A;  3LGL A;  1U1S A;  3RER A;  4FIB A;  1JRI A;  4WF2 A;  3OYG A;  2DD4 A;  2P0Q A;  4F7U B;  5DM7 R;  2JVV A;  3C4S A;  2RHZ A;  3V8J A;  3OYN A;  3GNF B;  3OS2 A;  5CAI A;  5GMK l;  1VQP T;  5A0L A;  4M78 E;  1YJW T;  2L3R A;  5A0D A;  3OS1 A;  3LWH A;  3KBG A;  3VYG A;  4FM4 B;  4XAX B;  2LDM A;  2M0O A;  3JB9 J;  3N5B B;  3HL8 A;  3QDR B;  4C0D C;  4R56 A;  4NL3 A;  1YIT A;  4J6X A;  4M7D E;  3VU3 C;  4A4K A;  3H6Z A;  5EG2 A;  3LX7 A;  5CQX A;  1Q86 C;  1XNI A;  3JCM V;  1Q82 U;  1BYM A;  2MI6 A;  4LD6 A;  3AHU A;  1YIJ T;  1S72 T;  4M7D G;  3OB9 A;  1IZ6 A;  2XK0 A;  2EJG A;  4XTX A;  4M77 B;  3GF5 A;  1K73 U;  3M4Y A;  1JJ2 A;  4PJO A;  4IUQ A;  5FU7 C;  2OTJ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...