1H641

Crystal structure of the sm-related protein of p. abyssi: the biological unit is a heptamer
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDNVLAISPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Pyrococcus Abyssi Sm Core and its Complex with RNA.Common Features of RNA Binding in Archaea and Eukarya
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Sm-like protein
molecule keywords SNRNP SM-LIKE PROTEIN
total genus 13
structure length 71
sequence length 71
chains with identical sequence 2, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2001-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1h64100
4EMGA 1LJOA 3BY7A 5GAOl 3BFMA 3GIBA 1Y96B 4M78B 4M7AF 4XU0A 4HT8A 1LNXA 4M7AG 5LJ3j 4M78F 2K57A 4F7UE 1B34B 4C92C 2VXFA 4M78C 4F7UG 3JCMg 5GAMd 3V8KA 5GAOq 1WNLA 5GANf 3JB9H 2DZ9A 4M78D 4MMLA 3JCMV 2DTIA 4M7DB 3JCMJ 3JB9G 4C8QC 3M4GA 4C8QA 3JCMd 3JCMQ 1MGQA 3INZA 1I4K1 4A54A 4XTZA 3L2ZA 2DZCA 2EJGA 2JN0A 3EFRA 4XU3A 4EMKB 5CAIA 4C8QG 4NOYA 3RUXA 4PNOA 4J6XA 4C92D 4C92G 4F7UA 3FIFA 4QVDA 5GMKi 5LJ3e 5GAN3 1M8VA 1WQWA 2YLCA 1X01A 2EJFA 3JCMc 5LJ5f 4C92A 5LJ5e 4M7DE 1H641 4PJOF 1I81A 4M77F 4EMKC 4M7AE 4N0AA 2FB7A 4M7DC 1LOJA 4XTVA 5LJ3d 4M75E 4N0AC 1HXDA 5GAOp 1U1TA 4X9CA 4PJOE 3JCMb 2VC8A 5GAOn 4RCBA 1BIAA 2E64A 3PGGA 4M77D 4PJOG 2DTOA 1KQ1A 2YLBA 1YCYA 2E1HA 1I8FA 4XTUA 4EMHA 5LJ5j 4XTYA 5GAN8 4M7DG 3JCMX 4WF2A 1WQ7A 1N9RA 2CGHA 2DXUA 3L1AA 3V7RA 4Y91A 3V8LA 4F7UB 3JB9I 4HT9A 3SWNB 5GANh 5GMKl 2DXTA 5GAMh 5LJ3h 3JCMf 4XU1A 4M75A 4HA8A 4QVCA 2E41A 2DKGA 3QSUA 4JRKA 4XTXA 5LJ5g 4MMKA 2EWNA 3SWNC 3VU3C 4JRIA 4A53A 4M7DA 3V7CA 3BDUA 4NL2A 3JCMe 3HFOA 3HFNA 4M7AB 4J6WA 4C8QF 1JRIA 1B34A 3JB9J 2RM4A 5GAN7 4J5YA 3RKYA 5GANd 4M7AD 1N9SA 3JB9D 3RIRA 5LJ5d 3JCMW 2EJ9A 3SB2A 4M78G 4M7AC 2DTHA 4M7AA 4M75C 4M78E 4XQ3A 5GANg 5GAOr 1KQ2A 5GANe 3JB9F 4NL3A 4C92F 3BW1A 2FYKA 2RA2A 1Y96A 4M78A 5GAMg 4PJOA 4C8QE 5GMKj 4M77C 2I2LA 3SWNA 4DQ2A 4M75B 1JBMA 3FB9A 4JUVA 1M5Q1 2Y90A 4JLIA 2YHTA 1BIBA 3RKWA 4XU2A 3V7SA 4C92E 5GAN6 2DJZA 4V2SA 2HNIA 1TH7A 5LJ3f 3JCMh 5GAMf 5GAMe 1D3BB 4M77B 5I21A 4M75G 5GMKe 1HK9A 4M75D 5GMKm 5LJ3g 5GAN5 1I5LA 1WPYA 2ZGWA 3RKXA 3EFSA 4J6YA 2DVEA 3JCMP 5GANj 4M7DD 4F7UF 2QTXA 5GAOm 4M77G 2DEQA 4M75F 2E65A 5GAMj 4PJOD 2VXEA 3QHSA 3HSBA 4M77E 5GAN2 5GAN4 4PJOC 4X9DA 2E10A 3RERA 4M7DF 1D3BA 4M77A 4C92B 5GMKh 3FJPA 4OP0A 1U1SA 4EMKA 2EAYA 4RCCA 3RESA 3QO3A 2RB6A 5DY9A 5LJ5h 4PJOB 3AHUA 3QUIA 4C8QB 4XTWA 2RD1A 3V8JA 4C8QD
chains in the Genus database with same CATH superfamily
3S3MA 3I56A 4C5GA 1PHTA 1D1AA 2GCXA 4QQ6A 1LCKA 3M57A 4EDUA 4F17A 4A4HA 2CP5A 1M30A 1KC8U 2DZ9A 2BE9B 2RHXA 4PK4A 5D6WA 4C5EA 1M9SA 2BE7D 5J26A 1YBYA 4DOVA 3OS1A 4KUDK 2F1LA 4CC7A 2ATCB 3EHRA 5CAIA 3VS3A 2CREA 4RTWA 2OX7A 1RLPC 3FIFA 3SD4A 1OQKA 3HL8A 5LJ5f 2DM1A 4C92A 5LJ5e 4EMKC 2DMOA 1NYFA 3TEEA 1GRIA 1KSWA 4EMHA 1NPPA 1YNZA 4ELYC 3MP1A 5J3BA 1N9RA 1WHJA 2W10A 4Z89A 4HT9A 4BI8B 1S72A 2D1XA 4HA8A 3QSUA 3NGPA 5FU7B 2EWNA 2FRWA 4HCBA 1KQSP 2AKLA 2HQXA 1ZQ1A 2J6KA 3QDFA 1N6AA 4M7AD 5HK0A 2EJ9A 2NLUA 4Z88A 2JT4A 4FYVB 3L2UA 1Y96A 2L3PA 3EFOB 5IHKA 4FCYA 1PWTA 3PMIA 4L59A 2I2LA 5HK3A 1VQKT 4M75B 1M5Q1 3BE3A 2CS7A 5FU6B 4AFQC 3TVTA 4M77B 3OSSC 4N4IA 1NJIR 1OX8A 4K11A 4Z8AA 2D0NA 4M75F 2E65A 2KMTA 4IUQA 1BYMA 2JXBA 2XU8A 2LCLA 4BE0A 4JJDA 1SRLA 4RG2A 2RPNA 2KYMA 1UGSB 1VQLT 2DJQA 4KH1B 1FMKA 3G1JA 1YHQA 1SKUB 1G8XA 2IG0A 2QA4Q 2M0YA 5LJ3j 2VXFA 2AK5A 1MMDA 3EGXB 1PD0A 3V8KA 5GAOq 4GLKA 3EG2A 1QKWA 4E47A 2DILA 3M5AA 4FSSA 3NHNA 2DVJA 2YT6A 3IQLA 1JJ2A 2DPPB 1AT1B 2XDDA 1YI2A 4LDXA 1K76A 5DLOA 4MZTA 1VQ5Q 1XTDA 4PJOF 2FB7A 2QA4A 1VQNT 4PFPA 2L3QA 4JZ3A 3OB9A 4EIKA 4KH0B 1IGQA 1BI0A 1PM3A 2E1HA 3OS2A 1MV0B 2O9VA 3DLMA 1B07A 3V7RA 2E5KA 4M4ZA 3LLRA 2DE0X 4WTOB 3CCET 1RL2A 4XAXB 2OTJT 3HFOA 3HFNA 4C8QF 2BZ8A 4FW2A 3CMEA 1YN8A 2E5QA 2ZAEA 4FT2A 3S6WA 2DL5A 3ULRB 4C5HA 1PCXA 4M78E 2EGEA 2GQIA 4RMOA 5CCAA 2KEAA 4J9IA 2O9SA 4OB2B 4C8QE 3SWNA 3VRZA 3FB9A 2D0QB 2F69A 3CCVT 4XU2A 1UE9A 1YCSB 2HNIA 1VQLQ 2GTJA 2VV5A 4KGXB 1X2QA 4ME7A 4F7UF 3CPWA 1SSFA 4MZPA 3FLGA 2EYWA 2ZPGB 2RK1A 1Z9ZA 2X3WD 5I2MA 4DEYA 1YI2T 1Q81C 1OU9A 3QUIA 3ZBDA 4EMGA 2RQVA 3BDLA 5GAOl 1LJOA 3GIBA 3QXEB 1KD1U 2FEIA 4OB1B 4OMNA 3VYHB 3OS5A 2XDBA 2P0QA 3PIPA 1YIJT 1VQNQ 4KGZB 1RLQC 4F16A 5I2SA 1KC8C 4QKUA 1PSFA 1JO8A 1YP5A 1VQPQ 2XKOC 2DLPA 5I22A 3INZA 3SDZA 2LX9A 4XU3A 2CP7A 2SRCA 4C8QG 5GAN3 2M0OA 1MMGA 3I55T 4JZ4A 4B9WA 1UJ0A 3M4YA 3CC7A 5GAOp 1U1TA 4BE2A 3TREA 2VC8A 3PVLA 4DBFA 3H41A 1WXTA 3UATA 3HHTB 3A8LB 5GMKl 3OYDA 1SRMA 3FEOA 2LC4A 3MKDA 3OYKA 4AMCA 2E41A 3M0RA 1XOVA 2P0PA 1C0MA 2AZSA 2XIDA 1TG0A 1VQ5A 3PTAA 3LX7A 4J9CA 4J5YA 3GF5A 2KK4A 2JTMA 1WHKA 5CKDA 1SF9A 2PU9B 3M0UA 2PZ1A 5KCHA 1TH7A 1UJYA 2W0ZA 3ME9A 1MNEA 2VUBA 1KHCA 3CMEQ 5GANj 2QTXA 2DEQA 4PJOC 2E10A 4M77A 1WXUA 4E7HA 4LDWA 2LDMA 2LJ1A 1HSQA 3QO3A 3CD6A 1ZSGA 3EG3A 1YI2Q 2CUDA 2L3RA 2B8AA 5FW9A 5CKBA 3G6EQ 3TSWA 1RAIB 6AT1B 4RTTA 1M1GA 1WNLA 2HEQA 3JB9G 1K73R 1OYXA 2EFIA 1TU0B 3M58A 1UGVA 1YJWA 4C92G 4QVDA 1CKBA 4J6XA 1Y7XA 3CCSA 3G4SA 2YLCA 2KT8A 1X01A 3A1PA 3JCMc 4B6MA 1K9AA 2R57A 5EG2A 2V8KA 2RNAA 3AT1B 3VRYA 2CYZB 2LT4A 4O6JA 2E3HA 2XICA 4R55A 1Q81U 2DO3A 2RO0A 3E2UA 2EW3A 1IB8A 2A3LA 2OTLA 4CC4B 3OBWA 1WQ7A 1WFWA 3SWNB 1BI3A 2V1QA 3MPUB 4HCKA 4DBHA 1RI0A 1M1KU 1OI1A 3VS6A 1E6GA 1KJWA 4PJMA 4M7AB 1U8RA 1FX7A 4BDZA 1AWXA 2LJ0A 2FL7A 4FM4B 2KT1A 1M90U 2KNBB 2H3JA 8AT1B 3G4ST 1YITA 1PSEA 3BW1A 1QVFP 2QEXA 1X27A 2JW4A 3UT1A 1W6XA 3I5SA 4OVAA 2NWMA 1QP3A 5HCKA 3RDVA 1VA7A 2XD0A 1IREB 1WPYA 3C4SA 1W2BP 4DEXA 1UEBA 5C6SA 5DLQE 1YJ9A 4D8DA 2BIVA 4OMPA 3CCEA 1K73C 4M7DF 1YITQ 4HCZA 1MHNA 2Y4XA 1X75C 1VQKA 4IUTA 4M78B 2RH2A 2FG0A 3EGDA 1KFZA 4HT8A 2NUPB 1OEBA 4N4HA 4M78F 2EKOA 2HMAA 3VS0A 4GY5A 2DTIA 2R5MA 5GJVB 4A4EA 2CSQA 1FMVA 2LNHB 1K9MC 3OMCA 3CCJT 1VQ4A 4CRIA 1WQWA 1CKAA 2EJFA 4C5IA 4QQDA 3QYHB 3G6EA 3KXTA 3S3NA 1NJIC 1YIJA 1VYTA 2JMAA 2YWWA 3QG1A 3PNWC 4II1A 3OW2P 2EVRA 3JCMb 3CPWS 4PJOG 1KQ1A 4XTUA 1KQSA 2CZ0B 1PG5B 2A36A 3VUBA 2CSIA 2XDPA 3PMTA 3CCQQ 2CZ6B 4P5NA 2O2OA 2RJDA 5J39A 3L2RA 4JRKA 3HKSA 1M2VB 3X28B 2PNIA 2HSPA 3GNGA 3JB9J 2LZ6B 2VB6A 5CKFA 4LNPA 3CC7T 1ZSZC 4M78G 2RMOA 4J7IA 1KHIA 3CCQA 1VQ7A 2EQIA 4E7SA 1RABB 2V8JA 3RKWA 2RF0A 1JU5C 5LJ3f 3FDRA 5GMKe 5GMKm 2QQBA 2ZGWA 4J6YA 4AFUC 2DL7A 3GOXA 3QDRB 5CR2A 1T0HA 1VQ9Q 1M1KC 3HSBA 3GPLA 3PT9A 2YDLA 2RHUA 4OP0A 2EAYA 4EPCA 2WACA 1PRMC 1ARKA 1JEGA 3G4SQ 2LP5A 5KYYB 3CCUA 2OAUA 4XU0A 3CEYA 3MCAB 2Y4YA 3UA6A 3OYNA 1WXBA 1SHGA 2K2VA 4M7DB 2HQHA 3CCVA 1WYXA 5A2QE 5KYXB 5A0DA 2KSSA 1TUGB 2DBMA 1OU8A 1SPKA 4C92D 2OAWA 2RN8A 2IVWA 3VS5A 2M9UA 1LPLA 1I81A 1PKTA 2PTKA 3SEMA 4BY6C 3OW2S 1BI2A 2H8HA 1QQJA 3E1SA 4LUEA 4LD9K 1YCYA 2LTOA 4KUIA 2EPDA 1WJRA 2GBQA 2DERA 1UB4A 2E70A 2RHZA 4BD3A 3GNFB 1M3BA 2L2PA 2PVDB 4FIBA 4E7JA 3QBYA 2WSCE 2K3BA 1IXDA 2P4TA 5KYWB 2C0IA 2DIQA 3ZL7C 3QJYA 2HBWA 2DD5A 4J6WA 2DXBA 4LDUA 1VIEA 2MIOA 3THKA 4L6V5 3UDCA 4E6RA 2XI9A 2DTHA 1NZ9A 2HCKA 2COWA 4BACA 3M54A 1XQHA 2KRMA 1Q7YU 2RI5A 1NM7A 2KRSA 2M1HA 4JS5A 2MK5A 1TTHB 2HZYA 1H3ZA 1BIBA 4C0DC 3JAME 5CKEA 1ZSZB 4M75G 5LJ3g 2QQ9A 2EYQA 4A4KA 4BB7A 2DVEA 3JCMP 3REBB 3C12A 1KQSS 1V1CA 2BZYA 4EMKA 4JS4A 1TSFA 1GBQA 2X4XA 4Y92A 2K79A 3JCMd 4M7AF 2HL3A 5IT9E 4JDSA 2QAZA 1T0JA 1TS9A 3LH5A 3JCMV 2KE9A 4YTLA 3UF4A 2MF2A 4OB3B 3EGDB 2E3IA 4OGEA 2X35A 4IUPA 3LWHA 2ROTA 1UDLA 1VIFA 2LJ3A 4KULA 1T3SA 3LWIA 5CIUA 1G2BA 1QCOA 2ZPBB 1IZ6A 2D8HA 2O01E 2NUTB 2R5AA 4AG2C 1BCMA 2DD4A 2J6OA 4M7DC 4ZGJB 1U3OA 1Q86C 1N8RR 2P0KA 2CDTA 1WJSA 4OMOA 1D1BA 1SEMA 2E12A 4QT7A 1VQOT 1KK7A 2OTJA 5LJ3h 1VQ7Q 4M75A 3CCQT 1YITT 3GBQA 4XTXA 3VU3C 3M56A 2DYIA 2MWOA 1P92A 2A08A 1PC0A 3H0IA 1JRIA 4E7KA 1UHFA 5FU7C 2RM4A 3M0SA 1VQ6T 3LGFA 1GL5A 2JM8A 2ABLA 2FYKA 1RAFB 4OGCA 2KY9A 1OX9A 4ZTFA 1KC8R 2H3EB 1PRLC 3CBMA 2FZKB 1QWFA 2DJZA 4XK8E 4J9FA 5M9OA 5I21A 1Y07A 2JM9A 1OV3A 3CBPA 1X43A 2ENMA 2DBKA 2HKQB 3O5ZA 2A28A 1V76A 3DB3A 1UTIA 2HBPA 2F2XA 2DETA 4M77E 4C92B 2ZPHB 1UGQB 1FYNA 5A0GA 3G7ZA 2ZPEB 1WI7A 1M27C 4C8QD 2E6NA 1Y96B 1MMNA 3OSVA 2FPDA 2L0AA 3QZ9B 1JXOA 3KUFA 1N5ZA 1M8MA 2K5LA 5IXBA 2A0FB 3TQ7P 1IRXA 4JLGA 3CCEQ 1JB0E 3GP8A 3I56T 3CXCS 1ZHIA 4A54A 1I07A 5IAYA 1VQOQ 1BKBA 3QYGB 3QWYA 2C06A 1UUEA 4RUGA 2PUOB 2AHJB 4AFSC 3CCRQ 1OOTA 1VQMA 4PJOE 1G5VA 1T3LA 3N5BB 1I8FA 1WHLA 2L89A 2MAMA 3D7SB 1EIFA 2J06A 3REAB 4LE9A 4X34A 1QVGP 1QP2A 5CQYA 1VQ6A 5FLXE 2KXDA 3OQ5A 2FPFA 2I0NA 5GANe 2RQRA 2QTVA 1K9MR 5IH2A 3CCUT 2WSEE 1VUBA 3OW2A 4AT1B 4PLIA 2GF7A 3JB9H 3RR6A 2LCCA 4M75D 4PLLA 2YXYA 4OMLA 4C0GA 1NEGA 5I11A 5D6XA 1BK2A 3VS7A 1UGRB 4M77G 4ESRA 4MDWA 2VXEA 4BI3A 3OYFA 4NS5A 5GAN4 2PUKB 3LW5E 1MNDA 3CCST 3RMQA 5LJ5h 5DY9A 1YJWQ 1WIEA 4PL6A 4IKFA 1KD1C 2DIGA 3R6NA 3TSZA 2XK0A 2LCSA 5CK9A 3H0FA 1Q82U 1HYOA 2JOYA 4C92C 3H0HA 3JCMg 2FHDA 2F5KA 4MMLA 4GLMA 4J9BA 3META 3JCMJ 1RUWA 5AYFA 4ZGEB 1H8KA 2OTJQ 1G3YA 4XTZA 1R0BG 3CC4Q 4F7UA 4PNOA 1BCOA 2ED1A 2OI3A 4JJCA 4L5GA 3E19A 3MEUA 2R58A 1H641 1G3TA 1LOJA 3P8HA 2QK0A 4OMFB 2LVMA 2CT3A 4M77D 2IPOB 4RTYA 3QZ5B 1PNJA 1X2KA 5CO7A 2QG9B 3CCVQ 3V8LA 2DXUA 4DBQA 3EGUA 2EQUA 3MEWA 4Y91A 3G71T 4HKEA 5KCOA 4N4GA 3T9NA 2KDSA 3G6ET 4E7IA 1ZA1B 2HSEB 4MMKA 4A53A 4AG1C 4FW1A 2JTEA 5GANd 2VWFA 1N9SA 1JXMA 3SB2A 1M3CA 3LH0A 1O9SA 3VJPA 1B7TA 3JB9F 2CZ7B 1OPKA 1X6GA 2AIRB 3OYEA 4A4GA 4F04B 1M3AA 1UGPB 3LYIA 2RQTA 4JLIA 5GAN6 1K4US 4HXJA 1VOMA 2JZ2A 1VYVA 1EZZB 2KVQG 1Q7YR 3M0QA 5CQXA 3VS4A 3NPFA 4Q5WA 2X4JA 2X3XD 1FWZA 3QWXX 3UA7A 2DL4A 4QW2A 4KT0E 5KYXA 4PJOB 4C8QB 1NLPC 2HL5C 4IIOA 3CBOA 1YIJQ 5CKHA 4DA4A 1AHJB 2EGCA 1GBRA 2J05A 2QQRA 2MWPA 1NYGA 1K8AC 1VYUA 3JCMQ 3MP8A 1YFNA 3I55Q 2JN0A 2FO0A 1TOVA 3L2WA 3CC4T 3VUZA 2X51A 2ROLA 3PE0A 1VQ9T 4RTZA 2L8DA 4KRTA 4J8OA 4E7LA 1WZOA 2QI2A 2FPEA 2JJ9A 3L1AA 1BB9A 2NUTA 3EG0A 4IURA 1AWOA 1E7OA 5GAMh 4XU1A 4ZGDB 4ZTJA 2YUNA 2D8JA 3SWNC 3U23A 1YJ9T 7AT1B 5L23A 4LXCA 2QQSA 2X4WA 1X6OA 1WLPB 4M7AC 1M90C 2CP2A 3CD6T 1KQ2A 3HTRA 3J81E 4NL3A 1QVGA 2KR3A 3MHXA 2RI2A 4PJJA 1Q82C 2O4XB 1S72Q 2P84A 2RK2A 1IO6A 2DAQA 3P8BB 1JBMA 2GFAA 1RADB 2KYBA 3M9QA 3DB4A 4J7FA 2XMFA 3I56Q 3V7SA 2EIFA 4C92E 3CCUQ 4V2SA 2FZGB 4ATOA 1D3BB 5GAN5 1BI1A 2DYBA 2V8IA 3HRSA 3EH1A 2DK3A 1QLYA 1RAAB 4E7ZA 1Q86R 3SHWA 2QA4T 1VQNA 2BKDN 4QQGA 3PVQA 3CCRT 4LDVA 2J7IA 1YHQT 1WHGA 2PVGB 4PKCC 2RB6A 4GBQA 3O8VA 2JNGA 1K0XA 5IXFA 1D0ZA 5KYNA 3BFMA 3DLLA 1LVKA 2EYZA 1QMCA 2QGGA 3VV0A 1ZUYA 2F5TX 3EGXA 4M78C 5KH6A 1RI9A 2LMJA 4RTXA 5GAMd 3ZEHA 4C8QC 1GCQC 4CC2A 1NG2A 2K7AA 1XJWB 3OYBA 4EMKB 4J9HA 2CKKA 3TU4K 1M8VA 2EBPA 1QVFA 2YUOA 3WXMB 1QVFS 3RBBB 2MPXC 1WX6A 4RCBA 1EX4A 2DTOA 3EG9B 1I1JA 2CH4W 2DRKA 4Z02A 5IN1A 3X25B 3I55A 3FC3A 3CQTA 3S3OA 1C1AA 3JCMe 4FYYB 5EC7A 3RKYA 1Y71A 4QVZA 3ZFJA 1N27A 1JJ2P 1J3TA 1AD5A 1V29B 1Y0MA 5ECAA 2KROA 3M55A 4M75C 5GAOr 2Z0WA 1QKXA 1ABOA 2CH4A 1YJNA 3CC2T 4C92F 4M77C 3CD6Q 1HJDA 3L2QA 4JUVA 1YHQQ 2YHTA 2DNUA 3QIIA 1VQKQ 3CXCA 3OYLA 1K8AU 4JJNK 5HKCA 2G6FX 3EFSA 3RKXA 3CMAT 1ZBJA 4M7DD 1IGUA 1M90R 5GAN2 3C95A 2EYYA 1U1SA 1MMAA 2YUPA 1AOJA 1W70A 4D6WA 1RAGB 1AEYA 2GFUA 1VQLA 2F2VA 1F1BB 1TXQA 2CP0A 1OZ2A 5FRMA 1AZEA 2SEMA 3A8GB 1RACB 4F7UG 1WJQA 2VKNA 1PKSA 2KRNA 2KI7A 5GJWB 2NUPA 3GLXA 3CCJQ 3VS2A 3VS1A 2ZPFB 4C8QA 4OB0B 3L2ZA 5KE3A 2EJGA 3X24B 3I5RA 1PD1A 2FZCB 2P4RA 2ZZDA 2K9GA 5DM7R 2MYSA 1M2OA 1OPLA 4ELZC 4M7AE 3OMGA 5LJ3d 4IUUA 3X20B 2VYTA 4X9CA 2C0OA 5KYUA 3H6ZA 1BIAA 2E64A 2EYXA 2K5FA 4BUGA 4F7UB 1MV3A 2DXTA 2LNVA 1AWJA 1W4SA 3CC4A 2RJEA 1H3HA 3CCSQ 1NPRA 2CP6A 1VQPT 4MDXA 2EGAA 5FWCA 2K6DA 2COZA 3M0PA 3C0CA 3CC7Q 4R0KA 3WVDB 2EQKA 2MMPA 2M16A 3RIRA 5LJ5d 2DL3A 4J9GA 1VQ5T 3TCJA 2LQKA 5KYYA 2OTLQ 4M7AA 4A4FA 5GANg 2DL8A 2YRCA 5L8RE 4PJOA 1ABQA 4HVVA 4DBRA 1FXXA 2YRVA 2GGRA 3CCMA 4BDYA 2EQMA 1UHCA 2KBTA 4J83A 3CC2A 1R77A 5GMKi 3JCMh 1KIKA 1HK9A 2DXCA 2FRYA 4OMMA 1EFNA 1FMWA 5GAOm 3I9QA 2JTFA 4PJOD 1N8RU 3CMAQ 1RAEB 1VQ7T 3FJ5A 1D3BA 2RJFA 1YJNQ 2M02A 3FJPA 3X26B 2PVOB 2CT4A 2DEUA 4RCCA 3AHUA 2QGFB 3QPHA 3G71Q 4PJNA 5GAMg 1VQOA 2MI6A 3OYJA 3CC2Q 5FRNA 1D09B 2K2MA 2ZPIB 2GQVA 1YJ9Q 2NYSA 1NEBA 3M4GA 1MGQA 1H92A 4KGVB 4RKUE 2PQWA 8ATCB 5LJ3e 4O5VA 3OYCA 4X1VA 2RQWA 1ZBXA 3NMZC 3C94A 1S72T 3E9GA 4LUDA 1NBEB 1VQ6Q 4N0AA 1Q7YC 4M75E 2RHIA 2ESWA 4R56A 1VQ8T 2AKKA 4JPBW 3SFMA 2KQWA 2YLBA 1GFDA 5GAN8 2FVUA 4WF2A 1Y57A 1ZSZA 3CCJA 3JB9I 4FSXA 4Y28E 1WDXA 1MUZA 3QKJA 3WVEB 2DKGA 3HRUA 1KD1R 2O31A 3LGLA 2F2WA 3V7CA 4D8KA 2LX7A 1Q82R 2BUDA 3FRNA 3Q1JA 2L5QA 4XQ3A 2X4YA 4LN2A 4F14A 1JQQA 5A0LA 4RTVA 2JVVA 1GFCA 2D9TA 3M0TA 4M7AG 3EG9A 1YWOA 3A5ZB 1E6HA 1UG1A 4ORZA 3QHSA 4B9XA 3PFSA 1HD3A 4PFZA 3CXCP 2QASA 2QEXQ 1WHHA 3KFVA 3CCLT 2EQJA 4C0ZA 1AZGB 1D0XA 4LD6A 3J7AF 1Q86U 2WSFE 1ZA2B 5KE2A 5C0MA 1GCPA 3EG1A 3H9NA 3MEVA 5IHNA 4E2FB 2YRDA 3JV3A 4HCCA 1OZ3A 2HQEA 1B34B 1ACMB 2K57A 2K5IA 2MOXA 3P8DA 1VQ9A 1AVZC 4FL6A 4M78D 2JMCA 3CMAA 1W1FA 1VQ4T 2JUFA 1A0NB 3URGA 2RHYA 2A37A 2DZCA 3EFRA 5CVIA 2KXCA 3NFCA 2YSQA 4ANJA 2VVKA 1JJ2S 5HY6A 4OMQA 3VYGA 1UFFA 1O75A 4XTVA 5GAOn 3M59A 3PGGA 2KGTA 5LJ5j 1DJ7B 1SSHA 1YJWT 5GANh 1UECA 1N8RC 3CPFA 2OJ2A 5LJ5g 4A63B 4CC3A 1K73U 4M7DA 3I35A 2CZ1B 1WA7A 2LQWA 2D6FA 3A98A 1C6VX 3NTKA 3DKMA 5GAN7 3KBGA 3L2VA 1Z9QA 3CCMT 1QVGS 1ZLMA 4M78A 2VASA 4JRPA 1NJIU 3CPWP 2GTOA 2RQUA 3G71A 1K0SA 3H8ZA 4J9DA 2IIMA 1ZUKA 3MJXA 4WCIA 5FWBA 1SHFA 2JS2A 2CP3A 2XHCA 4JJBA 1G83A 2ZCFB 3OS0A 1I0CA 2QYZA 3HRTA 3RERA 1QVPA 4BE1A 5GMKh 1KG1A 1CSKA 1IHVA 3F70A 3EHQA 3OY9A 3OYAA 3RESA 1YJNT 1VQ4Q 2QDYB 3HP9A 2OTLT 4XTWA 3PIOA 2K4YA 2B86A 1VQMT 5D6YA 1LNXA 1QCNA 5FROA 4F7UE 3CCRA 4IUVA 2O88A 1QCFA 2RJCA 2RI3A 2BZXA 3M53A 1ZX6A 1R8OB 1WGSA 2DFUA 5KYWA 2COYA 1BU1A 3OYIA 3RUXA 3CCLA 1SG5A 4PJLA 2VGNA 1X6BA 2BTTA 1G3WA 4LDYA 4N0AC 3A8HB 1GCQA 4HVUA 4DOWA 1D1CA 3MEAA 1I5OB 4CI0C 4XTYA 4M7DG 2LT1A 1D0YA 3CMET 2G3RA 4AFZC 2CGHA 2M51A 2AT1B 4IIMA 2DX1A 4HVWA 2EKHA 3NTHA 2K3YA 2NUZA 4QVCA 3NTIA 9ATCB 3A8OB 3L42A 1K8AR 1TUCA 4NL2A 3UPUA 5AT1B 2AZVA 2CUBA 4RG8A 1VQ8Q 3JCMW 4FYXB 2K3XA 4C0FA 1S1NA 2JS0A 2ECZA 3EAEA 5GMKj 4DQ2A 2Y90A 3EH2A 1GXIE 5GAMf 5GAMe 2VGMA 1XNIA 1RAHB 1W2BS 2HAXA 1VQ8A 5GAMj 1BBZA 2J6FA 1Q81R 4FU6A 4X9DA 2V26A 1U5SA 4ZNXA 3OYGA 1VQPA 3A8MB 4KBMB 2XG8D 3ER0A 3EFOA 3CCMQ 2GNCA 4J9EA 2RD1A 3BY7A 2DA9A 1Q95G 2HDAA 3HPWA 4FYWB 3MO8A 3RNJA 1TUDA 4RTUA 1IHWA 3R6OA 1NLOC 3OYYA 2DRMA 1VQMQ 3E9FA 3MP6A 2C0TA 5GANf 4TVRA 1K1ZA 1K9MU 1M2VA 4OF1A 1I4K1 1QWEA 2E4HA 4NOYA 2QXFA 4JRQA 4BY6B 5D7UA 4FT4A 2DF6A 4M77F 1HXDA 2LQ8A 2QQAA 4M7DE 1QW1A 2QDLA 2V1RA 3JCMX 1ZUUA 2O4XA 2A7YA 2E6ZA 2LRQA 3JCMf 3QJ6A 1YWPA 2QEXT 3CCLQ 2KAFA 3JSCA 4JRIA 2LQNA 3BDUA 2MCNA 1B34A 5FU6C 3UWNA 4BI4A 2X9HA 3JB9D 1AWWA 1M1KR 4ZN1A 1NE8A 5IHIA 2HD0A 1G3SA 3OA6A 3VKIA 2RA2A 4C0DB 3ASKA 3OYHA 1OULA 1B3QA 4MZMA 4UC4A 1WHMA 3JRZA 2HKNA 1I5LA 5KYUB 1R0CB 1TWBA 2L3SA 1X69A 1M4ZA 2ED0A 3OBYA 4PFOA 1M1FA 5LL6S 3J80E 4ZN3A 1U06A 4VUBA 3OYMA 1W2BA 2YUQA 3V8JA 3RMSA
chains in the Genus database with same CATH topology
3S3MA 3I56A 2MI6A 3OYJA 1KD1C 4IUTA 2DIGA 4M78B 2RH2A 4C5GA 1VQKA 5FRNA 2GCXA 4HT8A 2XK0A 4QQ6A 3M57A 4EDUA 4N4HA 4M78F 5CK9A 4A4HA 2ZPIB 1Q82U 2JOYA 4C92C 2GQVA 2EKOA 3JCMg 2FHDA 4GY5A 1KC8U 2DZ9A 2F5KA 4MMLA 2DTIA 2R5MA 2RHXA 3META 3JCMJ 5D6WA 4A4EA 4C5EA 1M9SA 5J26A 1YBYA 3M4GA 4DOVA 5AYFA 3OS1A 1K9MC 4KUDK 4ZGEB 4PL6A 1MGQA 3OMCA 1G3YA 4XTZA 3CCJT 5CAIA 1VQ4A 4RKUE 2PQWA 4F7UA 4PNOA 5LJ3e 3FIFA 4O5VA 3OYCA 4CRIA 1WQWA 1ZBXA 3HL8A 2EJFA 4L5GA 3SD4A 3E19A 3C94A 3MEUA 3QYHB 4QQDA 3E9GA 4C5IA 2R58A 4C92A 5LJ5f 1H641 5LJ5e 4EMKC 3KXTA 3S3NA 4N0AA 1G3TA 1LOJA 3P8HA 1YIJA 4M75E 2RHIA 4OMFB 3TEEA 1Q7YC 1NJIC 3QG1A 4R56A 1VQ8T 3PNWC 4II1A 3JCMb 3CPWS 3SFMA 2LVMA 2KQWA 4M77D 4PJOG 1VQOA 2YLBA 1KQ1A 5GAN8 4XTUA 4EMHA 1NPPA 1KQSA 3QZ5B 4ELYC 2CZ0B 3MP1A 5J3BA 2FVUA 4WF2A 5CO7A 3VUBA 1N9RA 2DXUA 3V8LA 3CCJA 3JB9I 2EQUA 2XDPA 3MEWA 3PMTA 4FSXA 4HKEA 4Y91A 4BI8B 5KCOA 3G71T 4HT9A 2CZ6B 4N4GA 4P5NA 2KDSA 4Y28E 3T9NA 2RJDA 3G6ET 1S72A 5J39A 4E7IA 4HA8A 3QKJA 3WVEB 3L2RA 2DKGA 3HRUA 3QSUA 4JRKA 5FU7B 3HKSA 4MMKA 2EWNA 3LGLA 4A53A 4HCBA 3V7CA 2HQXA 1ZQ1A 3X28B 3GNGA 3JB9J 1N6AA 5GANd 4M7AD 1N9SA 5CKFA 3CC7T 5HK0A 2EJ9A 3SB2A 2BUDA 4M78G 2NLUA 3FRNA 3Q1JA 3LH0A 1O9SA 2L5QA 4J7IA 4XQ3A 2X4YA 3VJPA 3JB9F 2CZ7B 3L2UA 1KHIA 1Y96A 3CCQA 5A0LA 3PMIA 4L59A 2I2LA 3OYEA 5HK3A 1VQKT 1VQ7A 4A4GA 4M75B 2JVVA 1M5Q1 2D9TA 1UGPB 2CS7A 3LYIA 2V8JA 4JLIA 5FU6B 3RKWA 5GAN6 5LJ3f 4M7AG 3FDRA 5GMKe 4M77B 2QQBA 5GMKm 3OSSC 2JZ2A 4N4IA 3A5ZB 2KVQG 2ZGWA 3QPHA 4J6YA 3GOXA 5CQXA 3QDRB 4M75F 2E65A 5CR2A 3QHSA 1M1KC 2KMTA 2X4JA 4Q5WA 3HSBA 4B9XA 4IUQA 3PFSA 3GPLA 1BYMA 2XU8A 3PT9A 1FWZA 2LCLA 4BE0A 2RHUA 4OP0A 3CCLT 4RG2A 2EQJA 2EAYA 4C0ZA 4EPCA 1UGSB 4LD6A 2WACA 4KT0E 4QW2A 1VQLT 4PJOB 4C8QB 3J7AF 1Q86U 1YHQA 2WSFE 3CCUA 5KE2A 5C0MA 2OAUA 3MEVA 4XU0A 2IG0A 3CBOA 4HCCA 3CEYA 5LJ3j 5CKHA 4DA4A 1OZ3A 1AHJB 1B34B 2HQEA 2K57A 2K5IA 3MCAB 2VXFA 2Y4YA 3OYNA 3V8KA 3P8DA 5GAOq 1VQ9A 2K2VA 4FL6A 4M78D 4M7DB 2QQRA 3CMAA 2MWPA 4GLKA 1VQ4T 1K8AC 3CCVA 2JUFA 5A2QE 3JCMQ 4E47A 5A0DA 3M5AA 3URGA 2KSSA 3MP8A 2RHYA 2DZCA 2JN0A 1JJ2A 3EFRA 5CVIA 2DPPB 3NFCA 4C92D 2XDDA 1YI2A 4LDXA 1JJ2S 5HY6A 3L2WA 1S72T 2IVWA 3CC4T 5DLOA 2M9UA 3VUZA 3VYGA 4MZTA 1O75A 1I81A 1XTDA 4PJOF 2FB7A 4XTVA 2QA4A 1VQ9T 1VQNT 4BY6C 2L8DA 3OW2S 1BI2A 3OB9A 4J8OA 4E7LA 3E1SA 5GAOn 2QI2A 3M59A 3PGGA 1BI0A 5LJ5j 4LD9K 1YCYA 2E1HA 2LTOA 4KUIA 3OS2A 1DJ7B 1WJRA 1YJWT 1UB4A 3DLMA 2E70A 2RHZA 3V7RA 4BD3A 3GNFB 3L1AA 5GANh 2PVDB 3LLRA 4IURA 5GAMh 4FIBA 4XU1A 4E7JA 4ZGDB 3CCET 4ZTJA 1RL2A 3CPFA 3QBYA 2WSCE 4XAXB 1N8RC 5LJ5g 2P4TA 3SWNC 1K73U 4M7DA 2DIQA 1YJ9T 2CZ1B 3QJYA 2OTJT 2QQSA 3HFOA 3HFNA 2D6FA 2DD5A 2X4WA 4J6WA 4C8QF 2DXBA 3NTKA 4LDUA 3DKMA 5GAN7 3CMEA 1VIEA 3KBGA 2E5QA 3L2VA 1X6OA 4L6V5 3UDCA 4FT2A 3S6WA 1M90C 2XI9A 2DTHA 3CCMT 1QVGS 1NZ9A 4C5HA 4M7AC 4M78E 3CD6T 1KQ2A 3J81E 4NL3A 4RMOA 1QVGA 4BACA 3M54A 3MHXA 1XQHA 4M78A 5CCAA 4JRPA 1Q7YU 2RI2A 2RI5A 1NJIU 2M1HA 2O4XB 1Q82C 4C8QE 4OB2B 2RK2A 4JS5A 3SWNA 2DAQA 3P8BB 1JBMA 2GFAA 3FB9A 3M9QA 3DB4A 2D0QB 3G71A 4J7FA 1H3ZA 2F69A 4V2SA 3V7SA 1BIBA 2EIFA 4XU2A 3H8ZA 4C0DC 4C92E 3CCVT 2HNIA 3JAME 4ATOA 5CKEA 1D3BB 2VV5A 4M75G 5GAN5 1BI1A 5LJ3g 2QQ9A 2EYQA 4A4KA 2V8IA 3HRSA 4BB7A 2DK3A 2DVEA 2XHCA 3JCMP 4ME7A 4F7UF 3CPWA 1SSFA 4MZPA 3C12A 3FLGA 2ZPGB 2ZCFB 2QA4T 3OS0A 1VQNA 1KQSS 2BKDN 3HRTA 2RK1A 4QQGA 3CCRT 3RERA 1QVPA 4BE1A 4LDVA 5GMKh 1KG1A 5I2MA 1YHQT 4EMKA 2PVGB 4JS4A 3F70A 4PKCC 3OY9A 3OYAA 1YI2T 3RESA 2X4XA 1YJNT 2RB6A 1Q81C 2QDYB 3HP9A 3QUIA 3O8VA 4XTWA 3ZBDA 2JNGA 4EMGA 3PIOA 2OTLT 3BDLA 3JCMd 5GAOl 1LJOA 3BFMA 3QXEB 1KD1U 2K4YA 3GIBA 4OB1B 3DLLA 1VQMT 4M7AF 5D6YA 1LNXA 3VV0A 5FROA 5IT9E 2F5TX 4JDSA 3VYHB 4F7UE 3CCRA 4M78C 4IUVA 5KH6A 3OS5A 5GAMd 2RJCA 2XDBA 2P0QA 3PIPA 1YIJT 3ZEHA 2RI3A 3JCMV 5I2SA 1KC8C 4YTLA 1PSFA 4C8QC 2MF2A 3M53A 4OB3B 4OGEA 2X35A 2XKOC 1R8OB 4IUPA 3LWHA 1WGSA 3INZA 3SDZA 1VIFA 4KULA 2LX9A 4XU3A 3OYBA 4EMKB 3LWIA 5CIUA 3OYIA 4C8QG 3RUXA 5GAN3 2M0OA 2CKKA 2ZPBB 1IZ6A 2O01E 3TU4K 3CCLA 1M8VA 2R5AA 2VGNA 3I55T 1QVFA 4B9WA 1G3WA 2DD4A 4LDYA 3WXMB 3M4YA 4M7DC 3CC7A 4ZGJB 1QVFS 4N0AC 3A8HB 5GAOp 1U1TA 4BE2A 3TREA 2VC8A 4DOWA 4RCBA 3MEAA 2DTOA 4CI0C 1Q86C 2P0KA 4XTYA 4M7DG 2LT1A 1WJSA 3CMET 3HHTB 2G3RA 2CGHA 3A8LB 2E12A 4Z02A 5IN1A 1VQOT 5GMKl 3OYDA 3NTHA 2OTJA 2K3YA 3FEOA 2LC4A 5LJ3h 3X25B 3OYKA 4M75A 3NTIA 4QVCA 3I55A 3FC3A 2E41A 3CCQT 1YITT 3S3OA 4XTXA 3A8OB 3L42A 1XOVA 3VU3C 2P0PA 3M56A 3G6EA 2XIDA 2MWOA 1VQ5A 4NL2A 3JCMe 3UPUA 1P92A 3PTAA 3LX7A 1JRIA 4E7KA 5FU7C 2RM4A 4J5YA 3RKYA 1Y71A 3GF5A 4QVZA 3ZFJA 4RG8A 1N27A 2KK4A 3JCMW 2JTMA 1VQ6T 1V29B 3LGFA 3M55A 4M75C 5GAOr 2K3XA 4C0FA 1YJNA 3CC2T 5CKDA 4C92F 2FYKA 4OGCA 3EAEA 5GMKj 2KY9A 4M77C 2PU9B 3L2QA 4DQ2A 4ZTFA 4JUVA 2Y90A 3CBMA 2YHTA 3QIIA 2DJZA 4XK8E 3OYLA 5KCHA 5GAMf 1TH7A 3CXCA 1K8AU 1GXIE 5GAMe 5M9OA 2VGMA 5I21A 4JJNK 1XNIA 1Y07A 3ME9A 5HKCA 3CBPA 3RKXA 3EFSA 1W2BS 2VUBA 1KHCA 5GANj 2HAXA 3CMAT 4M7DD 2QTXA 1VQ8A 2DEQA 3DB3A 5GAMj 2HBPA 4M77E 5GAN2 4FU6A 4PJOC 3C95A 4X9DA 2E10A 3OYGA 4M77A 4C92B 4E7HA 1VQPA 2ZPHB 1UGQB 1U1SA 2LDMA 3A8MB 4LDWA 5A0GA 4KBMB 3QO3A 2XG8D 3ER0A 3CD6A 3G7ZA 2ZPEB 4D6WA 2RD1A 2L3RA 4C8QD 3BY7A 2B8AA 2E6NA 1Y96B 2GFUA 3OSVA 5CKBA 1VQLA 3HPWA 3MO8A 3QZ9B 1OZ2A 3KUFA 5FRMA 3R6OA 3OYYA 1M1GA 3A8GB 3E9FA 4F7UG 3MP6A 2K5LA 1WJQA 1WNLA 5GANf 4TVRA 4JLGA 3JB9G 1OYXA 2EFIA 3GLXA 1JB0E 3M58A 1K9MU 2ZPFB 4C8QA 3GP8A 4OF1A 3I56T 3CXCS 4OB0B 1ZHIA 1I4K1 4A54A 3L2ZA 5KE3A 2EJGA 1YJWA 4NOYA 4C92G 2QXFA 4J6XA 4QVDA 4BY6B 5IAYA 1Y7XA 3CCSA 4JRQA 3X24B 1BKBA 3QYGB 2YLCA 3G4SA 1X01A 2ZZDA 3JCMc 2C06A 5DM7R 2R57A 5EG2A 4FT4A 2V8KA 4M77F 4ELZC 2PUOB 2AHJB 3OMGA 4M7AE 5LJ3d 2CYZB 2LT4A 1HXDA 2LQ8A 4IUUA 4O6JA 3X20B 2VYTA 4X9CA 1VQMA 4PJOE 1G5VA 2XICA 3H6ZA 2QQAA 1BIAA 4R55A 2E64A 3N5BB 2DO3A 2RO0A 1Q81U 4M7DE 1QW1A 1I8FA 2A3LA 2OTLA 3JCMX 2K5FA 3OBWA 1WQ7A 4BUGA 4F7UB 2L89A 3SWNB 1BI3A 2DXTA 2LNVA 2O4XA 2A7YA 1W4SA 2E6ZA 3CC4A 2LRQA 2RJEA 3JCMf 2MAMA 3QJ6A 1RI0A 1EIFA 1M1KU 1OI1A 2QEXT 1NPRA 4X34A 1VQPT 4MDXA 2KAFA 3JSCA 4JRIA 1QP2A 5CQYA 3BDUA 1VQ6A 1U8RA 4M7AB 5FLXE 3WVDB 1B34A 1FX7A 2EQKA 2MMPA 5FU6C 2M16A 3OQ5A 3UWNA 4BI4A 4BDZA 3JB9D 3RIRA 5LJ5d 2FL7A 4FM4B 1VQ5T 3TCJA 4ZN1A 1NE8A 2LQKA 1M90U 4M7AA 4A4FA 5GANg 2HD0A 1G3SA 2H3JA 3OA6A 3G4ST 5GANe 3VKIA 5L8RE 1PSEA 3BW1A 2RA2A 4C0DB 2QEXA 1YITA 4PJOA 3ASKA 3UT1A 3OYHA 1FXXA 2YRVA 4OVAA 2WSEE 3CCUT 1QP3A 1VUBA 3CCMA 4BDYA 3OW2A 2EQMA 4MZMA 4J83A 4UC4A 3CC2A 4PLIA 2GF7A 3JCMh 5GMKi 3JB9H 3JRZA 2LCCA 2XD0A 1HK9A 2DXCA 4M75D 4PLLA 1IREB 1I5LA 1WPYA 3C4SA 4C0GA 1UEBA 5D6XA 5C6SA 5DLQE 1M4ZA 5GAOm 1YJ9A 1UGRB 2JTFA 4M77G 4PJOD 4MDWA 1N8RU 2VXEA 4BI3A 3OYFA 2BIVA 4NS5A 5GAN4 3OBYA 3CCEA 1M1FA 2PUKB 3LW5E 1K73C 1VQ7T 4M7DF 1D3BA 2RJFA 3FJPA 5LL6S 3X26B 2PVOB 3J80E 3CCST 4ZN3A 4HCZA 4RCCA 3RMQA 4VUBA 3OYMA 1W2BA 1MHNA 5LJ5h 5DY9A 3AHUA 2Y4XA 1X75C 4IKFA 3V8JA 3RMSA 5GAMg
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMG A;  1LJO A;  3BY7 A;  5GAO l;  3BFM A;  3GIB A;  1Y96 B;  4M78 B;  4M7A F;  4XU0 A;  4HT8 A;  1LNX A;  4M7A G;  5LJ3 j;  4M78 F;  2K57 A;  4F7U E;  1B34 B;  4C92 C;  2VXF A;  4M78 C;  4F7U G;  3JCM g;  5GAM d;  3V8K A;  5GAO q;  1WNL A;  5GAN f;  3JB9 H;  2DZ9 A;  4M78 D;  4MML A;  3JCM V;  2DTI A;  4M7D B;  3JCM J;  3JB9 G;  4C8Q C;  3M4G A;  4C8Q A;  3JCM d;  3JCM Q;  1MGQ A;  3INZ A;  1I4K 1;  4A54 A;  4XTZ A;  3L2Z A;  2DZC A;  2EJG A;  2JN0 A;  3EFR A;  4XU3 A;  4EMK B;  5CAI A;  4C8Q G;  4NOY A;  3RUX A;  4PNO A;  4J6X A;  4C92 D;  4C92 G;  4F7U A;  3FIF A;  4QVD A;  5GMK i;  5LJ3 e;  5GAN 3;  1M8V A;  1WQW A;  2YLC A;  1X01 A;  2EJF A;  3JCM c;  5LJ5 f;  4C92 A;  5LJ5 e;  4M7D E;  1H64 1;  4PJO F;  1I81 A;  4M77 F;  4EMK C;  4M7A E;  4N0A A;  2FB7 A;  4M7D C;  1LOJ A;  4XTV A;  5LJ3 d;  4M75 E;  4N0A C;  1HXD A;  5GAO p;  1U1T A;  4X9C A;  4PJO E;  3JCM b;  2VC8 A;  5GAO n;  4RCB A;  1BIA A;  2E64 A;  3PGG A;  4M77 D;  4PJO G;  2DTO A;  1KQ1 A;  2YLB A;  1YCY A;  2E1H A;  1I8F A;  4XTU A;  4EMH A;  5LJ5 j;  4XTY A;  5GAN 8;  4M7D G;  3JCM X;  4WF2 A;  1WQ7 A;  1N9R A;  2CGH A;  2DXU A;  3L1A A;  3V7R A;  4Y91 A;  3V8L A;  4F7U B;  3JB9 I;  4HT9 A;  3SWN B;  5GAN h;  5GMK l;  2DXT A;  5GAM h;  5LJ3 h;  3JCM f;  4XU1 A;  4M75 A;  4HA8 A;  4QVC A;  2E41 A;  2DKG A;  3QSU A;  4JRK A;  4XTX A;  5LJ5 g;  4MMK A;  2EWN A;  3SWN C;  3VU3 C;  4JRI A;  4A53 A;  4M7D A;  3V7C A;  3BDU A;  4NL2 A;  3JCM e;  3HFO A;  3HFN A;  4M7A B;  4J6W A;  4C8Q F;  1JRI A;  1B34 A;  3JB9 J;  2RM4 A;  5GAN 7;  4J5Y A;  3RKY A;  5GAN d;  4M7A D;  1N9S A;  3JB9 D;  3RIR A;  5LJ5 d;  3JCM W;  2EJ9 A;  3SB2 A;  4M78 G;  4M7A C;  2DTH A;  4M7A A;  4M75 C;  4M78 E;  4XQ3 A;  5GAN g;  5GAO r;  1KQ2 A;  5GAN e;  3JB9 F;  4NL3 A;  4C92 F;  3BW1 A;  2FYK A;  2RA2 A;  1Y96 A;  4M78 A;  5GAM g;  4PJO A;  4C8Q E;  5GMK j;  4M77 C;  2I2L A;  3SWN A;  4DQ2 A;  4M75 B;  1JBM A;  3FB9 A;  4JUV A;  1M5Q 1;  2Y90 A;  4JLI A;  2YHT A;  1BIB A;  3RKW A;  4XU2 A;  3V7S A;  4C92 E;  5GAN 6;  2DJZ A;  4V2S A;  2HNI A;  1TH7 A;  5LJ3 f;  3JCM h;  5GAM f;  5GAM e;  1D3B B;  4M77 B;  5I21 A;  4M75 G;  5GMK e;  1HK9 A;  4M75 D;  5GMK m;  5LJ3 g;  5GAN 5;  1I5L A;  1WPY A;  2ZGW A;  3RKX A;  3EFS A;  4J6Y A;  2DVE A;  3JCM P;  5GAN j;  4M7D D;  4F7U F;  2QTX A;  5GAO m;  4M77 G;  2DEQ A;  4M75 F;  2E65 A;  5GAM j;  4PJO D;  2VXE A;  3QHS A;  3HSB A;  4M77 E;  5GAN 2;  5GAN 4;  4PJO C;  4X9D A;  2E10 A;  3RER A;  4M7D F;  1D3B A;  4M77 A;  4C92 B;  5GMK h;  3FJP A;  4OP0 A;  1U1S A;  4EMK A;  2EAY A;  4RCC A;  3RES A;  3QO3 A;  2RB6 A;  5DY9 A;  5LJ5 h;  4PJO B;  3AHU A;  3QUI A;  4C8Q B;  4XTW A;  2RD1 A;  3V8J A;  4C8Q D; 
#chains in the Genus database with same CATH topology
 3S3M A;  3I56 A;  4C5G A;  1PHT A;  1D1A A;  2GCX A;  4QQ6 A;  1LCK A;  3M57 A;  4EDU A;  4F17 A;  4A4H A;  2CP5 A;  1M30 A;  1KC8 U;  2DZ9 A;  2BE9 B;  2RHX A;  4PK4 A;  5D6W A;  4C5E A;  1M9S A;  2BE7 D;  5J26 A;  1YBY A;  4DOV A;  3OS1 A;  4KUD K;  2F1L A;  4CC7 A;  2ATC B;  3EHR A;  5CAI A;  3VS3 A;  2CRE A;  4RTW A;  2OX7 A;  1RLP C;  3FIF A;  3SD4 A;  1OQK A;  3HL8 A;  5LJ5 f;  2DM1 A;  4C92 A;  5LJ5 e;  4EMK C;  2DMO A;  1NYF A;  3TEE A;  1GRI A;  1KSW A;  4EMH A;  1NPP A;  1YNZ A;  4ELY C;  3MP1 A;  5J3B A;  1N9R A;  1WHJ A;  2W10 A;  4Z89 A;  4HT9 A;  4BI8 B;  1S72 A;  2D1X A;  4HA8 A;  3QSU A;  3NGP A;  5FU7 B;  2EWN A;  2FRW A;  4HCB A;  1KQS P;  2AKL A;  2HQX A;  1ZQ1 A;  2J6K A;  3QDF A;  1N6A A;  4M7A D;  5HK0 A;  2EJ9 A;  2NLU A;  4Z88 A;  2JT4 A;  4FYV B;  3L2U A;  1Y96 A;  2L3P A;  3EFO B;  5IHK A;  4FCY A;  1PWT A;  3PMI A;  4L59 A;  2I2L A;  5HK3 A;  1VQK T;  4M75 B;  1M5Q 1;  3BE3 A;  2CS7 A;  5FU6 B;  4AFQ C;  3TVT A;  4M77 B;  3OSS C;  4N4I A;  1NJI R;  1OX8 A;  4K11 A;  4Z8A A;  2D0N A;  4M75 F;  2E65 A;  2KMT A;  4IUQ A;  1BYM A;  2JXB A;  2XU8 A;  2LCL A;  4BE0 A;  4JJD A;  1SRL A;  4RG2 A;  2RPN A;  2KYM A;  1UGS B;  1VQL T;  2DJQ A;  4KH1 B;  1FMK A;  3G1J A;  1YHQ A;  1SKU B;  1G8X A;  2IG0 A;  2QA4 Q;  2M0Y A;  5LJ3 j;  2VXF A;  2AK5 A;  1MMD A;  3EGX B;  1PD0 A;  3V8K A;  5GAO q;  4GLK A;  3EG2 A;  1QKW A;  4E47 A;  2DIL A;  3M5A A;  4FSS A;  3NHN A;  2DVJ A;  2YT6 A;  3IQL A;  1JJ2 A;  2DPP B;  1AT1 B;  2XDD A;  1YI2 A;  4LDX A;  1K76 A;  5DLO A;  4MZT A;  1VQ5 Q;  1XTD A;  4PJO F;  2FB7 A;  2QA4 A;  1VQN T;  4PFP A;  2L3Q A;  4JZ3 A;  3OB9 A;  4EIK A;  4KH0 B;  1IGQ A;  1BI0 A;  1PM3 A;  2E1H A;  3OS2 A;  1MV0 B;  2O9V A;  3DLM A;  1B07 A;  3V7R A;  2E5K A;  4M4Z A;  3LLR A;  2DE0 X;  4WTO B;  3CCE T;  1RL2 A;  4XAX B;  2OTJ T;  3HFO A;  3HFN A;  4C8Q F;  2BZ8 A;  4FW2 A;  3CME A;  1YN8 A;  2E5Q A;  2ZAE A;  4FT2 A;  3S6W A;  2DL5 A;  3ULR B;  4C5H A;  1PCX A;  4M78 E;  2EGE A;  2GQI A;  4RMO A;  5CCA A;  2KEA A;  4J9I A;  2O9S A;  4OB2 B;  4C8Q E;  3SWN A;  3VRZ A;  3FB9 A;  2D0Q B;  2F69 A;  3CCV T;  4XU2 A;  1UE9 A;  1YCS B;  2HNI A;  1VQL Q;  2GTJ A;  2VV5 A;  4KGX B;  1X2Q A;  4ME7 A;  4F7U F;  3CPW A;  1SSF A;  4MZP A;  3FLG A;  2EYW A;  2ZPG B;  2RK1 A;  1Z9Z A;  2X3W D;  5I2M A;  4DEY A;  1YI2 T;  1Q81 C;  1OU9 A;  3QUI A;  3ZBD A;  4EMG A;  2RQV A;  3BDL A;  5GAO l;  1LJO A;  3GIB A;  3QXE B;  1KD1 U;  2FEI A;  4OB1 B;  4OMN A;  3VYH B;  3OS5 A;  2XDB A;  2P0Q A;  3PIP A;  1YIJ T;  1VQN Q;  4KGZ B;  1RLQ C;  4F16 A;  5I2S A;  1KC8 C;  4QKU A;  1PSF A;  1JO8 A;  1YP5 A;  1VQP Q;  2XKO C;  2DLP A;  5I22 A;  3INZ A;  3SDZ A;  2LX9 A;  4XU3 A;  2CP7 A;  2SRC A;  4C8Q G;  5GAN 3;  2M0O A;  1MMG A;  3I55 T;  4JZ4 A;  4B9W A;  1UJ0 A;  3M4Y A;  3CC7 A;  5GAO p;  1U1T A;  4BE2 A;  3TRE A;  2VC8 A;  3PVL A;  4DBF A;  3H41 A;  1WXT A;  3UAT A;  3HHT B;  3A8L B;  5GMK l;  3OYD A;  1SRM A;  3FEO A;  2LC4 A;  3MKD A;  3OYK A;  4AMC A;  2E41 A;  3M0R A;  1XOV A;  2P0P A;  1C0M A;  2AZS A;  2XID A;  1TG0 A;  1VQ5 A;  3PTA A;  3LX7 A;  4J9C A;  4J5Y A;  3GF5 A;  2KK4 A;  2JTM A;  1WHK A;  5CKD A;  1SF9 A;  2PU9 B;  3M0U A;  2PZ1 A;  5KCH A;  1TH7 A;  1UJY A;  2W0Z A;  3ME9 A;  1MNE A;  2VUB A;  1KHC A;  3CME Q;  5GAN j;  2QTX A;  2DEQ A;  4PJO C;  2E10 A;  4M77 A;  1WXU A;  4E7H A;  4LDW A;  2LDM A;  2LJ1 A;  1HSQ A;  3QO3 A;  3CD6 A;  1ZSG A;  3EG3 A;  1YI2 Q;  2CUD A;  2L3R A;  2B8A A;  5FW9 A;  5CKB A;  3G6E Q;  3TSW A;  1RAI B;  6AT1 B;  4RTT A;  1M1G A;  1WNL A;  2HEQ A;  3JB9 G;  1K73 R;  1OYX A;  2EFI A;  1TU0 B;  3M58 A;  1UGV A;  1YJW A;  4C92 G;  4QVD A;  1CKB A;  4J6X A;  1Y7X A;  3CCS A;  3G4S A;  2YLC A;  2KT8 A;  1X01 A;  3A1P A;  3JCM c;  4B6M A;  1K9A A;  2R57 A;  5EG2 A;  2V8K A;  2RNA A;  3AT1 B;  3VRY A;  2CYZ B;  2LT4 A;  4O6J A;  2E3H A;  2XIC A;  4R55 A;  1Q81 U;  2DO3 A;  2RO0 A;  3E2U A;  2EW3 A;  1IB8 A;  2A3L A;  2OTL A;  4CC4 B;  3OBW A;  1WQ7 A;  1WFW A;  3SWN B;  1BI3 A;  2V1Q A;  3MPU B;  4HCK A;  4DBH A;  1RI0 A;  1M1K U;  1OI1 A;  3VS6 A;  1E6G A;  1KJW A;  4PJM A;  4M7A B;  1U8R A;  1FX7 A;  4BDZ A;  1AWX A;  2LJ0 A;  2FL7 A;  4FM4 B;  2KT1 A;  1M90 U;  2KNB B;  2H3J A;  8AT1 B;  3G4S T;  1YIT A;  1PSE A;  3BW1 A;  1QVF P;  2QEX A;  1X27 A;  2JW4 A;  3UT1 A;  1W6X A;  3I5S A;  4OVA A;  2NWM A;  1QP3 A;  5HCK A;  3RDV A;  1VA7 A;  2XD0 A;  1IRE B;  1WPY A;  3C4S A;  1W2B P;  4DEX A;  1UEB A;  5C6S A;  5DLQ E;  1YJ9 A;  4D8D A;  2BIV A;  4OMP A;  3CCE A;  1K73 C;  4M7D F;  1YIT Q;  4HCZ A;  1MHN A;  2Y4X A;  1X75 C;  1VQK A;  4IUT A;  4M78 B;  2RH2 A;  2FG0 A;  3EGD A;  1KFZ A;  4HT8 A;  2NUP B;  1OEB A;  4N4H A;  4M78 F;  2EKO A;  2HMA A;  3VS0 A;  4GY5 A;  2DTI A;  2R5M A;  5GJV B;  4A4E A;  2CSQ A;  1FMV A;  2LNH B;  1K9M C;  3OMC A;  3CCJ T;  1VQ4 A;  4CRI A;  1WQW A;  1CKA A;  2EJF A;  4C5I A;  4QQD A;  3QYH B;  3G6E A;  3KXT A;  3S3N A;  1NJI C;  1YIJ A;  1VYT A;  2JMA A;  2YWW A;  3QG1 A;  3PNW C;  4II1 A;  3OW2 P;  2EVR A;  3JCM b;  3CPW S;  4PJO G;  1KQ1 A;  4XTU A;  1KQS A;  2CZ0 B;  1PG5 B;  2A36 A;  3VUB A;  2CSI A;  2XDP A;  3PMT A;  3CCQ Q;  2CZ6 B;  4P5N A;  2O2O A;  2RJD A;  5J39 A;  3L2R A;  4JRK A;  3HKS A;  1M2V B;  3X28 B;  2PNI A;  2HSP A;  3GNG A;  3JB9 J;  2LZ6 B;  2VB6 A;  5CKF A;  4LNP A;  3CC7 T;  1ZSZ C;  4M78 G;  2RMO A;  4J7I A;  1KHI A;  3CCQ A;  1VQ7 A;  2EQI A;  4E7S A;  1RAB B;  2V8J A;  3RKW A;  2RF0 A;  1JU5 C;  5LJ3 f;  3FDR A;  5GMK e;  5GMK m;  2QQB A;  2ZGW A;  4J6Y A;  4AFU C;  2DL7 A;  3GOX A;  3QDR B;  5CR2 A;  1T0H A;  1VQ9 Q;  1M1K C;  3HSB A;  3GPL A;  3PT9 A;  2YDL A;  2RHU A;  4OP0 A;  2EAY A;  4EPC A;  2WAC A;  1PRM C;  1ARK A;  1JEG A;  3G4S Q;  2LP5 A;  5KYY B;  3CCU A;  2OAU A;  4XU0 A;  3CEY A;  3MCA B;  2Y4Y A;  3UA6 A;  3OYN A;  1WXB A;  1SHG A;  2K2V A;  4M7D B;  2HQH A;  3CCV A;  1WYX A;  5A2Q E;  5KYX B;  5A0D A;  2KSS A;  1TUG B;  2DBM A;  1OU8 A;  1SPK A;  4C92 D;  2OAW A;  2RN8 A;  2IVW A;  3VS5 A;  2M9U A;  1LPL A;  1I81 A;  1PKT A;  2PTK A;  3SEM A;  4BY6 C;  3OW2 S;  1BI2 A;  2H8H A;  1QQJ A;  3E1S A;  4LUE A;  4LD9 K;  1YCY A;  2LTO A;  4KUI A;  2EPD A;  1WJR A;  2GBQ A;  2DER A;  1UB4 A;  2E70 A;  2RHZ A;  4BD3 A;  3GNF B;  1M3B A;  2L2P A;  2PVD B;  4FIB A;  4E7J A;  3QBY A;  2WSC E;  2K3B A;  1IXD A;  2P4T A;  5KYW B;  2C0I A;  2DIQ A;  3ZL7 C;  3QJY A;  2HBW A;  2DD5 A;  4J6W A;  2DXB A;  4LDU A;  1VIE A;  2MIO A;  3THK A;  4L6V 5;  3UDC A;  4E6R A;  2XI9 A;  2DTH A;  1NZ9 A;  2HCK A;  2COW A;  4BAC A;  3M54 A;  1XQH A;  2KRM A;  1Q7Y U;  2RI5 A;  1NM7 A;  2KRS A;  2M1H A;  4JS5 A;  2MK5 A;  1TTH B;  2HZY A;  1H3Z A;  1BIB A;  4C0D C;  3JAM E;  5CKE A;  1ZSZ B;  4M75 G;  5LJ3 g;  2QQ9 A;  2EYQ A;  4A4K A;  4BB7 A;  2DVE A;  3JCM P;  3REB B;  3C12 A;  1KQS S;  1V1C A;  2BZY A;  4EMK A;  4JS4 A;  1TSF A;  1GBQ A;  2X4X A;  4Y92 A;  2K79 A;  3JCM d;  4M7A F;  2HL3 A;  5IT9 E;  4JDS A;  2QAZ A;  1T0J A;  1TS9 A;  3LH5 A;  3JCM V;  2KE9 A;  4YTL A;  3UF4 A;  2MF2 A;  4OB3 B;  3EGD B;  2E3I A;  4OGE A;  2X35 A;  4IUP A;  3LWH A;  2ROT A;  1UDL A;  1VIF A;  2LJ3 A;  4KUL A;  1T3S A;  3LWI A;  5CIU A;  1G2B A;  1QCO A;  2ZPB B;  1IZ6 A;  2D8H A;  2O01 E;  2NUT B;  2R5A A;  4AG2 C;  1BCM A;  2DD4 A;  2J6O A;  4M7D C;  4ZGJ B;  1U3O A;  1Q86 C;  1N8R R;  2P0K A;  2CDT A;  1WJS A;  4OMO A;  1D1B A;  1SEM A;  2E12 A;  4QT7 A;  1VQO T;  1KK7 A;  2OTJ A;  5LJ3 h;  1VQ7 Q;  4M75 A;  3CCQ T;  1YIT T;  3GBQ A;  4XTX A;  3VU3 C;  3M56 A;  2DYI A;  2MWO A;  1P92 A;  2A08 A;  1PC0 A;  3H0I A;  1JRI A;  4E7K A;  1UHF A;  5FU7 C;  2RM4 A;  3M0S A;  1VQ6 T;  3LGF A;  1GL5 A;  2JM8 A;  2ABL A;  2FYK A;  1RAF B;  4OGC A;  2KY9 A;  1OX9 A;  4ZTF A;  1KC8 R;  2H3E B;  1PRL C;  3CBM A;  2FZK B;  1QWF A;  2DJZ A;  4XK8 E;  4J9F A;  5M9O A;  5I21 A;  1Y07 A;  2JM9 A;  1OV3 A;  3CBP A;  1X43 A;  2ENM A;  2DBK A;  2HKQ B;  3O5Z A;  2A28 A;  1V76 A;  3DB3 A;  1UTI A;  2HBP A;  2F2X A;  2DET A;  4M77 E;  4C92 B;  2ZPH B;  1UGQ B;  1FYN A;  5A0G A;  3G7Z A;  2ZPE B;  1WI7 A;  1M27 C;  4C8Q D;  2E6N A;  1Y96 B;  1MMN A;  3OSV A;  2FPD A;  2L0A A;  3QZ9 B;  1JXO A;  3KUF A;  1N5Z A;  1M8M A;  2K5L A;  5IXB A;  2A0F B;  3TQ7 P;  1IRX A;  4JLG A;  3CCE Q;  1JB0 E;  3GP8 A;  3I56 T;  3CXC S;  1ZHI A;  4A54 A;  1I07 A;  5IAY A;  1VQO Q;  1BKB A;  3QYG B;  3QWY A;  2C06 A;  1UUE A;  4RUG A;  2PUO B;  2AHJ B;  4AFS C;  3CCR Q;  1OOT A;  1VQM A;  4PJO E;  1G5V A;  1T3L A;  3N5B B;  1I8F A;  1WHL A;  2L89 A;  2MAM A;  3D7S B;  1EIF A;  2J06 A;  3REA B;  4LE9 A;  4X34 A;  1QVG P;  1QP2 A;  5CQY A;  1VQ6 A;  5FLX E;  2KXD A;  3OQ5 A;  2FPF A;  2I0N A;  5GAN e;  2RQR A;  2QTV A;  1K9M R;  5IH2 A;  3CCU T;  2WSE E;  1VUB A;  3OW2 A;  4AT1 B;  4PLI A;  2GF7 A;  3JB9 H;  3RR6 A;  2LCC A;  4M75 D;  4PLL A;  2YXY A;  4OML A;  4C0G A;  1NEG A;  5I11 A;  5D6X A;  1BK2 A;  3VS7 A;  1UGR B;  4M77 G;  4ESR A;  4MDW A;  2VXE A;  4BI3 A;  3OYF A;  4NS5 A;  5GAN 4;  2PUK B;  3LW5 E;  1MND A;  3CCS T;  3RMQ A;  5LJ5 h;  5DY9 A;  1YJW Q;  1WIE A;  4PL6 A;  4IKF A;  1KD1 C;  2DIG A;  3R6N A;  3TSZ A;  2XK0 A;  2LCS A;  5CK9 A;  3H0F A;  1Q82 U;  1HYO A;  2JOY A;  4C92 C;  3H0H A;  3JCM g;  2FHD A;  2F5K A;  4MML A;  4GLM A;  4J9B A;  3MET A;  3JCM J;  1RUW A;  5AYF A;  4ZGE B;  1H8K A;  2OTJ Q;  1G3Y A;  4XTZ A;  1R0B G;  3CC4 Q;  4F7U A;  4PNO A;  1BCO A;  2ED1 A;  2OI3 A;  4JJC A;  4L5G A;  3E19 A;  3MEU A;  2R58 A;  1H64 1;  1G3T A;  1LOJ A;  3P8H A;  2QK0 A;  4OMF B;  2LVM A;  2CT3 A;  4M77 D;  2IPO B;  4RTY A;  3QZ5 B;  1PNJ A;  1X2K A;  5CO7 A;  2QG9 B;  3CCV Q;  3V8L A;  2DXU A;  4DBQ A;  3EGU A;  2EQU A;  3MEW A;  4Y91 A;  3G71 T;  4HKE A;  5KCO A;  4N4G A;  3T9N A;  2KDS A;  3G6E T;  4E7I A;  1ZA1 B;  2HSE B;  4MMK A;  4A53 A;  4AG1 C;  4FW1 A;  2JTE A;  5GAN d;  2VWF A;  1N9S A;  1JXM A;  3SB2 A;  1M3C A;  3LH0 A;  1O9S A;  3VJP A;  1B7T A;  3JB9 F;  2CZ7 B;  1OPK A;  1X6G A;  2AIR B;  3OYE A;  4A4G A;  4F04 B;  1M3A A;  1UGP B;  3LYI A;  2RQT A;  4JLI A;  5GAN 6;  1K4U S;  4HXJ A;  1VOM A;  2JZ2 A;  1VYV A;  1EZZ B;  2KVQ G;  1Q7Y R;  3M0Q A;  5CQX A;  3VS4 A;  3NPF A;  4Q5W A;  2X4J A;  2X3X D;  1FWZ A;  3QWX X;  3UA7 A;  2DL4 A;  4QW2 A;  4KT0 E;  5KYX A;  4PJO B;  4C8Q B;  1NLP C;  2HL5 C;  4IIO A;  3CBO A;  1YIJ Q;  5CKH A;  4DA4 A;  1AHJ B;  2EGC A;  1GBR A;  2J05 A;  2QQR A;  2MWP A;  1NYG A;  1K8A C;  1VYU A;  3JCM Q;  3MP8 A;  1YFN A;  3I55 Q;  2JN0 A;  2FO0 A;  1TOV A;  3L2W A;  3CC4 T;  3VUZ A;  2X51 A;  2ROL A;  3PE0 A;  1VQ9 T;  4RTZ A;  2L8D A;  4KRT A;  4J8O A;  4E7L A;  1WZO A;  2QI2 A;  2FPE A;  2JJ9 A;  3L1A A;  1BB9 A;  2NUT A;  3EG0 A;  4IUR A;  1AWO A;  1E7O A;  5GAM h;  4XU1 A;  4ZGD B;  4ZTJ A;  2YUN A;  2D8J A;  3SWN C;  3U23 A;  1YJ9 T;  7AT1 B;  5L23 A;  4LXC A;  2QQS A;  2X4W A;  1X6O A;  1WLP B;  4M7A C;  1M90 C;  2CP2 A;  3CD6 T;  1KQ2 A;  3HTR A;  3J81 E;  4NL3 A;  1QVG A;  2KR3 A;  3MHX A;  2RI2 A;  4PJJ A;  1Q82 C;  2O4X B;  1S72 Q;  2P84 A;  2RK2 A;  1IO6 A;  2DAQ A;  3P8B B;  1JBM A;  2GFA A;  1RAD B;  2KYB A;  3M9Q A;  3DB4 A;  4J7F A;  2XMF A;  3I56 Q;  3V7S A;  2EIF A;  4C92 E;  3CCU Q;  4V2S A;  2FZG B;  4ATO A;  1D3B B;  5GAN 5;  1BI1 A;  2DYB A;  2V8I A;  3HRS A;  3EH1 A;  2DK3 A;  1QLY A;  1RAA B;  4E7Z A;  1Q86 R;  3SHW A;  2QA4 T;  1VQN A;  2BKD N;  4QQG A;  3PVQ A;  3CCR T;  4LDV A;  2J7I A;  1YHQ T;  1WHG A;  2PVG B;  4PKC C;  2RB6 A;  4GBQ A;  3O8V A;  2JNG A;  1K0X A;  5IXF A;  1D0Z A;  5KYN A;  3BFM A;  3DLL A;  1LVK A;  2EYZ A;  1QMC A;  2QGG A;  3VV0 A;  1ZUY A;  2F5T X;  3EGX A;  4M78 C;  5KH6 A;  1RI9 A;  2LMJ A;  4RTX A;  5GAM d;  3ZEH A;  4C8Q C;  1GCQ C;  4CC2 A;  1NG2 A;  2K7A A;  1XJW B;  3OYB A;  4EMK B;  4J9H A;  2CKK A;  3TU4 K;  1M8V A;  2EBP A;  1QVF A;  2YUO A;  3WXM B;  1QVF S;  3RBB B;  2MPX C;  1WX6 A;  4RCB A;  1EX4 A;  2DTO A;  3EG9 B;  1I1J A;  2CH4 W;  2DRK A;  4Z02 A;  5IN1 A;  3X25 B;  3I55 A;  3FC3 A;  3CQT A;  3S3O A;  1C1A A;  3JCM e;  4FYY B;  5EC7 A;  3RKY A;  1Y71 A;  4QVZ A;  3ZFJ A;  1N27 A;  1JJ2 P;  1J3T A;  1AD5 A;  1V29 B;  1Y0M A;  5ECA A;  2KRO A;  3M55 A;  4M75 C;  5GAO r;  2Z0W A;  1QKX A;  1ABO A;  2CH4 A;  1YJN A;  3CC2 T;  4C92 F;  4M77 C;  3CD6 Q;  1HJD A;  3L2Q A;  4JUV A;  1YHQ Q;  2YHT A;  2DNU A;  3QII A;  1VQK Q;  3CXC A;  3OYL A;  1K8A U;  4JJN K;  5HKC A;  2G6F X;  3EFS A;  3RKX A;  3CMA T;  1ZBJ A;  4M7D D;  1IGU A;  1M90 R;  5GAN 2;  3C95 A;  2EYY A;  1U1S A;  1MMA A;  2YUP A;  1AOJ A;  1W70 A;  4D6W A;  1RAG B;  1AEY A;  2GFU A;  1VQL A;  2F2V A;  1F1B B;  1TXQ A;  2CP0 A;  1OZ2 A;  5FRM A;  1AZE A;  2SEM A;  3A8G B;  1RAC B;  4F7U G;  1WJQ A;  2VKN A;  1PKS A;  2KRN A;  2KI7 A;  5GJW B;  2NUP A;  3GLX A;  3CCJ Q;  3VS2 A;  3VS1 A;  2ZPF B;  4C8Q A;  4OB0 B;  3L2Z A;  5KE3 A;  2EJG A;  3X24 B;  3I5R A;  1PD1 A;  2FZC B;  2P4R A;  2ZZD A;  2K9G A;  5DM7 R;  2MYS A;  1M2O A;  1OPL A;  4ELZ C;  4M7A E;  3OMG A;  5LJ3 d;  4IUU A;  3X20 B;  2VYT A;  4X9C A;  2C0O A;  5KYU A;  3H6Z A;  1BIA A;  2E64 A;  2EYX A;  2K5F A;  4BUG A;  4F7U B;  1MV3 A;  2DXT A;  2LNV A;  1AWJ A;  1W4S A;  3CC4 A;  2RJE A;  1H3H A;  3CCS Q;  1NPR A;  2CP6 A;  1VQP T;  4MDX A;  2EGA A;  5FWC A;  2K6D A;  2COZ A;  3M0P A;  3C0C A;  3CC7 Q;  4R0K A;  3WVD B;  2EQK A;  2MMP A;  2M16 A;  3RIR A;  5LJ5 d;  2DL3 A;  4J9G A;  1VQ5 T;  3TCJ A;  2LQK A;  5KYY A;  2OTL Q;  4M7A A;  4A4F A;  5GAN g;  2DL8 A;  2YRC A;  5L8R E;  4PJO A;  1ABQ A;  4HVV A;  4DBR A;  1FXX A;  2YRV A;  2GGR A;  3CCM A;  4BDY A;  2EQM A;  1UHC A;  2KBT A;  4J83 A;  3CC2 A;  1R77 A;  5GMK i;  3JCM h;  1KIK A;  1HK9 A;  2DXC A;  2FRY A;  4OMM A;  1EFN A;  1FMW A;  5GAO m;  3I9Q A;  2JTF A;  4PJO D;  1N8R U;  3CMA Q;  1RAE B;  1VQ7 T;  3FJ5 A;  1D3B A;  2RJF A;  1YJN Q;  2M02 A;  3FJP A;  3X26 B;  2PVO B;  2CT4 A;  2DEU A;  4RCC A;  3AHU A;  2QGF B;  3QPH A;  3G71 Q;  4PJN A;  5GAM g;  1VQO A;  2MI6 A;  3OYJ A;  3CC2 Q;  5FRN A;  1D09 B;  2K2M A;  2ZPI B;  2GQV A;  1YJ9 Q;  2NYS A;  1NEB A;  3M4G A;  1MGQ A;  1H92 A;  4KGV B;  4RKU E;  2PQW A;  8ATC B;  5LJ3 e;  4O5V A;  3OYC A;  4X1V A;  2RQW A;  1ZBX A;  3NMZ C;  3C94 A;  1S72 T;  3E9G A;  4LUD A;  1NBE B;  1VQ6 Q;  4N0A A;  1Q7Y C;  4M75 E;  2RHI A;  2ESW A;  4R56 A;  1VQ8 T;  2AKK A;  4JPB W;  3SFM A;  2KQW A;  2YLB A;  1GFD A;  5GAN 8;  2FVU A;  4WF2 A;  1Y57 A;  1ZSZ A;  3CCJ A;  3JB9 I;  4FSX A;  4Y28 E;  1WDX A;  1MUZ A;  3QKJ A;  3WVE B;  2DKG A;  3HRU A;  1KD1 R;  2O31 A;  3LGL A;  2F2W A;  3V7C A;  4D8K A;  2LX7 A;  1Q82 R;  2BUD A;  3FRN A;  3Q1J A;  2L5Q A;  4XQ3 A;  2X4Y A;  4LN2 A;  4F14 A;  1JQQ A;  5A0L A;  4RTV A;  2JVV A;  1GFC A;  2D9T A;  3M0T A;  4M7A G;  3EG9 A;  1YWO A;  3A5Z B;  1E6H A;  1UG1 A;  4ORZ A;  3QHS A;  4B9X A;  3PFS A;  1HD3 A;  4PFZ A;  3CXC P;  2QAS A;  2QEX Q;  1WHH A;  3KFV A;  3CCL T;  2EQJ A;  4C0Z A;  1AZG B;  1D0X A;  4LD6 A;  3J7A F;  1Q86 U;  2WSF E;  1ZA2 B;  5KE2 A;  5C0M A;  1GCP A;  3EG1 A;  3H9N A;  3MEV A;  5IHN A;  4E2F B;  2YRD A;  3JV3 A;  4HCC A;  1OZ3 A;  2HQE A;  1B34 B;  1ACM B;  2K57 A;  2K5I A;  2MOX A;  3P8D A;  1VQ9 A;  1AVZ C;  4FL6 A;  4M78 D;  2JMC A;  3CMA A;  1W1F A;  1VQ4 T;  2JUF A;  1A0N B;  3URG A;  2RHY A;  2A37 A;  2DZC A;  3EFR A;  5CVI A;  2KXC A;  3NFC A;  2YSQ A;  4ANJ A;  2VVK A;  1JJ2 S;  5HY6 A;  4OMQ A;  3VYG A;  1UFF A;  1O75 A;  4XTV A;  5GAO n;  3M59 A;  3PGG A;  2KGT A;  5LJ5 j;  1DJ7 B;  1SSH A;  1YJW T;  5GAN h;  1UEC A;  1N8R C;  3CPF A;  2OJ2 A;  5LJ5 g;  4A63 B;  4CC3 A;  1K73 U;  4M7D A;  3I35 A;  2CZ1 B;  1WA7 A;  2LQW A;  2D6F A;  3A98 A;  1C6V X;  3NTK A;  3DKM A;  5GAN 7;  3KBG A;  3L2V A;  1Z9Q A;  3CCM T;  1QVG S;  1ZLM A;  4M78 A;  2VAS A;  4JRP A;  1NJI U;  3CPW P;  2GTO A;  2RQU A;  3G71 A;  1K0S A;  3H8Z A;  4J9D A;  2IIM A;  1ZUK A;  3MJX A;  4WCI A;  5FWB A;  1SHF A;  2JS2 A;  2CP3 A;  2XHC A;  4JJB A;  1G83 A;  2ZCF B;  3OS0 A;  1I0C A;  2QYZ A;  3HRT A;  3RER A;  1QVP A;  4BE1 A;  5GMK h;  1KG1 A;  1CSK A;  1IHV A;  3F70 A;  3EHQ A;  3OY9 A;  3OYA A;  3RES A;  1YJN T;  1VQ4 Q;  2QDY B;  3HP9 A;  2OTL T;  4XTW A;  3PIO A;  2K4Y A;  2B86 A;  1VQM T;  5D6Y A;  1LNX A;  1QCN A;  5FRO A;  4F7U E;  3CCR A;  4IUV A;  2O88 A;  1QCF A;  2RJC A;  2RI3 A;  2BZX A;  3M53 A;  1ZX6 A;  1R8O B;  1WGS A;  2DFU A;  5KYW A;  2COY A;  1BU1 A;  3OYI A;  3RUX A;  3CCL A;  1SG5 A;  4PJL A;  2VGN A;  1X6B A;  2BTT A;  1G3W A;  4LDY A;  4N0A C;  3A8H B;  1GCQ A;  4HVU A;  4DOW A;  1D1C A;  3MEA A;  1I5O B;  4CI0 C;  4XTY A;  4M7D G;  2LT1 A;  1D0Y A;  3CME T;  2G3R A;  4AFZ C;  2CGH A;  2M51 A;  2AT1 B;  4IIM A;  2DX1 A;  4HVW A;  2EKH A;  3NTH A;  2K3Y A;  2NUZ A;  4QVC A;  3NTI A;  9ATC B;  3A8O B;  3L42 A;  1K8A R;  1TUC A;  4NL2 A;  3UPU A;  5AT1 B;  2AZV A;  2CUB A;  4RG8 A;  1VQ8 Q;  3JCM W;  4FYX B;  2K3X A;  4C0F A;  1S1N A;  2JS0 A;  2ECZ A;  3EAE A;  5GMK j;  4DQ2 A;  2Y90 A;  3EH2 A;  1GXI E;  5GAM f;  5GAM e;  2VGM A;  1XNI A;  1RAH B;  1W2B S;  2HAX A;  1VQ8 A;  5GAM j;  1BBZ A;  2J6F A;  1Q81 R;  4FU6 A;  4X9D A;  2V26 A;  1U5S A;  4ZNX A;  3OYG A;  1VQP A;  3A8M B;  4KBM B;  2XG8 D;  3ER0 A;  3EFO A;  3CCM Q;  2GNC A;  4J9E A;  2RD1 A;  3BY7 A;  2DA9 A;  1Q95 G;  2HDA A;  3HPW A;  4FYW B;  3MO8 A;  3RNJ A;  1TUD A;  4RTU A;  1IHW A;  3R6O A;  1NLO C;  3OYY A;  2DRM A;  1VQM Q;  3E9F A;  3MP6 A;  2C0T A;  5GAN f;  4TVR A;  1K1Z A;  1K9M U;  1M2V A;  4OF1 A;  1I4K 1;  1QWE A;  2E4H A;  4NOY A;  2QXF A;  4JRQ A;  4BY6 B;  5D7U A;  4FT4 A;  2DF6 A;  4M77 F;  1HXD A;  2LQ8 A;  2QQA A;  4M7D E;  1QW1 A;  2QDL A;  2V1R A;  3JCM X;  1ZUU A;  2O4X A;  2A7Y A;  2E6Z A;  2LRQ A;  3JCM f;  3QJ6 A;  1YWP A;  2QEX T;  3CCL Q;  2KAF A;  3JSC A;  4JRI A;  2LQN A;  3BDU A;  2MCN A;  1B34 A;  5FU6 C;  3UWN A;  4BI4 A;  2X9H A;  3JB9 D;  1AWW A;  1M1K R;  4ZN1 A;  1NE8 A;  5IHI A;  2HD0 A;  1G3S A;  3OA6 A;  3VKI A;  2RA2 A;  4C0D B;  3ASK A;  3OYH A;  1OUL A;  1B3Q A;  4MZM A;  4UC4 A;  1WHM A;  3JRZ A;  2HKN A;  1I5L A;  5KYU B;  1R0C B;  1TWB A;  2L3S A;  1X69 A;  1M4Z A;  2ED0 A;  3OBY A;  4PFO A;  1M1F A;  5LL6 S;  3J80 E;  4ZN3 A;  1U06 A;  4VUB A;  3OYM A;  1W2B A;  2YUQ A;  3V8J A;  3RMS A; 
#chains in the Genus database with same CATH homology
 3S3M A;  3I56 A;  2MI6 A;  3OYJ A;  1KD1 C;  4IUT A;  2DIG A;  4M78 B;  2RH2 A;  4C5G A;  1VQK A;  5FRN A;  2GCX A;  4HT8 A;  2XK0 A;  4QQ6 A;  3M57 A;  4EDU A;  4N4H A;  4M78 F;  5CK9 A;  4A4H A;  2ZPI B;  1Q82 U;  2JOY A;  4C92 C;  2GQV A;  2EKO A;  3JCM g;  2FHD A;  4GY5 A;  1KC8 U;  2DZ9 A;  2F5K A;  4MML A;  2DTI A;  2R5M A;  2RHX A;  3MET A;  3JCM J;  5D6W A;  4A4E A;  4C5E A;  1M9S A;  5J26 A;  1YBY A;  3M4G A;  4DOV A;  5AYF A;  3OS1 A;  1K9M C;  4KUD K;  4ZGE B;  4PL6 A;  1MGQ A;  3OMC A;  1G3Y A;  4XTZ A;  3CCJ T;  5CAI A;  1VQ4 A;  4RKU E;  2PQW A;  4F7U A;  4PNO A;  5LJ3 e;  3FIF A;  4O5V A;  3OYC A;  4CRI A;  1WQW A;  1ZBX A;  3HL8 A;  2EJF A;  4L5G A;  3SD4 A;  3E19 A;  3C94 A;  3MEU A;  3QYH B;  4QQD A;  3E9G A;  4C5I A;  2R58 A;  4C92 A;  5LJ5 f;  1H64 1;  5LJ5 e;  4EMK C;  3KXT A;  3S3N A;  4N0A A;  1G3T A;  1LOJ A;  3P8H A;  1YIJ A;  4M75 E;  2RHI A;  4OMF B;  3TEE A;  1Q7Y C;  1NJI C;  3QG1 A;  4R56 A;  1VQ8 T;  3PNW C;  4II1 A;  3JCM b;  3CPW S;  3SFM A;  2LVM A;  2KQW A;  4M77 D;  4PJO G;  1VQO A;  2YLB A;  1KQ1 A;  5GAN 8;  4XTU A;  4EMH A;  1NPP A;  1KQS A;  3QZ5 B;  4ELY C;  2CZ0 B;  3MP1 A;  5J3B A;  2FVU A;  4WF2 A;  5CO7 A;  3VUB A;  1N9R A;  2DXU A;  3V8L A;  3CCJ A;  3JB9 I;  2EQU A;  2XDP A;  3MEW A;  3PMT A;  4FSX A;  4HKE A;  4Y91 A;  4BI8 B;  5KCO A;  3G71 T;  4HT9 A;  2CZ6 B;  4N4G A;  4P5N A;  2KDS A;  4Y28 E;  3T9N A;  2RJD A;  3G6E T;  1S72 A;  5J39 A;  4E7I A;  4HA8 A;  3QKJ A;  3WVE B;  3L2R A;  2DKG A;  3HRU A;  3QSU A;  4JRK A;  5FU7 B;  3HKS A;  4MMK A;  2EWN A;  3LGL A;  4A53 A;  4HCB A;  3V7C A;  2HQX A;  1ZQ1 A;  3X28 B;  3GNG A;  3JB9 J;  1N6A A;  5GAN d;  4M7A D;  1N9S A;  5CKF A;  3CC7 T;  5HK0 A;  2EJ9 A;  3SB2 A;  2BUD A;  4M78 G;  2NLU A;  3FRN A;  3Q1J A;  3LH0 A;  1O9S A;  2L5Q A;  4J7I A;  4XQ3 A;  2X4Y A;  3VJP A;  3JB9 F;  2CZ7 B;  3L2U A;  1KHI A;  1Y96 A;  3CCQ A;  5A0L A;  3PMI A;  4L59 A;  2I2L A;  3OYE A;  5HK3 A;  1VQK T;  1VQ7 A;  4A4G A;  4M75 B;  2JVV A;  1M5Q 1;  2D9T A;  1UGP B;  2CS7 A;  3LYI A;  2V8J A;  4JLI A;  5FU6 B;  3RKW A;  5GAN 6;  5LJ3 f;  4M7A G;  3FDR A;  5GMK e;  4M77 B;  2QQB A;  5GMK m;  3OSS C;  2JZ2 A;  4N4I A;  3A5Z B;  2KVQ G;  2ZGW A;  3QPH A;  4J6Y A;  3GOX A;  5CQX A;  3QDR B;  4M75 F;  2E65 A;  5CR2 A;  3QHS A;  1M1K C;  2KMT A;  2X4J A;  4Q5W A;  3HSB A;  4B9X A;  4IUQ A;  3PFS A;  3GPL A;  1BYM A;  2XU8 A;  3PT9 A;  1FWZ A;  2LCL A;  4BE0 A;  2RHU A;  4OP0 A;  3CCL T;  4RG2 A;  2EQJ A;  2EAY A;  4C0Z A;  4EPC A;  1UGS B;  4LD6 A;  2WAC A;  4KT0 E;  4QW2 A;  1VQL T;  4PJO B;  4C8Q B;  3J7A F;  1Q86 U;  1YHQ A;  2WSF E;  3CCU A;  5KE2 A;  5C0M A;  2OAU A;  3MEV A;  4XU0 A;  2IG0 A;  3CBO A;  4HCC A;  3CEY A;  5LJ3 j;  5CKH A;  4DA4 A;  1OZ3 A;  1AHJ B;  1B34 B;  2HQE A;  2K57 A;  2K5I A;  3MCA B;  2VXF A;  2Y4Y A;  3OYN A;  3V8K A;  3P8D A;  5GAO q;  1VQ9 A;  2K2V A;  4FL6 A;  4M78 D;  4M7D B;  2QQR A;  3CMA A;  2MWP A;  4GLK A;  1VQ4 T;  1K8A C;  3CCV A;  2JUF A;  5A2Q E;  3JCM Q;  4E47 A;  5A0D A;  3M5A A;  3URG A;  2KSS A;  3MP8 A;  2RHY A;  2DZC A;  2JN0 A;  1JJ2 A;  3EFR A;  5CVI A;  2DPP B;  3NFC A;  4C92 D;  2XDD A;  1YI2 A;  4LDX A;  1JJ2 S;  5HY6 A;  3L2W A;  1S72 T;  2IVW A;  3CC4 T;  5DLO A;  2M9U A;  3VUZ A;  3VYG A;  4MZT A;  1O75 A;  1I81 A;  1XTD A;  4PJO F;  2FB7 A;  4XTV A;  2QA4 A;  1VQ9 T;  1VQN T;  4BY6 C;  2L8D A;  3OW2 S;  1BI2 A;  3OB9 A;  4J8O A;  4E7L A;  3E1S A;  5GAO n;  2QI2 A;  3M59 A;  3PGG A;  1BI0 A;  5LJ5 j;  4LD9 K;  1YCY A;  2E1H A;  2LTO A;  4KUI A;  3OS2 A;  1DJ7 B;  1WJR A;  1YJW T;  1UB4 A;  3DLM A;  2E70 A;  2RHZ A;  3V7R A;  4BD3 A;  3GNF B;  3L1A A;  5GAN h;  2PVD B;  3LLR A;  4IUR A;  5GAM h;  4FIB A;  4XU1 A;  4E7J A;  4ZGD B;  3CCE T;  4ZTJ A;  1RL2 A;  3CPF A;  3QBY A;  2WSC E;  4XAX B;  1N8R C;  5LJ5 g;  2P4T A;  3SWN C;  1K73 U;  4M7D A;  2DIQ A;  1YJ9 T;  2CZ1 B;  3QJY A;  2OTJ T;  2QQS A;  3HFO A;  3HFN A;  2D6F A;  2DD5 A;  2X4W A;  4J6W A;  4C8Q F;  2DXB A;  3NTK A;  4LDU A;  3DKM A;  5GAN 7;  3CME A;  1VIE A;  3KBG A;  2E5Q A;  3L2V A;  1X6O A;  4L6V 5;  3UDC A;  4FT2 A;  3S6W A;  1M90 C;  2XI9 A;  2DTH A;  3CCM T;  1QVG S;  1NZ9 A;  4C5H A;  4M7A C;  4M78 E;  3CD6 T;  1KQ2 A;  3J81 E;  4NL3 A;  4RMO A;  1QVG A;  4BAC A;  3M54 A;  3MHX A;  1XQH A;  4M78 A;  5CCA A;  4JRP A;  1Q7Y U;  2RI2 A;  2RI5 A;  1NJI U;  2M1H A;  2O4X B;  1Q82 C;  4C8Q E;  4OB2 B;  2RK2 A;  4JS5 A;  3SWN A;  2DAQ A;  3P8B B;  1JBM A;  2GFA A;  3FB9 A;  3M9Q A;  3DB4 A;  2D0Q B;  3G71 A;  4J7F A;  1H3Z A;  2F69 A;  4V2S A;  3V7S A;  1BIB A;  2EIF A;  4XU2 A;  3H8Z A;  4C0D C;  4C92 E;  3CCV T;  2HNI A;  3JAM E;  4ATO A;  5CKE A;  1D3B B;  2VV5 A;  4M75 G;  5GAN 5;  1BI1 A;  5LJ3 g;  2QQ9 A;  2EYQ A;  4A4K A;  2V8I A;  3HRS A;  4BB7 A;  2DK3 A;  2DVE A;  2XHC A;  3JCM P;  4ME7 A;  4F7U F;  3CPW A;  1SSF A;  4MZP A;  3C12 A;  3FLG A;  2ZPG B;  2ZCF B;  2QA4 T;  3OS0 A;  1VQN A;  1KQS S;  2BKD N;  3HRT A;  2RK1 A;  4QQG A;  3CCR T;  3RER A;  1QVP A;  4BE1 A;  4LDV A;  5GMK h;  1KG1 A;  5I2M A;  1YHQ T;  4EMK A;  2PVG B;  4JS4 A;  3F70 A;  4PKC C;  3OY9 A;  3OYA A;  1YI2 T;  3RES A;  2X4X A;  1YJN T;  2RB6 A;  1Q81 C;  2QDY B;  3HP9 A;  3QUI A;  3O8V A;  4XTW A;  3ZBD A;  2JNG A;  4EMG A;  3PIO A;  2OTL T;  3BDL A;  3JCM d;  5GAO l;  1LJO A;  3BFM A;  3QXE B;  1KD1 U;  2K4Y A;  3GIB A;  4OB1 B;  3DLL A;  1VQM T;  4M7A F;  5D6Y A;  1LNX A;  3VV0 A;  5FRO A;  5IT9 E;  2F5T X;  4JDS A;  3VYH B;  4F7U E;  3CCR A;  4M78 C;  4IUV A;  5KH6 A;  3OS5 A;  5GAM d;  2RJC A;  2XDB A;  2P0Q A;  3PIP A;  1YIJ T;  3ZEH A;  2RI3 A;  3JCM V;  5I2S A;  1KC8 C;  4YTL A;  1PSF A;  4C8Q C;  2MF2 A;  3M53 A;  4OB3 B;  4OGE A;  2X35 A;  2XKO C;  1R8O B;  4IUP A;  3LWH A;  1WGS A;  3INZ A;  3SDZ A;  1VIF A;  4KUL A;  2LX9 A;  4XU3 A;  3OYB A;  4EMK B;  3LWI A;  5CIU A;  3OYI A;  4C8Q G;  3RUX A;  5GAN 3;  2M0O A;  2CKK A;  2ZPB B;  1IZ6 A;  2O01 E;  3TU4 K;  3CCL A;  1M8V A;  2R5A A;  2VGN A;  3I55 T;  1QVF A;  4B9W A;  1G3W A;  2DD4 A;  4LDY A;  3WXM B;  3M4Y A;  4M7D C;  3CC7 A;  4ZGJ B;  1QVF S;  4N0A C;  3A8H B;  5GAO p;  1U1T A;  4BE2 A;  3TRE A;  2VC8 A;  4DOW A;  4RCB A;  3MEA A;  2DTO A;  4CI0 C;  1Q86 C;  2P0K A;  4XTY A;  4M7D G;  2LT1 A;  1WJS A;  3CME T;  3HHT B;  2G3R A;  2CGH A;  3A8L B;  2E12 A;  4Z02 A;  5IN1 A;  1VQO T;  5GMK l;  3OYD A;  3NTH A;  2OTJ A;  2K3Y A;  3FEO A;  2LC4 A;  5LJ3 h;  3X25 B;  3OYK A;  4M75 A;  3NTI A;  4QVC A;  3I55 A;  3FC3 A;  2E41 A;  3CCQ T;  1YIT T;  3S3O A;  4XTX A;  3A8O B;  3L42 A;  1XOV A;  3VU3 C;  2P0P A;  3M56 A;  3G6E A;  2XID A;  2MWO A;  1VQ5 A;  4NL2 A;  3JCM e;  3UPU A;  1P92 A;  3PTA A;  3LX7 A;  1JRI A;  4E7K A;  5FU7 C;  2RM4 A;  4J5Y A;  3RKY A;  1Y71 A;  3GF5 A;  4QVZ A;  3ZFJ A;  4RG8 A;  1N27 A;  2KK4 A;  3JCM W;  2JTM A;  1VQ6 T;  1V29 B;  3LGF A;  3M55 A;  4M75 C;  5GAO r;  2K3X A;  4C0F A;  1YJN A;  3CC2 T;  5CKD A;  4C92 F;  2FYK A;  4OGC A;  3EAE A;  5GMK j;  2KY9 A;  4M77 C;  2PU9 B;  3L2Q A;  4DQ2 A;  4ZTF A;  4JUV A;  2Y90 A;  3CBM A;  2YHT A;  3QII A;  2DJZ A;  4XK8 E;  3OYL A;  5KCH A;  5GAM f;  1TH7 A;  3CXC A;  1K8A U;  1GXI E;  5GAM e;  5M9O A;  2VGM A;  5I21 A;  4JJN K;  1XNI A;  1Y07 A;  3ME9 A;  5HKC A;  3CBP A;  3RKX A;  3EFS A;  1W2B S;  2VUB A;  1KHC A;  5GAN j;  2HAX A;  3CMA T;  4M7D D;  2QTX A;  1VQ8 A;  2DEQ A;  3DB3 A;  5GAM j;  2HBP A;  4M77 E;  5GAN 2;  4FU6 A;  4PJO C;  3C95 A;  4X9D A;  2E10 A;  3OYG A;  4M77 A;  4C92 B;  4E7H A;  1VQP A;  2ZPH B;  1UGQ B;  1U1S A;  2LDM A;  3A8M B;  4LDW A;  5A0G A;  4KBM B;  3QO3 A;  2XG8 D;  3ER0 A;  3CD6 A;  3G7Z A;  2ZPE B;  4D6W A;  2RD1 A;  2L3R A;  4C8Q D;  3BY7 A;  2B8A A;  2E6N A;  1Y96 B;  2GFU A;  3OSV A;  5CKB A;  1VQL A;  3HPW A;  3MO8 A;  3QZ9 B;  1OZ2 A;  3KUF A;  5FRM A;  3R6O A;  3OYY A;  1M1G A;  3A8G B;  3E9F A;  4F7U G;  3MP6 A;  2K5L A;  1WJQ A;  1WNL A;  5GAN f;  4TVR A;  4JLG A;  3JB9 G;  1OYX A;  2EFI A;  3GLX A;  1JB0 E;  3M58 A;  1K9M U;  2ZPF B;  4C8Q A;  3GP8 A;  4OF1 A;  3I56 T;  3CXC S;  4OB0 B;  1ZHI A;  1I4K 1;  4A54 A;  3L2Z A;  5KE3 A;  2EJG A;  1YJW A;  4NOY A;  4C92 G;  2QXF A;  4J6X A;  4QVD A;  4BY6 B;  5IAY A;  1Y7X A;  3CCS A;  4JRQ A;  3X24 B;  1BKB A;  3QYG B;  2YLC A;  3G4S A;  1X01 A;  2ZZD A;  3JCM c;  2C06 A;  5DM7 R;  2R57 A;  5EG2 A;  4FT4 A;  2V8K A;  4M77 F;  4ELZ C;  2PUO B;  2AHJ B;  3OMG A;  4M7A E;  5LJ3 d;  2CYZ B;  2LT4 A;  1HXD A;  2LQ8 A;  4IUU A;  4O6J A;  3X20 B;  2VYT A;  4X9C A;  1VQM A;  4PJO E;  1G5V A;  2XIC A;  3H6Z A;  2QQA A;  1BIA A;  4R55 A;  2E64 A;  3N5B B;  2DO3 A;  2RO0 A;  1Q81 U;  4M7D E;  1QW1 A;  1I8F A;  2A3L A;  2OTL A;  3JCM X;  2K5F A;  3OBW A;  1WQ7 A;  4BUG A;  4F7U B;  2L89 A;  3SWN B;  1BI3 A;  2DXT A;  2LNV A;  2O4X A;  2A7Y A;  1W4S A;  2E6Z A;  3CC4 A;  2LRQ A;  2RJE A;  3JCM f;  2MAM A;  3QJ6 A;  1RI0 A;  1EIF A;  1M1K U;  1OI1 A;  2QEX T;  1NPR A;  4X34 A;  1VQP T;  4MDX A;  2KAF A;  3JSC A;  4JRI A;  1QP2 A;  5CQY A;  3BDU A;  1VQ6 A;  1U8R A;  4M7A B;  5FLX E;  3WVD B;  1B34 A;  1FX7 A;  2EQK A;  2MMP A;  5FU6 C;  2M16 A;  3OQ5 A;  3UWN A;  4BI4 A;  4BDZ A;  3JB9 D;  3RIR A;  5LJ5 d;  2FL7 A;  4FM4 B;  1VQ5 T;  3TCJ A;  4ZN1 A;  1NE8 A;  2LQK A;  1M90 U;  4M7A A;  4A4F A;  5GAN g;  2HD0 A;  1G3S A;  2H3J A;  3OA6 A;  3G4S T;  5GAN e;  3VKI A;  5L8R E;  1PSE A;  3BW1 A;  2RA2 A;  4C0D B;  2QEX A;  1YIT A;  4PJO A;  3ASK A;  3UT1 A;  3OYH A;  1FXX A;  2YRV A;  4OVA A;  2WSE E;  3CCU T;  1QP3 A;  1VUB A;  3CCM A;  4BDY A;  3OW2 A;  2EQM A;  4MZM A;  4J83 A;  4UC4 A;  3CC2 A;  4PLI A;  2GF7 A;  3JCM h;  5GMK i;  3JB9 H;  3JRZ A;  2LCC A;  2XD0 A;  1HK9 A;  2DXC A;  4M75 D;  4PLL A;  1IRE B;  1I5L A;  1WPY A;  3C4S A;  4C0G A;  1UEB A;  5D6X A;  5C6S A;  5DLQ E;  1M4Z A;  5GAO m;  1YJ9 A;  1UGR B;  2JTF A;  4M77 G;  4PJO D;  4MDW A;  1N8R U;  2VXE A;  4BI3 A;  3OYF A;  2BIV A;  4NS5 A;  5GAN 4;  3OBY A;  3CCE A;  1M1F A;  2PUK B;  3LW5 E;  1K73 C;  1VQ7 T;  4M7D F;  1D3B A;  2RJF A;  3FJP A;  5LL6 S;  3X26 B;  2PVO B;  3J80 E;  3CCS T;  4ZN3 A;  4HCZ A;  4RCC A;  3RMQ A;  4VUB A;  3OYM A;  1W2B A;  1MHN A;  5LJ5 h;  5DY9 A;  3AHU A;  2Y4X A;  1X75 C;  4IKF A;  3V8J A;  3RMS A;  5GAM g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...