1H641

Crystal structure of the sm-related protein of p. abyssi: the biological unit is a heptamer
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDNVLAISPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Pyrococcus Abyssi Sm Core and its Complex with RNA.Common Features of RNA Binding in Archaea and Eukarya
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Sm-like protein
molecule keywords SNRNP SM-LIKE PROTEIN
total genus 13
structure length 71
sequence length 71
chains with identical sequence 2, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2001-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1h64100
1WPYA 4C92E 4EMGA 2E64A 1TH7A 3INZA 4EMHA 5LJ5h 3JCMQ 1HXDA 4M78B 4MMKA 3FJPA 5LJ3j 3JCMP 5GMKj 4M75G 5LJ3f 2RD1A 4F7UA 4HT8A 4M7AE 4XTXA 4J6WA 5GAOp 2RB6A 3HFNA 4M7AB 4C8QB 4M77C 4N0AC 4NOYA 1B34B 4M77A 4N0AA 3FB9A 4M7DD 3RERA 4XU0A 4C92A 4JRKA 1YCYA 4M77F 1U1SA 3RUXA 2I2LA 3SB2A 4Y91A 1KQ2A 2DTOA 3JCMf 5GANg 4QVDA 3JB9H 4M7AA 4M7DE 3RKYA 5GAN6 4RCCA 1D3BB 1I4K1 2DXTA 4XU1A 4F7UG 5GAOn 4HA8A 4JRIA 4PJOF 3SWNC 4M75C 5GMKh 3QSUA 4M7DC 4XU2A 2QTXA 3V7CA 4M77D 1B34A 4QVCA 5GMKl 4XTYA 3SWNA 5GAMg 3JB9F 3V8KA 4NL3A 4M7DF 4PJOC 5GAN7 4PJOE 4M78A 4EMKA 2E1HA 3HFOA 2DEQA 4M77E 2DTHA 5GAMd 1WQ7A 2CGHA 1N9RA 1WNLA 1X01A 2EJGA 2RM4A 3EFSA 5GMKm 3JCMe 4OP0A 3RKXA 4J5YA 4XTZA 3V7SA 4C8QF 3JCMc 5GAN8 1M5Q1 3BDUA 3PGGA 5GMKi 4M7AD 4M75A 4JLIA 2VC8A 4MMLA 5GAMh 3VU3C 3HSBA 4XTUA 3JB9J 2DJZA 3L2ZA 3JCMh 2E41A 1LNXA 4M75E 1BIAA 2Y90A 4C92B 4PJOA 2DKGA 2E65A 3BFMA 2VXFA 4X9DA 1HK9A 3JCMW 2EWNA 4J6YA 4C92C 5GANh 5LJ3d 3FIFA 4A54A 2YHTA 5GAOl 5GANd 4M78E 3JCMX 5GANe 1KQ1A 4C92D 4WF2A 4C8QE 5GAN4 4C92G 4M78C 5LJ3g 4M7AF 1D3BA 5GAN5 4C8QA 2YLCA 4NL2A 3JB9I 4A53A 4XU3A 4C8QD 5LJ5d 1M8VA 5GANf 3BW1A 5LJ5f 5LJ5e 5GAMe 2DZCA 3JCMJ 4M78F 3BY7A 3QO3A 4PJOG 5LJ3h 3V7RA 5GAOr 4M7AC 2EJFA 5LJ5g 1U1TA 1MGQA 2YLBA 3JB9D 2ZGWA 4M7DG 5I21A 4M75F 1WQWA 1LOJA 1JRIA 2K57A 4XTVA 3RESA 4V2SA 1Y96A 3JCMV 4PJOD 5LJ5j 2DXUA 4M7DB 3L1AA 2JN0A 3SWNB 2DVEA 2EJ9A 2E10A 3M4GA 4M75D 3V8LA 5GAMf 4F7UE 1Y96B 5GMKe 2FYKA 4J6XA 4JUVA 4DQ2A 5LJ3e 2FB7A 4PJOB 4EMKB 4F7UB 2HNIA 4M77G 5GANj 3JCMg 1I8FA 4C8QC 3QHSA 4EMKC 5GAOm 4M78D 3JCMb 4M77B 5GAN3 1BIBA 1N9SA 3RIRA 4F7UF 3JCMd 3QUIA 3AHUA 2DTIA 2VXEA 4XQ3A 1I81A 1H641 3JB9G 2RA2A 5DY9A 4C92F 4M7AG 5GAN2 3GIBA 3RKWA 2EAYA 5CAIA 1LJOA 3V8JA 4M75B 4X9CA 1JBMA 3EFRA 5GAMj 4XTWA 4M78G 4RCBA 4C8QG 2DZ9A 4PNOA 5GAOq 1I5LA 4HT9A 4M7DA
chains in the Genus database with same CATH superfamily
1OX9A 1BI2A 3JSCA 2VUBA 4MMKA 3LLRA 2I0NA 2DPPB 3NTKA 4M7AB 4M77C 4RTWA 2AHJB 4N0AA 3M53A 1D0ZA 1HSQA 4BE2A 3RERA 4DEYA 4KH0B 1GFDA 1JB0E 3DB4A 1K76A 4JS5A 1Q82C 3NGPA 1G3WA 1Y0MA 4XU1A 4D8KA 4FYYB 6AT1B 2JM9A 3EAEA 1MHNA 4TVRA 1ZUUA 2O4XA 4PJOC 1KQSP 2RI5A 4E7KA 1QKXA 4GLKA 3UATA 5J39A 4C8QF 2QASA 4F14A 5GAMh 3H41A 1YJ9Q 3HHTB 2EIFA 1NPRA 2HL3A 4Q5WA 1I5OB 2GGRA 2K2VA 2J6KA 2XDBA 1S72T 1KJWA 1UB4A 4WF2A 1SRLA 3FDRA 3OYEA 1JJ2P 3AT1B 3JB9I 2RHXA 2ABLA 4OB2B 4BDYA 2D0NA 1EZZB 4DBRA 2DZCA 3V7RA 1K8AR 4E6RA 3NTIA 3CC4A 2PVOB 3OQ5A 2RJFA 4XTVA 1G5VA 4GY5A 2KBTA 3SWNB 5IT9E 1QLYA 3M4GA 2YUQA 4PFOA 4N4GA 3DKMA 2QDLA 1TOVA 3CXCA 3CPWS 1U06A 2FPFA 3JCMd 4PLIA 2KEAA 4XQ3A 3GOXA 4PKCC 4RTUA 2CSIA 3ASKA 2CKKA 4ZNXA 3GIBA 3OYHA 3CD6T 2L3PA 4M75B 2H8HA 3NMZC 1I5LA 1NG2A 1SHFA 1HJDA 2DFUA 5DLOA 2DL7A 5KYNA 4R55A 4HCCA 2M9UA 4J6WA 2ROTA 4DA4A 3MPUB 2JM8A 1M90U 2DYBA 2DL5A 1NEBA 2LT4A 2JTFA 2RJDA 4FT2A 2L2PA 4HKEA 2RQRA 2F2WA 4A4GA 2DE0X 2MYSA 5GANg 2DL3A 4FL6A 3OW2A 4OMOA 5GMKl 4OB3B 4J9IA 2CUBA 1WNLA 1E6GA 3QZ5B 5KYXA 4XTZA 5GAN8 3PVQA 2XK0A 2V26A 1YITT 2H3EB 1UHCA 2ZPFB 3CCQT 3CCRA 4A54A 4IIMA 2VB6A 1AWOA 5GAOl 3VS4A 2CT3A 2WACA 2X4JA 4JZ4A 2HQHA 4A53A 2RHUA 2J05A 4LDVA 2DVJA 4KGXB 5J3BA 1WIEA 1MGQA 1GFCA 2F5KA 1VQ9T 3VRYA 1SSHA 1LCKA 3L2VA 2KROA 5L23A 2X4YA 2DK3A 2WSFE 2XI9A 2DXUA 3UF4A 5GAMf 4PJOE 1G3YA 2A28A 2GQVA 1NEGA 1RAHB 2DEUA 4IURA 2QGGA 4L6V5 4EMKC 2MMPA 2V1RA 2KSSA 3MHXA 2MF2A 1FXXA 2LMJA 1KQSS 2DF6A 3DLMA 2F1LA 1HYOA 3CCSQ 1M1KR 1IGUA 1K0SA 1NE8A 1VUBA 2MPXC 5CR2A 3EFRA 3CCUA 1Y07A 5IH2A 2DZ9A 2LCSA 2CH4W 3M54A 2KK4A 2V8IA 2O9SA 4M78B 2CZ7B 1PG5B 2ROLA 3I55Q 4DEXA 3CCLA 2KYMA 1Y71A 1Q82R 2ZPHB 4C8QB 2D9TA 3VYGA 4C92A 3MCAB 1EX4A 2AKLA 1UFFA 3G7ZA 3JCMf 1KHCA 3GP8A 5CKEA 4X34A 3CXCS 2J6OA 4B9XA 3G71A 1GL5A 1MV0B 3EGXB 2Y4YA 3V8KA 1IREB 2HEQA 2EVRA 1NM7A 3EFSA 1QVGP 4XAXB 3OYAA 1M5Q1 2KQWA 4D6WA 3M57A 1OX8A 4MMLA 3VU3C 3HSBA 1KC8C 2W0ZA 2DBKA 1NLOC 1IZ6A 2YHTA 3CBOA 1UEBA 3JCMX 1KQSA 2ZCFB 1JXOA 2NYSA 2H3JA 4E7LA 3BW1A 4OGCA 3HRTA 3X28B 3QO3A 1VQKQ 2MIOA 3H0FA 4FM4B 2QA4T 4RKUE 1M2VB 3M55A 4CC4B 3H0HA 5I21A 1Y96A 3QBYA 2O01E 4BACA 3A8HB 2DD4A 1NPPA 2COWA 4J6XA 5LJ3e 2DERA 2JW4A 2FVUA 4N4IA 1N9SA 1VQ8A 3AHUA 4KH1B 2DAQA 2K6DA 4P5NA 2VV5A 4JRQA 2ATCB 2FRWA 2EAYA 3S3OA 1U8RA 2QA4A 3G4SQ 2OTJA 3WVDB 3FLGA 2DILA 3LWIA 2EBPA 5D6XA 2DJQA 3E9FA 3OSSC 4F04B 2CDTA 3FJPA 2RD1A 2EQMA 3E2UA 1XTDA 1YITQ 2LVMA 2DRMA 1PSFA 2YWWA 3GF5A 1YHQT 1YI2Q 3P8DA 1U1SA 1D0YA 2DTOA 1VQ7T 3SWNC 2OAUA 1CKBA 4QVCA 1WFWA 1BU1A 2RH2A 3QDRB 1GXIE 2GFUA 3MEWA 2OTLT 2A0FB 2BTTA 2E1HA 2LJ0A 3QKJA 1K8AU 2EJGA 2P4TA 2HBWA 1C0MA 4UC4A 1YJ9T 3PMIA 1KFZA 1X69A 1YN8A 3TSZA 1TG0A 3VS1A 4XTUA 4Z8AA 3CCJT 2G6FX 2DKGA 3PFSA 1KD1U 3CPWA 3X20B 1TWBA 1OULA 3M59A 1M9SA 4AFQC 4LDWA 3CCST 3VYHB 2ECZA 1S72Q 1VQPQ 2RK2A 3T9NA 4E7IA 1YJNT 4M78F 2EPDA 3MEAA 2BIVA 1B3QA 1U1TA 2XG8D 2YUPA 5DLQE 4HVWA 2MOXA 2K57A 2KXCA 3RESA 1QVFP 1D0XA 2HBPA 2E10A 2EJ9A 4M75D 3V8LA 3VS5A 2DL4A 5CK9A 2CREA 2DMOA 3PNWC 3OYJA 3A1PA 1K73U 3RBBB 3JCMb 4M77B 2KRSA 4ME7A 2GFAA 3A8LB 3EGUA 1VQ8Q 1TSFA 1VQ5T 3I56Q 1TU0B 1VIEA 3CPFA 2KDSA 4X9CA 4M78G 1U3OA 2SRCA 2KE9A 4J9FA 2FZKB 2VWFA 3EG9B 3JCMP 4KRTA 2V1QA 2QYZA 2XIDA 5IAYA 2RB6A 2IG0A 1QMCA 4D8DA 3BE3A 5A0DA 3LH0A 1ARKA 1M1KU 3RUXA 3SB2A 2EYZA 3UPUA 3TREA 4Y28E 1ZBJA 2LP5A 1OI1A 2RMOA 4J9CA 4A4EA 2ED0A 3WVEB 4M78A 2CP0A 2CGHA 2HAXA 2KI7A 4J5YA 2O88A 2EQIA 2W10A 5IN1A 2PVDB 5C0MA 3G4SA 1W2BS 5A0GA 5AT1B 5FWCA 4M75E 4PFZA 2YT6A 4C92B 4PJOA 1W2BP 3RMQA 2K5FA 5GANh 4L5GA 1WHHA 1W2BA 2BE7D 3M0UA 3NFCA 1KQ1A 5FU6B 2EQJA 4M7AF 1D3BA 2R57A 2OX7A 2LTOA 2OAWA 3KXTA 1OYXA 4AFSC 3M9QA 1AWJA 2ZGWA 4M75F 2JS0A 1VA7A 1BKBA 5CQYA 1RAFB 1GRIA 1X6BA 1D1BA 5GMKe 2FYKA 4E7ZA 4OVAA 4F7UB 3JCMg 1JXMA 1YHQQ 1QCFA 2EYQA 1QW1A 3M4YA 1R0CB 4M78D 3CCVA 2K4YA 2NUZA 3QUIA 2VXEA 5A2QE 1VQNA 4M7AG 3OS1A 1XNIA 4F16A 5IXBA 3REAB 1YIJA 1Q7YU 1QCOA 1BK2A 1SPKA 2K9GA 1K9MC 4KT0E 4M75G 3EG9A 3HFNA 4PK4A 4OF1A 5CKDA 1VQPT 2P4RA 2GQIA 3I35A 1N8RC 2QEXQ 2NUPA 4Y91A 5A0LA 4FYWB 1Y57A 4EIKA 4QVDA 3G4ST 1X2QA 1JJ2S 4RCCA 3EHRA 3VUBA 3QSUA 3MP6A 4QQDA 3PE0A 2JXBA 2PQWA 2M51A 4XTYA 2JUFA 3EFOB 3JCMe 2QQAA 3CXCP 3JCMc 3REBB 1QVGS 2LZ6B 1M4ZA 1PRLC 4M75A 2QAZA 2DJZA 2E3IA 1RUWA 2CP3A 1Q86R 4X9DA 1HK9A 2EWNA 3UDCA 1AEYA 4M78E 4RTVA 3HP9A 4M78C 5CO7A 1IXDA 4E7SA 5IHIA 5LJ3h 1PC0A 1K0XA 5J26A 4X1VA 1Q7YR 1B07A 4BE1A 4LNPA 3QIIA 2QA4Q 3VRZA 2C0IA 2MCNA 4KUIA 4C5EA 4M7DB 4BB7A 2QTVA 1WJRA 4IUTA 1YJWQ 1G2BA 4M4ZA 1JO8A 5CVIA 4M77G 3CCMT 5GANj 1D09B 1VQ4T 3QHSA 1UG1A 3QXEB 1YJNQ 3C94A 1RAIB 1CKAA 4ZTFA 9ATCB 8ATCB 3M0RA 2CZ6B 3EGDA 1ZX6A 3RKWA 2HQEA 2JT4A 3U23A 5FRNA 4FCYA 3CCMA 5GAOq 4MZMA 3I5RA 4CC7A 4EMGA 2E64A 3JCMQ 4BUGA 2ZPGB 3PT9A 3R6OA 2HQXA 3M56A 1QCNA 1Q86C 2ENMA 3QWXX 4N0AC 3EGXA 4M77A 4MZPA 5KH6A 5FRMA 3VUZA 1AWXA 2A36A 5CCAA 5I2SA 1T0HA 5I2MA 1X75C 2DRKA 2C0TA 4M7DC 2O31A 1F1BB 1QVPA 4JZ3A 1AVZC 1GCQC 3V7CA 5CKFA 4OMPA 2OTLA 2K7AA 2K79A 2J6FA 2AZVA 3BDUA 4LN2A 2A08A 2DNUA 2X3WD 1QWEA 3SFMA 4DBFA 2Y4XA 4AT1B 2E65A 3CCET 2GTOA 2P0KA 5D6YA 2F5TX 1OEBA 2AT1B 2C06A 4AFUC 2BKDN 1LVKA 1K1ZA 5LJ3g 2AIRB 5LJ5d 4CRIA 5LJ5e 1TXQA 3JCMJ 3MJXA 1PCXA 5CIUA 1M3AA 2EJFA 2OTJT 3HRSA 3CCRQ 4QQGA 1RACB 1MUZA 2RHYA 4JJCA 2JZ2A 3SEMA 2MAMA 2VVKA 2MI6A 2FPEA 2CS7A 4PJOB 2LC4A 1Q95G 2RNAA 3JRZA 3CQTA 2GNCA 3CMET 1VQLA 1VQNT 2JNGA 2V8JA 1TS9A 1H641 2L89A 3J80E 3JB9G 2CUDA 1PKSA 4F17A 3CCVT 1JBMA 1E6HA 3EGDB 4XTWA 4ZN1A 3OS5A 4J7IA 3INZA 1A0NB 1BCOA 1WJQA 2DBMA 2BZYA 2HL5C 3QPHA 4RG8A 1RAEB 2A3LA 1MMGA 3CC4T 4FYVB 3P8HA 3CCEA 4JJDA 3LGLA 2I2LA 1PHTA 2KY9A 1ZBXA 2KR3A 2KYBA 2RHZA 2EQUA 1SF9A 3A98A 4LUDA 2P0QA 5FROA 1B34A 1HD3A 2QQRA 3E19A 3TU4K 3ZBDA 4M77E 2L5QA 1RABB 3ZEHA 4BDZA 3SD4A 4BI3A 4R56A 3KFVA 3L2UA 4Z89A 3A5ZB 3JB9J 3CC2Q 2CP2A 1LNXA 1BIAA 2E12A 1X2KA 1X6GA 1VIFA 4ZGJB 2KRNA 2P84A 5GANd 3UA6A 2X51A 3VV0A 3QJYA 1WXUA 5GAN5 3KUFA 2D6FA 2ZZDA 3I5SA 2EYYA 1PD1A 1TUDA 1YIJQ 2PTKA 3HTRA 5HCKA 3C4SA 2LDMA 4M7DG 3CBPA 1WQWA 4JPBW 1W1FA 4QQ6A 2GCXA 2RPNA 7AT1B 1SG5A 2KRMA 4K11A 2CZ0B 2GBQA 1P92A 2DXBA 5GAOm 3OYCA 4KUDK 2OTLQ 2JJ9A 3RIRA 1UE9A 4C5IA 1K8AC 1VQ5A 4PJMA 3LGFA 5DY9A 4RMOA 5LL6S 5GAN2 3MO8A 5GJWB 4EDUA 1YCSB 2HKNA 3I55A 3SDZA 4BE0A 4C8QG 3G6EA 3MKDA 2R5AA 1M90R 3QWYA 4HT8A 4RUGA 5M9OA 1BB9A 4EPCA 2JTMA 1PKTA 3CCRT 4AG1C 3PVLA 3CC7T 4XU0A 4Y92A 1YITA 1YCYA 1PWTA 2KMTA 5CKBA 4IIOA 3F70A 1KK7A 2HSPA 4WTOB 2M16A 3RKYA 2COZA 3O5ZA 4F7UG 5GAOn 4JRIA 5GMKh 3CCSA 1KHIA 4ORZA 2BE9B 5FU6C 3RR6A 3SWNA 4RTTA 3HFOA 3OB9A 3THKA 5GAMd 1WQ7A 2RM4A 4LD9K 4YTLA 4M7AD 2E5KA 2FPDA 2FRYA 3D7SB 3L2ZA 1VQOA 1NJIC 2DETA 4PJLA 1OU8A 4II1A 4MDXA 3OYKA 1JEGA 1BBZA 2YUNA 5GANe 1KC8R 4WCIA 3RMSA 4LD6A 2B86A 5KYUA 2XD0A 1WGSA 1XJWB 3L42A 4FSXA 4LXCA 4BY6C 8AT1B 1XOVA 2DYIA 2LNHB 4OGEA 1LOJA 4E2FB 4C0DC 1VYTA 1RLPC 4E7JA 4C5HA 4C5GA 3L2RA 2RHIA 5KYYA 1FMKA 4Z88A 3NHNA 2LCLA 3KBGA 4RTYA 1DJ7B 2K3YA 4JJBA 1TTHB 3CMEA 1VQLT 1ZHIA 4J9GA 5GAMj 5KYWA 1QQJA 1G3TA 3META 3SHWA 4KGZB 3L2WA 2PUOB 1WHKA 1QWFA 2K2MA 1C6VX 1SHGA 3OYNA 1OQKA 2B8AA 2CSQA 1BI1A 2SEMA 1X6OA 4ZGEB 3L2QA 4JRKA 1MMNA 4ZTJA 5FW9A 2RF0A 3Q1JA 4M7DE 4E7HA 2F2XA 4PFPA 1B7TA 2X3XD 1ZQ1A 5GAMg 3LYIA 2DLPA 3M0TA 2FO0A 1K9AA 2NUPB 1VQ9Q 4AFZC 1Q81R 1VQMT 2VC8A 3VS0A 3OBYA 4ANJA 2VGNA 2ZAEA 2Y90A 3CC7A 3BFMA 3PIPA 1VQ7Q 2MWOA 1M3BA 4C8QE 4KULA 2E5QA 2JMCA 3ER0A 4NL2A 4XU3A 2KXDA 3I55T 3CMAT 2J7IA 1GBQA 3QYGB 3CC2T 1OPLA 1N27A 1I07A 4J9EA 2DA9A 3QYHB 4C0GA 3M0PA 1U5SA 3NPFA 4ESRA 1Q81C 3L1AA 3VS7A 5D6WA 3FRNA 2RJCA 3EG3A 3EFOA 4DQ2A 4O5VA 2AKKA 2D0QB 3CMEQ 4A4FA 2F69A 3R6NA 3CCUT 2BZ8A 4CI0C 1ZSZB 1I81A 3CCVQ 2KVQG 4PLLA 5FU7C 1YP5A 2RQTA 2DM1A 2MWPA 3OMCA 2YRVA 1IGQA 4LUEA 4C0FA 1VQ6Q 1N6AA 4R0KA 4VUBA 1AOJA 1UJYA 1WHMA 1WX6A 2BZXA 2PUKB 2RJEA 1WA7A 2DO3A 1RI0A 5KYXB 4IKFA 1OU9A 3C12A 1D1AA 1VQ6A 5AYFA 3M58A 1MNDA 2OI3A 3OYDA 4J9DA 4O6JA 2HSEB 1D3BB 1I4K1 2DXTA 4PJJA 2QI2A 2LJ3A 2X4WA 4XU2A 2QTXA 4M77D 1EFNA 3J7AF 4NL3A 3BDLA 1KD1R 1GCPA 3A8OB 3LW5E 3JAME 2R58A 3CCQA 1K4US 2YRDA 1VQ4Q 1ZSZA 2X9HA 2E70A 3S6WA 3V7SA 2J06A 2KAFA 1VQ7A 1ZSZC 5EG2A 1UTIA 1OPKA 2FHDA 1UGSB 1KD1C 2VXFA 2K3XA 3OS0A 2DXCA 2QQBA 1WYXA 2XDPA 2FZCB 5DM7R 4MDWA 1O9SA 4C8QA 1W6XA 1VYVA 4J9BA 2WSEE 4LE9A 1M1FA 4M7AC 4AG2C 3JB9D 3URGA 4XK8E 3P8BB 3A8MB 3JCMV 1AD5A 5LJ5j 1VQ8T 1FX7A 2WSCE 1MNEA 1N5ZA 2L3QA 1YIJT 1RLQC 1H8KA 1D1CA 1UUEA 2HCKA 1W4SA 4IUQA 2LQWA 1ZLMA 2QGFB 3IQLA 2QEXA 4HT9A 3VS6A 1M27C 1PM3A 2CYZB 5LJ5h 1NZ9A 2LQNA 1HXDA 5GMKj 4Z02A 4OB1B 1OOTA 5KYYB 1R8OB 1M2VA 1B34B 3OW2S 4KBMB 1V1CA 2X4XA 2HDAA 1M1GA 1UHFA 3I9QA 4FW1A 3CCQQ 4QVZA 3TQ7P 1KG1A 4HA8A 4PJOF 4M75C 3S3MA 2PVGB 1FYNA 5KYWB 2L3RA 3S3NA 3VJPA 1SSFA 2QK0A 3JV3A 2X35A 1N9RA 4GLMA 1H92A 3G1JA 2QG9B 1VQOT 2DIGA 2RQVA 1I1JA 2LQ8A 1KC8U 3GBQA 1VQ6T 3WXMB 3J81E 1G3SA 1RADB 2CH4A 4HXJA 2PNIA 3FJ5A 3GNGA 1NBEB 1VQKA 5EC7A 5ECAA 3OY9A 5GAN4 4LDXA 1AZEA 4HCKA 5IHNA 2HKQB 2M0YA 4J8OA 4CC3A 3I56T 5IXFA 1S1NA 4ZN3A 4PJOG 4JLGA 3ZL7C 1M90C 5KCOA 1QVFA 1XQHA 2QQSA 5I11A 1RAAB 1UGRB 4A4KA 2DVEA 5LJ5f 1H3ZA 1Y96B 2M0OA 1WI7A 2XICA 4L59A 1VQ4A 2KT8A 1Z9ZA 1JQQA 1M3CA 2NUTB 3OYFA 4KGVB 2VKNA 3MP8A 2FL7A 3CCJQ 2JOYA 2A37A 2LJ1A 1C1AA 4FT4A 5CQXA 1VQ9A 1I0CA 3CC2A 1LJOA 5KCHA 2YSQA 2KNBB 4RTZA 1CSKA 4PJNA 4RCBA 5KE2A 1ZUKA 1WXTA 2EKOA 1PRMC 3M5AA 2CZ1B 1QVFS 4XTXA 4JRPA 3N5BB 2RQWA 3UA7A 2RI2A 1YNZA 3TCJA 4NOYA 4M7DD 1UDLA 4CC2A 4N4HA 1YJNA 3I56A 1VQMA 1IHWA 4OMQA 2M1HA 4HVUA 3JB9H 1WXBA 2CP7A 5GAN7 3O8VA 2HMAA 3QDFA 5GMKm 1X01A 4OP0A 2RK1A 1V29B 4JLIA 2KT1A 3GNFB 2O4XB 4IUUA 1VQPA 2F2VA 1UECA 2JS2A 3C0CA 3FIFA 3OYGA 4C92D 1WLPB 1QVGA 1N8RR 1YBYA 4OMLA 2LNVA 1BI0A 4C8QD 5GAMe 3CMAQ 2L3SA 2VGMA 1NYFA 1RAGB 1YJWT 3CD6A 3OW2P 1KIKA 1YI2A 1O75A 2EYWA 3OYBA 3G6EQ 4C0DB 1G83A 4JUVA 1UJ0A 4OB0B 3CCUQ 2OJ2A 1I8FA 1IHVA 3LH5A 3RDVA 2QEXT 4MZTA 1R77A 1WZOA 4BI8B 5HK0A 1Z9QA 3PTAA 1NYGA 1K73C 2EGAA 4C0ZA 3H6ZA 4RG2A 3ZFJA 2DTIA 1YI2T 2RA2A 1SRMA 3MEUA 3V8JA 1NJIU 3ULRB 1YJWA 4GBQA 1WDXA 2HD0A 4B6MA 1K73R 2E4HA 4C92E 4ELYC 1V76A 1TH7A 5LJ3j 2C0OA 5C6SA 1PD0A 2QQ9A 3E1SA 3H8ZA 1S72A 2ED1A 1PSEA 3X26B 1J3TA 5IHKA 4BY6B 1LPLA 1Q82U 1KQ2A 1SKUB 3FC3A 3CC4Q 4OMFB 4HVVA 5GJVB 2VYTA 5I22A 2D1XA 5HK3A 4BD3A 3OYIA 2A7YA 5CKHA 1PNJA 4FU6A 2PZ1A 4EMKA 3OYMA 3OYLA 3PGGA 1YFNA 2XKOC 1TUGB 2FEIA 3M0QA 3OS2A 2GF7A 4E47A 2CP5A 2YXYA 2XMFA 3C95A 3JCMW 5LJ3d 1M2OA 1UGPB 4QT7A 3M0SA 3G71T 1M30A 5FLXE 1BYMA 2RO0A 2E3HA 1R0BG 1ABQA 1MMAA 1UGVA 1YWPA 3G71Q 4HCZA 3DLLA 1AZGB 1YWOA 2O2OA 1AT1B 2YLBA 1OZ2A 1RL2A 1NJIR 3EG2A 2K3BA 2ESWA 4JDSA 1ZUYA 4M7AA 4F7UE 3LWHA 4EMKB 3OA6A 2HNIA 4FW2A 3EH1A 4C8QC 3HPWA 1ABOA 1W70A 2V8KA 2CP6A 4OMMA 5HY6A 4IUVA 3RNJA 2EKHA 4JJNK 1IO6A 1ACMB 2LQKA 1WHJA 3CEYA 1WHGA 3EG0A 2XU8A 2KGTA 4PNOA 1ZA1B 4EMHA 1T0JA 1Q7YC 1OZ3A 4HCBA 5LJ3f 1AHJB 1VQKT 1K9MU 3UT1A 4J7FA 3FB9A 2E6NA 2K5IA 3CMAA 3CCJA 4M77F 2RN8A 1N8RU 3UWNA 1FMWA 1T3LA 1OV3A 5GAN6 3CCEQ 1TUCA 1YJ9A 1BI3A 3TVTA 1Q81U 2BUDA 2QDYB 3GPLA 1KSWA 2EQKA 5KYUB 2DEQA 1VQOQ 2DTHA 5HKCA 2D8JA 5GAOr 1JJ2A 2XDDA 3RKXA 5FWBA 1GBRA 2DIQA 1IRXA 1VOMA 4DOVA 5GMKi 5L8RE 2O9VA 2FZGB 3JCMh 2YUOA 2E41A 2P0PA 3HRUA 3VS3A 3H0IA 1YHQA 3HL8A 2LT1A 2GTJA 2M02A 2CT4A 1GCQA 4C92C 3FEOA 1WHLA 3EHQA 4DBQA 2IIMA 1JU5C 3VKIA 4C92G 2EGCA 2DD5A 3X24B 2JMAA 1M8VA 2MK5A 3ME9A 5GANf 1FWZA 5FU7B 2G3RA 3E9GA 2L0AA 3PMTA 2RI3A 4NS5A 1JRIA 4PJOD 1IB8A 1QKWA 2XHCA 3NTHA 3CBMA 2JN0A 1T3SA 2L8DA 4DOWA 1VYUA 2HZYA 4A63B 4IUPA 3VS2A 3QJ6A 5GAN3 4AMCA 3GLXA 1SEMA 4C92F 2IPOB 4J83A 3X25B 3OSVA 2JTEA 1WPYA 1H3HA 3OMGA 2OTJQ 4F7UA 4M7AE 4QKUA 1E7OA 5GAOp 1Q86U 2E6ZA 1VQNQ 4J9HA 2LX7A 2ZPIB 2DL8A 4OMNA 2NLUA 3HKSA 2EFIA 2LRQA 1QP2A 4RTXA 2JVVA 3MP1A 1WJSA 1X27A 2YDLA 2PU9B 3JB9F 2QXFA 3CPWP 4M7DF 1ZSGA 3H9NA 2IVWA 2FG0A 2NWMA 1VQ5Q 2EGEA 2NUTA 2AZSA 1X43A 4A4HA 2VASA 3OBWA 1M8MA 3PIOA 3CCLQ 1FMVA 4ZGDB 4J6YA 3CD6Q 3EH2A 3QZ9B 4ELZC 1RI9A 2K5LA 3CCLT 3CCMQ 1EIFA 4ATOA 4B9WA 2YLCA 5D7UA 3BY7A 4FSSA 1M1KC 5LJ5g 2EW3A 3QG1A 3DB3A 1VQMQ 2ZPEB 3TEEA 5KE3A 1K9MR 2LX9A 4QW2A 1MMDA 4V2SA 1UGQB 4PL6A 1MV3A 2Z0WA 2LCCA 4LDYA 3OYYA 1VQLQ 2FB7A 3G6ET 1QP3A 3CC7Q 1Y7XA 4FIBA 4DBHA 3LX7A 2YRCA 2AK5A 3A8GB 3MEVA 4BI4A 1BIBA 4F7UF 1BCMA 2DX1A 2RQUA 1G8XA 1NLPC 3EG1A 2ZPBB 4FYXB 3TSWA 2COYA 4LDUA 4JS4A 5CAIA 2EYXA 1AWWA 1ZA2B 2D8HA 4M7DA 2R5MA
chains in the Genus database with same CATH topology
1BI2A 2EKOA 3JSCA 2R5AA 2VUBA 4MMKA 3JCMP 3M5AA 2CZ1B 4HT8A 3LLRA 4XTXA 4JRPA 2XIDA 5M9OA 5IAYA 4EPCA 2JTMA 3N5BB 2DPPB 2RB6A 3NTKA 4M7AB 2IG0A 4M77C 2RI2A 3TCJA 4NOYA 3CCRT 2AHJB 4N0AA 3M53A 5A0DA 3LH0A 4BE2A 1M1KU 3CC7T 4XU0A 3RERA 4M7DD 1YITA 3RUXA 1YCYA 1JB0E 2KMTA 3DB4A 4N4HA 5CKBA 3SB2A 3F70A 1YJNA 3UPUA 2M16A 3I56A 4JS5A 3TREA 3RKYA 1VQMA 4Y28E 1Q82C 1G3WA 1OI1A 4XU1A 4F7UG 5GAOn 4JRIA 5GMKh 3CCSA 2M1HA 1KHIA 3EAEA 3JB9H 1MHNA 4TVRA 5FU6C 3SWNA 4A4EA 2O4XA 4PJOC 5GAN7 3O8VA 3WVEB 4M78A 3HFOA 2RI5A 3OB9A 4E7KA 5GAMd 1WQ7A 2CGHA 5GMKm 1X01A 2RM4A 4GLKA 4LD9K 2HAXA 4OP0A 5J39A 4J5YA 4C8QF 2RK1A 4YTLA 4M7AD 1V29B 4JLIA 2PVDB 5IN1A 5C0MA 5GAMh 3G4SA 3HHTB 1W2BS 1VQOA 3L2ZA 5A0GA 1NJIC 3GNFB 4M75E 2EIFA 2O4XB 1NPRA 4C92B 4PJOA 4IUUA 4Q5WA 3RMQA 1VQPA 4II1A 4MDXA 2K5FA 5GANh 3OYKA 4L5GA 3FIFA 2K2VA 1W2BA 2XDBA 3OYGA 1S72T 3NFCA 1KQ1A 4C92D 1UB4A 4WF2A 5GANe 5FU6B 3RMSA 3FDRA 3OYEA 1QVGA 2EQJA 1YBYA 4LD6A 1D3BA 4M7AF 3JB9I 2RHXA 2LNVA 1BI0A 4OB2B 4BDYA 4C8QD 2R57A 2XD0A 5GAMe 2DZCA 1WGSA 3V7RA 2LTOA 2VGMA 4FSXA 3L42A 3KXTA 1YJWT 1OYXA 4BY6C 1XOVA 3CD6A 3M9QA 3NTIA 3CC4A 2ZGWA 4OGEA 2PVOB 3OQ5A 4M75F 1LOJA 1BKBA 2RJFA 1YI2A 5CQYA 4XTVA 1O75A 3OYBA 4C0DC 1G5VA 4GY5A 5IT9E 3SWNB 3M4GA 4C0DB 5GMKe 2FYKA 4JUVA 4E7JA 4N4GA 4OB0B 4C5HA 3DKMA 4OVAA 4C5GA 4F7UB 3L2RA 3JCMg 3CXCA 1I8FA 2RHIA 2QEXT 2EYQA 1QW1A 3M4YA 4MZTA 3CPWS 4BI8B 5HK0A 4M78D 3CCVA 2K4YA 3PTAA 2LCLA 3KBGA 3JCMd 1K73C 3QUIA 3H6ZA 4RG2A 4C0ZA 4PLIA 3ZFJA 1DJ7B 2DTIA 2K3YA 2VXEA 4XQ3A 3GOXA 1YI2T 4PKCC 5A2QE 2RA2A 1VQNA 3ASKA 3CMEA 1VQLT 2CKKA 3MEUA 3GIBA 1ZHIA 4M7AG 3OYHA 3CD6T 3V8JA 1NJIU 4M75B 3OS1A 4E7LA 5GAMj 1YJWA 1G3TA 1I5LA 2HD0A 3META 1XNIA 1YIJA 1Q7YU 4C92E 4ELYC 3L2WA 1TH7A 2PUOB 5LJ3j 1K9MC 4KT0E 5C6SA 4M75G 5DLOA 3OYNA 2QQ9A 3E1SA 4R55A 4HCCA 2M9UA 3H8ZA 4J6WA 1S72A 3HFNA 3X26B 1PSEA 4DA4A 1M90U 2B8AA 4OF1A 5CKDA 1VQPT 1BI1A 1X6OA 2LT4A 2JTFA 2RJDA 4FT2A 4BY6B 4ZGEB 3L2QA 4JRKA 4HKEA 1N8RC 4Y91A 4A4GA 1Q82U 5A0LA 4ZTJA 1KQ2A 5GANg 4QVDA 3G4ST 3FC3A 3Q1JA 4OMFB 1JJ2S 4M7DE 4RCCA 4E7HA 4FL6A 2VYTA 3VUBA 3OW2A 3QSUA 3MP6A 4QQDA 1ZQ1A 5HK3A 4BD3A 3OYIA 2PQWA 5GMKl 5GAMg 3LYIA 2A7YA 4XTYA 5CKHA 4FU6A 4EMKA 2JUFA 4OB3B 3OYMA 1WNLA 3JCMe 3QZ5B 2QQAA 4XTZA 5GAN8 3JCMc 3OYLA 1QVGS 3PGGA 1M4ZA 2XKOC 4M75A 2VC8A 1VQMT 2XK0A 3OBYA 3OS2A 2DJZA 2GF7A 2VGNA 4E47A 2Y90A 1YITT 3CC7A 3BFMA 3C95A 4X9DA 3JCMW 1HK9A 3PIPA 2EWNA 2ZPFB 3CCQT 3CCRA 3UDCA 5LJ3d 4A54A 2MWOA 5GAOl 4M78E 1UGPB 4C8QE 4KULA 2WACA 3HP9A 3G71T 2E5QA 2X4JA 4M78C 3ER0A 5CO7A 4NL2A 5FLXE 4A53A 4XU3A 1BYMA 2RO0A 2RHUA 4LDVA 5LJ3h 4HCZA 3DLLA 5J3BA 3I55T 3CMAT 5J26A 1MGQA 4BE1A 3QYGB 2YLBA 3CC2T 2F5KA 1VQ9T 3QIIA 1OZ2A 3L2VA 1N27A 1RL2A 2X4YA 3QYHB 2DK3A 2WSFE 2XI9A 4KUIA 2DXUA 4JDSA 4C0GA 4C5EA 4M7DB 1Q81C 3L1AA 4BB7A 5GAMf 5D6WA 4M7AA 3FRNA 4F7UE 1WJRA 2RJCA 3LWHA 1G3YA 4PJOE 4IUTA 2GQVA 4DQ2A 4EMKB 3OA6A 2HNIA 5CVIA 4M77G 3CCMT 4O5VA 5GANj 4IURA 4C8QC 1VQ4T 3QHSA 3HPWA 2D0QB 4L6V5 2MMPA 2F69A 2V8KA 2KSSA 3QXEB 4A4FA 3MHXA 4EMKC 2MF2A 3C94A 1FXXA 5HY6A 1KQSS 4ZTFA 3DLMA 4CI0C 1I81A 2KVQG 4IUVA 1NE8A 2CZ6B 1VUBA 4JJNK 4PLLA 5FU7C 3RKWA 2HQEA 5FRNA 2MWPA 3OMCA 2LQKA 3CEYA 2YRVA 3EFRA 1Y07A 5CR2A 3CCUA 2XU8A 4C0FA 2DZ9A 1N6AA 4PNOA 4MZMA 5GAOq 3CCMA 4VUBA 4EMGA 2E64A 3M54A 2KK4A 4EMHA 2V8IA 3JCMQ 1Q7YC 1OZ3A 4M78B 4BUGA 2CZ7B 2ZPGB 3PT9A 2PUKB 2HQXA 3R6OA 4HCBA 2RJEA 3M56A 1Q86C 5LJ3f 1AHJB 3CCLA 1VQKT 1K9MU 1Y71A 3UT1A 2ZPHB 2DO3A 4C8QB 1RI0A 4N0AC 4J7FA 4IKFA 4M77A 4MZPA 2D9TA 5KH6A 3C12A 3FB9A 2E6NA 2K5IA 5FRMA 1VQ6A 3CMAA 3VYGA 3CCJA 5AYFA 4C92A 4M77F 3VUZA 3MCAB 1N8RU 3M58A 3G7ZA 1KHCA 3JCMf 3UWNA 5CCAA 5I2SA 3OYDA 5I2MA 5GAN6 1X75C 5CKEA 4O6JA 4X34A 3GP8A 3CXCS 1QVFS 1D3BB 1I4K1 2DXTA 1YJ9A 2QI2A 4M7DC 1BI3A 4B9XA 3G71A 2X4WA 1QVPA 4XU2A 1Q81U 2QTXA 3V7CA 4M77D 2Y4YA 5CKFA 3J7AF 3V8KA 4NL3A 2OTLA 1IREB 2BUDA 2QDYB 3BDLA 3GPLA 3A8OB 3LW5E 3JAME 2EQKA 2R58A 3CCQA 2DEQA 2DTHA 5HKCA 3EFSA 5GAOr 1JJ2A 4XAXB 2XDDA 1M8VA 2E70A 3RKXA 3S6WA 3V7SA 3OYAA 2DIQA 1M5Q1 2KAFA 2KQWA 3BDUA 4D6WA 4DOVA 3M57A 5GMKi 3CCUT 1VQ7A 4MMLA 5L8RE 5EG2A 3VU3C 1KC8C 3HSBA 3SFMA 2Y4XA 3JCMh 2E41A 2FHDA 2P0PA 3HRUA 1UGSB 1KD1C 1YHQA 3HL8A 2E65A 2LT1A 2K3XA 2VXFA 3OS0A 3CCET 4C92C 2DXCA 2QQBA 1IZ6A 2P0KA 2YHTA 2F5TX 3CBOA 3FEOA 5D6YA 2XDPA 2C06A 1UEBA 3JCMX 1KQSA 2ZCFB 2BKDN 5DM7R 4MDWA 1O9SA 3VKIA 4C92G 5LJ3g 4C8QA 2DD5A 3X24B 2H3JA 5LJ5d 4CRIA 3ME9A 3BW1A 5LJ5f 5LJ5e 2WSEE 3HRTA 4OGCA 5GANf 1M1FA 3X28B 3JCMJ 4M7AC 3QO3A 5CIUA 1FWZA 2EJFA 2OTJT 4FM4B 5FU7B 2QA4T 2G3RA 4RKUE 3HRSA 3M55A 3JB9D 3URGA 3E9GA 4QQGA 4XK8E 5I21A 3P8BB 3A8MB 3PMTA 2RI3A 2RHYA 4NS5A 1JRIA 2JZ2A 4PJOD 1Y96A 3QBYA 2MAMA 3JCMV 2O01E 5LJ5j 2MI6A 1FX7A 2XHCA 3NTHA 3CBMA 2CS7A 4BACA 1VQ8T 2WSCE 2JN0A 3A8HB 2DD4A 1NPPA 4J6XA 5LJ3e 1YIJT 4PJOB 2LC4A 2L8DA 4DOWA 4IUPA 3JRZA 2FVUA 3QJ6A 5GAN3 4N4IA 1N9SA 3CMET 1VQLA 1VQ8A 1VQNT 3AHUA 2JNGA 2DAQA 2V8JA 1W4SA 4IUQA 1H641 2L89A 3GLXA 4P5NA 3J80E 3JB9G 2VV5A 4JRQA 4C92F 4J83A 3X25B 2EAYA 3S3OA 3CCVT 1U8RA 2QA4A 3OSVA 2OTJA 1JBMA 3WVDB 3FLGA 2QEXA 4XTWA 3LWIA 4HT9A 4ZN1A 3OS5A 5D6XA 1WPYA 2CYZB 4J7IA 3E9FA 3OSSC 3INZA 3OMGA 5LJ5h 1NZ9A 1HXDA 3FJPA 1WJQA 5GMKj 4Z02A 4OB1B 4F7UA 2RD1A 4M7AE 2EQMA 1XTDA 1Q86U 5GAOp 2LVMA 1R8OB 3QPHA 2E6ZA 4RG8A 2A3LA 1PSFA 3CC4T 1B34B 3OW2S 4KBMB 2ZPIB 3P8HA 3CCEA 3GF5A 1YHQT 3LGLA 3P8DA 2X4XA 1U1SA 1M1GA 2I2LA 2DTOA 2NLUA 3HKSA 2KY9A 2EFIA 4QVZA 1VQ7T 1ZBXA 2LRQA 1KG1A 2RHZA 1QP2A 4HA8A 2EQUA 2JVVA 4M75C 3MP1A 2OAUA 4PJOF 3SWNC 1WJSA 2PVGB 3S3MA 2L3RA 2P0QA 5FROA 4QVCA 3VJPA 1B34A 3S3NA 2PU9B 3JB9F 1SSFA 2QQRA 2QXFA 2RH2A 3E19A 3QDRB 4M7DF 1GXIE 2GFUA 3TU4K 3MEWA 3ZBDA 2OTLT 2E1HA 3QKJA 4M77E 2L5QA 2X35A 1K8AU 2IVWA 2EJGA 2P4TA 1N9RA 3ZEHA 4BDZA 3SD4A 4UC4A 4BI3A 1VQOT 1YJ9T 3PMIA 2DIGA 4R56A 3L2UA 2LQ8A 3A5ZB 4XTUA 3OBWA 4A4HA 3JB9J 1LNXA 1KC8U 1BIAA 2E12A 3CCJT 1VQ6T 2DKGA 3PIOA 3PFSA 4ZGDB 3WXMB 3J81E 1G3SA 1VIFA 4J6YA 3X20B 4ZGJB 3M59A 3CPWA 1KD1U 3QZ9B 1M9SA 4ELZC 5GANd 3GNGA 4LDWA 2K5LA 1VQKA 3CCLT 1EIFA 3OY9A 5GAN4 3CCST 3VV0A 3VYHB 4LDXA 4ATOA 4B9WA 3QJYA 5GAN5 2RK2A 2YLCA 3KUFA 2D6FA 2ZZDA 3T9NA 4J8OA 3I56T 4E7IA 1YJNT 4M78F 3BY7A 4ZN3A 4PJOG 3MEAA 1M1KC 2BIVA 4JLGA 5LJ5g 1M90C 1U1TA 2XG8D 3C4SA 3QG1A 3DB3A 5KCOA 2LDMA 5DLQE 4M7DG 2ZPEB 3TEEA 1QVFA 3CBPA 5KE3A 1WQWA 1XQHA 2LX9A 2QQSA 4QW2A 3RESA 2K57A 4V2SA 1UGQB 4PL6A 4A4KA 1UGRB 2HBPA 2LCCA 2DVEA 2E10A 2EJ9A 4LDYA 4M75D 4QQ6A 2GCXA 3OYYA 1Y96B 3V8LA 1H3ZA 2FB7A 3G6ET 2M0OA 2XICA 2CZ0B 4L59A 1VQ4A 1QP3A 5CK9A 1Y7XA 1P92A 2DXBA 4FIBA 3PNWC 3OYJA 5GAOm 3LX7A 3OYCA 4KUDK 3OYFA 3A8GB 3MEVA 3JCMb 4BI4A 1K73U 4M77B 1BIBA 3MP8A 3RIRA 4C5IA 2FL7A 4F7UF 4ME7A 1K8AC 2GFAA 2JOYA 3A8LB 1VQ5A 3LGFA 2ZPBB 4FT4A 5DY9A 4RMOA 5CQXA 1VQ5T 4LDUA 5LL6S 5GAN2 1VQ9A 4JS4A 1VIEA 3CPFA 3MO8A 5CAIA 1LJOA 3CC2A 4EDUA 2KDSA 4X9CA 5KCHA 3I55A 4M78G 3SDZA 4BE0A 4RCBA 4C8QG 5KE2A 3G6EA 4M7DA 2R5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPY A;  4C92 E;  4EMG A;  2E64 A;  1TH7 A;  3INZ A;  4EMH A;  5LJ5 h;  3JCM Q;  1HXD A;  4M78 B;  4MMK A;  3FJP A;  5LJ3 j;  3JCM P;  5GMK j;  4M75 G;  5LJ3 f;  2RD1 A;  4F7U A;  4HT8 A;  4M7A E;  4XTX A;  4J6W A;  5GAO p;  2RB6 A;  3HFN A;  4M7A B;  4C8Q B;  4M77 C;  4N0A C;  4NOY A;  1B34 B;  4M77 A;  4N0A A;  3FB9 A;  4M7D D;  3RER A;  4XU0 A;  4C92 A;  4JRK A;  1YCY A;  4M77 F;  1U1S A;  3RUX A;  2I2L A;  3SB2 A;  4Y91 A;  1KQ2 A;  2DTO A;  3JCM f;  5GAN g;  4QVD A;  3JB9 H;  4M7A A;  4M7D E;  3RKY A;  5GAN 6;  4RCC A;  1D3B B;  1I4K 1;  2DXT A;  4XU1 A;  4F7U G;  5GAO n;  4HA8 A;  4JRI A;  4PJO F;  3SWN C;  4M75 C;  5GMK h;  3QSU A;  4M7D C;  4XU2 A;  2QTX A;  3V7C A;  4M77 D;  1B34 A;  4QVC A;  5GMK l;  4XTY A;  3SWN A;  5GAM g;  3JB9 F;  3V8K A;  4NL3 A;  4M7D F;  4PJO C;  5GAN 7;  4PJO E;  4M78 A;  4EMK A;  2E1H A;  3HFO A;  2DEQ A;  4M77 E;  2DTH A;  5GAM d;  1WQ7 A;  2CGH A;  1N9R A;  1WNL A;  1X01 A;  2EJG A;  2RM4 A;  3EFS A;  5GMK m;  3JCM e;  4OP0 A;  3RKX A;  4J5Y A;  4XTZ A;  3V7S A;  4C8Q F;  3JCM c;  5GAN 8;  1M5Q 1;  3BDU A;  3PGG A;  5GMK i;  4M7A D;  4M75 A;  4JLI A;  2VC8 A;  4MML A;  5GAM h;  3VU3 C;  3HSB A;  4XTU A;  3JB9 J;  2DJZ A;  3L2Z A;  3JCM h;  2E41 A;  1LNX A;  4M75 E;  1BIA A;  2Y90 A;  4C92 B;  4PJO A;  2DKG A;  2E65 A;  3BFM A;  2VXF A;  4X9D A;  1HK9 A;  3JCM W;  2EWN A;  4J6Y A;  4C92 C;  5GAN h;  5LJ3 d;  3FIF A;  4A54 A;  2YHT A;  5GAO l;  5GAN d;  4M78 E;  3JCM X;  5GAN e;  1KQ1 A;  4C92 D;  4WF2 A;  4C8Q E;  5GAN 4;  4C92 G;  4M78 C;  5LJ3 g;  4M7A F;  1D3B A;  5GAN 5;  4C8Q A;  2YLC A;  4NL2 A;  3JB9 I;  4A53 A;  4XU3 A;  4C8Q D;  5LJ5 d;  1M8V A;  5GAN f;  3BW1 A;  5LJ5 f;  5LJ5 e;  5GAM e;  2DZC A;  3JCM J;  4M78 F;  3BY7 A;  3QO3 A;  4PJO G;  5LJ3 h;  3V7R A;  5GAO r;  4M7A C;  2EJF A;  5LJ5 g;  1U1T A;  1MGQ A;  2YLB A;  3JB9 D;  2ZGW A;  4M7D G;  5I21 A;  4M75 F;  1WQW A;  1LOJ A;  1JRI A;  2K57 A;  4XTV A;  3RES A;  4V2S A;  1Y96 A;  3JCM V;  4PJO D;  5LJ5 j;  2DXU A;  4M7D B;  3L1A A;  2JN0 A;  3SWN B;  2DVE A;  2EJ9 A;  2E10 A;  3M4G A;  4M75 D;  3V8L A;  5GAM f;  4F7U E;  1Y96 B;  5GMK e;  2FYK A;  4J6X A;  4JUV A;  4DQ2 A;  5LJ3 e;  2FB7 A;  4PJO B;  4EMK B;  4F7U B;  2HNI A;  4M77 G;  5GAN j;  3JCM g;  1I8F A;  4C8Q C;  3QHS A;  4EMK C;  5GAO m;  4M78 D;  3JCM b;  4M77 B;  5GAN 3;  1BIB A;  1N9S A;  3RIR A;  4F7U F;  3JCM d;  3QUI A;  3AHU A;  2DTI A;  2VXE A;  4XQ3 A;  1I81 A;  1H64 1;  3JB9 G;  2RA2 A;  5DY9 A;  4C92 F;  4M7A G;  5GAN 2;  3GIB A;  3RKW A;  2EAY A;  5CAI A;  1LJO A;  3V8J A;  4M75 B;  4X9C A;  1JBM A;  3EFR A;  5GAM j;  4XTW A;  4M78 G;  4RCB A;  4C8Q G;  2DZ9 A;  4PNO A;  5GAO q;  1I5L A;  4HT9 A;  4M7D A; 
#chains in the Genus database with same CATH topology
 1OX9 A;  1BI2 A;  3JSC A;  2VUB A;  4MMK A;  3LLR A;  2I0N A;  2DPP B;  3NTK A;  4M7A B;  4M77 C;  4RTW A;  2AHJ B;  4N0A A;  3M53 A;  1D0Z A;  1HSQ A;  4BE2 A;  3RER A;  4DEY A;  4KH0 B;  1GFD A;  1JB0 E;  3DB4 A;  1K76 A;  4JS5 A;  1Q82 C;  3NGP A;  1G3W A;  1Y0M A;  4XU1 A;  4D8K A;  4FYY B;  6AT1 B;  2JM9 A;  3EAE A;  1MHN A;  4TVR A;  1ZUU A;  2O4X A;  4PJO C;  1KQS P;  2RI5 A;  4E7K A;  1QKX A;  4GLK A;  3UAT A;  5J39 A;  4C8Q F;  2QAS A;  4F14 A;  5GAM h;  3H41 A;  1YJ9 Q;  3HHT B;  2EIF A;  1NPR A;  2HL3 A;  4Q5W A;  1I5O B;  2GGR A;  2K2V A;  2J6K A;  2XDB A;  1S72 T;  1KJW A;  1UB4 A;  4WF2 A;  1SRL A;  3FDR A;  3OYE A;  1JJ2 P;  3AT1 B;  3JB9 I;  2RHX A;  2ABL A;  4OB2 B;  4BDY A;  2D0N A;  1EZZ B;  4DBR A;  2DZC A;  3V7R A;  1K8A R;  4E6R A;  3NTI A;  3CC4 A;  2PVO B;  3OQ5 A;  2RJF A;  4XTV A;  1G5V A;  4GY5 A;  2KBT A;  3SWN B;  5IT9 E;  1QLY A;  3M4G A;  2YUQ A;  4PFO A;  4N4G A;  3DKM A;  2QDL A;  1TOV A;  3CXC A;  3CPW S;  1U06 A;  2FPF A;  3JCM d;  4PLI A;  2KEA A;  4XQ3 A;  3GOX A;  4PKC C;  4RTU A;  2CSI A;  3ASK A;  2CKK A;  4ZNX A;  3GIB A;  3OYH A;  3CD6 T;  2L3P A;  4M75 B;  2H8H A;  3NMZ C;  1I5L A;  1NG2 A;  1SHF A;  1HJD A;  2DFU A;  5DLO A;  2DL7 A;  5KYN A;  4R55 A;  4HCC A;  2M9U A;  4J6W A;  2ROT A;  4DA4 A;  3MPU B;  2JM8 A;  1M90 U;  2DYB A;  2DL5 A;  1NEB A;  2LT4 A;  2JTF A;  2RJD A;  4FT2 A;  2L2P A;  4HKE A;  2RQR A;  2F2W A;  4A4G A;  2DE0 X;  2MYS A;  5GAN g;  2DL3 A;  4FL6 A;  3OW2 A;  4OMO A;  5GMK l;  4OB3 B;  4J9I A;  2CUB A;  1WNL A;  1E6G A;  3QZ5 B;  5KYX A;  4XTZ A;  5GAN 8;  3PVQ A;  2XK0 A;  2V26 A;  1YIT T;  2H3E B;  1UHC A;  2ZPF B;  3CCQ T;  3CCR A;  4A54 A;  4IIM A;  2VB6 A;  1AWO A;  5GAO l;  3VS4 A;  2CT3 A;  2WAC A;  2X4J A;  4JZ4 A;  2HQH A;  4A53 A;  2RHU A;  2J05 A;  4LDV A;  2DVJ A;  4KGX B;  5J3B A;  1WIE A;  1MGQ A;  1GFC A;  2F5K A;  1VQ9 T;  3VRY A;  1SSH A;  1LCK A;  3L2V A;  2KRO A;  5L23 A;  2X4Y A;  2DK3 A;  2WSF E;  2XI9 A;  2DXU A;  3UF4 A;  5GAM f;  4PJO E;  1G3Y A;  2A28 A;  2GQV A;  1NEG A;  1RAH B;  2DEU A;  4IUR A;  2QGG A;  4L6V 5;  4EMK C;  2MMP A;  2V1R A;  2KSS A;  3MHX A;  2MF2 A;  1FXX A;  2LMJ A;  1KQS S;  2DF6 A;  3DLM A;  2F1L A;  1HYO A;  3CCS Q;  1M1K R;  1IGU A;  1K0S A;  1NE8 A;  1VUB A;  2MPX C;  5CR2 A;  3EFR A;  3CCU A;  1Y07 A;  5IH2 A;  2DZ9 A;  2LCS A;  2CH4 W;  3M54 A;  2KK4 A;  2V8I A;  2O9S A;  4M78 B;  2CZ7 B;  1PG5 B;  2ROL A;  3I55 Q;  4DEX A;  3CCL A;  2KYM A;  1Y71 A;  1Q82 R;  2ZPH B;  4C8Q B;  2D9T A;  3VYG A;  4C92 A;  3MCA B;  1EX4 A;  2AKL A;  1UFF A;  3G7Z A;  3JCM f;  1KHC A;  3GP8 A;  5CKE A;  4X34 A;  3CXC S;  2J6O A;  4B9X A;  3G71 A;  1GL5 A;  1MV0 B;  3EGX B;  2Y4Y A;  3V8K A;  1IRE B;  2HEQ A;  2EVR A;  1NM7 A;  3EFS A;  1QVG P;  4XAX B;  3OYA A;  1M5Q 1;  2KQW A;  4D6W A;  3M57 A;  1OX8 A;  4MML A;  3VU3 C;  3HSB A;  1KC8 C;  2W0Z A;  2DBK A;  1NLO C;  1IZ6 A;  2YHT A;  3CBO A;  1UEB A;  3JCM X;  1KQS A;  2ZCF B;  1JXO A;  2NYS A;  2H3J A;  4E7L A;  3BW1 A;  4OGC A;  3HRT A;  3X28 B;  3QO3 A;  1VQK Q;  2MIO A;  3H0F A;  4FM4 B;  2QA4 T;  4RKU E;  1M2V B;  3M55 A;  4CC4 B;  3H0H A;  5I21 A;  1Y96 A;  3QBY A;  2O01 E;  4BAC A;  3A8H B;  2DD4 A;  1NPP A;  2COW A;  4J6X A;  5LJ3 e;  2DER A;  2JW4 A;  2FVU A;  4N4I A;  1N9S A;  1VQ8 A;  3AHU A;  4KH1 B;  2DAQ A;  2K6D A;  4P5N A;  2VV5 A;  4JRQ A;  2ATC B;  2FRW A;  2EAY A;  3S3O A;  1U8R A;  2QA4 A;  3G4S Q;  2OTJ A;  3WVD B;  3FLG A;  2DIL A;  3LWI A;  2EBP A;  5D6X A;  2DJQ A;  3E9F A;  3OSS C;  4F04 B;  2CDT A;  3FJP A;  2RD1 A;  2EQM A;  3E2U A;  1XTD A;  1YIT Q;  2LVM A;  2DRM A;  1PSF A;  2YWW A;  3GF5 A;  1YHQ T;  1YI2 Q;  3P8D A;  1U1S A;  1D0Y A;  2DTO A;  1VQ7 T;  3SWN C;  2OAU A;  1CKB A;  4QVC A;  1WFW A;  1BU1 A;  2RH2 A;  3QDR B;  1GXI E;  2GFU A;  3MEW A;  2OTL T;  2A0F B;  2BTT A;  2E1H A;  2LJ0 A;  3QKJ A;  1K8A U;  2EJG A;  2P4T A;  2HBW A;  1C0M A;  4UC4 A;  1YJ9 T;  3PMI A;  1KFZ A;  1X69 A;  1YN8 A;  3TSZ A;  1TG0 A;  3VS1 A;  4XTU A;  4Z8A A;  3CCJ T;  2G6F X;  2DKG A;  3PFS A;  1KD1 U;  3CPW A;  3X20 B;  1TWB A;  1OUL A;  3M59 A;  1M9S A;  4AFQ C;  4LDW A;  3CCS T;  3VYH B;  2ECZ A;  1S72 Q;  1VQP Q;  2RK2 A;  3T9N A;  4E7I A;  1YJN T;  4M78 F;  2EPD A;  3MEA A;  2BIV A;  1B3Q A;  1U1T A;  2XG8 D;  2YUP A;  5DLQ E;  4HVW A;  2MOX A;  2K57 A;  2KXC A;  3RES A;  1QVF P;  1D0X A;  2HBP A;  2E10 A;  2EJ9 A;  4M75 D;  3V8L A;  3VS5 A;  2DL4 A;  5CK9 A;  2CRE A;  2DMO A;  3PNW C;  3OYJ A;  3A1P A;  1K73 U;  3RBB B;  3JCM b;  4M77 B;  2KRS A;  4ME7 A;  2GFA A;  3A8L B;  3EGU A;  1VQ8 Q;  1TSF A;  1VQ5 T;  3I56 Q;  1TU0 B;  1VIE A;  3CPF A;  2KDS A;  4X9C A;  4M78 G;  1U3O A;  2SRC A;  2KE9 A;  4J9F A;  2FZK B;  2VWF A;  3EG9 B;  3JCM P;  4KRT A;  2V1Q A;  2QYZ A;  2XID A;  5IAY A;  2RB6 A;  2IG0 A;  1QMC A;  4D8D A;  3BE3 A;  5A0D A;  3LH0 A;  1ARK A;  1M1K U;  3RUX A;  3SB2 A;  2EYZ A;  3UPU A;  3TRE A;  4Y28 E;  1ZBJ A;  2LP5 A;  1OI1 A;  2RMO A;  4J9C A;  4A4E A;  2ED0 A;  3WVE B;  4M78 A;  2CP0 A;  2CGH A;  2HAX A;  2KI7 A;  4J5Y A;  2O88 A;  2EQI A;  2W10 A;  5IN1 A;  2PVD B;  5C0M A;  3G4S A;  1W2B S;  5A0G A;  5AT1 B;  5FWC A;  4M75 E;  4PFZ A;  2YT6 A;  4C92 B;  4PJO A;  1W2B P;  3RMQ A;  2K5F A;  5GAN h;  4L5G A;  1WHH A;  1W2B A;  2BE7 D;  3M0U A;  3NFC A;  1KQ1 A;  5FU6 B;  2EQJ A;  4M7A F;  1D3B A;  2R57 A;  2OX7 A;  2LTO A;  2OAW A;  3KXT A;  1OYX A;  4AFS C;  3M9Q A;  1AWJ A;  2ZGW A;  4M75 F;  2JS0 A;  1VA7 A;  1BKB A;  5CQY A;  1RAF B;  1GRI A;  1X6B A;  1D1B A;  5GMK e;  2FYK A;  4E7Z A;  4OVA A;  4F7U B;  3JCM g;  1JXM A;  1YHQ Q;  1QCF A;  2EYQ A;  1QW1 A;  3M4Y A;  1R0C B;  4M78 D;  3CCV A;  2K4Y A;  2NUZ A;  3QUI A;  2VXE A;  5A2Q E;  1VQN A;  4M7A G;  3OS1 A;  1XNI A;  4F16 A;  5IXB A;  3REA B;  1YIJ A;  1Q7Y U;  1QCO A;  1BK2 A;  1SPK A;  2K9G A;  1K9M C;  4KT0 E;  4M75 G;  3EG9 A;  3HFN A;  4PK4 A;  4OF1 A;  5CKD A;  1VQP T;  2P4R A;  2GQI A;  3I35 A;  1N8R C;  2QEX Q;  2NUP A;  4Y91 A;  5A0L A;  4FYW B;  1Y57 A;  4EIK A;  4QVD A;  3G4S T;  1X2Q A;  1JJ2 S;  4RCC A;  3EHR A;  3VUB A;  3QSU A;  3MP6 A;  4QQD A;  3PE0 A;  2JXB A;  2PQW A;  2M51 A;  4XTY A;  2JUF A;  3EFO B;  3JCM e;  2QQA A;  3CXC P;  3JCM c;  3REB B;  1QVG S;  2LZ6 B;  1M4Z A;  1PRL C;  4M75 A;  2QAZ A;  2DJZ A;  2E3I A;  1RUW A;  2CP3 A;  1Q86 R;  4X9D A;  1HK9 A;  2EWN A;  3UDC A;  1AEY A;  4M78 E;  4RTV A;  3HP9 A;  4M78 C;  5CO7 A;  1IXD A;  4E7S A;  5IHI A;  5LJ3 h;  1PC0 A;  1K0X A;  5J26 A;  4X1V A;  1Q7Y R;  1B07 A;  4BE1 A;  4LNP A;  3QII A;  2QA4 Q;  3VRZ A;  2C0I A;  2MCN A;  4KUI A;  4C5E A;  4M7D B;  4BB7 A;  2QTV A;  1WJR A;  4IUT A;  1YJW Q;  1G2B A;  4M4Z A;  1JO8 A;  5CVI A;  4M77 G;  3CCM T;  5GAN j;  1D09 B;  1VQ4 T;  3QHS A;  1UG1 A;  3QXE B;  1YJN Q;  3C94 A;  1RAI B;  1CKA A;  4ZTF A;  9ATC B;  8ATC B;  3M0R A;  2CZ6 B;  3EGD A;  1ZX6 A;  3RKW A;  2HQE A;  2JT4 A;  3U23 A;  5FRN A;  4FCY A;  3CCM A;  5GAO q;  4MZM A;  3I5R A;  4CC7 A;  4EMG A;  2E64 A;  3JCM Q;  4BUG A;  2ZPG B;  3PT9 A;  3R6O A;  2HQX A;  3M56 A;  1QCN A;  1Q86 C;  2ENM A;  3QWX X;  4N0A C;  3EGX A;  4M77 A;  4MZP A;  5KH6 A;  5FRM A;  3VUZ A;  1AWX A;  2A36 A;  5CCA A;  5I2S A;  1T0H A;  5I2M A;  1X75 C;  2DRK A;  2C0T A;  4M7D C;  2O31 A;  1F1B B;  1QVP A;  4JZ3 A;  1AVZ C;  1GCQ C;  3V7C A;  5CKF A;  4OMP A;  2OTL A;  2K7A A;  2K79 A;  2J6F A;  2AZV A;  3BDU A;  4LN2 A;  2A08 A;  2DNU A;  2X3W D;  1QWE A;  3SFM A;  4DBF A;  2Y4X A;  4AT1 B;  2E65 A;  3CCE T;  2GTO A;  2P0K A;  5D6Y A;  2F5T X;  1OEB A;  2AT1 B;  2C06 A;  4AFU C;  2BKD N;  1LVK A;  1K1Z A;  5LJ3 g;  2AIR B;  5LJ5 d;  4CRI A;  5LJ5 e;  1TXQ A;  3JCM J;  3MJX A;  1PCX A;  5CIU A;  1M3A A;  2EJF A;  2OTJ T;  3HRS A;  3CCR Q;  4QQG A;  1RAC B;  1MUZ A;  2RHY A;  4JJC A;  2JZ2 A;  3SEM A;  2MAM A;  2VVK A;  2MI6 A;  2FPE A;  2CS7 A;  4PJO B;  2LC4 A;  1Q95 G;  2RNA A;  3JRZ A;  3CQT A;  2GNC A;  3CME T;  1VQL A;  1VQN T;  2JNG A;  2V8J A;  1TS9 A;  1H64 1;  2L89 A;  3J80 E;  3JB9 G;  2CUD A;  1PKS A;  4F17 A;  3CCV T;  1JBM A;  1E6H A;  3EGD B;  4XTW A;  4ZN1 A;  3OS5 A;  4J7I A;  3INZ A;  1A0N B;  1BCO A;  1WJQ A;  2DBM A;  2BZY A;  2HL5 C;  3QPH A;  4RG8 A;  1RAE B;  2A3L A;  1MMG A;  3CC4 T;  4FYV B;  3P8H A;  3CCE A;  4JJD A;  3LGL A;  2I2L A;  1PHT A;  2KY9 A;  1ZBX A;  2KR3 A;  2KYB A;  2RHZ A;  2EQU A;  1SF9 A;  3A98 A;  4LUD A;  2P0Q A;  5FRO A;  1B34 A;  1HD3 A;  2QQR A;  3E19 A;  3TU4 K;  3ZBD A;  4M77 E;  2L5Q A;  1RAB B;  3ZEH A;  4BDZ A;  3SD4 A;  4BI3 A;  4R56 A;  3KFV A;  3L2U A;  4Z89 A;  3A5Z B;  3JB9 J;  3CC2 Q;  2CP2 A;  1LNX A;  1BIA A;  2E12 A;  1X2K A;  1X6G A;  1VIF A;  4ZGJ B;  2KRN A;  2P84 A;  5GAN d;  3UA6 A;  2X51 A;  3VV0 A;  3QJY A;  1WXU A;  5GAN 5;  3KUF A;  2D6F A;  2ZZD A;  3I5S A;  2EYY A;  1PD1 A;  1TUD A;  1YIJ Q;  2PTK A;  3HTR A;  5HCK A;  3C4S A;  2LDM A;  4M7D G;  3CBP A;  1WQW A;  4JPB W;  1W1F A;  4QQ6 A;  2GCX A;  2RPN A;  7AT1 B;  1SG5 A;  2KRM A;  4K11 A;  2CZ0 B;  2GBQ A;  1P92 A;  2DXB A;  5GAO m;  3OYC A;  4KUD K;  2OTL Q;  2JJ9 A;  3RIR A;  1UE9 A;  4C5I A;  1K8A C;  1VQ5 A;  4PJM A;  3LGF A;  5DY9 A;  4RMO A;  5LL6 S;  5GAN 2;  3MO8 A;  5GJW B;  4EDU A;  1YCS B;  2HKN A;  3I55 A;  3SDZ A;  4BE0 A;  4C8Q G;  3G6E A;  3MKD A;  2R5A A;  1M90 R;  3QWY A;  4HT8 A;  4RUG A;  5M9O A;  1BB9 A;  4EPC A;  2JTM A;  1PKT A;  3CCR T;  4AG1 C;  3PVL A;  3CC7 T;  4XU0 A;  4Y92 A;  1YIT A;  1YCY A;  1PWT A;  2KMT A;  5CKB A;  4IIO A;  3F70 A;  1KK7 A;  2HSP A;  4WTO B;  2M16 A;  3RKY A;  2COZ A;  3O5Z A;  4F7U G;  5GAO n;  4JRI A;  5GMK h;  3CCS A;  1KHI A;  4ORZ A;  2BE9 B;  5FU6 C;  3RR6 A;  3SWN A;  4RTT A;  3HFO A;  3OB9 A;  3THK A;  5GAM d;  1WQ7 A;  2RM4 A;  4LD9 K;  4YTL A;  4M7A D;  2E5K A;  2FPD A;  2FRY A;  3D7S B;  3L2Z A;  1VQO A;  1NJI C;  2DET A;  4PJL A;  1OU8 A;  4II1 A;  4MDX A;  3OYK A;  1JEG A;  1BBZ A;  2YUN A;  5GAN e;  1KC8 R;  4WCI A;  3RMS A;  4LD6 A;  2B86 A;  5KYU A;  2XD0 A;  1WGS A;  1XJW B;  3L42 A;  4FSX A;  4LXC A;  4BY6 C;  8AT1 B;  1XOV A;  2DYI A;  2LNH B;  4OGE A;  1LOJ A;  4E2F B;  4C0D C;  1VYT A;  1RLP C;  4E7J A;  4C5H A;  4C5G A;  3L2R A;  2RHI A;  5KYY A;  1FMK A;  4Z88 A;  3NHN A;  2LCL A;  3KBG A;  4RTY A;  1DJ7 B;  2K3Y A;  4JJB A;  1TTH B;  3CME A;  1VQL T;  1ZHI A;  4J9G A;  5GAM j;  5KYW A;  1QQJ A;  1G3T A;  3MET A;  3SHW A;  4KGZ B;  3L2W A;  2PUO B;  1WHK A;  1QWF A;  2K2M A;  1C6V X;  1SHG A;  3OYN A;  1OQK A;  2B8A A;  2CSQ A;  1BI1 A;  2SEM A;  1X6O A;  4ZGE B;  3L2Q A;  4JRK A;  1MMN A;  4ZTJ A;  5FW9 A;  2RF0 A;  3Q1J A;  4M7D E;  4E7H A;  2F2X A;  4PFP A;  1B7T A;  2X3X D;  1ZQ1 A;  5GAM g;  3LYI A;  2DLP A;  3M0T A;  2FO0 A;  1K9A A;  2NUP B;  1VQ9 Q;  4AFZ C;  1Q81 R;  1VQM T;  2VC8 A;  3VS0 A;  3OBY A;  4ANJ A;  2VGN A;  2ZAE A;  2Y90 A;  3CC7 A;  3BFM A;  3PIP A;  1VQ7 Q;  2MWO A;  1M3B A;  4C8Q E;  4KUL A;  2E5Q A;  2JMC A;  3ER0 A;  4NL2 A;  4XU3 A;  2KXD A;  3I55 T;  3CMA T;  2J7I A;  1GBQ A;  3QYG B;  3CC2 T;  1OPL A;  1N27 A;  1I07 A;  4J9E A;  2DA9 A;  3QYH B;  4C0G A;  3M0P A;  1U5S A;  3NPF A;  4ESR A;  1Q81 C;  3L1A A;  3VS7 A;  5D6W A;  3FRN A;  2RJC A;  3EG3 A;  3EFO A;  4DQ2 A;  4O5V A;  2AKK A;  2D0Q B;  3CME Q;  4A4F A;  2F69 A;  3R6N A;  3CCU T;  2BZ8 A;  4CI0 C;  1ZSZ B;  1I81 A;  3CCV Q;  2KVQ G;  4PLL A;  5FU7 C;  1YP5 A;  2RQT A;  2DM1 A;  2MWP A;  3OMC A;  2YRV A;  1IGQ A;  4LUE A;  4C0F A;  1VQ6 Q;  1N6A A;  4R0K A;  4VUB A;  1AOJ A;  1UJY A;  1WHM A;  1WX6 A;  2BZX A;  2PUK B;  2RJE A;  1WA7 A;  2DO3 A;  1RI0 A;  5KYX B;  4IKF A;  1OU9 A;  3C12 A;  1D1A A;  1VQ6 A;  5AYF A;  3M58 A;  1MND A;  2OI3 A;  3OYD A;  4J9D A;  4O6J A;  2HSE B;  1D3B B;  1I4K 1;  2DXT A;  4PJJ A;  2QI2 A;  2LJ3 A;  2X4W A;  4XU2 A;  2QTX A;  4M77 D;  1EFN A;  3J7A F;  4NL3 A;  3BDL A;  1KD1 R;  1GCP A;  3A8O B;  3LW5 E;  3JAM E;  2R58 A;  3CCQ A;  1K4U S;  2YRD A;  1VQ4 Q;  1ZSZ A;  2X9H A;  2E70 A;  3S6W A;  3V7S A;  2J06 A;  2KAF A;  1VQ7 A;  1ZSZ C;  5EG2 A;  1UTI A;  1OPK A;  2FHD A;  1UGS B;  1KD1 C;  2VXF A;  2K3X A;  3OS0 A;  2DXC A;  2QQB A;  1WYX A;  2XDP A;  2FZC B;  5DM7 R;  4MDW A;  1O9S A;  4C8Q A;  1W6X A;  1VYV A;  4J9B A;  2WSE E;  4LE9 A;  1M1F A;  4M7A C;  4AG2 C;  3JB9 D;  3URG A;  4XK8 E;  3P8B B;  3A8M B;  3JCM V;  1AD5 A;  5LJ5 j;  1VQ8 T;  1FX7 A;  2WSC E;  1MNE A;  1N5Z A;  2L3Q A;  1YIJ T;  1RLQ C;  1H8K A;  1D1C A;  1UUE A;  2HCK A;  1W4S A;  4IUQ A;  2LQW A;  1ZLM A;  2QGF B;  3IQL A;  2QEX A;  4HT9 A;  3VS6 A;  1M27 C;  1PM3 A;  2CYZ B;  5LJ5 h;  1NZ9 A;  2LQN A;  1HXD A;  5GMK j;  4Z02 A;  4OB1 B;  1OOT A;  5KYY B;  1R8O B;  1M2V A;  1B34 B;  3OW2 S;  4KBM B;  1V1C A;  2X4X A;  2HDA A;  1M1G A;  1UHF A;  3I9Q A;  4FW1 A;  3CCQ Q;  4QVZ A;  3TQ7 P;  1KG1 A;  4HA8 A;  4PJO F;  4M75 C;  3S3M A;  2PVG B;  1FYN A;  5KYW B;  2L3R A;  3S3N A;  3VJP A;  1SSF A;  2QK0 A;  3JV3 A;  2X35 A;  1N9R A;  4GLM A;  1H92 A;  3G1J A;  2QG9 B;  1VQO T;  2DIG A;  2RQV A;  1I1J A;  2LQ8 A;  1KC8 U;  3GBQ A;  1VQ6 T;  3WXM B;  3J81 E;  1G3S A;  1RAD B;  2CH4 A;  4HXJ A;  2PNI A;  3FJ5 A;  3GNG A;  1NBE B;  1VQK A;  5EC7 A;  5ECA A;  3OY9 A;  5GAN 4;  4LDX A;  1AZE A;  4HCK A;  5IHN A;  2HKQ B;  2M0Y A;  4J8O A;  4CC3 A;  3I56 T;  5IXF A;  1S1N A;  4ZN3 A;  4PJO G;  4JLG A;  3ZL7 C;  1M90 C;  5KCO A;  1QVF A;  1XQH A;  2QQS A;  5I11 A;  1RAA B;  1UGR B;  4A4K A;  2DVE A;  5LJ5 f;  1H3Z A;  1Y96 B;  2M0O A;  1WI7 A;  2XIC A;  4L59 A;  1VQ4 A;  2KT8 A;  1Z9Z A;  1JQQ A;  1M3C A;  2NUT B;  3OYF A;  4KGV B;  2VKN A;  3MP8 A;  2FL7 A;  3CCJ Q;  2JOY A;  2A37 A;  2LJ1 A;  1C1A A;  4FT4 A;  5CQX A;  1VQ9 A;  1I0C A;  3CC2 A;  1LJO A;  5KCH A;  2YSQ A;  2KNB B;  4RTZ A;  1CSK A;  4PJN A;  4RCB A;  5KE2 A;  1ZUK A;  1WXT A;  2EKO A;  1PRM C;  3M5A A;  2CZ1 B;  1QVF S;  4XTX A;  4JRP A;  3N5B B;  2RQW A;  3UA7 A;  2RI2 A;  1YNZ A;  3TCJ A;  4NOY A;  4M7D D;  1UDL A;  4CC2 A;  4N4H A;  1YJN A;  3I56 A;  1VQM A;  1IHW A;  4OMQ A;  2M1H A;  4HVU A;  3JB9 H;  1WXB A;  2CP7 A;  5GAN 7;  3O8V A;  2HMA A;  3QDF A;  5GMK m;  1X01 A;  4OP0 A;  2RK1 A;  1V29 B;  4JLI A;  2KT1 A;  3GNF B;  2O4X B;  4IUU A;  1VQP A;  2F2V A;  1UEC A;  2JS2 A;  3C0C A;  3FIF A;  3OYG A;  4C92 D;  1WLP B;  1QVG A;  1N8R R;  1YBY A;  4OML A;  2LNV A;  1BI0 A;  4C8Q D;  5GAM e;  3CMA Q;  2L3S A;  2VGM A;  1NYF A;  1RAG B;  1YJW T;  3CD6 A;  3OW2 P;  1KIK A;  1YI2 A;  1O75 A;  2EYW A;  3OYB A;  3G6E Q;  4C0D B;  1G83 A;  4JUV A;  1UJ0 A;  4OB0 B;  3CCU Q;  2OJ2 A;  1I8F A;  1IHV A;  3LH5 A;  3RDV A;  2QEX T;  4MZT A;  1R77 A;  1WZO A;  4BI8 B;  5HK0 A;  1Z9Q A;  3PTA A;  1NYG A;  1K73 C;  2EGA A;  4C0Z A;  3H6Z A;  4RG2 A;  3ZFJ A;  2DTI A;  1YI2 T;  2RA2 A;  1SRM A;  3MEU A;  3V8J A;  1NJI U;  3ULR B;  1YJW A;  4GBQ A;  1WDX A;  2HD0 A;  4B6M A;  1K73 R;  2E4H A;  4C92 E;  4ELY C;  1V76 A;  1TH7 A;  5LJ3 j;  2C0O A;  5C6S A;  1PD0 A;  2QQ9 A;  3E1S A;  3H8Z A;  1S72 A;  2ED1 A;  1PSE A;  3X26 B;  1J3T A;  5IHK A;  4BY6 B;  1LPL A;  1Q82 U;  1KQ2 A;  1SKU B;  3FC3 A;  3CC4 Q;  4OMF B;  4HVV A;  5GJV B;  2VYT A;  5I22 A;  2D1X A;  5HK3 A;  4BD3 A;  3OYI A;  2A7Y A;  5CKH A;  1PNJ A;  4FU6 A;  2PZ1 A;  4EMK A;  3OYM A;  3OYL A;  3PGG A;  1YFN A;  2XKO C;  1TUG B;  2FEI A;  3M0Q A;  3OS2 A;  2GF7 A;  4E47 A;  2CP5 A;  2YXY A;  2XMF A;  3C95 A;  3JCM W;  5LJ3 d;  1M2O A;  1UGP B;  4QT7 A;  3M0S A;  3G71 T;  1M30 A;  5FLX E;  1BYM A;  2RO0 A;  2E3H A;  1R0B G;  1ABQ A;  1MMA A;  1UGV A;  1YWP A;  3G71 Q;  4HCZ A;  3DLL A;  1AZG B;  1YWO A;  2O2O A;  1AT1 B;  2YLB A;  1OZ2 A;  1RL2 A;  1NJI R;  3EG2 A;  2K3B A;  2ESW A;  4JDS A;  1ZUY A;  4M7A A;  4F7U E;  3LWH A;  4EMK B;  3OA6 A;  2HNI A;  4FW2 A;  3EH1 A;  4C8Q C;  3HPW A;  1ABO A;  1W70 A;  2V8K A;  2CP6 A;  4OMM A;  5HY6 A;  4IUV A;  3RNJ A;  2EKH A;  4JJN K;  1IO6 A;  1ACM B;  2LQK A;  1WHJ A;  3CEY A;  1WHG A;  3EG0 A;  2XU8 A;  2KGT A;  4PNO A;  1ZA1 B;  4EMH A;  1T0J A;  1Q7Y C;  1OZ3 A;  4HCB A;  5LJ3 f;  1AHJ B;  1VQK T;  1K9M U;  3UT1 A;  4J7F A;  3FB9 A;  2E6N A;  2K5I A;  3CMA A;  3CCJ A;  4M77 F;  2RN8 A;  1N8R U;  3UWN A;  1FMW A;  1T3L A;  1OV3 A;  5GAN 6;  3CCE Q;  1TUC A;  1YJ9 A;  1BI3 A;  3TVT A;  1Q81 U;  2BUD A;  2QDY B;  3GPL A;  1KSW A;  2EQK A;  5KYU B;  2DEQ A;  1VQO Q;  2DTH A;  5HKC A;  2D8J A;  5GAO r;  1JJ2 A;  2XDD A;  3RKX A;  5FWB A;  1GBR A;  2DIQ A;  1IRX A;  1VOM A;  4DOV A;  5GMK i;  5L8R E;  2O9V A;  2FZG B;  3JCM h;  2YUO A;  2E41 A;  2P0P A;  3HRU A;  3VS3 A;  3H0I A;  1YHQ A;  3HL8 A;  2LT1 A;  2GTJ A;  2M02 A;  2CT4 A;  1GCQ A;  4C92 C;  3FEO A;  1WHL A;  3EHQ A;  4DBQ A;  2IIM A;  1JU5 C;  3VKI A;  4C92 G;  2EGC A;  2DD5 A;  3X24 B;  2JMA A;  1M8V A;  2MK5 A;  3ME9 A;  5GAN f;  1FWZ A;  5FU7 B;  2G3R A;  3E9G A;  2L0A A;  3PMT A;  2RI3 A;  4NS5 A;  1JRI A;  4PJO D;  1IB8 A;  1QKW A;  2XHC A;  3NTH A;  3CBM A;  2JN0 A;  1T3S A;  2L8D A;  4DOW A;  1VYU A;  2HZY A;  4A63 B;  4IUP A;  3VS2 A;  3QJ6 A;  5GAN 3;  4AMC A;  3GLX A;  1SEM A;  4C92 F;  2IPO B;  4J83 A;  3X25 B;  3OSV A;  2JTE A;  1WPY A;  1H3H A;  3OMG A;  2OTJ Q;  4F7U A;  4M7A E;  4QKU A;  1E7O A;  5GAO p;  1Q86 U;  2E6Z A;  1VQN Q;  4J9H A;  2LX7 A;  2ZPI B;  2DL8 A;  4OMN A;  2NLU A;  3HKS A;  2EFI A;  2LRQ A;  1QP2 A;  4RTX A;  2JVV A;  3MP1 A;  1WJS A;  1X27 A;  2YDL A;  2PU9 B;  3JB9 F;  2QXF A;  3CPW P;  4M7D F;  1ZSG A;  3H9N A;  2IVW A;  2FG0 A;  2NWM A;  1VQ5 Q;  2EGE A;  2NUT A;  2AZS A;  1X43 A;  4A4H A;  2VAS A;  3OBW A;  1M8M A;  3PIO A;  3CCL Q;  1FMV A;  4ZGD B;  4J6Y A;  3CD6 Q;  3EH2 A;  3QZ9 B;  4ELZ C;  1RI9 A;  2K5L A;  3CCL T;  3CCM Q;  1EIF A;  4ATO A;  4B9W A;  2YLC A;  5D7U A;  3BY7 A;  4FSS A;  1M1K C;  5LJ5 g;  2EW3 A;  3QG1 A;  3DB3 A;  1VQM Q;  2ZPE B;  3TEE A;  5KE3 A;  1K9M R;  2LX9 A;  4QW2 A;  1MMD A;  4V2S A;  1UGQ B;  4PL6 A;  1MV3 A;  2Z0W A;  2LCC A;  4LDY A;  3OYY A;  1VQL Q;  2FB7 A;  3G6E T;  1QP3 A;  3CC7 Q;  1Y7X A;  4FIB A;  4DBH A;  3LX7 A;  2YRC A;  2AK5 A;  3A8G B;  3MEV A;  4BI4 A;  1BIB A;  4F7U F;  1BCM A;  2DX1 A;  2RQU A;  1G8X A;  1NLP C;  3EG1 A;  2ZPB B;  4FYX B;  3TSW A;  2COY A;  4LDU A;  4JS4 A;  5CAI A;  2EYX A;  1AWW A;  1ZA2 B;  2D8H A;  4M7D A;  2R5M A; 
#chains in the Genus database with same CATH homology
 1BI2 A;  2EKO A;  3JSC A;  2R5A A;  2VUB A;  4MMK A;  3JCM P;  3M5A A;  2CZ1 B;  4HT8 A;  3LLR A;  4XTX A;  4JRP A;  2XID A;  5M9O A;  5IAY A;  4EPC A;  2JTM A;  3N5B B;  2DPP B;  2RB6 A;  3NTK A;  4M7A B;  2IG0 A;  4M77 C;  2RI2 A;  3TCJ A;  4NOY A;  3CCR T;  2AHJ B;  4N0A A;  3M53 A;  5A0D A;  3LH0 A;  4BE2 A;  1M1K U;  3CC7 T;  4XU0 A;  3RER A;  4M7D D;  1YIT A;  3RUX A;  1YCY A;  1JB0 E;  2KMT A;  3DB4 A;  4N4H A;  5CKB A;  3SB2 A;  3F70 A;  1YJN A;  3UPU A;  2M16 A;  3I56 A;  4JS5 A;  3TRE A;  3RKY A;  1VQM A;  4Y28 E;  1Q82 C;  1G3W A;  1OI1 A;  4XU1 A;  4F7U G;  5GAO n;  4JRI A;  5GMK h;  3CCS A;  2M1H A;  1KHI A;  3EAE A;  3JB9 H;  1MHN A;  4TVR A;  5FU6 C;  3SWN A;  4A4E A;  2O4X A;  4PJO C;  5GAN 7;  3O8V A;  3WVE B;  4M78 A;  3HFO A;  2RI5 A;  3OB9 A;  4E7K A;  5GAM d;  1WQ7 A;  2CGH A;  5GMK m;  1X01 A;  2RM4 A;  4GLK A;  4LD9 K;  2HAX A;  4OP0 A;  5J39 A;  4J5Y A;  4C8Q F;  2RK1 A;  4YTL A;  4M7A D;  1V29 B;  4JLI A;  2PVD B;  5IN1 A;  5C0M A;  5GAM h;  3G4S A;  3HHT B;  1W2B S;  1VQO A;  3L2Z A;  5A0G A;  1NJI C;  3GNF B;  4M75 E;  2EIF A;  2O4X B;  1NPR A;  4C92 B;  4PJO A;  4IUU A;  4Q5W A;  3RMQ A;  1VQP A;  4II1 A;  4MDX A;  2K5F A;  5GAN h;  3OYK A;  4L5G A;  3FIF A;  2K2V A;  1W2B A;  2XDB A;  3OYG A;  1S72 T;  3NFC A;  1KQ1 A;  4C92 D;  1UB4 A;  4WF2 A;  5GAN e;  5FU6 B;  3RMS A;  3FDR A;  3OYE A;  1QVG A;  2EQJ A;  1YBY A;  4LD6 A;  1D3B A;  4M7A F;  3JB9 I;  2RHX A;  2LNV A;  1BI0 A;  4OB2 B;  4BDY A;  4C8Q D;  2R57 A;  2XD0 A;  5GAM e;  2DZC A;  1WGS A;  3V7R A;  2LTO A;  2VGM A;  4FSX A;  3L42 A;  3KXT A;  1YJW T;  1OYX A;  4BY6 C;  1XOV A;  3CD6 A;  3M9Q A;  3NTI A;  3CC4 A;  2ZGW A;  4OGE A;  2PVO B;  3OQ5 A;  4M75 F;  1LOJ A;  1BKB A;  2RJF A;  1YI2 A;  5CQY A;  4XTV A;  1O75 A;  3OYB A;  4C0D C;  1G5V A;  4GY5 A;  5IT9 E;  3SWN B;  3M4G A;  4C0D B;  5GMK e;  2FYK A;  4JUV A;  4E7J A;  4N4G A;  4OB0 B;  4C5H A;  3DKM A;  4OVA A;  4C5G A;  4F7U B;  3L2R A;  3JCM g;  3CXC A;  1I8F A;  2RHI A;  2QEX T;  2EYQ A;  1QW1 A;  3M4Y A;  4MZT A;  3CPW S;  4BI8 B;  5HK0 A;  4M78 D;  3CCV A;  2K4Y A;  3PTA A;  2LCL A;  3KBG A;  3JCM d;  1K73 C;  3QUI A;  3H6Z A;  4RG2 A;  4C0Z A;  4PLI A;  3ZFJ A;  1DJ7 B;  2DTI A;  2K3Y A;  2VXE A;  4XQ3 A;  3GOX A;  1YI2 T;  4PKC C;  5A2Q E;  2RA2 A;  1VQN A;  3ASK A;  3CME A;  1VQL T;  2CKK A;  3MEU A;  3GIB A;  1ZHI A;  4M7A G;  3OYH A;  3CD6 T;  3V8J A;  1NJI U;  4M75 B;  3OS1 A;  4E7L A;  5GAM j;  1YJW A;  1G3T A;  1I5L A;  2HD0 A;  3MET A;  1XNI A;  1YIJ A;  1Q7Y U;  4C92 E;  4ELY C;  3L2W A;  1TH7 A;  2PUO B;  5LJ3 j;  1K9M C;  4KT0 E;  5C6S A;  4M75 G;  5DLO A;  3OYN A;  2QQ9 A;  3E1S A;  4R55 A;  4HCC A;  2M9U A;  3H8Z A;  4J6W A;  1S72 A;  3HFN A;  3X26 B;  1PSE A;  4DA4 A;  1M90 U;  2B8A A;  4OF1 A;  5CKD A;  1VQP T;  1BI1 A;  1X6O A;  2LT4 A;  2JTF A;  2RJD A;  4FT2 A;  4BY6 B;  4ZGE B;  3L2Q A;  4JRK A;  4HKE A;  1N8R C;  4Y91 A;  4A4G A;  1Q82 U;  5A0L A;  4ZTJ A;  1KQ2 A;  5GAN g;  4QVD A;  3G4S T;  3FC3 A;  3Q1J A;  4OMF B;  1JJ2 S;  4M7D E;  4RCC A;  4E7H A;  4FL6 A;  2VYT A;  3VUB A;  3OW2 A;  3QSU A;  3MP6 A;  4QQD A;  1ZQ1 A;  5HK3 A;  4BD3 A;  3OYI A;  2PQW A;  5GMK l;  5GAM g;  3LYI A;  2A7Y A;  4XTY A;  5CKH A;  4FU6 A;  4EMK A;  2JUF A;  4OB3 B;  3OYM A;  1WNL A;  3JCM e;  3QZ5 B;  2QQA A;  4XTZ A;  5GAN 8;  3JCM c;  3OYL A;  1QVG S;  3PGG A;  1M4Z A;  2XKO C;  4M75 A;  2VC8 A;  1VQM T;  2XK0 A;  3OBY A;  3OS2 A;  2DJZ A;  2GF7 A;  2VGN A;  4E47 A;  2Y90 A;  1YIT T;  3CC7 A;  3BFM A;  3C95 A;  4X9D A;  3JCM W;  1HK9 A;  3PIP A;  2EWN A;  2ZPF B;  3CCQ T;  3CCR A;  3UDC A;  5LJ3 d;  4A54 A;  2MWO A;  5GAO l;  4M78 E;  1UGP B;  4C8Q E;  4KUL A;  2WAC A;  3HP9 A;  3G71 T;  2E5Q A;  2X4J A;  4M78 C;  3ER0 A;  5CO7 A;  4NL2 A;  5FLX E;  4A53 A;  4XU3 A;  1BYM A;  2RO0 A;  2RHU A;  4LDV A;  5LJ3 h;  4HCZ A;  3DLL A;  5J3B A;  3I55 T;  3CMA T;  5J26 A;  1MGQ A;  4BE1 A;  3QYG B;  2YLB A;  3CC2 T;  2F5K A;  1VQ9 T;  3QII A;  1OZ2 A;  3L2V A;  1N27 A;  1RL2 A;  2X4Y A;  3QYH B;  2DK3 A;  2WSF E;  2XI9 A;  4KUI A;  2DXU A;  4JDS A;  4C0G A;  4C5E A;  4M7D B;  1Q81 C;  3L1A A;  4BB7 A;  5GAM f;  5D6W A;  4M7A A;  3FRN A;  4F7U E;  1WJR A;  2RJC A;  3LWH A;  1G3Y A;  4PJO E;  4IUT A;  2GQV A;  4DQ2 A;  4EMK B;  3OA6 A;  2HNI A;  5CVI A;  4M77 G;  3CCM T;  4O5V A;  5GAN j;  4IUR A;  4C8Q C;  1VQ4 T;  3QHS A;  3HPW A;  2D0Q B;  4L6V 5;  2MMP A;  2F69 A;  2V8K A;  2KSS A;  3QXE B;  4A4F A;  3MHX A;  4EMK C;  2MF2 A;  3C94 A;  1FXX A;  5HY6 A;  1KQS S;  4ZTF A;  3DLM A;  4CI0 C;  1I81 A;  2KVQ G;  4IUV A;  1NE8 A;  2CZ6 B;  1VUB A;  4JJN K;  4PLL A;  5FU7 C;  3RKW A;  2HQE A;  5FRN A;  2MWP A;  3OMC A;  2LQK A;  3CEY A;  2YRV A;  3EFR A;  1Y07 A;  5CR2 A;  3CCU A;  2XU8 A;  4C0F A;  2DZ9 A;  1N6A A;  4PNO A;  4MZM A;  5GAO q;  3CCM A;  4VUB A;  4EMG A;  2E64 A;  3M54 A;  2KK4 A;  4EMH A;  2V8I A;  3JCM Q;  1Q7Y C;  1OZ3 A;  4M78 B;  4BUG A;  2CZ7 B;  2ZPG B;  3PT9 A;  2PUK B;  2HQX A;  3R6O A;  4HCB A;  2RJE A;  3M56 A;  1Q86 C;  5LJ3 f;  1AHJ B;  3CCL A;  1VQK T;  1K9M U;  1Y71 A;  3UT1 A;  2ZPH B;  2DO3 A;  4C8Q B;  1RI0 A;  4N0A C;  4J7F A;  4IKF A;  4M77 A;  4MZP A;  2D9T A;  5KH6 A;  3C12 A;  3FB9 A;  2E6N A;  2K5I A;  5FRM A;  1VQ6 A;  3CMA A;  3VYG A;  3CCJ A;  5AYF A;  4C92 A;  4M77 F;  3VUZ A;  3MCA B;  1N8R U;  3M58 A;  3G7Z A;  1KHC A;  3JCM f;  3UWN A;  5CCA A;  5I2S A;  3OYD A;  5I2M A;  5GAN 6;  1X75 C;  5CKE A;  4O6J A;  4X34 A;  3GP8 A;  3CXC S;  1QVF S;  1D3B B;  1I4K 1;  2DXT A;  1YJ9 A;  2QI2 A;  4M7D C;  1BI3 A;  4B9X A;  3G71 A;  2X4W A;  1QVP A;  4XU2 A;  1Q81 U;  2QTX A;  3V7C A;  4M77 D;  2Y4Y A;  5CKF A;  3J7A F;  3V8K A;  4NL3 A;  2OTL A;  1IRE B;  2BUD A;  2QDY B;  3BDL A;  3GPL A;  3A8O B;  3LW5 E;  3JAM E;  2EQK A;  2R58 A;  3CCQ A;  2DEQ A;  2DTH A;  5HKC A;  3EFS A;  5GAO r;  1JJ2 A;  4XAX B;  2XDD A;  1M8V A;  2E70 A;  3RKX A;  3S6W A;  3V7S A;  3OYA A;  2DIQ A;  1M5Q 1;  2KAF A;  2KQW A;  3BDU A;  4D6W A;  4DOV A;  3M57 A;  5GMK i;  3CCU T;  1VQ7 A;  4MML A;  5L8R E;  5EG2 A;  3VU3 C;  1KC8 C;  3HSB A;  3SFM A;  2Y4X A;  3JCM h;  2E41 A;  2FHD A;  2P0P A;  3HRU A;  1UGS B;  1KD1 C;  1YHQ A;  3HL8 A;  2E65 A;  2LT1 A;  2K3X A;  2VXF A;  3OS0 A;  3CCE T;  4C92 C;  2DXC A;  2QQB A;  1IZ6 A;  2P0K A;  2YHT A;  2F5T X;  3CBO A;  3FEO A;  5D6Y A;  2XDP A;  2C06 A;  1UEB A;  3JCM X;  1KQS A;  2ZCF B;  2BKD N;  5DM7 R;  4MDW A;  1O9S A;  3VKI A;  4C92 G;  5LJ3 g;  4C8Q A;  2DD5 A;  3X24 B;  2H3J A;  5LJ5 d;  4CRI A;  3ME9 A;  3BW1 A;  5LJ5 f;  5LJ5 e;  2WSE E;  3HRT A;  4OGC A;  5GAN f;  1M1F A;  3X28 B;  3JCM J;  4M7A C;  3QO3 A;  5CIU A;  1FWZ A;  2EJF A;  2OTJ T;  4FM4 B;  5FU7 B;  2QA4 T;  2G3R A;  4RKU E;  3HRS A;  3M55 A;  3JB9 D;  3URG A;  3E9G A;  4QQG A;  4XK8 E;  5I21 A;  3P8B B;  3A8M B;  3PMT A;  2RI3 A;  2RHY A;  4NS5 A;  1JRI A;  2JZ2 A;  4PJO D;  1Y96 A;  3QBY A;  2MAM A;  3JCM V;  2O01 E;  5LJ5 j;  2MI6 A;  1FX7 A;  2XHC A;  3NTH A;  3CBM A;  2CS7 A;  4BAC A;  1VQ8 T;  2WSC E;  2JN0 A;  3A8H B;  2DD4 A;  1NPP A;  4J6X A;  5LJ3 e;  1YIJ T;  4PJO B;  2LC4 A;  2L8D A;  4DOW A;  4IUP A;  3JRZ A;  2FVU A;  3QJ6 A;  5GAN 3;  4N4I A;  1N9S A;  3CME T;  1VQL A;  1VQ8 A;  1VQN T;  3AHU A;  2JNG A;  2DAQ A;  2V8J A;  1W4S A;  4IUQ A;  1H64 1;  2L89 A;  3GLX A;  4P5N A;  3J80 E;  3JB9 G;  2VV5 A;  4JRQ A;  4C92 F;  4J83 A;  3X25 B;  2EAY A;  3S3O A;  3CCV T;  1U8R A;  2QA4 A;  3OSV A;  2OTJ A;  1JBM A;  3WVD B;  3FLG A;  2QEX A;  4XTW A;  3LWI A;  4HT9 A;  4ZN1 A;  3OS5 A;  5D6X A;  1WPY A;  2CYZ B;  4J7I A;  3E9F A;  3OSS C;  3INZ A;  3OMG A;  5LJ5 h;  1NZ9 A;  1HXD A;  3FJP A;  1WJQ A;  5GMK j;  4Z02 A;  4OB1 B;  4F7U A;  2RD1 A;  4M7A E;  2EQM A;  1XTD A;  1Q86 U;  5GAO p;  2LVM A;  1R8O B;  3QPH A;  2E6Z A;  4RG8 A;  2A3L A;  1PSF A;  3CC4 T;  1B34 B;  3OW2 S;  4KBM B;  2ZPI B;  3P8H A;  3CCE A;  3GF5 A;  1YHQ T;  3LGL A;  3P8D A;  2X4X A;  1U1S A;  1M1G A;  2I2L A;  2DTO A;  2NLU A;  3HKS A;  2KY9 A;  2EFI A;  4QVZ A;  1VQ7 T;  1ZBX A;  2LRQ A;  1KG1 A;  2RHZ A;  1QP2 A;  4HA8 A;  2EQU A;  2JVV A;  4M75 C;  3MP1 A;  2OAU A;  4PJO F;  3SWN C;  1WJS A;  2PVG B;  3S3M A;  2L3R A;  2P0Q A;  5FRO A;  4QVC A;  3VJP A;  1B34 A;  3S3N A;  2PU9 B;  3JB9 F;  1SSF A;  2QQR A;  2QXF A;  2RH2 A;  3E19 A;  3QDR B;  4M7D F;  1GXI E;  2GFU A;  3TU4 K;  3MEW A;  3ZBD A;  2OTL T;  2E1H A;  3QKJ A;  4M77 E;  2L5Q A;  2X35 A;  1K8A U;  2IVW A;  2EJG A;  2P4T A;  1N9R A;  3ZEH A;  4BDZ A;  3SD4 A;  4UC4 A;  4BI3 A;  1VQO T;  1YJ9 T;  3PMI A;  2DIG A;  4R56 A;  3L2U A;  2LQ8 A;  3A5Z B;  4XTU A;  3OBW A;  4A4H A;  3JB9 J;  1LNX A;  1KC8 U;  1BIA A;  2E12 A;  3CCJ T;  1VQ6 T;  2DKG A;  3PIO A;  3PFS A;  4ZGD B;  3WXM B;  3J81 E;  1G3S A;  1VIF A;  4J6Y A;  3X20 B;  4ZGJ B;  3M59 A;  3CPW A;  1KD1 U;  3QZ9 B;  1M9S A;  4ELZ C;  5GAN d;  3GNG A;  4LDW A;  2K5L A;  1VQK A;  3CCL T;  1EIF A;  3OY9 A;  5GAN 4;  3CCS T;  3VV0 A;  3VYH B;  4LDX A;  4ATO A;  4B9W A;  3QJY A;  5GAN 5;  2RK2 A;  2YLC A;  3KUF A;  2D6F A;  2ZZD A;  3T9N A;  4J8O A;  3I56 T;  4E7I A;  1YJN T;  4M78 F;  3BY7 A;  4ZN3 A;  4PJO G;  3MEA A;  1M1K C;  2BIV A;  4JLG A;  5LJ5 g;  1M90 C;  1U1T A;  2XG8 D;  3C4S A;  3QG1 A;  3DB3 A;  5KCO A;  2LDM A;  5DLQ E;  4M7D G;  2ZPE B;  3TEE A;  1QVF A;  3CBP A;  5KE3 A;  1WQW A;  1XQH A;  2LX9 A;  2QQS A;  4QW2 A;  3RES A;  2K57 A;  4V2S A;  1UGQ B;  4PL6 A;  4A4K A;  1UGR B;  2HBP A;  2LCC A;  2DVE A;  2E10 A;  2EJ9 A;  4LDY A;  4M75 D;  4QQ6 A;  2GCX A;  3OYY A;  1Y96 B;  3V8L A;  1H3Z A;  2FB7 A;  3G6E T;  2M0O A;  2XIC A;  2CZ0 B;  4L59 A;  1VQ4 A;  1QP3 A;  5CK9 A;  1Y7X A;  1P92 A;  2DXB A;  4FIB A;  3PNW C;  3OYJ A;  5GAO m;  3LX7 A;  3OYC A;  4KUD K;  3OYF A;  3A8G B;  3MEV A;  3JCM b;  4BI4 A;  1K73 U;  4M77 B;  1BIB A;  3MP8 A;  3RIR A;  4C5I A;  2FL7 A;  4F7U F;  4ME7 A;  1K8A C;  2GFA A;  2JOY A;  3A8L B;  1VQ5 A;  3LGF A;  2ZPB B;  4FT4 A;  5DY9 A;  4RMO A;  5CQX A;  1VQ5 T;  4LDU A;  5LL6 S;  5GAN 2;  1VQ9 A;  4JS4 A;  1VIE A;  3CPF A;  3MO8 A;  5CAI A;  1LJO A;  3CC2 A;  4EDU A;  2KDS A;  4X9C A;  5KCH A;  3I55 A;  4M78 G;  3SDZ A;  4BE0 A;  4RCB A;  4C8Q G;  5KE2 A;  3G6E A;  4M7D A;  2R5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...