1H641

Crystal structure of the sm-related protein of p. abyssi: the biological unit is a heptamer
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDNVLAISPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SNRNP SM-LIKE PROTEIN
publication title Crystal Structures of the Pyrococcus Abyssi Sm Core and its Complex with RNA.Common Features of RNA Binding in Archaea and Eukarya
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Sm-like protein
total genus 13
structure length 71
sequence length 71
chains with identical sequence 2, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2001-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1h64100
4M7AG 5LJ5j 2VXEA 3JCMc 4C92A 1JRIA 1I4K1 2ZGWA 1KQ2A 3JB9H 2RM4A 1B34B 4M7AF 3JCMQ 3RIRA 1WQ7A 4X9CA 4XU3A 5GAOq 5GAOr 1B34A 2DJZA 4J5YA 4M77G 4M75C 4N0AC 2DEQA 2DKGA 4OP0A 3VU3C 5GMKj 5LJ3j 5GAN6 3JCMe 3JB9I 4M78E 4M75B 4M77F 4JUVA 3SB2A 1BIAA 4M78D 3RKYA 1N9SA 2DTIA 4F7UB 2E41A 2EWNA 3SWNC 5GAOm 4M75E 5GAOl 4M7DA 1BIBA 3FB9A 5LJ5g 5LJ5h 5I21A 4F7UE 3SWNB 3JB9G 4DQ2A 3EFRA 1HK9A 3JB9D 4C8QB 4JLIA 4XU2A 3V7SA 5GAOp 5GMKh 3JCMJ 5LJ3h 4C8QE 4Y91A 5LJ3g 2RA2A 3V8KA 3GIBA 4XTUA 3BW1A 3RERA 4XTXA 2YHTA 2DXUA 1I5LA 5LJ3f 4HT9A 3M4GA 4NL2A 3JCMf 3QO3A 5GANd 4PJOC 1M8VA 5GMKi 4HT8A 4A53A 2Y90A 1H641 1WNLA 4XTYA 4C92E 4RCBA 5GAMe 2VXFA 4PJOB 4C92D 4XTZA 2RB6A 4EMKA 4XTWA 4PJOA 1N9RA 2E65A 2E64A 5GAN3 3V7RA 1KQ1A 1LJOA 5GAOn 2I2LA 4M7DC 5GANe 4JRIA 5GAN4 1U1SA 1WPYA 3L1AA 3HFNA 4M78G 4M7DB 3BFMA 1MGQA 2DXTA 3RUXA 4M7DE 4M78F 4M75D 1X01A 4MMLA 4M7AC 3V8JA 1JBMA 3JB9F 4A54A 3JCMV 3HSBA 2VC8A 4M7AB 4NL3A 4RCCA 5GAN8 2EAYA 5GAMd 3QSUA 2DVEA 4C8QG 4M7AA 4C8QD 4M7AE 4M77C 1M5Q1 3JCMh 3JCMg 4XU0A 2DZ9A 4C8QF 4M77B 4EMKC 4JRKA 1Y96A 1YCYA 2YLBA 4M77A 4M77E 4MMKA 4EMKB 2EJGA 4C92G 3RKXA 4J6YA 5GAMj 4PJOE 4PJOD 3EFSA 4C92F 2QTXA 1D3BA 3L2ZA 3FIFA 4EMHA 4J6XA 4HA8A 3V7CA 5GANj 5DY9A 2HNIA 5LJ5d 5GAN7 4M75G 1I81A 1LNXA 4M7DD 1I8FA 2EJFA 2JN0A 3FJPA 4XTVA 4F7UG 5GAMh 1U1TA 5GAMg 4M75F 1TH7A 4X9DA 2DTOA 3HFOA 4F7UF 5GAMf 4J6WA 3BDUA 5LJ5e 3JCMW 4V2SA 1HXDA 4M7AD 5GANh 5GANg 1LOJA 1Y96B 4M78C 5CAIA 5GANf 5GAN2 5GMKe 2CGHA 3QUIA 5LJ3e 4M78B 4M77D 2K57A 3V8LA 3JCMX 4M78A 3QHSA 3RESA 2DTHA 1D3BB 4PJOG 2DZCA 1WQWA 4N0AA 4PNOA 4M75A 4XQ3A 4QVDA 4C8QC 4PJOF 3PGGA 4F7UA 3AHUA 2YLCA 4XU1A 2FYKA 2FB7A 4WF2A 5LJ5f 3JCMb 3SWNA 5GAN5 3JB9J 4C8QA 2E10A 4NOYA 4M7DG 4QVCA 3RKWA 3BY7A 3INZA 3JCMP 2E1HA 5LJ3d 4C92C 5GMKl 5GMKm 4M7DF 2RD1A 3JCMd 4C92B 4EMGA 2EJ9A
chains in the Genus database with same CATH superfamily
3A1PA 4X1VA 1T0JA 1WIEA 4DA4A 2K5FA 1SRLA 2RPNA 1LCKA 2E6NA 2X4XA 1BIAA 3CCUA 3UDCA 3CCVA 4E7ZA 3FB9A 3THKA 4DQ2A 2QK0A 1BYMA 2CSQA 1NLPC 2VB6A 2L0AA 5GAOp 3E19A 1PWTA 3OYGA 4LD9K 1B3QA 1D0ZA 1PD0A 3QO3A 5GMKi 1VQNA 5CCAA 1CSKA 2RI3A 2E5KA 3QKJA 3CCUT 5GAN3 1NZ9A 5GAOn 1K8AR 1PM3A 3VS2A 1D1CA 4WTOB 4M78F 2EQUA 1QVPA 1OI1A 2J6KA 4ELYC 2R5AA 2LRQA 1UGSB 2RHUA 2EAYA 3I35A 3I56A 4M77C 4ME7A 2CH4A 2PQWA 3KBGA 3LWIA 4M77A 2NUPA 3HKSA 2RN8A 1BCOA 1K8AC 3OYIA 3EFSA 4M4ZA 2GQIA 3A8HB 1NJIU 4QQ6A 3U23A 1WJRA 3GF5A 4LXCA 4HVUA 1OEBA 5GAMg 2EYZA 7AT1B 4OMOA 3JCMW 4J9FA 1VQ4Q 3H0FA 1ZA1B 1NM7A 2X3XD 1ZBXA 4PLIA 5LJ3e 2R58A 4M77D 1GFDA 4D8DA 3MEAA 3UA7A 3EHRA 2JXBA 2COWA 3QYHB 2EKHA 1PG5B 4OMNA 5CKFA 1YNZA 2L5QA 2PUOB 1G2BA 4HCBA 1OYXA 1H3ZA 2JMCA 2WSCE 3TSWA 2JS0A 4RKUE 4PJMA 5GMKl 1Y07A 4IUQA 4EMGA 2LZ6B 4BE1A 3AT1B 4ANJA 1B34B 1U3OA 5FRMA 3ZFJA 2IVWA 3JCMe 2EBPA 2EYXA 3KXTA 4A4GA 1M1KR 1KJWA 1QP2A 4OB3B 1WXBA 3DLLA 1AWOA 5FU6C 1IREB 2CS7A 3NMZC 3X28B 2QQSA 3HTRA 4XTWA 4C0ZA 2OAWA 2KRSA 2O88A 4LDVA 3V7RA 2I2LA 3M0UA 3MJXA 4ZN3A 3QZ5B 2E12A 4M7AC 1M1KC 2K5IA 2HD0A 2HSPA 1W70A 4M7AA 2EYQA 2CP6A 1IGQA 1WLPB 5HY6A 3S6WA 2LCCA 1YI2A 2ZZDA 4C0DB 3CPWS 2K7AA 1WFWA 2L3PA 3PIOA 3VYHB 1KC8U 2FG0A 3L2ZA 1G3TA 3PVQA 3GPLA 2BE7D 2C0IA 3NHNA 2VKNA 2VWFA 4J9GA 3CCSQ 2EGEA 1YI2T 5LJ5e 4M7AD 1Y96B 3MP8A 5CAIA 2CYZB 2DLPA 3CPWP 2OJ2A 4E47A 2RNAA 2DD4A 1KHCA 2O01E 3O8VA 1D3BB 5IHNA 4XQ3A 1YJ9T 1VQ4A 3OMCA 1C6VX 1XNIA 4NOYA 1YJNQ 4ORZA 1HSQA 3FRNA 4M7DF 1I1JA 4UC4A 1QKXA 1ZA2B 2RHZA 2EJ9A 3RMSA 4DBRA 1WHGA 3RIRA 1Q7YU 2DEUA 4M77G 3CEYA 2EFIA 4F7UB 5C6SA 2LX9A 4PL6A 4F7UE 1UG1A 1XTDA 3EG9A 3JB9D 2E70A 4JLIA 3HL8A 3PE0A 5LJ3g 1RLPC 4XTUA 4R0KA 3CC4Q 2YHTA 3CCEQ 4KH1B 1F1BB 4C0DC 3S3NA 5GANd 3L2QA 2KVQG 2V26A 2WSFE 2VGMA 4ESRA 2Y90A 2VXFA 1B07A 2IIMA 4AMCA 2YRCA 3M4YA 1WHJA 5IHKA 5EG2A 4A4KA 2D1XA 4GY5A 4N4HA 4CC4B 2JM8A 2O31A 3CXCA 3OY9A 2LNHB 4RTXA 4FSXA 2W10A 3VS1A 2Y4YA 3M55A 3JCMg 5IAYA 3OYMA 4FCYA 2K3XA 4JRKA 1Y96A 3CCQT 2QXFA 5I2MA 2RJFA 3OYLA 3CCRQ 1D3BA 3G71T 2BZXA 2JOYA 2E4HA 4E7JA 4XTVA 4OMMA 2XU8A 1TH7A 4X9DA 4DBFA 1UTIA 4ZTFA 1WHKA 2DYBA 5GAN2 3FC3A 2CGHA 4M78B 2AHJB 1TUGB 3CCSA 1CKAA 4F7UA 1VQKT 3S3OA 1VQOT 2JTFA 1WDXA 1K1ZA 1U06A 3FLGA 1B7TA 3CC7Q 3P8BB 2QTVA 4M7AG 1ZUYA 3I5RA 2RM4A 5CO7A 1YJNA 1SF9A 3URGA 2KK4A 4M75C 4OP0A 2XDBA 2DETA 3UA6A 1PKTA 2KT1A 2F5TX 5LJ5g 1NG2A 1MHNA 5FROA 2CT4A 5GMKh 2BE9B 2GCXA 3E1SA 3RDVA 1FX7A 4NL2A 4KGZB 5A0DA 2JNGA 2YUNA 4A53A 1VQ5Q 1V29B 4EPCA 2RB6A 4KGVB 1N9RA 3PIPA 1JO8A 3CCEA 1MMGA 1WPYA 1VQ7Q 2O9SA 2LCSA 4AG2C 4M75D 1KHIA 1X01A 2RMOA 3MP6A 3V8JA 2FZGB 2AT1B 1I07A 4NL3A 2DL3A 1GL5A 3OA6A 1SG5A 3VS6A 2ZAEA 1AVZC 6AT1B 2LC4A 4HCCA 4PJOE 2BTTA 3LGLA 2P4TA 1O9SA 2HNIA 3R6OA 4HXJA 1I81A 2V1QA 1JU5C 3FJPA 2MI6A 1U1TA 2COZA 3WVDB 3OYFA 2X3WD 4P5NA 4RTYA 3CCRA 1K73R 3G7ZA 5CKEA 1BU1A 3TSZA 2QGFB 3P8HA 5GANh 1YITT 1WA7A 2QGGA 2F2WA 3TCJA 2NUTB 1YJWT 2JS2A 3CMEA 2D0QB 1Y71A 3QBYA 3OW2A 3AHUA 2FPFA 4BD3A 2E10A 1G83A 2IG0A 4A63B 4BI3A 1K73C 3INZA 3P8DA 3ER0A 1N8RU 4JPBW 3FEOA 4MDXA 4E7KA 4C5GA 1W2BA 3CMET 2LDMA 5GAOq 3QG1A 3VU3C 3OS1A 2DD5A 4KBMB 5GAN6 5FRNA 1RABB 3LGFA 3CC7A 2LQWA 4LDUA 3SWNB 1W6XA 2NUZA 2MYSA 2ZCFB 3JB9F 3JCMJ 2KMTA 2DFUA 4F04B 3QDFA 2QASA 4PJOC 3CCUQ 4IUUA 1BBZA 4RMOA 4PJOA 2E64A 1KFZA 1KD1U 1DJ7B 4M7DB 2YSQA 3ZL7C 4M7DE 1VQ5A 1JXMA 4MMLA 3SFMA 4A54A 5I22A 1R0BG 1X43A 3JSCA 3M5AA 5GAN8 1BI1A 1Y57A 1VQ7A 2RHIA 3CD6A 2F2XA 1Y0MA 1XQHA 4HVWA 2C0OA 2KE9A 1YCYA 4IURA 2K9GA 2RHYA 2NUTA 1MV0B 4FM4B 1AWJA 4PJOD 4C92F 3M0PA 1NEBA 2E3IA 4OB1B 1QW1A 1VQ8T 2QYZA 2K2MA 2RQRA 5D6XA 4M75G 4OMPA 3GBQA 1VQ7T 5GAMh 4R55A 3CD6T 2FEIA 1Q81U 1M2VB 1WHMA 3A8MB 1HXDA 2HDAA 3ME9A 2L89A 3E9GA 9ATCB 3OYEA 4CC7A 4LNPA 2MMPA 4BI8B 3R6NA 2PUKB 3PMTA 2QQAA 1M90U 2QG9B 3SWNA 3GNGA 3OYAA 1MMNA 2GTJA 3PTAA 2OTLT 5D7UA 2RD1A 8ATCB 3JCMd 2PVDB 2CT3A 2VXEA 5KE2A 5AYFA 4KGXB 2RI2A 4FT4A 4RTTA 4N0AC 2DEQA 1UB4A 3SHWA 3QZ9B 3VUZA 3SB2A 2CDTA 2EWNA 4M7DA 1OPLA 4PLLA 1X6OA 4C8QB 2RH2A 1E7OA 3H6ZA 3I5SA 2LQKA 4C8QE 2ZPEB 2RA2A 3M0RA 4O5VA 1WJSA 2BIVA 2HKNA 2O2OA 1Q7YR 2EQIA 2C0TA 2KSSA 4E7HA 2DO3A 3LLRA 5ECAA 4C5IA 4E7IA 3A8GB 2LQNA 2O9VA 1VQPQ 2RJDA 3REBB 2CP0A 2RF0A 4VUBA 3CCLQ 1U1SA 1P92A 1MMDA 3EH1A 2KQWA 4RG2A 4QQGA 1Z9ZA 1K9MU 2D9TA 4KH0B 1QCFA 2X51A 1G3YA 1JEGA 4OB2B 1Q7YC 1H3HA 4MZPA 2EQKA 2DF6A 2JJ9A 4EMKB 3MP1A 2X35A 4PJJA 4L5GA 5KYXA 4BY6C 5CQYA 5FWBA 2F5KA 2RO0A 2JW4A 4C0GA 5FLXE 1X69A 2L3QA 5LJ5d 1UUEA 1QWFA 1YI2Q 2JN0A 1XOVA 4HVVA 1ZBJA 2L8DA 5FU7C 4JZ4A 3L2VA 2MF2A 2M0YA 4V2SA 3LW5E 3E2UA 2L2PA 1YWPA 4J7IA 5KYYA 1YJ9Q 2EPDA 1NPRA 4PJOG 1ZUKA 4PNOA 1E6HA 4C8QC 4L6V5 1QWEA 3JB9J 4DBQA 4C8QA 2JT4A 2JZ2A 1ZLMA 2OX7A 2VUBA 2EKOA 1YBYA 3CPWA 5KH6A 3VKIA 1UE9A 1BKBA 5DLOA 4J83A 5EC7A 1WQ7A 4XU3A 3RNJA 2ENMA 2EW3A 1T3SA 4LE9A 5AT1B 3H8ZA 3NFCA 1HK9A 4ZTJA 1OQKA 2XG8D 1CKBA 4OF1A 1Y7XA 2ECZA 5LJ3h 3OBYA 1VYVA 4LD6A 2EQMA 2HQXA 1VOMA 2MOXA 3BDLA 2KEAA 2X4YA 1AT1B 1ZQ1A 2MK5A 4XTYA 4EMKA 4K11A 2M1HA 5CQXA 4BE2A 2DL8A 2CH4W 2CP3A 5CKDA 2D8HA 2H3JA 2I0NA 3RUXA 2YUQA 2FVUA 1T3LA 2YT6A 1VQPA 4JRPA 4L59A 3NTKA 1UECA 3X20B 3CCLA 3JCMh 1QP3A 3CCQQ 2DZ9A 2MCNA 3WXMB 1ZX6A 3G71Q 3OS0A 2DILA 3G1JA 1WGSA 2DA9A 4FSSA 1G8XA 2HQEA 1VIFA 2YRDA 1VQPT 2ROLA 3HRUA 1M2OA 1UGVA 4BI4A 2QDYB 4IIMA 2LX7A 3CCLT 1OOTA 2DE0X 2PVOB 5A2QE 4AFQC 2K3YA 4EDUA 2RQWA 2LT1A 5KYWB 2E3HA 3L42A 3CBMA 3QPHA 1A0NB 3RESA 2Y4XA 1VQKQ 1FWZA 5CKHA 1IO6A 1VQOQ 5J3BA 2KGTA 2YLCA 4WF2A 3OSVA 1K4US 2CP2A 1YJ9A 3QIIA 2QQRA 4BE0A 5KE3A 1K0XA 4IUVA 4A4FA 4C92B 5KCOA 2VGNA 4E6RA 4LN2A 1Q82R 1B34A 1JB0E 3GLXA 2ZPBB 3CCJT 2QQ9A 2DTIA 5LJ5h 3EG2A 3EH2A 1N8RR 4DEXA 1M1FA 2E6ZA 1XJWB 3M56A 1SHGA 1Q86R 2CUDA 3QWXX 4HCZA 2ATCB 3UWNA 2P4RA 1Q82C 1H641 4YTLA 3JV3A 1KQ1A 2LJ1A 2MWPA 5D6WA 2JVVA 5D6YA 4JRIA 4FW1A 3MHXA 2DK3A 3OYDA 2R57A 1N8RC 2J06A 2WACA 4N4IA 4F14A 2M16A 1Q86C 2JTEA 4RCCA 4LDXA 4CC2A 2BKDN 4LUDA 4C8QG 4D8KA 2M02A 2XIDA 3G4ST 3EGUA 5KYWA 2DXBA 2H3EB 1QQJA 2DERA 2K79A 1KD1R 1YIJA 3A5ZB 3CC2Q 5GJWB 2DNUA 2YRVA 3CCQA 2KYBA 1AZGB 1BI3A 3G71A 2EJFA 1Q95G 4ZGJB 1YITQ 4JDSA 3EHQA 1ABQA 2AKKA 3HRSA 1OX9A 1H8KA 3BDUA 2LCLA 1YJWQ 1YIJT 1PC0A 2DPPB 1KD1C 1WHLA 4KULA 1MNEA 2NWMA 3QHSA 2XMFA 1NEGA 3H0IA 2HEQA 1K8AU 4FYYB 4XU1A 3HPWA 4C5EA 2G3RA 1VQKA 3CMEQ 3M58A 1M27C 1VQOA 5A0GA 2FO0A 4A4EA 4PFPA 2ZGWA 3N5BB 3UATA 4M78E 4M77F 2KBTA 1M3AA 1RUWA 2HBWA 5FW9A 2VV5A 2NYSA 1PD1A 4B6MA 2GFUA 2KYMA 3EFOB 1W4SA 3NPFA 2A0FB 2XK0A 3LX7A 3LYIA 3M59A 4CC3A 2F1LA 4ZNXA 3BFMA 2DXTA 4BUGA 1M3CA 3O5ZA 4FT2A 4ZGDB 2DRKA 2ZPFB 2MWOA 2G6FX 2GQVA 5GAMd 2HL3A 5DM7R 1SPKA 1M5Q1 1I5OB 2KNBB 2LNVA 4PFOA 1K9AA 2YDLA 4J6YA 5DLQE 2KI7A 1VQ8Q 1FMWA 1KG1A 2MPXC 4MZMA 1K9MR 1IRXA 4RTZA 3CD6Q 4J9EA 2P0QA 5IN1A 1OV3A 2FL7A 3CC2A 4DOWA 4OMFB 3CBPA 2GFAA 4N4GA 4M78C 3L2WA 1PHTA 2NLUA 4PKCC 2DJQA 2QI2A 5CK9A 1YITA 4M78A 1NLOC 3J80E 2DTHA 4CRIA 1K9MC 3X26B 1WQWA 3JAME 3L2UA 1YJWA 2D8JA 3PGGA 1GXIE 2PNIA 4GLMA 3CC2T 1WI7A 2EGCA 2P0PA 3VS3A 1X27A 2OTLQ 4NS5A 2AZSA 5IH2A 1J3TA 2YXYA 2HQHA 1U5SA 3EFOA 3QXEB 1D09B 1I4K1 1MMAA 1VQLT 4M7AF 1KSWA 5GMKj 1TS9A 5CIUA 2DKGA 3RMQA 1QVFP 4LDYA 4B9WA 1NJIR 4Z02A 4M78D 3OMGA 1N9SA 2E41A 2CKKA 3ULRB 1QKWA 3J7AF 1KQSP 4Z89A 3GIBA 4Y91A 4C0FA 1VYTA 4XK8E 4HT9A 3A8LB 3UF4A 1K76A 3MEWA 4FIBA 3MEVA 3EAEA 3EG3A 1NJIC 1SSFA 2OTJT 2HMAA 1N27A 4QW2A 1EZZB 1RL2A 3OYNA 1S72A 1UHFA 2V8KA 2KRMA 2FPEA 4HKEA 1RLQC 4BB7A 4JLGA 4Y28E 1H92A 1MUZA 1GRIA 3I9QA 2YLBA 1PNJA 5J26A 1RACB 2P84A 4XAXB 1VA7A 3QJ6A 1S72T 1RI9A 3V7CA 5GANj 1BB9A 3X24B 1HJDA 2KRNA 1LNXA 3J81E 3DB3A 4F7UG 2KAFA 1X2KA 4EIKA 1VQ8A 1YHQA 3ZEHA 2EIFA 4KUDK 3CCMQ 1ABOA 1HYOA 3QDRB 3VUBA 3PNWC 4C5HA 4RTVA 1FXXA 2QAZA 4ATOA 1PRLC 4AFUC 2QEXA 1YHQT 1ZSZB 1WYXA 2MIOA 1YCSB 1NPPA 2E1HA 5LJ3d 1C0MA 1X6BA 5CVIA 3JB9H 2GNCA 2PVGB 3JCMc 2OTLA 4X9CA 2PU9B 2J05A 5GAOr 2QA4A 1SRMA 1KC8R 1M4ZA 1V76A 3JB9I 2QEXT 1VQ6Q 3SWNC 5GAOm 4LUEA 2LJ0A 1OU9A 1MNDA 1WXUA 4HCKA 3SD4A 4Z88A 2FZCB 3V7SA 2CSIA 3OYHA 1GCPA 3TQ7P 4IKFA 2BZ8A 2XDPA 4JJCA 5LL6S 3JCMf 2QA4T 1GFCA 2CP7A 3H9NA 1KC8C 4OGCA 1BI2A 2E65A 2QDLA 1GCQA 1LJOA 2ZPIB 4M7DC 4M78G 4TVRA 5KYUB 3FJ5A 4J9IA 1QVGP 1WZOA 3KFVA 2VC8A 2A37A 3NGPA 3OYBA 1JJ2S 3C12A 4PJLA 3A8OB 4XU0A 4M77B 4FL6A 4M77E 1ACMB 3M9QA 5GAMj 1VQMT 3FIFA 1IGUA 3BE3A 2F2VA 2FRYA 2LTOA 1OULA 3S3MA 1M9SA 4M7DD 1ZSZA 2QQBA 4M75F 1JJ2P 1M2VA 3VYGA 1LOJA 3LH5A 4X34A 2HZYA 4KUIA 3M53A 2K2VA 4Q5WA 2XD0A 2DZCA 4FW2A 1N6AA 3VS5A 5IXFA 2BUDA 3CCMA 5IHIA 1AWWA 2FB7A 5LJ5f 2IPOB 4JJNK 1HD3A 3OB9A 1NYFA 3TREA 3GP8A 1ZUUA 2KDSA 3CCJQ 5HK3A 1TTHB 2W0ZA 3CMAA 3CQTA 2JUFA 3CCVT 4J5YA 1EX4A 4F16A 3CCMT 4MDWA 2ROTA 2Z0WA 4JUVA 3RKYA 2XDDA 1BIBA 1D1BA 3EGDB 1IB8A 3EFRA 5KYUA 3M0QA 4IIOA 3TEEA 5M9OA 3MCAB 4JS5A 1VQNT 2DM1A 4J9HA 1VQ6A 3BW1A 4XTXA 1I5LA 2DXUA 1UGPB 2X4WA 3CMAT 1K73U 5IT9E 1AOJA 5FU6B 4GBQA 2CREA 3D7SB 4AFSC 2ED1A 4BDZA 3G6EQ 3I56T 3TVTA 1VQ6T 1G3SA 2VYTA 2D6FA 3JCMV 3HSBA 4M7AB 3G4SQ 2FHDA 3HHTB 4C8QD 4M7AE 1VUBA 4IUTA 2DBMA 1W1FA 1YP5A 2YUPA 5KCHA 4EMKC 1R77A 4MMKA 2QTXA 2DRMA 1AZEA 3X25B 2JTMA 2EVRA 5GAN7 1PRMC 2KXCA 1BI0A 4R56A 2D0NA 3OBWA 1M8MA 4AFZC 2ZPHB 2OI3A 4ELZC 4D6WA 4BDYA 1YIJQ 1TUCA 2DVJA 3JRZA 2RQVA 3OQ5A 2K3BA 1QCOA 5I11A 2K57A 4RUGA 3OYYA 4E7SA 1VYUA 4PJOF 1OPKA 3VV0A 2FYKA 4E7LA 2M0OA 3EGDA 4M7DG 4DEYA 1PKSA 3JCMP 4QQDA 3A98A 2K5LA 2MAMA 3META 2HL5C 4J9BA 1EIFA 4WCIA 5L8RE 2JM9A 2LT4A 5LJ3j 4QKUA 5L23A 1RAFB 1V1CA 1Z9QA 3EG9B 3VJPA 5I21A 3T9NA 2P0KA 3CCJA 2KXDA 1BK2A 1VQ9Q 5HCKA 1RAHB 1QMCA 2RQUA 3V8KA 4FYXB 4JS4A 2DL5A 2DL4A 5HKCA 4C92E 2O4XB 3GNFB 2J6OA 2E5QA 4PK4A 2V8IA 5GAN4 1M3BA 2K4YA 3L1AA 3C0CA 1D0YA 3M0TA 1UHCA 3RR6A 3EG0A 2M51A 1RADB 4II1A 3GOXA 1TUDA 3HP9A 3REAB 2ZPGB 3ZBDA 1TG0A 3G6EA 4E2FB 4AT1B 2EJGA 3G4SA 2RJEA 3H0HA 4OMLA 1AHJB 4ZN1A 3Q1JA 1WX6A 3VS0A 1UFFA 3CBOA 2KT8A 2AIRB 1X2QA 2ED0A 1RI0A 3G6ET 1ZSGA 2HKQB 3F70A 2CUBA 2GBQA 5HK0A 5GANf 4FU6A 3QUIA 1VQ4T 2AK5A 5FWCA 1D0XA 1G3WA 1K0SA 3OSSC 2RK1A 1PSFA 2HBPA 3RKWA 4C92C 3LWHA 3DKMA 2ESWA 1VQLQ 4ZGEB 2H8HA 2J6FA 2LQ8A 5LJ5j 4C92A 1JRIA 2CZ6B 1TWBA 2O4XA 1N5ZA 5C0MA 3E9FA 1M8VA 4JRQA 2A08A 3KUFA 4M75B 4M75E 5GAOl 3MO8A 2OAUA 2EQJA 3NTIA 1I0CA 1Q81R 2JMAA 1LVKA 1SSHA 3EG1A 2HAXA 3RERA 4F17A 1QLYA 1SKUB 3L2RA 4QT7A 2DIGA 3VS7A 2OTJQ 4RG8A 1QVFA 1VQ9A 4C92D 2C06A 2DBKA 1M90R 1T0HA 3NTHA 4O6JA 1MGQA 1U8RA 1Q81C 1KQSA 4BACA 3OYJA 1JBMA 3OS2A 5J39A 4DBHA 1KIKA 1VQ9T 4C8QF 1UGQB 2A36A 1KK7A 1S72Q 3C94A 1ZHIA 2RK2A 3RKXA 1M90C 4RTUA 2M9UA 4DOVA 2XHCA 5DY9A 5I2SA 1TXQA 5CR2A 2V8JA 4JZ3A 1RAAB 4Y92A 3HFOA 1UJYA 5GAMf 3C95A 8AT1B 3PFSA 1FMVA 2BZYA 1R8OB 1R0CB 2A7YA 3PVLA 3CCST 2KR3A 4JJBA 4PFZA 5GMKe 1IXDA 3JCMX 4A4HA 2VVKA 1NYGA 1RAEB 1YHQQ 4M75A 4LDWA 1MV3A 3JCMb 3VS4A 2GGRA 3CXCS 2DXCA 2KROA 3BY7A 5GMKm 2DYIA 1YJNT 1M1KU 1TU0B 1SEMA 1KQ2A 4OB0B 2QEXQ 2CZ1B 2ABLA 2V1RA 2X9HA 3DB4A 1D1AA 2RI5A 3IQLA 3CC4A 1QVFS 2LVMA 3UPUA 1VQLA 2EYYA 2DL7A 2RQTA 3EGXB 3JB9G 1GBQA 2GTOA 4XU2A 1KQSS 2LJ3A 2QA4Q 3CXCP 2AZVA 3QWYA 3HRTA 3M4GA 2YUOA 1FMKA 4CI0C 3CC4T 3C4SA 1VIEA 3CCET 1UGRB 4PJOB 2PTKA 4OGEA 5IXBA 1OX8A 4XTZA 5GANe 3HFNA 2OTJA 1UEBA 1X75C 3QJYA 2WSEE 2DAQA 3VRYA 1WHHA 4MZTA 2FPDA 3DLMA 1WJQA 1JXOA 3VRZA 1VQMQ 3PMIA 4C92G 2L3RA 4J9CA 3I55Q 1Q82U 2SRCA 4IUPA 2FRWA 2L3SA 2AKLA 1QVGA 4J6XA 1WXTA 2X4JA 4HA8A 1PSEA 4J8OA 3CCRT 1I8FA 3CPFA 2LMJA 1NBEB 2J7IA 4J6WA 3WVEB 2KY9A 4KT0E 1JQQA 2A28A 1UDLA 1Q86U 5CKBA 1S1NA 1GBRA 4Z8AA 2EYWA 2XI9A 4FYVB 1YFNA 3FDRA 2DX1A 2B8AA 3EGXA 1IHVA 5GAN5 1IHWA 4GLKA 1JJ2A 4QVCA 2F69A 3PT9A 4OVAA 3MPUB 3CCVQ 3MEUA 1IZ6A 1RAIB 2CZ7B 3JCMQ 3SDZA 3CC7T 1M30A 1PCXA 2DJZA 3M54A 1AWXA 3TU4K 1NE8A 1O75A 3RBBB 1VQNQ 1SHFA 3CMAQ 1YN8A 2GF7A 5LJ3f 3OS5A 1AEYA 1TOVA 4HT8A 1WNLA 2DMOA 4OMQA 4RCBA 4J7FA 5GAMe 4RTWA 2COYA 2PZ1A 1VQ5T 3I56Q 2HSEB 4KRTA 5GJVB 2B86A 2VASA 1QVGS 1OZ3A 2RJCA 2CP5A 3OW2S 1OU8A 3OYKA 4QVZA 3QSUA 1C1AA 2DVEA 1AD5A 1M1GA 4JJDA 1ARKA 4FYWB 2EGAA 2XKOC 5KYXB 1GCQC 1W2BS 5KYNA 3LH0A 2FZKB 4BY6B 4AG1C 1QCNA 1G5VA 4EMHA 3QYGB 4B9XA 2K6DA 1VQMA 2A3LA 2YWWA 3M57A 3OW2P 1YWOA 4PJNA 2DTOA 3M0SA 3I55A 4F7UF 1FYNA 5A0LA 3ASKA 5FU7B 5GANg 1TSFA 3H41A 1BCMA 2NUPB 5KYYB 1UJ0A 1LPLA 3V8LA 1W2BP 2CZ0B 2XICA 2LP5A 3MKDA 2DIQA 4N0AA 4QVDA 1RAGB 1OZ2A 3UT1A 1ZSZC 3I55T 2RHXA 1X6GA 3OYCA 2SEMA 1E6GA 3SEMA 2R5MA 2HCKA 4J9DA 1EFNA
chains in the Genus database with same CATH topology
4E7KA 4C5GA 4DA4A 1W2BA 2K5LA 2K5FA 2MAMA 2ZGWA 3META 3CMET 2LDMA 1EIFA 5L8RE 5GAOq 3N5BB 3QG1A 3VU3C 3OS1A 2LT4A 2DD5A 2E6NA 4KBMB 5LJ3j 2X4XA 5GAN6 5FRNA 4M78E 4M77F 1BIAA 3CCUA 3UDCA 3CCVA 3LGFA 3CC7A 3VJPA 3FB9A 4LDUA 5I21A 3T9NA 2VV5A 2P0KA 3SWNB 3CCJA 4DQ2A 1BYMA 2ZCFB 5GAOp 3JCMJ 3JB9F 2GFUA 3V8KA 3E19A 3OYGA 4LD9K 1W4SA 2KMTA 4JS4A 4PJOC 3QO3A 2XK0A 4IUUA 3LX7A 3LYIA 5GMKi 1VQNA 5CCAA 5HKCA 2RI3A 4C92E 3M59A 2O4XB 3QKJA 3GNFB 4RMOA 3CCUT 4PJOA 2E64A 2E5QA 1NZ9A 5GAN3 5GAOn 2V8IA 5GAN4 1KD1U 1DJ7B 2K4YA 3L1AA 4M7DB 3BFMA 2DXTA 4BUGA 4M7DE 4M78F 4FT2A 2EQUA 1VQ5A 4ZGDB 1QVPA 4MMLA 3SFMA 2ZPFB 1OI1A 2MWOA 4A54A 4ELYC 2R5AA 3JSCA 2LRQA 2GQVA 1UGSB 3M5AA 2RHUA 5GAN8 1BI1A 2EAYA 5GAMd 4II1A 3I56A 4M77C 4ME7A 1M5Q1 2PQWA 3KBGA 5DM7R 3GOXA 1VQ7A 2RHIA 3HP9A 3CD6A 2ZPGB 3ZBDA 3LWIA 1XQHA 3G6EA 1YCYA 4M77A 2LNVA 3HKSA 2EJGA 4IURA 2RHYA 3G4SA 2RJEA 4J6YA 5DLQE 1K8AC 4FM4B 3OYIA 4PJOD 3EFSA 1AHJB 4C92F 4ZN1A 1KG1A 3Q1JA 4MZMA 3A8HB 4OB1B 1NJIU 1QW1A 3CBOA 1VQ8T 4QQ6A 5D6XA 4M75G 1WJRA 3GF5A 2P0QA 5IN1A 2FL7A 1VQ7T 5GAMh 5GAMg 4R55A 3CD6T 3CC2A 1Q81U 1RI0A 4DOWA 3G6ET 4OMFB 3CBPA 3F70A 2GFAA 3A8MB 3JCMW 1HXDA 4N4GA 3ME9A 2L89A 5HK0A 3E9GA 4M78C 3OYEA 5GANf 3L2WA 2NLUA 4FU6A 3QUIA 4PKCC 1ZBXA 4PLIA 5LJ3e 2R58A 2QI2A 4M77D 1VQ4T 5CK9A 1YITA 3MEAA 2MMPA 4M78A 4BI8B 3J80E 3QYHB 2DTHA 4CRIA 1K9MC 3X26B 1G3WA 1WQWA 3JAME 2PUKB 3PMTA 3L2UA 2QQAA 5CKFA 1YJWA 2L5QA 1M90U 2PUOB 3PGGA 3OSSC 4HCBA 1VQ6T 3CC2T 1GXIE 2P0PA 1OYXA 2RK1A 3SWNA 1PSFA 1H3ZA 3GNGA 3OYAA 2WSCE 4NS5A 2HBPA 4RKUE 3RKWA 3PTAA 4C92C 1Y07A 5GMKl 3LWHA 2OTLT 3DKMA 2RD1A 3QXEB 4ZGEB 3JCMd 4IUQA 4EMGA 2PVDB 4BE1A 2LQ8A 2VXEA 5KE2A 4C92A 1JRIA 1I4K1 2CZ6B 5AYFA 5LJ5j 1B34B 1VQLT 4M7AF 2RI2A 2O4XA 4FT4A 5C0MA 4N0AC 5GMKj 3E9FA 1M8VA 2DEQA 1UB4A 2DKGA 5CIUA 3ZFJA 2IVWA 3QZ9B 3RMQA 3KUFA 4LDYA 3VUZA 4B9WA 3JCMe 4M75B 3SB2A 4Z02A 4M78D 3OMGA 1N9SA 2E41A 2EWNA 4M75E 5GAOl 4M7DA 3MO8A 4PLLA 2CKKA 1X6OA 2OAUA 2EQJA 3NTIA 2RH2A 4C8QB 3H6ZA 3KXTA 4A4GA 3J7AF 2LQKA 4C8QE 3GIBA 2ZPEB 4Y91A 2RA2A 4C0FA 4O5VA 1WJSA 4XK8E 4HT9A 2HAXA 1QP2A 3RERA 3A8LB 4OB3B 2BIVA 3L2RA 3MEWA 3DLLA 2KSSA 3MEVA 2DIGA 4FIBA 4E7HA 2DO3A 3LLRA 5FU6C 1IREB 2CS7A 4RG8A 4C5IA 4E7IA 3EAEA 1QVFA 1VQ9A 3X28B 2QQSA 3A8GB 4C92D 2C06A 4XTWA 4C0ZA 2OTJT 1NJIC 1SSFA 4LDVA 2RJDA 3V7RA 1N27A 2I2LA 4QW2A 4VUBA 1U1SA 1P92A 3NTHA 4ZN3A 4O6JA 1MGQA 3QZ5B 2E12A 1RL2A 3OYNA 2KQWA 4RG2A 1U8RA 1S72A 4BACA 4QQGA 1Q81C 1KQSA 4M7AC 1K9MU 1M1KC 3OYJA 1JBMA 3OS2A 2D9TA 2K5IA 2HD0A 1G3YA 2V8KA 5J39A 4HKEA 4M7AA 2EYQA 4OB2B 4BB7A 1Q7YC 4JLGA 4MZPA 1VQ9T 4C8QF 4Y28E 2EQKA 1UGQB 5HY6A 3S6WA 2LCCA 1YI2A 2YLBA 2ZZDA 4C0DB 3CPWS 5J26A 4EMKB 3MP1A 2X35A 3C94A 1ZHIA 2RK2A 4L5GA 4XAXB 3RKXA 3PIOA 1M90C 4BY6C 5CQYA 3VYHB 1KC8U 2F5KA 3QJ6A 2RO0A 1S72T 2M9UA 3L2ZA 4DOVA 4C0GA 1G3TA 2XHCA 5FLXE 3V7CA 3GPLA 5GANj 5DY9A 5LJ5d 3X24B 5I2SA 5CR2A 1LNXA 3J81E 2V8JA 3DB3A 2JN0A 4F7UG 2KAFA 1XOVA 1VQ8A 2L8DA 3HFOA 1YHQA 5FU7C 5GAMf 1YI2T 3C95A 2EIFA 3ZEHA 3L2VA 2MF2A 3PFSA 5LJ5e 4KUDK 4V2SA 3LW5E 1R8OB 4M7AD 2A7YA 1Y96B 3MP8A 3CCST 5CAIA 3QDRB 3VUBA 2CYZB 5GMKe 4J7IA 3JCMX 4A4HA 3PNWC 4E47A 2DD4A 1KHCA 2O01E 1NPRA 1D3BB 3O8VA 4PJOG 4C5HA 1FXXA 4PNOA 4M75A 4XQ3A 4C8QC 1YJ9T 4L6V5 4ATOA 1VQ4A 3OMCA 2QEXA 4LDWA 1XNIA 1YHQT 3JCMb 3JB9J 4C8QA 4NOYA 3CXCS 2JZ2A 2DXCA 3BY7A 1NPPA 2VUBA 2E1HA 3FRNA 2EKOA 5LJ3d 5GMKm 4UC4A 4M7DF 5CVIA 1YJNT 2RHZA 1M1KU 1YBYA 2EJ9A 3RMSA 3CPWA 5KH6A 3JB9H 2PVGB 3JCMc 3VKIA 1KQ2A 4OB0B 1BKBA 5DLOA 2OTLA 4J83A 2CZ1B 1WQ7A 4X9CA 2PU9B 4XU3A 3RIRA 5GAOr 2QA4A 1Q7YU 3DB4A 4M77G 2RI5A 3CC4A 1M4ZA 1QVFS 3CEYA 3JB9I 2LVMA 2QEXT 3UPUA 1VQLA 2EFIA 4F7UB 3SWNC 5C6SA 5GAOm 3H8ZA 2LX9A 4PL6A 4F7UE 1XTDA 3NFCA 3JB9G 1HK9A 3JB9D 2E70A 4JLIA 3SD4A 4ZTJA 4XU2A 2XG8D 1KQSS 3V7SA 4OF1A 1Y7XA 3HL8A 5LJ3h 3OBYA 4LD6A 5LJ3g 2EQMA 2HQXA 3OYHA 4XTUA 4IKFA 3BDLA 2YHTA 3HRTA 3M4GA 4C0DC 2X4YA 2XDPA 1ZQ1A 5LL6S 3JCMf 2QA4T 5GANd 3L2QA 3S3NA 2KVQG 2WSFE 3C4SA 4CI0C 1VIEA 2VGMA 3CC4T 2Y90A 1UGRB 4XTYA 4OGEA 1KC8C 3CCET 4PJOB 2VXFA 4XTZA 5CQXA 2M1HA 4EMKA 4OGCA 4BE2A 1BI2A 2E65A 3M4YA 1LJOA 2ZPIB 4M7DC 5EG2A 5GANe 5CKDA 4M78G 3HFNA 4TVRA 4A4KA 2H3JA 4GY5A 2OTJA 1UEBA 1X75C 3QJYA 2WSEE 2DAQA 4N4HA 3RUXA 2FVUA 3CXCA 5FRMA 3OY9A 4MZTA 2VC8A 3OYBA 1VQPA 4JRPA 1JJ2S 3C12A 4FSXA 4L59A 3DLMA 3NTKA 3X20B 3CCLA 2Y4YA 1WJQA 3M55A 3JCMh 1QP3A 3JCMg 5IAYA 3A8OB 2DZ9A 4XU0A 3OYMA 4M77B 2K3XA 4JRKA 1Y96A 3WXMB 4FL6A 4M77E 3CCQT 3PMIA 4C92G 2L3RA 3M9QA 2QXFA 5GAMj 1VQMT 5I2MA 2RJFA 3OS0A 3OYLA 1Q82U 4IUPA 1D3BA 3G71T 1WGSA 3FIFA 1QVGA 4J6XA 2X4JA 4HA8A 1PSEA 2HQEA 1VQPT 1VIFA 2LTOA 3HRUA 4J8OA 3CCRT 2JOYA 4BI4A 3S3MA 1M9SA 2QDYB 4M7DD 1I8FA 3CCLT 4XTVA 4E7JA 3CPFA 2QQBA 2XU8A 1TH7A 2PVOB 4M75F 2K3YA 4X9DA 5A2QE 4EDUA 3WVEB 4J6WA 2LT1A 2KY9A 4KT0E 4ZTFA 3VYGA 1Q86U 1LOJA 4X34A 5CKBA 4JRQA 5GAN2 3L42A 3FC3A 2CGHA 3CBMA 4M78B 2AHJB 2XI9A 3M53A 3QPHA 3FDRA 4KUIA 3RESA 2K2VA 4Q5WA 2XD0A 2Y4XA 3CCSA 1FWZA 5CKHA 2DZCA 1N6AA 2B8AA 2BUDA 5J3BA 4F7UA 3CCMA 2YLCA 3S3OA 1VQKT 2FB7A 4WF2A 5LJ5f 5GAN5 4GLKA 4JJNK 1VQOT 1JJ2A 2JTFA 3OSVA 3OB9A 4QVCA 1YJ9A 3QIIA 2F69A 3PT9A 2QQRA 3TREA 3GP8A 4BE0A 4OVAA 5KE3A 4IUVA 3FLGA 4A4FA 4C92B 3MEUA 2KDSA 1IZ6A 3P8BB 4M7AG 5KCOA 2CZ7B 2RM4A 2VGNA 5HK3A 3JCMQ 3CCVT 5CO7A 3SDZA 3CMAA 2JUFA 1YJNA 3CC7T 3URGA 1B34A 1JB0E 2DJZA 3GLXA 2KK4A 4J5YA 4M75C 4OP0A 3M54A 2ZPBB 3CCJT 1NE8A 4MDWA 3CCMT 3TU4K 2XDBA 2QQ9A 4JUVA 3RKYA 2DTIA 1O75A 2XDDA 1BIBA 2F5TX 5LJ5g 5LJ5h 3EFRA 1MHNA 5FROA 5M9OA 3TEEA 1M1FA 5GMKh 3MCAB 2E6ZA 2GCXA 4JS5A 3E1SA 1VQNT 1VQ6A 3M56A 3BW1A 4XTXA 1I5LA 1FX7A 2DXUA 2GF7A 5LJ3f 1UGPB 2X4WA 4HCZA 3CMAT 4NL2A 3OS5A 1K73U 5A0DA 3UWNA 2JNGA 4HT8A 4A53A 1Q82C 1H641 1WNLA 4YTLA 1V29B 4RCBA 5GAMe 5IT9E 4J7FA 5FU6B 4EPCA 2RB6A 1N9RA 1KQ1A 2MWPA 3PIPA 5D6WA 1VQ5T 2JVVA 3CCEA 5D6YA 4JRIA 1WPYA 3MHXA 2DK3A 3OYDA 2R57A 4BDZA 1N8RC 1QVGS 1KHIA 1OZ3A 1X01A 2RJCA 4M75D 3MP6A 3V8JA 3I56T 2WACA 1G3SA 2VYTA 4N4IA 3OW2S 2D6FA 3JCMV 3HSBA 3OYKA 4M7AB 2M16A 4QVZA 4NL3A 1Q86C 4RCCA 4LDXA 3QSUA 2FHDA 2BKDN 2DVEA 3HHTB 4C8QG 4C8QD 4M7AE 1VUBA 4IUTA 1M1GA 2XIDA 3G4ST 5KCHA 4EMKC 3OA6A 2DXBA 4MMKA 2XKOC 1W2BS 1YIJA 3A5ZB 2LC4A 4HCCA 4PJOE 3LGLA 2QTXA 3LH0A 2P4TA 4BY6B 2YRVA 3CCQA 4EMHA 1G5VA 3QYGB 1O9SA 3X25B 2HNIA 4B9XA 2JTMA 3R6OA 5GAN7 1BI3A 1VQMA 1I81A 2A3LA 3G71A 1BI0A 2EJFA 3FJPA 3M57A 4R56A 3OBWA 2MI6A 1U1TA 4ZGJB 3WVDB 4JDSA 2DTOA 2ZPHB 3OYFA 3I55A 4P5NA 4D6WA 4ELZC 4F7UF 3CCRA 4BDYA 3HRSA 5A0LA 3G7ZA 3BDUA 2LCLA 3ASKA 3JRZA 5CKEA 5FU7B 5GANh 3P8HA 5GANg 3OQ5A 1YITT 1YIJT 2DPPB 1KD1C 3TCJA 1YJWT 2K57A 3V8LA 2CZ0B 2XICA 4KULA 3QHSA 2D0QB 3OYYA 3CMEA 2DIQA 1Y71A 4N0AA 4QVDA 1K8AU 3UT1A 1OZ2A 4PJOF 3QBYA 3OW2A 4XU1A 3AHUA 3VV0A 2FYKA 3I55T 4E7LA 2RHXA 2M0OA 4BD3A 3HPWA 4C5EA 4M7DG 2E10A 3OYCA 2IG0A 4BI3A 2G3RA 1K73C 3INZA 3JCMP 1VQKA 3P8DA 3ER0A 1N8RU 3M58A 1VQOA 2R5MA 4QQDA 5A0GA 4A4EA 3FEOA 4MDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A G;  5LJ5 j;  2VXE A;  3JCM c;  4C92 A;  1JRI A;  1I4K 1;  2ZGW A;  1KQ2 A;  3JB9 H;  2RM4 A;  1B34 B;  4M7A F;  3JCM Q;  3RIR A;  1WQ7 A;  4X9C A;  4XU3 A;  5GAO q;  5GAO r;  1B34 A;  2DJZ A;  4J5Y A;  4M77 G;  4M75 C;  4N0A C;  2DEQ A;  2DKG A;  4OP0 A;  3VU3 C;  5GMK j;  5LJ3 j;  5GAN 6;  3JCM e;  3JB9 I;  4M78 E;  4M75 B;  4M77 F;  4JUV A;  3SB2 A;  1BIA A;  4M78 D;  3RKY A;  1N9S A;  2DTI A;  4F7U B;  2E41 A;  2EWN A;  3SWN C;  5GAO m;  4M75 E;  5GAO l;  4M7D A;  1BIB A;  3FB9 A;  5LJ5 g;  5LJ5 h;  5I21 A;  4F7U E;  3SWN B;  3JB9 G;  4DQ2 A;  3EFR A;  1HK9 A;  3JB9 D;  4C8Q B;  4JLI A;  4XU2 A;  3V7S A;  5GAO p;  5GMK h;  3JCM J;  5LJ3 h;  4C8Q E;  4Y91 A;  5LJ3 g;  2RA2 A;  3V8K A;  3GIB A;  4XTU A;  3BW1 A;  3RER A;  4XTX A;  2YHT A;  2DXU A;  1I5L A;  5LJ3 f;  4HT9 A;  3M4G A;  4NL2 A;  3JCM f;  3QO3 A;  5GAN d;  4PJO C;  1M8V A;  5GMK i;  4HT8 A;  4A53 A;  2Y90 A;  1H64 1;  1WNL A;  4XTY A;  4C92 E;  4RCB A;  5GAM e;  2VXF A;  4PJO B;  4C92 D;  4XTZ A;  2RB6 A;  4EMK A;  4XTW A;  4PJO A;  1N9R A;  2E65 A;  2E64 A;  5GAN 3;  3V7R A;  1KQ1 A;  1LJO A;  5GAO n;  2I2L A;  4M7D C;  5GAN e;  4JRI A;  5GAN 4;  1U1S A;  1WPY A;  3L1A A;  3HFN A;  4M78 G;  4M7D B;  3BFM A;  1MGQ A;  2DXT A;  3RUX A;  4M7D E;  4M78 F;  4M75 D;  1X01 A;  4MML A;  4M7A C;  3V8J A;  1JBM A;  3JB9 F;  4A54 A;  3JCM V;  3HSB A;  2VC8 A;  4M7A B;  4NL3 A;  4RCC A;  5GAN 8;  2EAY A;  5GAM d;  3QSU A;  2DVE A;  4C8Q G;  4M7A A;  4C8Q D;  4M7A E;  4M77 C;  1M5Q 1;  3JCM h;  3JCM g;  4XU0 A;  2DZ9 A;  4C8Q F;  4M77 B;  4EMK C;  4JRK A;  1Y96 A;  1YCY A;  2YLB A;  4M77 A;  4M77 E;  4MMK A;  4EMK B;  2EJG A;  4C92 G;  3RKX A;  4J6Y A;  5GAM j;  4PJO E;  4PJO D;  3EFS A;  4C92 F;  2QTX A;  1D3B A;  3L2Z A;  3FIF A;  4EMH A;  4J6X A;  4HA8 A;  3V7C A;  5GAN j;  5DY9 A;  2HNI A;  5LJ5 d;  5GAN 7;  4M75 G;  1I81 A;  1LNX A;  4M7D D;  1I8F A;  2EJF A;  2JN0 A;  3FJP A;  4XTV A;  4F7U G;  5GAM h;  1U1T A;  5GAM g;  4M75 F;  1TH7 A;  4X9D A;  2DTO A;  3HFO A;  4F7U F;  5GAM f;  4J6W A;  3BDU A;  5LJ5 e;  3JCM W;  4V2S A;  1HXD A;  4M7A D;  5GAN h;  5GAN g;  1LOJ A;  1Y96 B;  4M78 C;  5CAI A;  5GAN f;  5GAN 2;  5GMK e;  2CGH A;  3QUI A;  5LJ3 e;  4M78 B;  4M77 D;  2K57 A;  3V8L A;  3JCM X;  4M78 A;  3QHS A;  3RES A;  2DTH A;  1D3B B;  4PJO G;  2DZC A;  1WQW A;  4N0A A;  4PNO A;  4M75 A;  4XQ3 A;  4QVD A;  4C8Q C;  4PJO F;  3PGG A;  4F7U A;  3AHU A;  2YLC A;  4XU1 A;  2FYK A;  2FB7 A;  4WF2 A;  5LJ5 f;  3JCM b;  3SWN A;  5GAN 5;  3JB9 J;  4C8Q A;  2E10 A;  4NOY A;  4M7D G;  4QVC A;  3RKW A;  3BY7 A;  3INZ A;  3JCM P;  2E1H A;  5LJ3 d;  4C92 C;  5GMK l;  5GMK m;  4M7D F;  2RD1 A;  3JCM d;  4C92 B;  4EMG A;  2EJ9 A; 
#chains in the Genus database with same CATH topology
 3A1P A;  4X1V A;  1T0J A;  1WIE A;  4DA4 A;  2K5F A;  1SRL A;  2RPN A;  1LCK A;  2E6N A;  2X4X A;  1BIA A;  3CCU A;  3UDC A;  3CCV A;  4E7Z A;  3FB9 A;  3THK A;  4DQ2 A;  2QK0 A;  1BYM A;  2CSQ A;  1NLP C;  2VB6 A;  2L0A A;  5GAO p;  3E19 A;  1PWT A;  3OYG A;  4LD9 K;  1B3Q A;  1D0Z A;  1PD0 A;  3QO3 A;  5GMK i;  1VQN A;  5CCA A;  1CSK A;  2RI3 A;  2E5K A;  3QKJ A;  3CCU T;  5GAN 3;  1NZ9 A;  5GAO n;  1K8A R;  1PM3 A;  3VS2 A;  1D1C A;  4WTO B;  4M78 F;  2EQU A;  1QVP A;  1OI1 A;  2J6K A;  4ELY C;  2R5A A;  2LRQ A;  1UGS B;  2RHU A;  2EAY A;  3I35 A;  3I56 A;  4M77 C;  4ME7 A;  2CH4 A;  2PQW A;  3KBG A;  3LWI A;  4M77 A;  2NUP A;  3HKS A;  2RN8 A;  1BCO A;  1K8A C;  3OYI A;  3EFS A;  4M4Z A;  2GQI A;  3A8H B;  1NJI U;  4QQ6 A;  3U23 A;  1WJR A;  3GF5 A;  4LXC A;  4HVU A;  1OEB A;  5GAM g;  2EYZ A;  7AT1 B;  4OMO A;  3JCM W;  4J9F A;  1VQ4 Q;  3H0F A;  1ZA1 B;  1NM7 A;  2X3X D;  1ZBX A;  4PLI A;  5LJ3 e;  2R58 A;  4M77 D;  1GFD A;  4D8D A;  3MEA A;  3UA7 A;  3EHR A;  2JXB A;  2COW A;  3QYH B;  2EKH A;  1PG5 B;  4OMN A;  5CKF A;  1YNZ A;  2L5Q A;  2PUO B;  1G2B A;  4HCB A;  1OYX A;  1H3Z A;  2JMC A;  2WSC E;  3TSW A;  2JS0 A;  4RKU E;  4PJM A;  5GMK l;  1Y07 A;  4IUQ A;  4EMG A;  2LZ6 B;  4BE1 A;  3AT1 B;  4ANJ A;  1B34 B;  1U3O A;  5FRM A;  3ZFJ A;  2IVW A;  3JCM e;  2EBP A;  2EYX A;  3KXT A;  4A4G A;  1M1K R;  1KJW A;  1QP2 A;  4OB3 B;  1WXB A;  3DLL A;  1AWO A;  5FU6 C;  1IRE B;  2CS7 A;  3NMZ C;  3X28 B;  2QQS A;  3HTR A;  4XTW A;  4C0Z A;  2OAW A;  2KRS A;  2O88 A;  4LDV A;  3V7R A;  2I2L A;  3M0U A;  3MJX A;  4ZN3 A;  3QZ5 B;  2E12 A;  4M7A C;  1M1K C;  2K5I A;  2HD0 A;  2HSP A;  1W70 A;  4M7A A;  2EYQ A;  2CP6 A;  1IGQ A;  1WLP B;  5HY6 A;  3S6W A;  2LCC A;  1YI2 A;  2ZZD A;  4C0D B;  3CPW S;  2K7A A;  1WFW A;  2L3P A;  3PIO A;  3VYH B;  1KC8 U;  2FG0 A;  3L2Z A;  1G3T A;  3PVQ A;  3GPL A;  2BE7 D;  2C0I A;  3NHN A;  2VKN A;  2VWF A;  4J9G A;  3CCS Q;  2EGE A;  1YI2 T;  5LJ5 e;  4M7A D;  1Y96 B;  3MP8 A;  5CAI A;  2CYZ B;  2DLP A;  3CPW P;  2OJ2 A;  4E47 A;  2RNA A;  2DD4 A;  1KHC A;  2O01 E;  3O8V A;  1D3B B;  5IHN A;  4XQ3 A;  1YJ9 T;  1VQ4 A;  3OMC A;  1C6V X;  1XNI A;  4NOY A;  1YJN Q;  4ORZ A;  1HSQ A;  3FRN A;  4M7D F;  1I1J A;  4UC4 A;  1QKX A;  1ZA2 B;  2RHZ A;  2EJ9 A;  3RMS A;  4DBR A;  1WHG A;  3RIR A;  1Q7Y U;  2DEU A;  4M77 G;  3CEY A;  2EFI A;  4F7U B;  5C6S A;  2LX9 A;  4PL6 A;  4F7U E;  1UG1 A;  1XTD A;  3EG9 A;  3JB9 D;  2E70 A;  4JLI A;  3HL8 A;  3PE0 A;  5LJ3 g;  1RLP C;  4XTU A;  4R0K A;  3CC4 Q;  2YHT A;  3CCE Q;  4KH1 B;  1F1B B;  4C0D C;  3S3N A;  5GAN d;  3L2Q A;  2KVQ G;  2V26 A;  2WSF E;  2VGM A;  4ESR A;  2Y90 A;  2VXF A;  1B07 A;  2IIM A;  4AMC A;  2YRC A;  3M4Y A;  1WHJ A;  5IHK A;  5EG2 A;  4A4K A;  2D1X A;  4GY5 A;  4N4H A;  4CC4 B;  2JM8 A;  2O31 A;  3CXC A;  3OY9 A;  2LNH B;  4RTX A;  4FSX A;  2W10 A;  3VS1 A;  2Y4Y A;  3M55 A;  3JCM g;  5IAY A;  3OYM A;  4FCY A;  2K3X A;  4JRK A;  1Y96 A;  3CCQ T;  2QXF A;  5I2M A;  2RJF A;  3OYL A;  3CCR Q;  1D3B A;  3G71 T;  2BZX A;  2JOY A;  2E4H A;  4E7J A;  4XTV A;  4OMM A;  2XU8 A;  1TH7 A;  4X9D A;  4DBF A;  1UTI A;  4ZTF A;  1WHK A;  2DYB A;  5GAN 2;  3FC3 A;  2CGH A;  4M78 B;  2AHJ B;  1TUG B;  3CCS A;  1CKA A;  4F7U A;  1VQK T;  3S3O A;  1VQO T;  2JTF A;  1WDX A;  1K1Z A;  1U06 A;  3FLG A;  1B7T A;  3CC7 Q;  3P8B B;  2QTV A;  4M7A G;  1ZUY A;  3I5R A;  2RM4 A;  5CO7 A;  1YJN A;  1SF9 A;  3URG A;  2KK4 A;  4M75 C;  4OP0 A;  2XDB A;  2DET A;  3UA6 A;  1PKT A;  2KT1 A;  2F5T X;  5LJ5 g;  1NG2 A;  1MHN A;  5FRO A;  2CT4 A;  5GMK h;  2BE9 B;  2GCX A;  3E1S A;  3RDV A;  1FX7 A;  4NL2 A;  4KGZ B;  5A0D A;  2JNG A;  2YUN A;  4A53 A;  1VQ5 Q;  1V29 B;  4EPC A;  2RB6 A;  4KGV B;  1N9R A;  3PIP A;  1JO8 A;  3CCE A;  1MMG A;  1WPY A;  1VQ7 Q;  2O9S A;  2LCS A;  4AG2 C;  4M75 D;  1KHI A;  1X01 A;  2RMO A;  3MP6 A;  3V8J A;  2FZG B;  2AT1 B;  1I07 A;  4NL3 A;  2DL3 A;  1GL5 A;  3OA6 A;  1SG5 A;  3VS6 A;  2ZAE A;  1AVZ C;  6AT1 B;  2LC4 A;  4HCC A;  4PJO E;  2BTT A;  3LGL A;  2P4T A;  1O9S A;  2HNI A;  3R6O A;  4HXJ A;  1I81 A;  2V1Q A;  1JU5 C;  3FJP A;  2MI6 A;  1U1T A;  2COZ A;  3WVD B;  3OYF A;  2X3W D;  4P5N A;  4RTY A;  3CCR A;  1K73 R;  3G7Z A;  5CKE A;  1BU1 A;  3TSZ A;  2QGF B;  3P8H A;  5GAN h;  1YIT T;  1WA7 A;  2QGG A;  2F2W A;  3TCJ A;  2NUT B;  1YJW T;  2JS2 A;  3CME A;  2D0Q B;  1Y71 A;  3QBY A;  3OW2 A;  3AHU A;  2FPF A;  4BD3 A;  2E10 A;  1G83 A;  2IG0 A;  4A63 B;  4BI3 A;  1K73 C;  3INZ A;  3P8D A;  3ER0 A;  1N8R U;  4JPB W;  3FEO A;  4MDX A;  4E7K A;  4C5G A;  1W2B A;  3CME T;  2LDM A;  5GAO q;  3QG1 A;  3VU3 C;  3OS1 A;  2DD5 A;  4KBM B;  5GAN 6;  5FRN A;  1RAB B;  3LGF A;  3CC7 A;  2LQW A;  4LDU A;  3SWN B;  1W6X A;  2NUZ A;  2MYS A;  2ZCF B;  3JB9 F;  3JCM J;  2KMT A;  2DFU A;  4F04 B;  3QDF A;  2QAS A;  4PJO C;  3CCU Q;  4IUU A;  1BBZ A;  4RMO A;  4PJO A;  2E64 A;  1KFZ A;  1KD1 U;  1DJ7 B;  4M7D B;  2YSQ A;  3ZL7 C;  4M7D E;  1VQ5 A;  1JXM A;  4MML A;  3SFM A;  4A54 A;  5I22 A;  1R0B G;  1X43 A;  3JSC A;  3M5A A;  5GAN 8;  1BI1 A;  1Y57 A;  1VQ7 A;  2RHI A;  3CD6 A;  2F2X A;  1Y0M A;  1XQH A;  4HVW A;  2C0O A;  2KE9 A;  1YCY A;  4IUR A;  2K9G A;  2RHY A;  2NUT A;  1MV0 B;  4FM4 B;  1AWJ A;  4PJO D;  4C92 F;  3M0P A;  1NEB A;  2E3I A;  4OB1 B;  1QW1 A;  1VQ8 T;  2QYZ A;  2K2M A;  2RQR A;  5D6X A;  4M75 G;  4OMP A;  3GBQ A;  1VQ7 T;  5GAM h;  4R55 A;  3CD6 T;  2FEI A;  1Q81 U;  1M2V B;  1WHM A;  3A8M B;  1HXD A;  2HDA A;  3ME9 A;  2L89 A;  3E9G A;  9ATC B;  3OYE A;  4CC7 A;  4LNP A;  2MMP A;  4BI8 B;  3R6N A;  2PUK B;  3PMT A;  2QQA A;  1M90 U;  2QG9 B;  3SWN A;  3GNG A;  3OYA A;  1MMN A;  2GTJ A;  3PTA A;  2OTL T;  5D7U A;  2RD1 A;  8ATC B;  3JCM d;  2PVD B;  2CT3 A;  2VXE A;  5KE2 A;  5AYF A;  4KGX B;  2RI2 A;  4FT4 A;  4RTT A;  4N0A C;  2DEQ A;  1UB4 A;  3SHW A;  3QZ9 B;  3VUZ A;  3SB2 A;  2CDT A;  2EWN A;  4M7D A;  1OPL A;  4PLL A;  1X6O A;  4C8Q B;  2RH2 A;  1E7O A;  3H6Z A;  3I5S A;  2LQK A;  4C8Q E;  2ZPE B;  2RA2 A;  3M0R A;  4O5V A;  1WJS A;  2BIV A;  2HKN A;  2O2O A;  1Q7Y R;  2EQI A;  2C0T A;  2KSS A;  4E7H A;  2DO3 A;  3LLR A;  5ECA A;  4C5I A;  4E7I A;  3A8G B;  2LQN A;  2O9V A;  1VQP Q;  2RJD A;  3REB B;  2CP0 A;  2RF0 A;  4VUB A;  3CCL Q;  1U1S A;  1P92 A;  1MMD A;  3EH1 A;  2KQW A;  4RG2 A;  4QQG A;  1Z9Z A;  1K9M U;  2D9T A;  4KH0 B;  1QCF A;  2X51 A;  1G3Y A;  1JEG A;  4OB2 B;  1Q7Y C;  1H3H A;  4MZP A;  2EQK A;  2DF6 A;  2JJ9 A;  4EMK B;  3MP1 A;  2X35 A;  4PJJ A;  4L5G A;  5KYX A;  4BY6 C;  5CQY A;  5FWB A;  2F5K A;  2RO0 A;  2JW4 A;  4C0G A;  5FLX E;  1X69 A;  2L3Q A;  5LJ5 d;  1UUE A;  1QWF A;  1YI2 Q;  2JN0 A;  1XOV A;  4HVV A;  1ZBJ A;  2L8D A;  5FU7 C;  4JZ4 A;  3L2V A;  2MF2 A;  2M0Y A;  4V2S A;  3LW5 E;  3E2U A;  2L2P A;  1YWP A;  4J7I A;  5KYY A;  1YJ9 Q;  2EPD A;  1NPR A;  4PJO G;  1ZUK A;  4PNO A;  1E6H A;  4C8Q C;  4L6V 5;  1QWE A;  3JB9 J;  4DBQ A;  4C8Q A;  2JT4 A;  2JZ2 A;  1ZLM A;  2OX7 A;  2VUB A;  2EKO A;  1YBY A;  3CPW A;  5KH6 A;  3VKI A;  1UE9 A;  1BKB A;  5DLO A;  4J83 A;  5EC7 A;  1WQ7 A;  4XU3 A;  3RNJ A;  2ENM A;  2EW3 A;  1T3S A;  4LE9 A;  5AT1 B;  3H8Z A;  3NFC A;  1HK9 A;  4ZTJ A;  1OQK A;  2XG8 D;  1CKB A;  4OF1 A;  1Y7X A;  2ECZ A;  5LJ3 h;  3OBY A;  1VYV A;  4LD6 A;  2EQM A;  2HQX A;  1VOM A;  2MOX A;  3BDL A;  2KEA A;  2X4Y A;  1AT1 B;  1ZQ1 A;  2MK5 A;  4XTY A;  4EMK A;  4K11 A;  2M1H A;  5CQX A;  4BE2 A;  2DL8 A;  2CH4 W;  2CP3 A;  5CKD A;  2D8H A;  2H3J A;  2I0N A;  3RUX A;  2YUQ A;  2FVU A;  1T3L A;  2YT6 A;  1VQP A;  4JRP A;  4L59 A;  3NTK A;  1UEC A;  3X20 B;  3CCL A;  3JCM h;  1QP3 A;  3CCQ Q;  2DZ9 A;  2MCN A;  3WXM B;  1ZX6 A;  3G71 Q;  3OS0 A;  2DIL A;  3G1J A;  1WGS A;  2DA9 A;  4FSS A;  1G8X A;  2HQE A;  1VIF A;  2YRD A;  1VQP T;  2ROL A;  3HRU A;  1M2O A;  1UGV A;  4BI4 A;  2QDY B;  4IIM A;  2LX7 A;  3CCL T;  1OOT A;  2DE0 X;  2PVO B;  5A2Q E;  4AFQ C;  2K3Y A;  4EDU A;  2RQW A;  2LT1 A;  5KYW B;  2E3H A;  3L42 A;  3CBM A;  3QPH A;  1A0N B;  3RES A;  2Y4X A;  1VQK Q;  1FWZ A;  5CKH A;  1IO6 A;  1VQO Q;  5J3B A;  2KGT A;  2YLC A;  4WF2 A;  3OSV A;  1K4U S;  2CP2 A;  1YJ9 A;  3QII A;  2QQR A;  4BE0 A;  5KE3 A;  1K0X A;  4IUV A;  4A4F A;  4C92 B;  5KCO A;  2VGN A;  4E6R A;  4LN2 A;  1Q82 R;  1B34 A;  1JB0 E;  3GLX A;  2ZPB B;  3CCJ T;  2QQ9 A;  2DTI A;  5LJ5 h;  3EG2 A;  3EH2 A;  1N8R R;  4DEX A;  1M1F A;  2E6Z A;  1XJW B;  3M56 A;  1SHG A;  1Q86 R;  2CUD A;  3QWX X;  4HCZ A;  2ATC B;  3UWN A;  2P4R A;  1Q82 C;  1H64 1;  4YTL A;  3JV3 A;  1KQ1 A;  2LJ1 A;  2MWP A;  5D6W A;  2JVV A;  5D6Y A;  4JRI A;  4FW1 A;  3MHX A;  2DK3 A;  3OYD A;  2R57 A;  1N8R C;  2J06 A;  2WAC A;  4N4I A;  4F14 A;  2M16 A;  1Q86 C;  2JTE A;  4RCC A;  4LDX A;  4CC2 A;  2BKD N;  4LUD A;  4C8Q G;  4D8K A;  2M02 A;  2XID A;  3G4S T;  3EGU A;  5KYW A;  2DXB A;  2H3E B;  1QQJ A;  2DER A;  2K79 A;  1KD1 R;  1YIJ A;  3A5Z B;  3CC2 Q;  5GJW B;  2DNU A;  2YRV A;  3CCQ A;  2KYB A;  1AZG B;  1BI3 A;  3G71 A;  2EJF A;  1Q95 G;  4ZGJ B;  1YIT Q;  4JDS A;  3EHQ A;  1ABQ A;  2AKK A;  3HRS A;  1OX9 A;  1H8K A;  3BDU A;  2LCL A;  1YJW Q;  1YIJ T;  1PC0 A;  2DPP B;  1KD1 C;  1WHL A;  4KUL A;  1MNE A;  2NWM A;  3QHS A;  2XMF A;  1NEG A;  3H0I A;  2HEQ A;  1K8A U;  4FYY B;  4XU1 A;  3HPW A;  4C5E A;  2G3R A;  1VQK A;  3CME Q;  3M58 A;  1M27 C;  1VQO A;  5A0G A;  2FO0 A;  4A4E A;  4PFP A;  2ZGW A;  3N5B B;  3UAT A;  4M78 E;  4M77 F;  2KBT A;  1M3A A;  1RUW A;  2HBW A;  5FW9 A;  2VV5 A;  2NYS A;  1PD1 A;  4B6M A;  2GFU A;  2KYM A;  3EFO B;  1W4S A;  3NPF A;  2A0F B;  2XK0 A;  3LX7 A;  3LYI A;  3M59 A;  4CC3 A;  2F1L A;  4ZNX A;  3BFM A;  2DXT A;  4BUG A;  1M3C A;  3O5Z A;  4FT2 A;  4ZGD B;  2DRK A;  2ZPF B;  2MWO A;  2G6F X;  2GQV A;  5GAM d;  2HL3 A;  5DM7 R;  1SPK A;  1M5Q 1;  1I5O B;  2KNB B;  2LNV A;  4PFO A;  1K9A A;  2YDL A;  4J6Y A;  5DLQ E;  2KI7 A;  1VQ8 Q;  1FMW A;  1KG1 A;  2MPX C;  4MZM A;  1K9M R;  1IRX A;  4RTZ A;  3CD6 Q;  4J9E A;  2P0Q A;  5IN1 A;  1OV3 A;  2FL7 A;  3CC2 A;  4DOW A;  4OMF B;  3CBP A;  2GFA A;  4N4G A;  4M78 C;  3L2W A;  1PHT A;  2NLU A;  4PKC C;  2DJQ A;  2QI2 A;  5CK9 A;  1YIT A;  4M78 A;  1NLO C;  3J80 E;  2DTH A;  4CRI A;  1K9M C;  3X26 B;  1WQW A;  3JAM E;  3L2U A;  1YJW A;  2D8J A;  3PGG A;  1GXI E;  2PNI A;  4GLM A;  3CC2 T;  1WI7 A;  2EGC A;  2P0P A;  3VS3 A;  1X27 A;  2OTL Q;  4NS5 A;  2AZS A;  5IH2 A;  1J3T A;  2YXY A;  2HQH A;  1U5S A;  3EFO A;  3QXE B;  1D09 B;  1I4K 1;  1MMA A;  1VQL T;  4M7A F;  1KSW A;  5GMK j;  1TS9 A;  5CIU A;  2DKG A;  3RMQ A;  1QVF P;  4LDY A;  4B9W A;  1NJI R;  4Z02 A;  4M78 D;  3OMG A;  1N9S A;  2E41 A;  2CKK A;  3ULR B;  1QKW A;  3J7A F;  1KQS P;  4Z89 A;  3GIB A;  4Y91 A;  4C0F A;  1VYT A;  4XK8 E;  4HT9 A;  3A8L B;  3UF4 A;  1K76 A;  3MEW A;  4FIB A;  3MEV A;  3EAE A;  3EG3 A;  1NJI C;  1SSF A;  2OTJ T;  2HMA A;  1N27 A;  4QW2 A;  1EZZ B;  1RL2 A;  3OYN A;  1S72 A;  1UHF A;  2V8K A;  2KRM A;  2FPE A;  4HKE A;  1RLQ C;  4BB7 A;  4JLG A;  4Y28 E;  1H92 A;  1MUZ A;  1GRI A;  3I9Q A;  2YLB A;  1PNJ A;  5J26 A;  1RAC B;  2P84 A;  4XAX B;  1VA7 A;  3QJ6 A;  1S72 T;  1RI9 A;  3V7C A;  5GAN j;  1BB9 A;  3X24 B;  1HJD A;  2KRN A;  1LNX A;  3J81 E;  3DB3 A;  4F7U G;  2KAF A;  1X2K A;  4EIK A;  1VQ8 A;  1YHQ A;  3ZEH A;  2EIF A;  4KUD K;  3CCM Q;  1ABO A;  1HYO A;  3QDR B;  3VUB A;  3PNW C;  4C5H A;  4RTV A;  1FXX A;  2QAZ A;  4ATO A;  1PRL C;  4AFU C;  2QEX A;  1YHQ T;  1ZSZ B;  1WYX A;  2MIO A;  1YCS B;  1NPP A;  2E1H A;  5LJ3 d;  1C0M A;  1X6B A;  5CVI A;  3JB9 H;  2GNC A;  2PVG B;  3JCM c;  2OTL A;  4X9C A;  2PU9 B;  2J05 A;  5GAO r;  2QA4 A;  1SRM A;  1KC8 R;  1M4Z A;  1V76 A;  3JB9 I;  2QEX T;  1VQ6 Q;  3SWN C;  5GAO m;  4LUE A;  2LJ0 A;  1OU9 A;  1MND A;  1WXU A;  4HCK A;  3SD4 A;  4Z88 A;  2FZC B;  3V7S A;  2CSI A;  3OYH A;  1GCP A;  3TQ7 P;  4IKF A;  2BZ8 A;  2XDP A;  4JJC A;  5LL6 S;  3JCM f;  2QA4 T;  1GFC A;  2CP7 A;  3H9N A;  1KC8 C;  4OGC A;  1BI2 A;  2E65 A;  2QDL A;  1GCQ A;  1LJO A;  2ZPI B;  4M7D C;  4M78 G;  4TVR A;  5KYU B;  3FJ5 A;  4J9I A;  1QVG P;  1WZO A;  3KFV A;  2VC8 A;  2A37 A;  3NGP A;  3OYB A;  1JJ2 S;  3C12 A;  4PJL A;  3A8O B;  4XU0 A;  4M77 B;  4FL6 A;  4M77 E;  1ACM B;  3M9Q A;  5GAM j;  1VQM T;  3FIF A;  1IGU A;  3BE3 A;  2F2V A;  2FRY A;  2LTO A;  1OUL A;  3S3M A;  1M9S A;  4M7D D;  1ZSZ A;  2QQB A;  4M75 F;  1JJ2 P;  1M2V A;  3VYG A;  1LOJ A;  3LH5 A;  4X34 A;  2HZY A;  4KUI A;  3M53 A;  2K2V A;  4Q5W A;  2XD0 A;  2DZC A;  4FW2 A;  1N6A A;  3VS5 A;  5IXF A;  2BUD A;  3CCM A;  5IHI A;  1AWW A;  2FB7 A;  5LJ5 f;  2IPO B;  4JJN K;  1HD3 A;  3OB9 A;  1NYF A;  3TRE A;  3GP8 A;  1ZUU A;  2KDS A;  3CCJ Q;  5HK3 A;  1TTH B;  2W0Z A;  3CMA A;  3CQT A;  2JUF A;  3CCV T;  4J5Y A;  1EX4 A;  4F16 A;  3CCM T;  4MDW A;  2ROT A;  2Z0W A;  4JUV A;  3RKY A;  2XDD A;  1BIB A;  1D1B A;  3EGD B;  1IB8 A;  3EFR A;  5KYU A;  3M0Q A;  4IIO A;  3TEE A;  5M9O A;  3MCA B;  4JS5 A;  1VQN T;  2DM1 A;  4J9H A;  1VQ6 A;  3BW1 A;  4XTX A;  1I5L A;  2DXU A;  1UGP B;  2X4W A;  3CMA T;  1K73 U;  5IT9 E;  1AOJ A;  5FU6 B;  4GBQ A;  2CRE A;  3D7S B;  4AFS C;  2ED1 A;  4BDZ A;  3G6E Q;  3I56 T;  3TVT A;  1VQ6 T;  1G3S A;  2VYT A;  2D6F A;  3JCM V;  3HSB A;  4M7A B;  3G4S Q;  2FHD A;  3HHT B;  4C8Q D;  4M7A E;  1VUB A;  4IUT A;  2DBM A;  1W1F A;  1YP5 A;  2YUP A;  5KCH A;  4EMK C;  1R77 A;  4MMK A;  2QTX A;  2DRM A;  1AZE A;  3X25 B;  2JTM A;  2EVR A;  5GAN 7;  1PRM C;  2KXC A;  1BI0 A;  4R56 A;  2D0N A;  3OBW A;  1M8M A;  4AFZ C;  2ZPH B;  2OI3 A;  4ELZ C;  4D6W A;  4BDY A;  1YIJ Q;  1TUC A;  2DVJ A;  3JRZ A;  2RQV A;  3OQ5 A;  2K3B A;  1QCO A;  5I11 A;  2K57 A;  4RUG A;  3OYY A;  4E7S A;  1VYU A;  4PJO F;  1OPK A;  3VV0 A;  2FYK A;  4E7L A;  2M0O A;  3EGD A;  4M7D G;  4DEY A;  1PKS A;  3JCM P;  4QQD A;  3A98 A;  2K5L A;  2MAM A;  3MET A;  2HL5 C;  4J9B A;  1EIF A;  4WCI A;  5L8R E;  2JM9 A;  2LT4 A;  5LJ3 j;  4QKU A;  5L23 A;  1RAF B;  1V1C A;  1Z9Q A;  3EG9 B;  3VJP A;  5I21 A;  3T9N A;  2P0K A;  3CCJ A;  2KXD A;  1BK2 A;  1VQ9 Q;  5HCK A;  1RAH B;  1QMC A;  2RQU A;  3V8K A;  4FYX B;  4JS4 A;  2DL5 A;  2DL4 A;  5HKC A;  4C92 E;  2O4X B;  3GNF B;  2J6O A;  2E5Q A;  4PK4 A;  2V8I A;  5GAN 4;  1M3B A;  2K4Y A;  3L1A A;  3C0C A;  1D0Y A;  3M0T A;  1UHC A;  3RR6 A;  3EG0 A;  2M51 A;  1RAD B;  4II1 A;  3GOX A;  1TUD A;  3HP9 A;  3REA B;  2ZPG B;  3ZBD A;  1TG0 A;  3G6E A;  4E2F B;  4AT1 B;  2EJG A;  3G4S A;  2RJE A;  3H0H A;  4OML A;  1AHJ B;  4ZN1 A;  3Q1J A;  1WX6 A;  3VS0 A;  1UFF A;  3CBO A;  2KT8 A;  2AIR B;  1X2Q A;  2ED0 A;  1RI0 A;  3G6E T;  1ZSG A;  2HKQ B;  3F70 A;  2CUB A;  2GBQ A;  5HK0 A;  5GAN f;  4FU6 A;  3QUI A;  1VQ4 T;  2AK5 A;  5FWC A;  1D0X A;  1G3W A;  1K0S A;  3OSS C;  2RK1 A;  1PSF A;  2HBP A;  3RKW A;  4C92 C;  3LWH A;  3DKM A;  2ESW A;  1VQL Q;  4ZGE B;  2H8H A;  2J6F A;  2LQ8 A;  5LJ5 j;  4C92 A;  1JRI A;  2CZ6 B;  1TWB A;  2O4X A;  1N5Z A;  5C0M A;  3E9F A;  1M8V A;  4JRQ A;  2A08 A;  3KUF A;  4M75 B;  4M75 E;  5GAO l;  3MO8 A;  2OAU A;  2EQJ A;  3NTI A;  1I0C A;  1Q81 R;  2JMA A;  1LVK A;  1SSH A;  3EG1 A;  2HAX A;  3RER A;  4F17 A;  1QLY A;  1SKU B;  3L2R A;  4QT7 A;  2DIG A;  3VS7 A;  2OTJ Q;  4RG8 A;  1QVF A;  1VQ9 A;  4C92 D;  2C06 A;  2DBK A;  1M90 R;  1T0H A;  3NTH A;  4O6J A;  1MGQ A;  1U8R A;  1Q81 C;  1KQS A;  4BAC A;  3OYJ A;  1JBM A;  3OS2 A;  5J39 A;  4DBH A;  1KIK A;  1VQ9 T;  4C8Q F;  1UGQ B;  2A36 A;  1KK7 A;  1S72 Q;  3C94 A;  1ZHI A;  2RK2 A;  3RKX A;  1M90 C;  4RTU A;  2M9U A;  4DOV A;  2XHC A;  5DY9 A;  5I2S A;  1TXQ A;  5CR2 A;  2V8J A;  4JZ3 A;  1RAA B;  4Y92 A;  3HFO A;  1UJY A;  5GAM f;  3C95 A;  8AT1 B;  3PFS A;  1FMV A;  2BZY A;  1R8O B;  1R0C B;  2A7Y A;  3PVL A;  3CCS T;  2KR3 A;  4JJB A;  4PFZ A;  5GMK e;  1IXD A;  3JCM X;  4A4H A;  2VVK A;  1NYG A;  1RAE B;  1YHQ Q;  4M75 A;  4LDW A;  1MV3 A;  3JCM b;  3VS4 A;  2GGR A;  3CXC S;  2DXC A;  2KRO A;  3BY7 A;  5GMK m;  2DYI A;  1YJN T;  1M1K U;  1TU0 B;  1SEM A;  1KQ2 A;  4OB0 B;  2QEX Q;  2CZ1 B;  2ABL A;  2V1R A;  2X9H A;  3DB4 A;  1D1A A;  2RI5 A;  3IQL A;  3CC4 A;  1QVF S;  2LVM A;  3UPU A;  1VQL A;  2EYY A;  2DL7 A;  2RQT A;  3EGX B;  3JB9 G;  1GBQ A;  2GTO A;  4XU2 A;  1KQS S;  2LJ3 A;  2QA4 Q;  3CXC P;  2AZV A;  3QWY A;  3HRT A;  3M4G A;  2YUO A;  1FMK A;  4CI0 C;  3CC4 T;  3C4S A;  1VIE A;  3CCE T;  1UGR B;  4PJO B;  2PTK A;  4OGE A;  5IXB A;  1OX8 A;  4XTZ A;  5GAN e;  3HFN A;  2OTJ A;  1UEB A;  1X75 C;  3QJY A;  2WSE E;  2DAQ A;  3VRY A;  1WHH A;  4MZT A;  2FPD A;  3DLM A;  1WJQ A;  1JXO A;  3VRZ A;  1VQM Q;  3PMI A;  4C92 G;  2L3R A;  4J9C A;  3I55 Q;  1Q82 U;  2SRC A;  4IUP A;  2FRW A;  2L3S A;  2AKL A;  1QVG A;  4J6X A;  1WXT A;  2X4J A;  4HA8 A;  1PSE A;  4J8O A;  3CCR T;  1I8F A;  3CPF A;  2LMJ A;  1NBE B;  2J7I A;  4J6W A;  3WVE B;  2KY9 A;  4KT0 E;  1JQQ A;  2A28 A;  1UDL A;  1Q86 U;  5CKB A;  1S1N A;  1GBR A;  4Z8A A;  2EYW A;  2XI9 A;  4FYV B;  1YFN A;  3FDR A;  2DX1 A;  2B8A A;  3EGX A;  1IHV A;  5GAN 5;  1IHW A;  4GLK A;  1JJ2 A;  4QVC A;  2F69 A;  3PT9 A;  4OVA A;  3MPU B;  3CCV Q;  3MEU A;  1IZ6 A;  1RAI B;  2CZ7 B;  3JCM Q;  3SDZ A;  3CC7 T;  1M30 A;  1PCX A;  2DJZ A;  3M54 A;  1AWX A;  3TU4 K;  1NE8 A;  1O75 A;  3RBB B;  1VQN Q;  1SHF A;  3CMA Q;  1YN8 A;  2GF7 A;  5LJ3 f;  3OS5 A;  1AEY A;  1TOV A;  4HT8 A;  1WNL A;  2DMO A;  4OMQ A;  4RCB A;  4J7F A;  5GAM e;  4RTW A;  2COY A;  2PZ1 A;  1VQ5 T;  3I56 Q;  2HSE B;  4KRT A;  5GJV B;  2B86 A;  2VAS A;  1QVG S;  1OZ3 A;  2RJC A;  2CP5 A;  3OW2 S;  1OU8 A;  3OYK A;  4QVZ A;  3QSU A;  1C1A A;  2DVE A;  1AD5 A;  1M1G A;  4JJD A;  1ARK A;  4FYW B;  2EGA A;  2XKO C;  5KYX B;  1GCQ C;  1W2B S;  5KYN A;  3LH0 A;  2FZK B;  4BY6 B;  4AG1 C;  1QCN A;  1G5V A;  4EMH A;  3QYG B;  4B9X A;  2K6D A;  1VQM A;  2A3L A;  2YWW A;  3M57 A;  3OW2 P;  1YWO A;  4PJN A;  2DTO A;  3M0S A;  3I55 A;  4F7U F;  1FYN A;  5A0L A;  3ASK A;  5FU7 B;  5GAN g;  1TSF A;  3H41 A;  1BCM A;  2NUP B;  5KYY B;  1UJ0 A;  1LPL A;  3V8L A;  1W2B P;  2CZ0 B;  2XIC A;  2LP5 A;  3MKD A;  2DIQ A;  4N0A A;  4QVD A;  1RAG B;  1OZ2 A;  3UT1 A;  1ZSZ C;  3I55 T;  2RHX A;  1X6G A;  3OYC A;  2SEM A;  1E6G A;  3SEM A;  2R5M A;  2HCK A;  4J9D A;  1EFN A; 
#chains in the Genus database with same CATH homology
 4E7K A;  4C5G A;  4DA4 A;  1W2B A;  2K5L A;  2K5F A;  2MAM A;  2ZGW A;  3MET A;  3CME T;  2LDM A;  1EIF A;  5L8R E;  5GAO q;  3N5B B;  3QG1 A;  3VU3 C;  3OS1 A;  2LT4 A;  2DD5 A;  2E6N A;  4KBM B;  5LJ3 j;  2X4X A;  5GAN 6;  5FRN A;  4M78 E;  4M77 F;  1BIA A;  3CCU A;  3UDC A;  3CCV A;  3LGF A;  3CC7 A;  3VJP A;  3FB9 A;  4LDU A;  5I21 A;  3T9N A;  2VV5 A;  2P0K A;  3SWN B;  3CCJ A;  4DQ2 A;  1BYM A;  2ZCF B;  5GAO p;  3JCM J;  3JB9 F;  2GFU A;  3V8K A;  3E19 A;  3OYG A;  4LD9 K;  1W4S A;  2KMT A;  4JS4 A;  4PJO C;  3QO3 A;  2XK0 A;  4IUU A;  3LX7 A;  3LYI A;  5GMK i;  1VQN A;  5CCA A;  5HKC A;  2RI3 A;  4C92 E;  3M59 A;  2O4X B;  3QKJ A;  3GNF B;  4RMO A;  3CCU T;  4PJO A;  2E64 A;  2E5Q A;  1NZ9 A;  5GAN 3;  5GAO n;  2V8I A;  5GAN 4;  1KD1 U;  1DJ7 B;  2K4Y A;  3L1A A;  4M7D B;  3BFM A;  2DXT A;  4BUG A;  4M7D E;  4M78 F;  4FT2 A;  2EQU A;  1VQ5 A;  4ZGD B;  1QVP A;  4MML A;  3SFM A;  2ZPF B;  1OI1 A;  2MWO A;  4A54 A;  4ELY C;  2R5A A;  3JSC A;  2LRQ A;  2GQV A;  1UGS B;  3M5A A;  2RHU A;  5GAN 8;  1BI1 A;  2EAY A;  5GAM d;  4II1 A;  3I56 A;  4M77 C;  4ME7 A;  1M5Q 1;  2PQW A;  3KBG A;  5DM7 R;  3GOX A;  1VQ7 A;  2RHI A;  3HP9 A;  3CD6 A;  2ZPG B;  3ZBD A;  3LWI A;  1XQH A;  3G6E A;  1YCY A;  4M77 A;  2LNV A;  3HKS A;  2EJG A;  4IUR A;  2RHY A;  3G4S A;  2RJE A;  4J6Y A;  5DLQ E;  1K8A C;  4FM4 B;  3OYI A;  4PJO D;  3EFS A;  1AHJ B;  4C92 F;  4ZN1 A;  1KG1 A;  3Q1J A;  4MZM A;  3A8H B;  4OB1 B;  1NJI U;  1QW1 A;  3CBO A;  1VQ8 T;  4QQ6 A;  5D6X A;  4M75 G;  1WJR A;  3GF5 A;  2P0Q A;  5IN1 A;  2FL7 A;  1VQ7 T;  5GAM h;  5GAM g;  4R55 A;  3CD6 T;  3CC2 A;  1Q81 U;  1RI0 A;  4DOW A;  3G6E T;  4OMF B;  3CBP A;  3F70 A;  2GFA A;  3A8M B;  3JCM W;  1HXD A;  4N4G A;  3ME9 A;  2L89 A;  5HK0 A;  3E9G A;  4M78 C;  3OYE A;  5GAN f;  3L2W A;  2NLU A;  4FU6 A;  3QUI A;  4PKC C;  1ZBX A;  4PLI A;  5LJ3 e;  2R58 A;  2QI2 A;  4M77 D;  1VQ4 T;  5CK9 A;  1YIT A;  3MEA A;  2MMP A;  4M78 A;  4BI8 B;  3J80 E;  3QYH B;  2DTH A;  4CRI A;  1K9M C;  3X26 B;  1G3W A;  1WQW A;  3JAM E;  2PUK B;  3PMT A;  3L2U A;  2QQA A;  5CKF A;  1YJW A;  2L5Q A;  1M90 U;  2PUO B;  3PGG A;  3OSS C;  4HCB A;  1VQ6 T;  3CC2 T;  1GXI E;  2P0P A;  1OYX A;  2RK1 A;  3SWN A;  1PSF A;  1H3Z A;  3GNG A;  3OYA A;  2WSC E;  4NS5 A;  2HBP A;  4RKU E;  3RKW A;  3PTA A;  4C92 C;  1Y07 A;  5GMK l;  3LWH A;  2OTL T;  3DKM A;  2RD1 A;  3QXE B;  4ZGE B;  3JCM d;  4IUQ A;  4EMG A;  2PVD B;  4BE1 A;  2LQ8 A;  2VXE A;  5KE2 A;  4C92 A;  1JRI A;  1I4K 1;  2CZ6 B;  5AYF A;  5LJ5 j;  1B34 B;  1VQL T;  4M7A F;  2RI2 A;  2O4X A;  4FT4 A;  5C0M A;  4N0A C;  5GMK j;  3E9F A;  1M8V A;  2DEQ A;  1UB4 A;  2DKG A;  5CIU A;  3ZFJ A;  2IVW A;  3QZ9 B;  3RMQ A;  3KUF A;  4LDY A;  3VUZ A;  4B9W A;  3JCM e;  4M75 B;  3SB2 A;  4Z02 A;  4M78 D;  3OMG A;  1N9S A;  2E41 A;  2EWN A;  4M75 E;  5GAO l;  4M7D A;  3MO8 A;  4PLL A;  2CKK A;  1X6O A;  2OAU A;  2EQJ A;  3NTI A;  2RH2 A;  4C8Q B;  3H6Z A;  3KXT A;  4A4G A;  3J7A F;  2LQK A;  4C8Q E;  3GIB A;  2ZPE B;  4Y91 A;  2RA2 A;  4C0F A;  4O5V A;  1WJS A;  4XK8 E;  4HT9 A;  2HAX A;  1QP2 A;  3RER A;  3A8L B;  4OB3 B;  2BIV A;  3L2R A;  3MEW A;  3DLL A;  2KSS A;  3MEV A;  2DIG A;  4FIB A;  4E7H A;  2DO3 A;  3LLR A;  5FU6 C;  1IRE B;  2CS7 A;  4RG8 A;  4C5I A;  4E7I A;  3EAE A;  1QVF A;  1VQ9 A;  3X28 B;  2QQS A;  3A8G B;  4C92 D;  2C06 A;  4XTW A;  4C0Z A;  2OTJ T;  1NJI C;  1SSF A;  4LDV A;  2RJD A;  3V7R A;  1N27 A;  2I2L A;  4QW2 A;  4VUB A;  1U1S A;  1P92 A;  3NTH A;  4ZN3 A;  4O6J A;  1MGQ A;  3QZ5 B;  2E12 A;  1RL2 A;  3OYN A;  2KQW A;  4RG2 A;  1U8R A;  1S72 A;  4BAC A;  4QQG A;  1Q81 C;  1KQS A;  4M7A C;  1K9M U;  1M1K C;  3OYJ A;  1JBM A;  3OS2 A;  2D9T A;  2K5I A;  2HD0 A;  1G3Y A;  2V8K A;  5J39 A;  4HKE A;  4M7A A;  2EYQ A;  4OB2 B;  4BB7 A;  1Q7Y C;  4JLG A;  4MZP A;  1VQ9 T;  4C8Q F;  4Y28 E;  2EQK A;  1UGQ B;  5HY6 A;  3S6W A;  2LCC A;  1YI2 A;  2YLB A;  2ZZD A;  4C0D B;  3CPW S;  5J26 A;  4EMK B;  3MP1 A;  2X35 A;  3C94 A;  1ZHI A;  2RK2 A;  4L5G A;  4XAX B;  3RKX A;  3PIO A;  1M90 C;  4BY6 C;  5CQY A;  3VYH B;  1KC8 U;  2F5K A;  3QJ6 A;  2RO0 A;  1S72 T;  2M9U A;  3L2Z A;  4DOV A;  4C0G A;  1G3T A;  2XHC A;  5FLX E;  3V7C A;  3GPL A;  5GAN j;  5DY9 A;  5LJ5 d;  3X24 B;  5I2S A;  5CR2 A;  1LNX A;  3J81 E;  2V8J A;  3DB3 A;  2JN0 A;  4F7U G;  2KAF A;  1XOV A;  1VQ8 A;  2L8D A;  3HFO A;  1YHQ A;  5FU7 C;  5GAM f;  1YI2 T;  3C95 A;  2EIF A;  3ZEH A;  3L2V A;  2MF2 A;  3PFS A;  5LJ5 e;  4KUD K;  4V2S A;  3LW5 E;  1R8O B;  4M7A D;  2A7Y A;  1Y96 B;  3MP8 A;  3CCS T;  5CAI A;  3QDR B;  3VUB A;  2CYZ B;  5GMK e;  4J7I A;  3JCM X;  4A4H A;  3PNW C;  4E47 A;  2DD4 A;  1KHC A;  2O01 E;  1NPR A;  1D3B B;  3O8V A;  4PJO G;  4C5H A;  1FXX A;  4PNO A;  4M75 A;  4XQ3 A;  4C8Q C;  1YJ9 T;  4L6V 5;  4ATO A;  1VQ4 A;  3OMC A;  2QEX A;  4LDW A;  1XNI A;  1YHQ T;  3JCM b;  3JB9 J;  4C8Q A;  4NOY A;  3CXC S;  2JZ2 A;  2DXC A;  3BY7 A;  1NPP A;  2VUB A;  2E1H A;  3FRN A;  2EKO A;  5LJ3 d;  5GMK m;  4UC4 A;  4M7D F;  5CVI A;  1YJN T;  2RHZ A;  1M1K U;  1YBY A;  2EJ9 A;  3RMS A;  3CPW A;  5KH6 A;  3JB9 H;  2PVG B;  3JCM c;  3VKI A;  1KQ2 A;  4OB0 B;  1BKB A;  5DLO A;  2OTL A;  4J83 A;  2CZ1 B;  1WQ7 A;  4X9C A;  2PU9 B;  4XU3 A;  3RIR A;  5GAO r;  2QA4 A;  1Q7Y U;  3DB4 A;  4M77 G;  2RI5 A;  3CC4 A;  1M4Z A;  1QVF S;  3CEY A;  3JB9 I;  2LVM A;  2QEX T;  3UPU A;  1VQL A;  2EFI A;  4F7U B;  3SWN C;  5C6S A;  5GAO m;  3H8Z A;  2LX9 A;  4PL6 A;  4F7U E;  1XTD A;  3NFC A;  3JB9 G;  1HK9 A;  3JB9 D;  2E70 A;  4JLI A;  3SD4 A;  4ZTJ A;  4XU2 A;  2XG8 D;  1KQS S;  3V7S A;  4OF1 A;  1Y7X A;  3HL8 A;  5LJ3 h;  3OBY A;  4LD6 A;  5LJ3 g;  2EQM A;  2HQX A;  3OYH A;  4XTU A;  4IKF A;  3BDL A;  2YHT A;  3HRT A;  3M4G A;  4C0D C;  2X4Y A;  2XDP A;  1ZQ1 A;  5LL6 S;  3JCM f;  2QA4 T;  5GAN d;  3L2Q A;  3S3N A;  2KVQ G;  2WSF E;  3C4S A;  4CI0 C;  1VIE A;  2VGM A;  3CC4 T;  2Y90 A;  1UGR B;  4XTY A;  4OGE A;  1KC8 C;  3CCE T;  4PJO B;  2VXF A;  4XTZ A;  5CQX A;  2M1H A;  4EMK A;  4OGC A;  4BE2 A;  1BI2 A;  2E65 A;  3M4Y A;  1LJO A;  2ZPI B;  4M7D C;  5EG2 A;  5GAN e;  5CKD A;  4M78 G;  3HFN A;  4TVR A;  4A4K A;  2H3J A;  4GY5 A;  2OTJ A;  1UEB A;  1X75 C;  3QJY A;  2WSE E;  2DAQ A;  4N4H A;  3RUX A;  2FVU A;  3CXC A;  5FRM A;  3OY9 A;  4MZT A;  2VC8 A;  3OYB A;  1VQP A;  4JRP A;  1JJ2 S;  3C12 A;  4FSX A;  4L59 A;  3DLM A;  3NTK A;  3X20 B;  3CCL A;  2Y4Y A;  1WJQ A;  3M55 A;  3JCM h;  1QP3 A;  3JCM g;  5IAY A;  3A8O B;  2DZ9 A;  4XU0 A;  3OYM A;  4M77 B;  2K3X A;  4JRK A;  1Y96 A;  3WXM B;  4FL6 A;  4M77 E;  3CCQ T;  3PMI A;  4C92 G;  2L3R A;  3M9Q A;  2QXF A;  5GAM j;  1VQM T;  5I2M A;  2RJF A;  3OS0 A;  3OYL A;  1Q82 U;  4IUP A;  1D3B A;  3G71 T;  1WGS A;  3FIF A;  1QVG A;  4J6X A;  2X4J A;  4HA8 A;  1PSE A;  2HQE A;  1VQP T;  1VIF A;  2LTO A;  3HRU A;  4J8O A;  3CCR T;  2JOY A;  4BI4 A;  3S3M A;  1M9S A;  2QDY B;  4M7D D;  1I8F A;  3CCL T;  4XTV A;  4E7J A;  3CPF A;  2QQB A;  2XU8 A;  1TH7 A;  2PVO B;  4M75 F;  2K3Y A;  4X9D A;  5A2Q E;  4EDU A;  3WVE B;  4J6W A;  2LT1 A;  2KY9 A;  4KT0 E;  4ZTF A;  3VYG A;  1Q86 U;  1LOJ A;  4X34 A;  5CKB A;  4JRQ A;  5GAN 2;  3L42 A;  3FC3 A;  2CGH A;  3CBM A;  4M78 B;  2AHJ B;  2XI9 A;  3M53 A;  3QPH A;  3FDR A;  4KUI A;  3RES A;  2K2V A;  4Q5W A;  2XD0 A;  2Y4X A;  3CCS A;  1FWZ A;  5CKH A;  2DZC A;  1N6A A;  2B8A A;  2BUD A;  5J3B A;  4F7U A;  3CCM A;  2YLC A;  3S3O A;  1VQK T;  2FB7 A;  4WF2 A;  5LJ5 f;  5GAN 5;  4GLK A;  4JJN K;  1VQO T;  1JJ2 A;  2JTF A;  3OSV A;  3OB9 A;  4QVC A;  1YJ9 A;  3QII A;  2F69 A;  3PT9 A;  2QQR A;  3TRE A;  3GP8 A;  4BE0 A;  4OVA A;  5KE3 A;  4IUV A;  3FLG A;  4A4F A;  4C92 B;  3MEU A;  2KDS A;  1IZ6 A;  3P8B B;  4M7A G;  5KCO A;  2CZ7 B;  2RM4 A;  2VGN A;  5HK3 A;  3JCM Q;  3CCV T;  5CO7 A;  3SDZ A;  3CMA A;  2JUF A;  1YJN A;  3CC7 T;  3URG A;  1B34 A;  1JB0 E;  2DJZ A;  3GLX A;  2KK4 A;  4J5Y A;  4M75 C;  4OP0 A;  3M54 A;  2ZPB B;  3CCJ T;  1NE8 A;  4MDW A;  3CCM T;  3TU4 K;  2XDB A;  2QQ9 A;  4JUV A;  3RKY A;  2DTI A;  1O75 A;  2XDD A;  1BIB A;  2F5T X;  5LJ5 g;  5LJ5 h;  3EFR A;  1MHN A;  5FRO A;  5M9O A;  3TEE A;  1M1F A;  5GMK h;  3MCA B;  2E6Z A;  2GCX A;  4JS5 A;  3E1S A;  1VQN T;  1VQ6 A;  3M56 A;  3BW1 A;  4XTX A;  1I5L A;  1FX7 A;  2DXU A;  2GF7 A;  5LJ3 f;  1UGP B;  2X4W A;  4HCZ A;  3CMA T;  4NL2 A;  3OS5 A;  1K73 U;  5A0D A;  3UWN A;  2JNG A;  4HT8 A;  4A53 A;  1Q82 C;  1H64 1;  1WNL A;  4YTL A;  1V29 B;  4RCB A;  5GAM e;  5IT9 E;  4J7F A;  5FU6 B;  4EPC A;  2RB6 A;  1N9R A;  1KQ1 A;  2MWP A;  3PIP A;  5D6W A;  1VQ5 T;  2JVV A;  3CCE A;  5D6Y A;  4JRI A;  1WPY A;  3MHX A;  2DK3 A;  3OYD A;  2R57 A;  4BDZ A;  1N8R C;  1QVG S;  1KHI A;  1OZ3 A;  1X01 A;  2RJC A;  4M75 D;  3MP6 A;  3V8J A;  3I56 T;  2WAC A;  1G3S A;  2VYT A;  4N4I A;  3OW2 S;  2D6F A;  3JCM V;  3HSB A;  3OYK A;  4M7A B;  2M16 A;  4QVZ A;  4NL3 A;  1Q86 C;  4RCC A;  4LDX A;  3QSU A;  2FHD A;  2BKD N;  2DVE A;  3HHT B;  4C8Q G;  4C8Q D;  4M7A E;  1VUB A;  4IUT A;  1M1G A;  2XID A;  3G4S T;  5KCH A;  4EMK C;  3OA6 A;  2DXB A;  4MMK A;  2XKO C;  1W2B S;  1YIJ A;  3A5Z B;  2LC4 A;  4HCC A;  4PJO E;  3LGL A;  2QTX A;  3LH0 A;  2P4T A;  4BY6 B;  2YRV A;  3CCQ A;  4EMH A;  1G5V A;  3QYG B;  1O9S A;  3X25 B;  2HNI A;  4B9X A;  2JTM A;  3R6O A;  5GAN 7;  1BI3 A;  1VQM A;  1I81 A;  2A3L A;  3G71 A;  1BI0 A;  2EJF A;  3FJP A;  3M57 A;  4R56 A;  3OBW A;  2MI6 A;  1U1T A;  4ZGJ B;  3WVD B;  4JDS A;  2DTO A;  2ZPH B;  3OYF A;  3I55 A;  4P5N A;  4D6W A;  4ELZ C;  4F7U F;  3CCR A;  4BDY A;  3HRS A;  5A0L A;  3G7Z A;  3BDU A;  2LCL A;  3ASK A;  3JRZ A;  5CKE A;  5FU7 B;  5GAN h;  3P8H A;  5GAN g;  3OQ5 A;  1YIT T;  1YIJ T;  2DPP B;  1KD1 C;  3TCJ A;  1YJW T;  2K57 A;  3V8L A;  2CZ0 B;  2XIC A;  4KUL A;  3QHS A;  2D0Q B;  3OYY A;  3CME A;  2DIQ A;  1Y71 A;  4N0A A;  4QVD A;  1K8A U;  3UT1 A;  1OZ2 A;  4PJO F;  3QBY A;  3OW2 A;  4XU1 A;  3AHU A;  3VV0 A;  2FYK A;  3I55 T;  4E7L A;  2RHX A;  2M0O A;  4BD3 A;  3HPW A;  4C5E A;  4M7D G;  2E10 A;  3OYC A;  2IG0 A;  4BI3 A;  2G3R A;  1K73 C;  3INZ A;  3JCM P;  1VQK A;  3P8D A;  3ER0 A;  1N8R U;  3M58 A;  1VQO A;  2R5M A;  4QQD A;  5A0G A;  4A4E A;  3FEO A;  4MDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...