1H69A

Crystal structure of human nad[p]h-quinone oxidoreductase co with 2,3,5,6,tetramethyl-p-benzoquinone (duroquinone) at 2.5 angstrom resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
273
structure length
273
Chain Sequence
b'AGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H DEHYDROGENASE [QUINONE] 1
publication title Structure-Based Development of Anticancer Drugs: Complexes of Nad(P)H:Quinone Oxidoreductase 1 with Chemotherapeutic Quinones
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 89
structure length 273
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2001-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1h69A00
3QFRA 4YAUA 5EMNA 4YAOA 3W79A 1XI2A 1ZWKA 4HEQA 3NFRA 1SG0A 3S2YA 1NNI1 4FGKA 4GI5A 3NHFA 1AZLA 1TIKA 5LLDA 2KLBA 4QOFA 4XDHA 4ZVLA 3F6SA 3LCMA 4QODA 3NHWA 4QOHA 1RCFA 1CZLA 4U7HA 2M6SA 1RLIA 2HNAA 3HA2A 3NHUA 1CZNA 2Z98A 3EYWA 4H2DA 2R96A 4D02A 3NHYA 5FUQA 2W5UA 4OXXA 1WSBA 3UXEA 2QMYA 5LJIA 2Z9BA 2B3DA 5JROA 4PU0A 1AHNA 1J8QA 3HR4A 1BU5A 3NHJA 3TE7A 1J9GA 1AKRA 2MTBA 1CZUA 3FJOA 2FZVA 1GG5A 4FGJA 1KBOA 5B3LA 1JA1A 3EDOA 2BF4A 2N1MA 3N3AC 1YCFA 1C7EA 4LAFA 3L9XA 4C76A 1QRDA 1BVYF 2Z9DA 1FTGA 4N65A 3UXHA 3OWHA 4F8YA 3K20A 2OHIA 1AKUA 4ZVMA 1WSWA 1OBOA 3NLLA 4LTMA 3W78A 1QR2A 4M0CA 3QE2A 3F6RA 2FX2A 5F12A 3G5MA 2GSWA 4HS4A 1YOBA 3U7RA 3B6IA 3GFRA 3B6MA 4YAWA 3FX2A 1YDGA 2OYSA 4PTYA 1I1OA 1QHEA 2FAXA 4ZVNA 3W77A 4ZVKA 1DX9A 5FA6A 3GAMA 4PTZA 3N39C 2BN4A 4DY4A 2V5VA 3B6JA 2R97A 1AG9A 2ARKA 4H6PA 4C0WA 2FLVA 3O2NA 3ESXA 1YRHA 2BZSA 6NULA 3R6WA 1SQSA 1J9ZA 1RLJA 3OJXA 1AKTA 1YKGA 3FVWA 2HNBA 3KLBA 4Y9RA 2X2OA 1OFVA 4LTDA 3TEMA 2FVXA 3RPEA 3SVLA 4BMPB 1C7FA 3F90A 1AKWA 2BPOA 5F4BA 4CF6A 1J9EA 5A4KA 2FZ5A 4Y7CA 4C0XA 2KQUA 3TZBA 2X2PA 1QBGA 5FX2A 3NHKA 1XT6A 3ES9A 1D4AA 5LBTA 1T5BA 3OX3A 1FLVA 2V5UA 5LJLA 4YQEA 1TLLA 4GR9A 4U7GA 4R81A 3KEGA 4N82A 2QX6A 4NLLA 2AMJA 1CZOA 4GQIA 3L9WA 2FOXA 4QOEA 5NULA 4CETA 5BUCA 4NULA 2MT9A 1FLDA 5ULLA 1CZHA 1AMOA 2WC1A 1CZKA 3P0RA 1AKQA 4QOJA 4FX2A 4DILA 1FLNA 1ZWLA 1E5DA 3U7IA 1FVXA 1AKVA 2RG1A 2Q9UA 2XOEA 4U7FA 3KAQA 2BMVA 3NHRA 1FX1A 3D7NA 1F4PA 3NHPA 3F2VA 3OX1A 1XYYA 4ESEA 2Q62A 4LA4A 2D5IA 3HLYA 4N9QA 3OVMA 4QOIA 3OX2A 3GFSA 5LBUA 1ZX1A 5EAIA 1FUEA 2M6RA 4QOGA 4BMOB 2FCRA 1H69A 1X77A 2QR2A 4XDGA 3QFCA 2OHHA 2A5LA 3OWXA 1D03A 1FLAA 2MWMA 2XODA 4C14A 2OHJA 2FDXA 3B6KA 2QMZA 1OBVA 5TGZA 5NLLA 1T0IA 3LT5A 3N3BC 2MOKA 1DXOA 1DXQA 3ESYA 1RTTA 4YAFA 5EA2A 1D04A 2QX4A 4FGLA 4LTNA 4ICIA 2QX8A 3FNIA 2Z9CA 5F51A 5B3KA 5LVAA 3K1YA 3ZHOA 2QWXA 3O73A 3OJWA 2ZKIA 1KBQA 3KAPA 3GFQA 3NHSA 1JA0A 4YALA 1XYVA 3NHLA 2QX9A 2F1OA 4Y9UA 1V4BA 3JSXA 2HPVA 1B1CA 1YCHA 3ESZA 2V9CA 1H66A 1CZRA 1YCGA 3W7AA 4S24A 4J8PA 5LMCA 1VMEA 3FW1A 4DIKA
chains in the Genus database with same CATH superfamily
4L4RA 4U1RA 1E2PA 2A4KA 2N47A 3N58A 2FUKA 3ZHQA 3F7MA 1UKVY 4PZYA 4Q4LA 4PGFA 1OLXB 3V42A 1B0UA 2EOAA 4LISA 1H4QA 2FUCA 4NIMA 5JAIA 4MEAA 4Y7DA 3OIGA 3A58B 4IMJB 1XI2A 3CGGA 1BJRE 3E58A 4MUKA 1DFIA 1UKZA 4PC1A 3HKEA 5F4ZA 5FL7D 5ILOA 4YHHB 1K06A 3DMDA 4RJJA 5AVOA 1OFGA 1PG0A 2E49A 4UHDA 2BZ1A 5CLFA 3M6UA 1PJZA 1HTWA 2QT0A 1JJVA 3OZ7A 4OKNA 3WJ1A 3IKVA 2IEGA 3ECAA 3U40A 4M9CA 2IYEA 2C5EA 3H5WA 1OFHA 2A4MA 3MYRA 3KL2A 1UPTA 2RAFA 3LCVB 1LX6A 4QOFA 4LVNA 2MSKA 3K2IA 2LVBA 3OIYA 1K3TA 2JFYA 2JIBA 1WUJS 2QLTA 3C7KA 3HDYA 2X0FA 5KNCA 3C5HA 1DEXA 4EBFA 2V0GA 3H7IA 3U80A 2V8OA 2YWEA 3O31A 2HZ7A 4KR0A 1MIHA 3OEED 2R0QC 1JKXA 4M1MA 3WJAA 1EEHA 1XWWA 2X19A 3H42B 4JLWA 3S7TA 3D4OA 5DN6A 5FI1B 1FTSA 2V8BA 4J91A 4M36A 5T64A 1T3HA 1YL6A 1T2CA 3OFVA 1N5OX 2DG2A 5B64A 2I4LA 2NU7B 2P69A 4Y1GA 1XB2A 3KSUA 4GRDA 1GTL1 2G1KA 1MO4A 3EYWA 2FF7A 2XQVA 3FBWA 1BD4A 1CRQA 2VWPA 3FRHA 4P7FA 4RIEA 4TV8A 3RK4A 2AF4C 2RHOA 1TEVA 4O59O 5G3YA 5AOBA 1CJTC 1Y7TA 4RY0A 2P9TA 4C6HA 4G1BA 4BLUA 5IXYA 5DNDA 1DJMA 1L4MA 2CVFA 2OFOA 4ZHQB 3NHBA 4ZKEA 3ILYA 2BMJA 3N8NA 4JA0A 1SKBA 3QMMA 3DAPA 3CUYA 3GLGA 1CE8B 3A2LA 3SXJA 2Q9BA 2OO5C 3BEDA 1D7AA 2A1UA 1X3SA 3CEPB 1BCSB 1QS0B 3EZNA 1SG9A 4UVIA 3BCUA 4F9EA 3G17A 2NVWA 2DWPA 3WLSA 4EI2A 2BGUA 2YIMA 4U9UA 1LPBB 4TM7A 5TMEA 3NBFA 2IUEA 1MXHA 3DEYX 3VSDA 5ITZA 2PT7A 2OV2A 4RK6A 5JVDA 2M2IA 4FBLA 2FMFA 2JASA 4TVKA 4G0NA 1KJYA 2CLCX 1RKVA 3R5KA 1PR5A 5FTNA 3ZDZB 2IF0A 3QU7A 1G5TA 4PC7A 1LS1A 1QCYA 5CCDA 1JA1A 1DIAA 2G71A 2WUWE 3DFFA 1SQGA 2XHZA 4RKRA 4W1QA 4QSHA 1BO6A 2XCOA 3DMTC 4YA6A 1H4VB 5CLIA 1DP4A 4COOA 4L6AA 4MYDA 4NCJA 2VDUE 4ITVA 8ABPA 1QGUB 1KEEB 1Z83A 5H80A 2ZWAA 5BQ3A 4LUCA 5L6MB 1YBHA 5H0IA 1DE0A 4NCNA 2CNDA 3EEYA 4Q19A 4FLMA 2E89A 1QF7A 3I92A 3T9CA 5IASA 1VP9A 3OQOA 5JPDA 3ETGA 1V1MB 2QTBA 3PGVA 2ALJA 4LQ4A 1EFRD 4OH1A 3T9BA 3KUXA 4Q3AA 2WIDA 4E5VA 1E0KA 1WEKA 4ISBA 1XUOA 3WIDA 3LOPA 4QGHA 4W5QA 5HDBB 5I3ZA 1XNQB 1XHEA 4CMIA 3U0BA 2CLKB 4RVSA 3I1FA 5C8DA 3HZZA 1BXGB 1MOZA 4ZOEA 2HXYA 2L0XA 4UTZA 2DZDA 3TJMA 1L5SA 3EVDA 1XCMA 3T8YA 3HDTA 2QP9X 4AQDA 4EI7A 1PR1A 4Q7EA 4RHYA 4E2FA 2TMDA 5CYOA 4E1AA 3KCQA 4ENPA 1VCMA 1JHMA 1YDGA 2JIMA 2LP4Y 4JLUA 3C48A 4P4UA 1GV0A 1A7JA 2ATVA 2VUUA 6LDHA 2FEMA 3DB2A 3TEFA 1JKJB 4DFDA 4HX9A 2AEJA 2WOOA 2XUAA 3O7MA 5CX1A 1NXOA 1DKMA 4RACA 4G6ZA 4PYMA 3HWWA 4DQDA 1Y3FE 3IP3A 5HOQA 1V3UA 4AD8A 2DTDA 3H5TA 3WGVA 5J23A 1M2JA 2H85A 4PVDA 5CXQA 2EJCA 1N3LA 1U8CB 1ADBA 1DXYA 3C15C 4RVGA 3I28A 2VFAA 2PSDA 4XEHA 4AUKA 1VP3A 1Q3KA 1BS9A 1U3UA 3HR8A 4CKCA 4XZ3A 1G9TA 1LSOA 1VB3A 3KJEA 1JIVA 1XKXA 4US1R 3O2NA 1V41E 4ZCLA 3U39A 4ZZ1A 2GPWA 2V7TA 1J0EA 1Z73A 3VYWA 1ILEA 4BQSA 4GAEA 4LGYA 1X86B 4BFXA 3MBIA 1J9ZA 4GLBA 1LWNA 5G53C 2F62A 3AVOA 2X6TA 1QE0A 4TXNA 1KK2A 3O4RA 3ODPA 3OJEA 4AMYA 3BDAA 1Q21A 4JXKA 4Z2YA 4D74A 5KQGA 3X1JA 1HE2A 1RQ2A 4LTDA 5FHRA 2ZDGA 4B4VA 3K32A 4RKFA 1SQ6A 1MT3A 3S2EA 4EUSA 2AYXA 3Q7IA 2MR6A 4US0R 2A0FA 5BWLA 4PZLA 2ZT5A 4KYIB 2YC4C 3FWYA 4H7HA 3H9CA 5D1HA 3WBKA 4RF2A 3TBFA 4G0UA 1L7BA 5A2GA 1AO3A 3I0MA 3KLMX 3M1AA 4RKQA 1W4BA 1JG2A 5JARA 2IEDA 3I4LA 1B7GO 2FZ5A 3ICCA 2JATA 1L5MA 2O5VA 1KMQA 3IUQA 2AFHA 4JROA 2OSVA 4ZOAA 3O4IA 5TR9A 3A05A 5J4KA 2KPOA 2VDPB 1QUEA 1RHQA 3TQFA 1B2RA 1QAOA 1ULTA 2C7BA 2JGMA 3T1OA 3HM9A 3V4PB 2W4MA 3M1LA 2BDTA 2E4XA 2DSNA 1K88A 4TTSA 3M0EA 4XVHA 4PICA 1XN1A 2R48A 3ONVA 4V0QA 1DKLA 4H7DA 5DLYA 3KHSA 1IHDA 3REFA 2BBWA 2YMMA 2P7IA 4K6FA 1VE6A 5E1MA 5BQPA 3P97A 4YWHA 1K2WA 4ECEA 1DJPA 2XA9A 3E1GA 2VP0A 3CLSD 3QVUA 4IXDA 1N57A 1CP3A 1S3GA 3GK3A 3RYFA 1CQIB 4R1PA 4MUYA 1ZP6A 1CFZA 5FTWA 4YQEA 3M6LA 1S2IA 3P9PA 4QUJA 2GPNA 4Y2RA 4AY4A 4LXQA 4RTQA 2HK8A 2WYHA 4OL0A 3EEFA 1DHTA 1XQ1A 5ECGC 2VYND 1I3CA 3LIIA 4U7GA 1LNSA 3F9CA 5SYMA 2HLPA 2DQYA 3AJ9A 2NU9B 1JU9A 1X38A 4LV6A 3ZCRA 4ALMA 2V9ZA 3DPSA 5JHHB 5L4SA 4HV4A 1GG2A 5AVKA 3PQCA 4MKRA 3GLUA 4M9QA 2QX6A 3GG9A 2OWEA 3L8EA 1M2KA 3LFUA 1P7CA 2UVPB 1ANKA 1MCZA 2P3LA 1W4CA 4HDOB 3T61A 3UOWA 1Z22A 3A6LA 4OK3A 3A1TA 1S6YA 4CF5A 2DFKB 1PN3A 3KQNA 4GZMA 4DR7B 1IONA 4JLAA 5JZVA 1YS6A 5AI4A 2C1EA 1AS3A 2IOHA 2QMUA 4FHFA 3INRA 3URMA 1EVYA 2O3QA 1QX3A 1EKXA 2R60A 3AXTA 3DDOA 3QVGB 4E4RA 2HO5A 3TRJA 3ZE9A 2CNLA 2KX7A 3PTZA 3RC9A 3CF6R 2XMPA 1HDYA 4L7VA 2HIAA 4MZDA 1FDIA 1P45A 4FC6A 1UAYA 2C7PA 3RT7A 1W36C 1T2FA 1KP2A 2HMAA 3V00A 2ODPA 1QLJA 2OXCA 4LF6B 1YVPA 4LZZA 3EA0A 2XRZA 3VO2A 1NL3A 3VI4B 1J5XA 3QF4B 2F3PA 1PFUA 3WWPA 1XVUA 4L95C 2QJWA 3BWVA 1P7WA 3GBSA 1FL9A 5D5QA 1I0LA 1QH1A 4BX2A 4K6GA 1NPDA 4BP9A 3UPUA 1WBJB 3GRAA 4I50B 4MA5A 2A88A 2C2HA 1PJRA 3M4XA 3ZC3A 2YMLA 5KTKA 3HCBA 2A9RA 1E1YA 1EESA 1LZLA 3DWGA 4R2WA 4E70A 1LC3A 3QVLA 2UV8A 1R0BA 4FYKA 4HDKA 4U7FA 1IRIA 5K8IA 5JUWA 4C7XA 3L5KA 2Y1WA 3MTAA 4UC0A 4QO7A 2OLEA 3SNKA 4QE3A 3VH3A 5JV5A 2CXOA 3KETA 3VJRA 4BNZA 2H29A 1BYIA 1Z08A 3PHBE 1EP2B 3GGOA 1M2VB 4JLVA 3IJPA 3U7FB 1ZINA 2V03A 4I9GA 4BUJA 3K1AB 2XQKA 4OATA 1PIWA 4XA8A 3PX3A 4I3GA 1NXSA 3MS2A 2ZJ7A 4DCNA 2WAAA 4H15A 1G1MA 1YS4A 2WA1A 4TTIA 5BP7A 3UAWA 6REQA 5JJCA 2XBLA 1XYYA 4P82A 4G67A 4D3XA 3ZUGA 3R09A 4K26A 2B8NA 1II9A 4NCBA 3PZBA 1U65A 3UK6A 4HLNA 1RTKA 2CFCA 1CHDA 1QQAA 1NQUA 2PVSA 3RQSA 4YP9A 1DDGA 5HZGA 4HJXA 3HXOA 1IPHA 2VHJA 1EX6A 2Q2WA 4QXOA 3ZPXA 4LGMA 3J81k 2Q3MA 4D82A 1E6WA 3F1KA 3DG9A 4O0LA 1WDKA 3HWX1 4KBGA 3E05A 3AM4A 4EVQA 1VLJA 2WP8J 3UCXA 5TC4A 1M2WA 2ZR7A 5CA1F 5ADVA 4ILEA 2H7VA 3V8VA 3UWKA 3HTXA 4IKOA 4YRGA 1UL1X 2ZUFA 1X77A 4XDYA 4L8LA 3STTA 3HFRA 3LVQE 4YYZA 1FNSA 2VJKA 1Y4ZA 3CTPA 1SMKA 3I62A 2ZSKA 4U2KA 4KRYA 2XF2A 2Z09A 5IDXA 5TJ9A 4E08A 3VPAA 1EM8A 3E0QA 5G1OA 2P9JA 1GZVA 4JASB 2PV7A 5AW7A 4N12A 2ACEA 2HHHB 4OBEA 1MC1A 4B83A 2I1LA 4NBWA 4TT3D 1L9KA 1C14A 1CUXA 2BHTA 2XTAA 2ZR9A 2EV9A 3L6OO 2VYQA 3AWIA 2NMVA 3AUFA 4TXLA 1ZJ6A 5BMVB 3AUSA 1X7ZA 3AG5A 3ZY3A 3IEPA 1JJIA 2XHEA 4B6QA 4BFYA 4DDKA 2ILVA 2ZRPA 5I9LA 3OQ6A 1PVDA 5JQWA 5JSQA 2XT0A 3A4YA 5LQCA 2J4FA 3O93A 3PC3A 1GSOA 1K9SA 5CLHA 1U3CA 1CU1A 3FWZA 2DFVA 2V6FA 3GDHA 3RM3A 2WKSA 2JBAA 3A11A 2HBRA 1IZ8A 1TPYA 3G68A 4GPBA 4KN6A 4XVQA 5JCPA 3PHIA 3FDZB 1R18A 2QD4A 3QLJA 4DUPA 4Z4HA 1SXPA 3NYIA 1U1CA 3EWNA 3BB4A 1SOAA 1YZGA 1PK8A 4FB5A 1QDEA 1VE1A 5EA2A 1HG1A 1HSZA 2Y1CA 2PU5A 4KXXA 3H99A 4YJGB 1CY8A 3QBVA 4ZEMA 2P35A 1FC0A 3GPDG 1O3YA 2HSDA 1N2GA 4RE5A 1Z5UA 2PG3A 3BTOA 5E9QA 1L3CA 2QSJA 3IP6A 2P1DA 4OAPA 4G84A 2QTMA 2LIPA 4N47A 3VO9A 3ADBA 4CDRA 4BMSA 1UMCB 3SZOA 2PKQP 3QX7A 4GZ5A 1LEHA 2O0LA 1QQBA 1U7HA 3GLVA 3EEOA 3IR7A 1F1BA 2DE0X 5EWJB 4FGZA 2VT7A 3C24A 1Q6ZA 3O73A 5BW5A 1MJNA 1QE3A 2P6UA 2OQIA 1EX9A 3GQBA 4JSYA 3FN4A 1DWUA 3B7PA 3LC2O 4KAFA 1I2ZA 4LDQA 3DEKA 5JVDF 3AB7A 3RADC 2QUAA 5EUCA 1C4OA 5BN5A 1YGYA 2YDYA 3D43A 1TIBA 4GQBA 3AVUA 3D54D 3IAHA 3VDQA 3KNZA 4DTIA 3FWHA 4X20B 1Q92A 3OM1A 1PFYA 4JA2A 3ZIAD 3EN0A 5HF6A 5I9TA 4QXQA 1H6BA 5ALTA 5HEKA 2ZZKA 1E8MA 5KYUA 2BTOA 4ZIRB 3FMGA 1OLOA 4HB2A 1LLDA 3DHVA 2VP2A 3UKDA 1OKKD 1JSLA 2DU8A 3NXSA 5AW0A 3OMLA 3UW1A 2AXPA 3A3KA 3WL7A 1B74A 1H85A 2Z8XA 4C7OB 2YZKA 4LRXA 4NBKA 2QROA 4CUKA 1H1DA 2EYUA 3CPEA 1EFPA 5CXSA 1OXMA 1YS9A 3IULA 2CJFA 4RH3A 3L93A 1P2DA 5ESXA 1JDTA 1ZJ5A 2XVMA 1L1EA 4DLKA 4YMUA 1YDWA 1T26A 3LY5A 1EXMA 4E15A 3DBRA 3LQKA 4NTZA 4OMDA 3ZHYA 2N9UA 3TQCA 1BQEA 5F1YA 5JHGB 1PTJA 3RE1A 1CHNA 3TGPA 2BTEA 1GNRA 3BA1A 4EF5A 1S0UA 2UVDA 1G4HA 3JQ7B 2GKGA 4E14A 2NZJA 3GJ3A 4FE7A 1L5KA 4J43A 4QLOA 3HO6A 3L04A 4KXMA 3RHFA 3WLAA 3WYNA 3ONDA 2JFXA 4CIVA 5FDFA 5ICGA 5BR8B 1Z82A 3QE9Y 4D9IA 2AC7A 4IIUA 1OILA 1J20A 4CM3A 4QG3A 1N2ZA 1EPUA 3TOCA 1F48A 3KBOA 2XE8A 3PFWO 1YA4A 4ZVLA 3WLIA 5KYYB 3U09A 4PX3A 1WW8A 2J0EA 3OP1A 2ZIAA 4OPMA 1G0OA 2BFEA 2GETA 3REGA 4DCSA 3OPYA 4E07A 1QPGA 5KNBA 1OT5A 2GFQA 1ZMRA 1EE1A 3VKUA 4CF4A 3V2UA 3D0KA 2V3CC 3B70A 1D0IA 1GTVA 2BEUA 2GF0A 3CT6A 1JKMA 3O5AA 4Q9DA 1P0MA 3DLTA 2B36A 2W8ZA 2SHKA 4L50A 3KCNA 4TM8A 5J5CA 3PI7A 4WBSA 4B85A 4HUTA 1XGKA 3ECSA 1FTNA 2JCBA 4ACAA 5AKLA 4OGGA 4UEQA 4R2XA 3NHUA 4QPNA 3TKYA 1CZNA 1NBWB 4EGQA 3TTWA 2VUHB 2AN9A 4J16A 4EKEA 3T1TA 4RVOA 3N2NA 3BIXA 5EL0A 2PJUA 3EASA 4G0MA 3ZHRA 4N0DA 4N5DA 1OREA 4JHXA 2XNDA 3C4QA 5IT0A 1YUBA 1U6IA 1WDTA 1EK5A 2ZIVB 5ITZB 4PLYA 3NJRA 1WR8A 3NYQA 2B3DA 5FIUA 1JEDA 4U7WA 3TNYA 2PLAA 4EKNB 3I83A 2J6BA 3G02A 3RVMA 4LEIA 5C7YA 5HQTA 3I5UA 2AK2A 1NYTA 2FPKA 3A36A 4FZ3A 1D6MA 4MO2A 4NJEB 5LQDA 2XI4A 3MGBA 4FYWA 5BWNA 4PNEA 4CQMB 2GXSA 3RKSA 2JI6A 3WYGA 4MI6A 1FBTA 3DP7A 2MTBA 2YZGA 1KBZA 2I6XA 1JG4A 4OHCA 1VJ1A 3NMUF 2N3ZA 5CTAA 3MT8A 1H94A 2JIPA 2R8RA 4RHXA 3PQ2A 3VPXA 1UOQA 2CLHB 1GQRA 2BE9A 3CBGA 3PYMA 2ZG6A 4Q3OA 3ZIUA 4GPD1 1NASA 3D2LA 4GYJA 4BGVA 3B9PA 3CZRA 3E5NA 3I6IA 2ZOSA 3SM3A 2PGNA 3ENNA 4UCXA 5LDHA 4HB0A 1BZYA 1MRSA 3SHQA 4JBIA 4D9JA 5ED0A 3QXXA 3DBLB 4M7WA 4W6QA 4HQFA 3CW9A 2IEBA 4H1HA 2O7SA 1NA5A 2XB8A 3K94A 2FZWA 1NYLA 4ZHSA 1NMXA 3A31A 2X5KO 4R9SA 3AIMA 4ZOCA 2J5XA 3SLGA 5HIIA 1KZGB 3DVSX 2IXDA 3ISVA 1YJCA 3BT7A 2O59A 2C2OA 3CO0S 4Q7LA 3WKCA 2WVAA 2F59A 1KEPA 4JX9A 4J0GA 1T5LA 3PLAE 1SCUB 3ABRB 1TTPB 2WD9A 4HSEA 1ZA1A 4P80A 5JXHA 1GTRA 2VATA 4MQEB 1JI0A 2WPNA 3TOXA 1A9XB 3JQGA 4RK5A 1NVGA 2CSXA 3KSRA 2H18A 3P2JA 4MVJI 4TXHA 4UM8B 5JC8A 1ZHFA 3A6KA 4C06A 3FYUB 3HXTA 4PTYA 2PY6A 1U9IC 2VJMB 3A3OA 3COSA 3IAFA 2B83A 5FUMA 4JUBA 1MJFA 1EVEA 1NVDA 2A35A 3COZA 3LC0A 4G09A 4ZVKA 5IM4F 3KV3O 2JH8A 4BVBA 4ZT4A 4R84A 3EGCA 3TIXB 3CF2A 1ST2A 4NZ9A 1I0IA 1IIBA 2MR5A 4LWQA 4WCVA 1YB7A 2I65A 3H13A 1NXTA 4TLEA 3CLUD 1JTFA 3LT2A 4TL6A 3JAMA 4ALJA 1H2EA 4AJ9A 4M8NE 2F1HA 2FSFA 2WICA 3DZIA 4H6PA 4RWZA 4BKPA 5BNWA 5CFQA 3CJRA 2VXCA 3E5RA 1O08A 3LUPA 3LXXA 1SVWA 5ISMA 2FN8A 5DLQC 1GAWA 3QUAA 4B47A 3ESXA 5KSOA 1X7HA 3WB9A 1JE0A 3MHPA 1VMAA 4HB3A 3VR3D 3D6NB 4GRIA 4WLNA 4HYTA 4XD7A 2QQEA 3D3EA 3OJXA 1CERA 2Y0BA 3KHKA 3U3RA 1DWOA 2IW3A 3AM3A 3E35A 1UDBA 2CMDA 1YKGA 3L5OA 3VBCA 4EFKA 1JPVA 1XZMA 2I1QA 5CAEB 3IQIX 2GCNA 2R1UA 3RYTC 4L27A 1QIFA 1Z06A 3GT3A 4JODA 3R7AA 5GOTA 5JLJA 5JAUA 2NNWB 1B41A 2JGNA 2Q8PA 3GRCA 3HGTA 4YT8A 1KSHA 9ABPA 1OX6A 2ZJOA 2FR8C 5DTEA 1W96A 2B3TA 4NBTA 1VKNA 1SUIA 2YQ4A 4J76A 1M2NA 1GPLA 1MQAA 2O14A 2Q1YA 3Q7SA 3Q87B 5DX8A 1ECJA 4OD0A 1AKWA 1J06A 2UKDA 4YUAA 5BYKA 5D7BA 2BT4A 2VDVE 2FLKA 4HYYA 4KK3A 4MQBA 3TJZA 3ZDFA 1WW3A 4TMWA 1FTQA 1F9AA 1YQQA 1YR6A 2GBLC 3C6KA 3JYHA 3KTFA 1WPXA 4D43A 4URXR 3WZMA 1W94A 1HOTA 5LQMA 1QFJA 2ZI3A 2ZJ6A 5L6LB 1E99A 5ITSA 1NBAA 4RFVA 1Y7IA 2JJ1D 3P2IA 2IEIA 4GI2A 1I7DA 2FRDC 4OHMA 2FPUA 3CS3A 4ND2A 1C1YA 1LI7A 4D3ZA 5J63A 5KWVA 5FX2A 4K9MA 5JWHA 3RJTA 3OURA 1XT6A 1DAIA 3LZ6A 1IJEA 3ES9A 4L4YA 2C4WA 4JQSA 1C7RA 2H0QA 1VSUA 2VHVA 2HFKA 3HRHA 1AQ6A 3SX2A 4GLFA 1FP6A 2BGLA 1KQPA 3H9EO 1XEWY 3G13A 2PFGA 4JZYA 4X84A 1WIWA 3X43A 2NAPA 4RPLA 5BNIA 5JZ9A 1N75A 2GJ4A 1F8UA 1W85A 5H59A 1PZNA 4QGSA 1W87A 2P9FA 1UDXA 2WHYA 4LQLA 2OYCA 2COEA 1U0LA 1UPCA 2EFHB 3A9TA 1HORA 2OBBA 1JT2A 2FUG1 1R0XA 3JPWA 2I33A 1LKZA 3P9QA 2ZRMA 1YSCA 3O4FA 1LK7A 1J2JA 1TCCA 3KEGA 3RTAA 4BNDA 5BVGA 2I2WA 4KG7A 1Q1AA 3I23A 4EATA 4LXUA 4YJ3B 2AMJA 1V39A 4F4HA 3IXLA 5IFLA 3L4JA 1W4ZA 1YJQA 4AG3A 2PUGA 3UAYA 5C34B 3NVMB 1PFGA 1GR1A 5ELMA 4LJRA 4BNHA 5AW5A 1Q84A 3OFKA 4EYSA 4M4SA 4M7PA 3F5QA 1M7BA 1VHTA 1JR4A 2P2LA 1YE3A 1SCDA 1WW2A 1G6HA 1L6RA 2D54A 2AUNA 2IDMA 2I7XA 1JLRA 2OG2A 3BS4A 3KTAB 3MWLA 3O0TA 4MS3A 4ZK6A 2WYWA 4O29A 3I6YA 4P22A 4JXJA 1U9CA 3BXHA 1FLDA 1WF6A 2W6ZA 2YJ3A 1JIKA 5AW2A 2JIOA 5FQNA 1VPTA 3OUZA 2A5FA 3ME5A 3L46A 4JMPA 3OJOA 4X1IB 4A0FA 3ZTWA 4ZYTA 1N1MA 2C3PA 2IYNA 2ZVDA 5F3DA 4RLQA 1N92A 3ROTA 4KDFA 4MLDA 1JB1A 1UEXC 3IP1A 1C1HA 1DKOA 2WNIA 1FLNA 1FPQA 1P6UA 4AL4A 1ZBQA 1OASA 2PZMA 1CJSA 4PLZA 5C1IA 2JGRA 4DABA 3K8OE 3RSQA 2QQ0A 1YGPA 1ODSA 4QJBA 3SX0A 1J1IA 3UFBA 5FLYA 3IDSA 4EGSA 4U2GA 2CUKA 1TA4A 1ZD5A 4RJLA 5CDFA 3ZZTA 2ZBFA 1RPZA 4BE9A 4QBHA 3OKFA 3ST7A 5E2BA 3M83A 1O95D 3WJ2A 1GYQA 2PNJA 2A0WA 1J09A 3NHRA 1SKUA 4XIYA 2BTQA 2FMTA 1UBHS 2OUKA 3PRYA 4WXMA 4UBNA 3PKIA 5IKMA 4IDNA 3D3QA 3A28A 4CMAA 2VRCD 3IJEB 4MEBA 1IQRA 1W4RA 2ZPUA 1ZD3A 4BGDA 4BMCA 4AZSA 3M6VA 2FZCA 2C04A 1PVOA 1M1YB 4LHXA 3NCHA 2EKBA 4WZBE 4DDVA 1U0SY 1X1EA 5DP1A 3Q40A 3J7TA 2XIJA 1V8PA 1LI4A 1XZDA 5CLLA 2CNBA 1JFFB 1O5OA 3AT1A 3COWA 3DZKA 4WW0A 4YMSA 2VPXA 5B7QA 1ELOA 1VOTA 4WOPA 2AE1A 1N4AA 3CFYA 5AW9A 1E5VA 2IUUA 3HO8A 1DDIA 2G7ZA 2X6RA 1Z8HA 1N1EA 3EHDA 2HDWA 3D8RA 3QELA 4UUQA 2FMHA 2ZZMA 4M46A 2B1QA 5FBHA 4MUBA 1F5SA 3W8RA 1XN4A 2XXBA 2Y9PB 2NZ8A 1J5EB 4GKAA 2ZIXB 3H4MA 3PP8A 1AY0A 1GGVA 4O08A 3QQPA 5EAIA 1PT8A 3ZD8A 4JOQA 4Q4JB 4RD2A 4F6RB 5JR3A 5KZMB 2O8EB 4PONA 5JFGA 4H4EA 4OUKX 3I4FA 4WXRA 3NHZA 3W4IA 1NN5A 3HB5X 3LECA 4QOGA 3AETA 3UB3A 2GNAA 2H07A 2PFKA 3GAAA 4EDHA 2EP5A 4FWBA 3HDHA 2PRYA 2PVPA 3VNVA 3X1XA 1ZISA 2ZYRA 3TLGB 2H1CA 4NDNE 2LRHA 2H2IA 4RDIA 5JSZB 3SD7A 2VDWA 5A3SA 4J0CA 1WXDA 1ZMBA 2PGXA 2WW8A 3HUFA 4B3HA 1YMVA 2W6ID 4FINA 3PEUA 2IYTA 3TDNA 3IVCA 3TX2A 1PR3A 3B1ZA 3NWJA 2WHXA 1Z4IA 4ZJPA 1PNTA 2Q3FA 3TW8B 5HRCA 1S01A 1Z74A 3BXGA 2OHJA 2QRZA 3O84A 1WPGA 1KIMA 3UUEA 2XZLA 4CFSA 1ZM2A 2LR0A 4H3KB 4NU5A 4WZZA 5DEIA 3TSYA 1OBVA 2ZXUA 3TAXA 1PX2A 1WKBA 5IK2D 4CQMD 4KIFA 3UQYS 4V0LA 2ZRNA 4DJDC 1R6UA 2PD6A 3N8GA 4ML3A 2F6RA 2BGRA 4DIEA 1RXWA 3N0XA 3F8SA 5EPEA 5EJAA 3V1UA 1YB2A 5AXDA 1C30A 2D0PB 4A26A 4TYMA 4F56A 4HZIA 4Q1VA 4F2GA 1Q0SA 3ZHBA 3TVTA 1K66A 4BO0A 5C5CA 3ODGA 5A7GA 4PO8A 2QPOA 4E5SA 3EODA 3AONB 3CX4A 3G0IA 2SBTA 5B1IA 3ORFA 1JR3E 3IBSA 4H1WA 2H00A 4QPZA 2PA0A 4RH1A 4YJHA 1F0NA 4YBZA 1AK2A 3OQ1A 4LFCB 4UM9B 4PYRA 5B5SA 2VSXA 3H04A 1JUDA 4E4TA 1EB8A 4JLBA 1L8LA 3GPLA 2EKLA 3AHJA 4O2AF 3UYLA 1PKEA 4BWGA 5JC1A 3ORYA 2X0EA 3U7EB 4YIHA 4HG2A 1VXRA 1NVWQ 1T3SA 1WG8A 3G9XA 4IJWA 4XYMA 1TU0A 2W58A 2SCUA 5L53A 1OCEA 3SKYA 1A9RA 2E5WA 1V1JA 1T1JA 5KWEA 3P96A 2V4ZA 2Q6TA 5F52A 1QZ3A 1UR5A 2GR9A 2W83A 3C5VA 5F5NA 2JFPA 4LMPA 3WLHA 2QKYA 2WHPA 2AJ8A 4XGRA 2IDJA 1PJ8A 1M2EA 2FWPA 2GEUA 4X94A 3GZTB 3CLHA 1PQUA 2KSQA 4X65B 1Z5PA 1V3QE 3LWZA 5FCDA 3ITDA 1QP0A 3ESDA 5BV8A 1Z2EA 5D3MB 2O0MA 5CITA 1ZUNA 4UD2A 4O8ZA 1IHPA 1P61B 4Y2GA 2F1OA 2DM6A 3NUZA 1QGOA 3ZWCA 1JNXX 4LF9B 5KJ6A 1F2DA 3RYCA 3GUCA 3HKCB 1G2QA 1XTRA 1KPHA 1A5ZA 4H3HB 1P39A 5B55A 5IJ0A 3VAYA 2C2MA 3TLMA 3MTEA 2WZDA 2E4UA 4LV8B 1H66A 2CMGA 3B9RA 1C3LA 2XUQA 1EE2A 1YBFA 3L05A 3OLQA 2AQIA 2OGWA 4X7BA 2WJ6A 5DLEA 2C98A 4MV4A 1NP3A 1Z0UA 3UENA 3PD0A 3SKVA 4DCJA 1S1MA 1U2DA 4WLFA 4BE4A 4BRUA 2O8DA 1ORVA 1C8LA 1KYTA 2A3NA 3LXMA 4PRZA 5GJWC 3HO1A 1YDFA 1UXOA 4RU1A 1Z2DA 1HYEA 2AEMA 3ML1A 1NBIA 5ER6A 4MWEA 4GHWA 1T1RA 3EEBA 3S5JA 2OGUA 1WY5A 2C9CA 4KXFB 4DSTA 2I78A 3DE0X 2VKQA 4OI4A 1WBDA 1ZGJA 1Q1QA 3NFRA 1XEXB 2DMRA 3B6EA 2D5CA 3SF8A 4EBBA 4QREA 4JYMA 2H2WA 4HK4A 4NZOA 1P2SA 3CNLA 3DLIA 4FP9A 1ISJA 2UZ1B 5CPFA 4CR8A 3TB6A 3PLRA 1B43A 1JEOA 1UAGA 3OFNA 4HRVA 3THWB 2PXXA 2HWXA 2X2EA 1I3MA 4G24A 5B7GA 3H1BA 2PUTA 3KSZO 2GXAA 3WNQA 2CEAA 2QG4A 4KU4A 4NENB 2XEXA 3LYLA 4TS1A 3Q88A 4S1WA 3UHAA 5I6DA 4B32A 1DB3A 2HF2A 4RYLA 4TN1A 1RMTA 4XR9A 2Y6VA 4BCCA 2FX5A 2I3AA 3GFOA 4OLJA 3N7AA 4FE4A 2PWYA 1U7WA 4HX5A 3DKPA 3BJIC 3BMQA 2EFJA 3ZNPA 4Z9YA 5JWRA 3KVNA 3TMAA 1K7CA 2DHDA 4FDMA 4NWIA 4S2UA 3TE6A 2ZJ2A 1XVAA 1PSZA 2TMGA 3GJ7A 4MVWA 3N2GA 4HADA 4F84A 3ON5A 5CH8A 3VR2D 4F2PA 4QUBA 4HVCA 5L3SA 2JBHA 5M04A 121PA 2RHTA 5D84A 3I6QA 2C82A 7ABPA 1II0A 3DEZA 4BRSA 4EX6A 4PZ0A 1SBIA 1ZLYA 4HNSA 1A9QA 4WV3A 1OMOA 1YIAA 2QYTA 2VH5R 4F1JA 3CN9A 1F38A 2HQRA 5AVWA 3A9SA 4GX2A 3BWBA 5FUQA 4BFSA 1GTG1 4WI1A 3BBPA 4WADA 1RP7A 2BFFB 1IL0A 4RVCA 3W1VA 3HJUA 2O5EA 4LGVA 1HQDA 1C3JA 2HKIA 2C4KA 5B53A 2XGMA 1N32B 1VHQA 3HC7A 1VJGA 2RHLA 2YXBA 3NBKA 5ALUA 4FFPA 1H0RA 4G0XA 5E2IA 1B73A 3TUJC 2ZRAA 1TUIA 3WK5A 5K3SA 4CV2A 4OG2A 1I2AA 4QPDA 5KYKA 3DDZX 3ICVA 4MIOA 4RSGA 4QUAA 5CT8A 1F14A 3A4NA 2YXLA 2I87A 5KOHA 3O8CA 2C61A 2V3VA 1R9NA 2RGUA 4H4DA 4UZFA 4AO6A 3Q8KA 1EVLA 2IJGX 4ZCQA 3DBHB 4N0PA 1TYZA 1U7UA 3K09C 5E7QA 4GMGA 3HCRA 5C7LO 1APBA 1WQ4A 2IPMA 5HA5A 1Z88A 3BYZA 3O1IC 4AS1A 1DAFA 3I09A 4UAJA 5A5DA 5JJBA 3BKXA 3U3XA 3CZ9A 2VP5A 4U2CA 4EF4A 3COPA 1AO0A 3DDSA 4MP8A 1V4VA 1JQLB 2GQ0A 2AG1A 3CSDA 4L0QA 4WN9A 4EHDA 3AR2A 2BHRA 3N1UA 1XD8A 1ZNQO 4IKPA 1K6EA 5C7OO 1KOLA 2XYPA 4OHKA 4JUDX 2RGCA 2CJWA 5HNKA 1C4KA 1OF1A 1EP1B 4IJ5A 3KS9A 1E59A 3DOEA 5AXBA 2ISSD 4LRWA 3K20A 1HLDA 4OJTA 2O3SA 4QGGA 5EIAA 2Q7DA 4ESHA 1Q1EA 1TKCA 4HWTA 2W8BB 4IIJF 3QZUA 2ZXEA 3UMCA 4Z4FA 4YP7A 1XC7A 1I6KA 3C6MA 3NLLA 4NP6A 3I2HA 4KXNA 3WIBA 3G3EA 5JDIA 5THXA 1E3TA 3LD9A 5C8YB 1O54A 5ALRA 1QIKA 2EEZA 2GM4A 2PJRA 1EG2A 2IS6A 3ICPA 2PSSA 1E1RD 1SKQA 1SUEA 3FUCA 4PV7A 5KI6A 5JW6A 2W93A 1GGMA 3PNLA 3GDOA 3FBTA 4MV5A 5FAXA 3QTTA 1V1RB 3CKYA 1XAHA 1TZMA 3COYA 1XDGA 4NBSA 1SC3A 4G8DA 4TOIA 1J23A 1CJMA 2ERYA 2OHFA 2HXSA 2VEOA 1O0SA 1B93A 1P0PA 1YH3A 2XR1A 3EAFA 4LECA 3VX4A 3IEVA 1KRWA 2XE7A 4C22A 2NGRA 3OLYA 1SOMA 1A8SA 2JD1A 4G9EA 1YZYA 2XMRA 3I9FA 4MEJA 1IVYA 1RT9A 1I13A 1MXFA 1KO5A 4YS6A 4X95A 4BHTA 3QG1A 1JHYA 2O2ZA 2X8AA 4B71A 4S35A 2CFSA 4XRGA 1QP7A 4CKEA 4M1SA 5B4TA 2B7CA 2PQ0A 3BH6A 3TINA 3IE1A 3CHYA 3GD7A 4EG8A 1T2DA 3LHSA 1ZVJA 5ER9A 4UPDA 5KVAA 2CLDX 5EWMB 1TGVA 2JLWA 2A84A 3CVOA 4AKIA 4BZWA 3BGWA 2DULA 1QP8A 2WSLA 4MICA 3JWPA 3ROXA 2FFQA 2FPMA 1L7QA 4HH0A 2XXJA 1Z4KA 2W7TA 5CDTA 3D3WB 3AKZA 4HOYA 3RARA 4EABA 1PL0A 1HMPA 1Z12A 2CHGA 1KJJA 2GHRA 3IOBA 5AOCA 3SEFA 2A3RA 2WMYA 2L19A 3SHVA 3R6WA 3UGJA 3OTIA 3ROEA 4U6SA 5CA1B 3EXEB 4M21A 1CUVA 5DBIA 5IABA 1QU2A 3FNBA 1GAQA 3FVWA 1OI2A 2OCBA 2XDWA 3TSAA 1IWOA 5B4UA 2PS0A 4HI0E 3S8YA 3HA3A 1TJNA 2QSZA 1L9XA 3ZCPA 4AZ3B 4TUYB 3V48A 3ZR4B 4A03A 5GONA 4XVRA 2BJWA 2WJYA 3VMMA 2UXCB 2ZYVX 1EIWA 4F21A 1Q1BA 1PWYE 4IUBS 4F2HA 4FCCA 3I2JA 5LN1A 1J6UA 3ORSA 2VF7A 3UK2A 2GJSA 4ZOQI 1UBLS 1E9SA 1Q6YA 1LX7A 1E0DA 3KU4A 4LE0A 5BXYA 3P71T 5DFAA 1XTJA 4RQUA 1KYYA 4YRLA 3EE6A 4M0LA 4JYCA 3HKEB 4BS9A 2JAHA 1TT5A 4FKBA 3QIVA 4MAMA 3WSTA 3A2KA 3T7JA 2ZE6A 3O2QB 5DBGA 4YAGA 3DE2X 1PNQA 3GWZA 4DJFC 2IPLA 2ZSJA 4OL9A 1Z5NA 2ZS8A 3PC8C 4LHWA 1L1RA 1IEWA 2F64A 4R16A 3TR6A 1VKZA 2ICAA 2JGLA 5EEHA 1RRPA 3QITA 2KQUA 3I2GA 3L3BA 4U4AA 1M5RA 3V2HA 2HEGA 2IS4A 2Q5IA 3TSOA 2OD2A 2AT1A 1Q0UA 4OO3A 3IHLA 2PZFA 1Z07A 2WABA 3DXZA 3I42A 4FN5A 5HCUA 4D2IA 5DW3A 2DY1A 5A7HA 4AS3A 1E18A 1RVV1 1Y9JA 3FCEA 4LFAB 1G7CA 3GVXA 5CCXA 4D3DA 4YACA 5E9WA 4AMGA 1BGXT 1NDUA 1BU8A 2ZYTX 4FSXA 4GOMD 3LDAA 3P27A 3QFSA 3BQ9A 4J4HA 4WLUA 4DA6A 3SDZA 2WNSA 1QHYA 2V98A 5A5EA 1ZVQA 4C4PA 1CDOA 1A72A 5AI8A 2PUEA 1P91A 2IYSA 4BGEA 3EGXA 2YYSA 4UM9D 2IXAA 1FVHA 1ZDMA 3IE2A 4TV8B 2WKQA 4C0JA 1O97D 5HQJA 1HY3A 1K1EA 1P7PA 2Z8YA 2VHCA 5AJWA 1Y6GA 3BJMA 5ALYA 1KS2A 1XMQB 3MZ0A 1F4VA 4NBVA 2IUTA 3T9EA 4KNWA 3TW4A 2PN1A 5CFLA 1B8OA 2QRPA 4FSHA 3GLGB 3QEKA 1M74A 1I2DA 1DT5A 4P1ZA 3VO8A 4GC5A 3SYNA 2X41A 3L4BC 3W8DA 2AOVA 5FWYB 2A1UB 4H1VA 1DKQA 3NKFA 5GWXA 2A0KA 2UUBB 1Q0ZA 3RH0A 4B3TB 1F12A 3QSYA 4KR6A 5HUQA 4MWCA 4OK5A 5NULA 3NWBA 2YWXA 5DASA 3RO7A 5CFMA 3BIJA 4Y1EA 4Q9NA 5J40A 3D1VA 1RHJA 3WSWA 5DBFA 2O2YA 5JVDB 4JT8A 1KKUA 3P2MA 3CWZA 4GPTA 2OR3A 4Y2YA 3GO4A 5DJ5A 3WMWA 2VL7A 2GD6A 4H59A 4GEGA 3K9FC 2IP4A 5KTYA 2YIVX 2JA1A 3WLFA 3WKBA 1DUSA 4WOBA 2CXNA 2WWGA 1B15A 4ND7A 4O4IA 2Y2UA 3BWEA 3K1TA 3IBYA 3O8BA 3PHLA 4L5CA 2C2YA 1MEEA 1O03A 1UFKA 1JALA 3IQXA 4QOJA 5FBLB 4CU2A 3CVWA 1TL7C 2FPXA 2Z2XA 4LN1A 4YMVA 3SU8A 1YONA 3K6JA 4FQ7A 4JEHA 4B4KA 2X86A 1U7TA 1TM3E 1ZEJA 1USGA 3MEQA 2O3RA 2EKDA 1T15A 3Q3IA 4IF4A 2AJLI 1FSPA 2X8WA 1OZAA 1GGHA 2DAPA 4Q4DA 4C3UA 1ZAKA 2JB9A 3DO8A 3BREA 4IWNA 1T9GR 1U9IA 1JW9B 3PKJA 4BDTA 3E53A 3A8TA 2HA4A 3SNHA 3NVKI 1NG1A 2RC6A 3L0ZA 4OA5A 4JLOA 5D5PA 1ZAYA 1A97A 1AGNA 1JDVA 2QM3A 1FJ2A 3KKMA 1N8SA 1R15A 1X8XA 2O2SA 1P3DA 1VKOA 1CSEE 4F5ZA 3P9SA 1F4PA 1SFRA 5KKNB 2CL5A 3PGJA 1Q11A 1TFRA 2CFOA 4TMKA 1UKEA 1UKYA 5EZQA 4N8SA 1JLHA 4Z4QA 1XKQA 1CULC 2FQXA 3PE6A 3SBDA 4AIIA 4N6OA 5B58C 5U4XA 4LXYA 4GGOA 5CX1B 2XCSB 2ZTSA 1L7XA 5FJIA 4IOLA 3IQWA 4DEXA 1EEXB 2J4DA 4JT4A 1F0PA 1P8AA 1ZM3A 2BHNA 4PQEA 3EXAA 4V0SA 5AHRA 3NTLA 3BTVA 3UJDA 4AN0A 1MKYA 2ZRDA 4XFDA 3H8SA 4L5YA 4RSRA 3NJ4A 5IBQA 5FO1A 3TQSA 3WJ7A 1YU6A 3K73O 2VAPA 5KTRA 2WZBA 4CKCB 1H9BA 3DV2A 3JY6A 3C70A 3T9FA 2ZCUA 3DMNA 5AW4A 5ICMA 4RZXA 1NTOA 4RADA 1DQPA 3VKGA 4PGHA 4HDQB 5ALVA 3EF1A 2FR8A 1R10A 3JQFC 4C7JA 3LBNA 2NIPA 2QLFA 4Y6LA 5KTNA 2QZ9A 1W8IA 2B21A 3AHEA 4RJTA 4EG3A 1NUTA 1RWOA 2XTNA 4IHQA 5FR1A 2RHMA 4LHSA 5DBEX 3KELA 3SS9X 1O94C 2OFPA 1GP2A 3RAEC 4XH9B 1XL1A 2QMOA 4CYMA 4Q9AA 2INGX 1C29B 2EWMA 2XA2A 4BMXA 2FGKA 2EGUA 5H1YA 1V5GA 5ILGA 3BH7A 4JLPA 4LJ8A 3LRPA 2H08A 3L7CA 1JVSA 1JEQA 3IERA 3JQCA 2FMXA 2GKOA 5IVHA 2FRDA 4KJXA 2DJ5A 2QRNA 1YQ9A 1O6GA 4X97A 4URVR 3CPHA 3STWA 4YRTA 4K6MA 3T5MA 4C7MA 1MJHA 1RE0A 2HRCA 2D1SA 1YUMA 2YZMA 2OKGA 3SEZA 3EZ9A 3UWOA 1Z0SA 4EKYA 4KXUA 1FDOA 2AFHB 2EP7A 2ZWIA 1ZZEA 4YTEA 2JLZA 1DJOA 3ZWDA 5KMGA 5LNK6 1VQ1A 1TYBE 4KV9A 2ZSEA 3FLEA 3JAWB 2OK8A 1BROA 3LW7A 4LRSB 4PLTA 3ZX4A 4DYDA 5AVJA 1IZ0A 2Y4OA 3GGCA 1Z17A 1YK1A 1V6AA 1TM1E 3CO5A 3N2KA 1A95A 1VE5A 2GO7A 4N3GA 2P8JA 2QSYA 3IPYA 2RD2A 4W1SA 4OYYA 1NXQA 1DV1A 3MQFA 2ISQA 4G1FA 1XXLA 4MI9A 2Q29A 4M9ZA 4NDAA 1CUIA 1L5WA 3VTKA 4IIXA 4BRZA 1FVFA 4Y67A 4FC7A 3WDLA 2II6A 1SBCA 3RYFB 3G8AA 2OOKA 3C3AA 3ZVRA 3WY9A 3ND5A 4KUEA 4BO6A 5C18A 1GNPA 1VMDA 1ZZGA 4AY5A 3R3VA 2B0CA 4E5MA 2ZT6A 3EH2A 3Q6MA 3RUIA 5K05A 1J0BA 1QV6A 1U8XX 2ZAGA 2BI8A 2H4WA 3M81A 2HK6A 2N0SA 3OF3A 3RJZA 2GZ1A 4A92A 3DZFA 3G1WA 1XRLA 2CLEB 1MORA 1CEEA 3R4CA 5MGNA 2DPYA 1G41A 2Y1LA 5DZSA 6AT1A 2IS1A 2CXSA 3Q8LA 1BG6A 3L7BA 4JJIA 2VSYA 2YRFA 3QLUC 4TMXA 5INTA 2J08A 2C07A 5ICSA 1FJHA 3IUBA 2QUIA 1IM8A 3A3YA 3I9NA 3VZCA 4EKIA 3A6EA 3I04A 1CB0A 1XRNA 3GNQA 4R8RA 4OQQA 1MH1A 5CT5A 1XYVA 2OQ2A 1TD9A 1PFKA 2ZB3A 3IT0A 3JVUA 5E7MA 3TNDA 2YOFA 4DR3B 2CVPA 3UMRA 2Q0SA 3A6ZA 4U2FA 1SG6A 2I3BA 3GJZA 2Y8EA 2ONCA 2G70A 3DONA 2D8AA 4O5OA 4PNPA 1C50A 3N0VA 3V55A 3V7FA 1FA9A 1FBNA 1U4NA 2VDQB 3FRJA 2IBTA 4BO7A 1GPWB 2R6ZA 2A1TR 2Q41A 2QJRA 3HYRA 4JJ8A 3WHIA 4KAXA 4PS1A 3IL2A 3ESZA 4KTTE 3AX6A 2F55A 3A4IA 3Q1KA 5BV7A 1C2YA 1NC3A 1B16A 4KIGA 4MRNA 2W70A 4F04A 2XKAA 2YN2A 4P7KA 4PYIA 3VISA 1P80A 3VR4H 5EERA 1VCIA 3D6VA 5LL6P 3RLFA 4N7RA 3AR4A 3BMXA 4I8IA 4IQFA 1R0YA 4S1OA 1QE5A 4I19A 3P4YA 4FGUA 4QUKA 1IEVA 3R1IA 5IXSA 4IOMA 3AYXB 3URKA 2I2BA 4TKZA 3S2IA 1QH1B 1U4OA 3T7TA 5LMZA 3ZDAA 3N0TA 1Z7YA 3IALA 3HZHA 5FPYA 4P5EA 5J5VA 3IYLW 1H5QA 2ZWPA 3FDXA 3HGMA 3NJ8A 2BIFA 5IWCA 2Y92A 1N0VC 2OC4A 4FD2A 1SOVA 1YACA 2VBFA 3GFTA 4HDKB 3M82A 4D26A 4J6FA 1ZGHA 2VDLB 3K9HA 2GYYA 4XUDA 5DIZA 4NECA 4O4HF 3EVGA 4FD3A 4KN5A 4G41A 4D4KA 4OJMX 5JNTA 4R40A 3HSKA 4IMRA 1QDLB 1TMOA 3O4GA 3EFOA 4EHJA 5LFAA 3C5CA 4KO1S 1SXJE 5FFNA 1P2BA 2ZBQA 2P75A 4DIBA 2FFBA 2O1XA 3JWJA 2P9CA 3KD3A 4I9FA 3GXOA 4AF7A 1J24A 1K9VF 1YQXA 4AJOA 2XNSA 4B7ZA 6REQB 1FSFA 3IIIA 5G0UA 4A15A 1ZH4A 1L3IA 4BNKA 5K8LA 3KL4A 4Y2XA 2ZS9A 3UVEA 2XUJA 4KQIA 3QNMA 4MUGA 1RXSA 4WLEA 4FMPA 4XSGA 5KNCD 1FZTA 1QB7A 5D51S 3KVOA 4NF2A 4TKVA 2GILA 1JDBB 3WISA 3NIGB 1KO4A 4G5XA 4CIYA 4KQJA 1SC6A 1Y33E 1OTYA 4V3CA 5AUOB 1KEKA 4D0SA 2ZI4A 5DN6D 4F92B 1L4KA 1E2HA 4O6VA 4HXEB 5KYVA 4YMHA 5JZMA 3KOOA 3A7EA 3HS3A 3JQDA 2Y1GA 4PINA 3UXEA 1XZJA 2ERXA 4RPIA 1D8AA 4AN1A 1FRFS 1XWFA 2R25B 2QVCA 4XOUA 3UUGA 4ZTUB 1XTQA 5GONF 4EY4A 4XE5A 3HVJA 1M73E 1HETA 1JU3A 2AR7A 4OGLA 2ATEA 3IQHX 1JSCA 4XVCA 1VLHA 1SKYE 3CWQA 2FLWA 1EM8B 3FHCB 5GVRA 3WMEA 5C2JB 1PUJA 1FNNA 1XJ0A 2V59A 1KSFX 2NTYC 4G97A 5F7ZA 3ZOKA 1I3KA 4CM4A 2F1KA 3WIEA 5HOEA 2ASEA 2W0SA 1PEKE 3E81A 3C5EA 2IYXA 1II8A 4L8WB 1N7JA 3ER6A 2Y1OA 3BL5A 3ITEA 4MV7A 5T4BA 3WQQA 4YB8A 3UWMA 3RHZA 3OICA 3NATA 3HFJA 4L5BA 4A10A 1DJQA 2G9QA 2JD0A 3BXXA 5IUKC 1TTTA 3W6UA 3S2GA 3UTCA 4LBZA 1TK3A 1W6RA 2DHRA 1AOXA 4KAJA 2A7XA 1X7ZB 1AHIA 1A2KC 1MB2A 1UQTA 3KQQA 4Q48A 3S99A 5AT1A 3B3GA 3O8OA 1HRDA 1TB4A 2QOEA 3TF5A 5KOJB 3DB1A 4FR5A 4M9UA 3DVAA 1M8JA 4YROA 2IH2A 1IK4A 1JXQA 3LP8A 3EIEA 3TJRA 5HQ3B 1K92A 4YMGA 3LA8A 4UHEA 2D5LA 4DC9A 4NU6A 3AFHA 2IUYA 2HA3A 3LXRA 3AF6A 1ZHHA 2DKFA 2C42A 4DIFA 3CMMA 4Y1RB 3EFHA 4YRIA 2ECOA 3QWBA 1CUUA 1WSWA 2HQ1A 3NONA 4KO4S 5L7YA 3ZYCA 4IIEA 3ZDRA 3MIZA 1E9RA 4KWHA 4ZZIA 1RZUA 4FK8A 4MW5A 4ARCA 1XG5A 1DC4A 1UAAA 2W48A 1B6TA 1GLNA 2G8LA 3PDUA 1XVTA 1L8OA 1P5RA 1DXHA 1RYZA 3G5MA 4QJ4A 2QENA 2XTJA 4QDXA 2HJHA 4Q3DA 1G6KA 1W1WA 2QYSA 4BTEA 2A78A 2R1ZA 2ZLBA 3GFRA 1RYBA 4F96A 1AURA 3R0JA 3DMPA 3ILSA 5CYPA 2CXRA 4ZOLA 5DRTA 1EK2A 2O4UX 1IZZA 3VU3A 4BJHB 3PEEA 3GVIA 3K1JA 1YA8A 4GC9A 4N3BA 5K3BA 4LKRA 5A0TA 2RC5A 1QTNA 3LOUA 3KM0A 4G4JA 3R5FA 1JS1X 1JHZA 3BA6A 1NW5A 2WINI 1ZJ4A 1T4MA 1YB4A 1FQOA 3IVRA 2IIBA 3QU4A 4B6RA 1INLA 1BX1A 2CZQA 2R8BA 3WLNA 3ZHSA 4CGZA 3K15A 2J3MA 3KOUA 3P94A 5K09A 3JQEA 1K5HA 3JQ8A 4NV0A 2PX0A 1JWBB 2OSBA 1MEOA 2W6PA 2JW5A 2W2KA 1ZC3A 4WASA 5BN5B 2XUDA 2WWRA 3HUEA 1QVRA 3FYCA 2QN9A 5HZKA 2ZSUA 3D7MA 3O1LA 4R7ZA 4EHFA 2X4DA 5HM6A 5IG2A 2PIDA 1H0SA 1R1DA 2NUPA 3EC1A 4UHFA 2IV7A 3CN7A 2PBLA 4MQ4A 5GMOA 3E03A 4W1RA 4S05A 3BK2A 6NULA 5KYUB 1Y3HA 4HBZA 4O4IF 5ICCA 1UPFA 3LV8A 1NVEA 5CH3A 1SU4A 1TEHA 2PFSA 2GYUA 2GTHA 2C8JA 2NVOA 2PGIA 2Q5FA 1FSGA 1G21E 1C41A 2QMQA 2YWJA 1ZS9A 4AJIA 3TTUA 1KMHA 1MD9A 2QF7A 4ZV4A 3TQOA 1I4TD 1IUPA 4FONA 3BCRA 3C8ZA 3JQ9A 2IELA 3L84A 3NH6A 1C7JA 2AI3A 1Z4JA 1HEIA 2I67A 1EFPB 2GLXA 2V3WA 4WZBA 1I4OA 1C80A 1GPH1 2XPCA 1CIPA 1NDQA 3EZLA 2YYZA 1FYFA 3OOYA 3RSLA 3WDSA 3WV4A 4A6DA 1BX0A 1JI3A 2AZTA 2PGJA 2RGNA 3R0VA 3DBRB 4FDLA 3UJHA 3FCYA 1WWKA 3KTOA 1OHHA 2VQ6A 2ADMA 4QA9A 4JQYA 3O82A 5ENZA 2VHTA 2BPOA 4E32A 3BRSA 1SXJC 1UM9B 2JFQA 1TQDA 3R3UA 1JAHA 3CKLA 4ZEVA 4UNNA 1IBRA 1KA9H 1XA4A 5C52B 4YYEA 4UATA 1CF9A 1WXQA 4MWOA 4P4GA 5TF4A 4RZ2A 1SEPA 1RWNA 4XWWA 4YXWA 4KXYA 2FXIA 1KDYA 3QFHA 3E7DA 1WMSA 2GF2A 3SZLA 1Z38A 4ABYA 1J8FA 5HF8A 5MF6A 1ULAA 4FNGA 1X1TA 3OPYB 1RYYA 4Q3CA 2FWRA 1DO0A 2AMFA 2PRKA 4QDJA 4AURA 1C7ZA 4UQLA 2X7JA 2P79A 2BEUB 2V6BA 1Q2UA 3CX3A 5K8TA 4C20A 4A5OA 4U2EA 1SBZA 1YE8A 3KZVA 3H6GA 2W2LA 2PANA 1ZJZA 3JTEA 3WLRA 4FJ2A 3SJAA 1IULA 2V1UA 4RGBA 3QKWA 3EBPA 2J0VA 3BTSA 3RSSA 2B5WA 5REQA 2EL9A 1Q77A 3GA7A 3OO0A 3C7CB 2CBGA 3G2HA 3LBAA 1XP8A 3NH9A 3VC7A 1U8YA 2MJLA 1GRVA 5CIWA 1A76A 3V1LA 3G1UA 3TM5A 3OPMA 4F97A 1KSJA 4GM0A 4PG5A 4DLRA 5D3KA 2JL1A 1QHFA 4X6XA 2OA0A 5KTSA 4MI3A 3UMJA 1K5GA 4II3A 2IZ7A 1HE5A 4QXMA 4V38A 1EZ4A 2G80A 3WX0A 2BFCB 2HUNA 4HAIA 4WKNA 1EFCA 3RFCA 1EUCA 1JWLA 1CIVA 4KEAA 3VDXA 3PF8A 1UC5B 2IS2A 2G36A 4H31A 1JR3A 3FYHA 4FHZA 2X5XA 2YWCA 1UK8A 2QIOA 4EB6A 1N9GA 1PT6A 1UOOA 1M2GA 1U0GA 1N2JA 3AJAA 3D8SA 3ICOA 4G65A 3VZDA 1C0LA 2NYUA 4ZZ2A 1NVAA 2IYYA 2R2GA 1ZNZA 3VPFA 2O07A 3TXYA 3ZWMA 2XCIA 1PE0A 1ZO8A 1CFJA 1VA4A 2B8JA 2Q3BA 2Z43A 3HYLA 2WR8A 4TL8A 4RWEA 1HT0A 3F6PA 4O25A 3UICA 1EGAA 4OMCA 1WDWB 2ZYDA 3N5CA 1VTKA 2GCOB 4RJIA 3ZDBA 1IHUA 5MFZA 5H4GA 2R9VA 3C8DA 3NT2A 3ZWXA 1N7HA 4PEVA 1HFWA 3AUJB 1RHRA 1S9HA 2O2DA 1FVXA 1RZRA 4H77A 4MQLA 2ZBDA 1GN9A 1GPMA 4NPHA 3TXAA 3ZK8A 1GGFA 1WRBA 1ZIOA 2A86A 5CRIA 2Q9UA 2XTMA 3EGWA 4KE9A 1R5JA 2VK2A 5HMLA 3UMFA 2X6QA 1Q57A 2HSJA 3LF1A 1E9FA 1U2TA 3OX4A 1XTPA 3SC6A 1FX1A 1LRLA 1WO8A 5CHYA 3W5DA 4BMDA 2CWDA 3JQGB 5HFNA 4EUNA 4BMVA 2CDBA 3IIMA 3V97A 4UEJA 4RS4A 1LSJA 3ZN2A 1ZKDA 1SBQA 4RZQA 3TCKA 1F60A 2F48A 3AZQA 3AW9A 5JBIA 1SXGA 4B79A 3IKTA 3Q9LA 5BORA 1WV0A 4OOEA 1RRCA 2JI9A 1M1XB 4UZEA 5TEWA 1OWNA 4JVMA 3C3YA 3CPJB 3HDGA 4ESEA 4BIIA 5IBRA 4JX8A 3F78A 4C4TA 5TDHA 4HQOA 4ASUA 1QLHA 4QT4A 3HH8A 4RV4A 1U8EA 4FMCF 3RLIA 2XYQA 1X70A 2AB0A 4MDHA 4QOIA 3LQ2A 4D9MA 2NYAA 3R76A 1WZEA 3W6NA 2IH4A 5JH7A 4ZI7A 5HR5A 3UH0A 4JLJA 1TUGA 1K4KA 1CQXA 1PCXA 5EN4A 3W5VA 4DNPA 3E48A 5EJFA 4I5IA 5T6MA 3W1WA 2VQEB 4HR7A 1X2BA 3HCNA 4MB2A 3LPAA 1BMDA 4RLSA 3LH5A 4L6IA 3RRMA 4XB6B 1SD1A 1YTUA 2ZFUA 3T0IA 3NGXA 1KZYC 1R6XA 4L9RA 1Z6GA 4H7FA 4M0KA 4M9SA 1OA1A 2JPDA 4MPTA 4PN3A 4HGZA 3RS4A 3TECE 4UOZA 4IXMA 2CFRA 3SMQA 3PE4A 4AM8A 3DOFA 1SR8A 4KQEA 5KX5F 3D6HA 2C97A 3EF3A 3IPCA 2VDRB 3CLVA 2YY7A 4LXXA 1Z3CA 3C6QA 4C14A 3ZD7A 3BB3A 4K2HA 4YXFA 1PBNA 2AW5A 4MK4A 4CLDA 1KP3A 1GDTA 4DDUA 4DLUA 3V7WA 1C7IA 1RJFA 4L72A 1FFYA 3F8WA 1SXHA 5EJ6A 4Q39A 1CR0A 2PH1A 4XQ9A 3SZRA 1MX5A 3B1KA 5GJCA 1R4MA 3OD5A 4NR0A 2RE8A 3GT0A 3L8CA 3MIIA 5JY6A 2YCLA 2XNCA 1MB9A 1TD1A 5EKSA 3RKUA 2XCRB 5BSHA 5AYVA 4R0VA 4TTPA 1X1QA 2IUSA 3WQRA 4H6WA 1IN4A 2WFLA 1K5PA 2P0YA 2UYHA 5ITVA 4B7UA 1WZ2A 1A9PA 1GFZA 2W2MA 3UA3A 5ARDA 3U17A 3R3HA 5FP0A 5J47A 5AKJA 3K72B 3DP9A 1H4SA 2Q4TA 5G41A 1DCMA 1Z29A 1YJ5A 2PUWA 1LW6E 3AGQA 3FUUA 3I39X 1SURA 4TLCA 3AERA 4EA6A 2A2ZA 3LBIA 1LB1B 4ZK2A 1VMIA 3CU5A 3DLCA 4BRWA 3DAGA 2FPGB 3AR9A 3IP7A 2K7FA 3DEFA 4NS1A 1KC3A 1EK6A 3M3HA 3IUNA 4WPGA 2I6TA 2DWUA 1L8AA 4JHLA 1UT5A 1NW9B 1VYUA 1GDDA 4NVRA 2FW8A 3PK0A 1KMIY 1PR6A 3PWSA 1VZ2A 1FQKA 1NHWA 1WSAA 2XZPA 1W85B 1YVEI 1T6BY 5LVAA 2BGTA 3OH8A 3AF2A 4HJRA 4FUTA 3RG2A 4O1IA 5IJ9A 3PUZA 2JLUA 3W2TA 4PO9A 2HLDD 3GMSA 4JKIA 4NHOA 4U5QA 1JBKA 1UJNA 3CBQA 4LJKA 4BN0A 1BXRA 4BNDB 1GPBA 2QRJA 2MYPA 2OVBA 3UCEA 3GRZA 2VP3A 4RPCA 2PRZA 2PUCA 2A33A 4JQZA 1K6MA 1E20A 1YKFA 1DIBA 4E7PA 4IRXA 1OFIA 4UBKA 4YPFA 4CZ2A 2O8FA 1YQTA 3HLKA 3BHNA 1WP9A 2PO5A 2QXUA 3NHLA 4J7UA 3WQBA 5FTMA 2A7QA 2G9UA 4BEVA 2BMDA 1AUOA 3H5VA 1NUQA 4HQ6A 4DB4A 1T24A 1G1AA 5HILA 4JWTA 1GG9A 2WD7B 4MS3B 5CK5A 4QJ3A 3ZNOA 4D0RA 1A50B 4BB0A 4ZGGA 2PWAA 1JLKA 1YZTA 1IM2A 2YY6A 1TYDE 1G5PA 2J9RA 1GL6A 4EITA 3O7WA 1LLQA 4P86A 3LC1O 1L7NA 3AF3A 4XCQA 3FOFC 4PYJA 3WZ2A 2Q21A 1K6JA 3HP1A 5EVJA 1H2ZA 3R0QA 5EVCA 4IWXA 4LMBA 2HV8A 2W4QA 4HYEA 1IHYA 4WLVA 13PKA 3KT3A 1UC8A 3KE9A 3QI2A 3G7UA 4B8YA 1XZQA 4AMZA 4WDRA 1JG6A 3FLMA 3QVJA 5KNLA 3V8PA 2RKOA 1NNUA 2J7PA 2YV5A 1G6OA 4KPUA 3LY7A 4RKYA 4CQNA 1OI7A 4XARA 4UJ5A 5J58A 1RC8A 3PFBA 2G9NA 3IBFA 3GGGA 3DYIA 3N6XA 4BYGA 4DLAA 5I4CA 2C95A 1PWHA 1COWA 2IQIA 3K35A 3MTIA 4KXWA 1AXGA 2WWTA 2G25A 3ZGNA 4K8RB 1JQEA 1W30A 1K6IA 2WT9A 4O02B 5DCWA 1WTCA 4B2IA 3FZQA 3W5UA 1VRVA 3EPJA 4B6GA 1JXMA 5JZOA 1UK9A 1LDYA 3DFKA 4ZAGA 1CUEA 3EGVA 2BTQB 3FFAA 4TROA 1NFQA 1XTVA 4ZOLF 1BRTA 2GXQA 5F5XA 5CW1A 3ECCA 2WZCA 4PWYA 3QK7A 5DM4A 3L8GA 5EZSA 2CSUA 1XRQA 4QODA 3ESBA 4CWAA 1IBSA 4S12A 4UREA 2DKNA 3BGOS 1CEXA 2HRRA 2WU1A 4QBFA 5KDLA 1LCIA 3UJ3X 4QM6A 3C3JA 1XF9A 1Z9BA 1P1FA 4BMYA 4R0NA 4C1NA 1EB9A 1IY0A 3O03A 3PZRA 4F38A 3W04A 3ADDA 1FMFA 4D8WA 2FH5B 3FHLA 1ZOOA 4AXBA 1NFRA 4MUXA 2ZJ5A 3RVJA 3M3DA 4IKEA 1K98A 1QRTA 4LDAA 1HYGA 3LSYA 3QELB 4O4LA 3JQFA 1PWXA 2VZ9A 5KNBD 3WL6A 4EENA 1SEVA 3B48A 1Y9ZA 4R2LA 4HBGA 3H8VA 2RHJA 2ZSFA 2HW8A 2WMDA 4ZI2A 2EVWX 1P1IA 2JKZA 1AD2A 1GU1A 1OBFO 4RZIA 4QYTA 2AIRA 4B7CA 2FMIA 4MPPA 3PVCA 1EDEA 3NDBB 2I8LA 1VL6A 2QN8A 3AETB 2OAEA 3JARA 1J0AA 4OXXA 2RDMA 5AUPB 5JZBA 4FJ0A 2W11A 5LJIA 3VA7A 2VG8A 2B4AA 2Q8QA 3LT4A 3REQA 2BKAA 4FS8A 3D5TA 4PIPA 4B4WA 2H4ZA 2ZAOA 2O7RA 2XNDD 3M5WA 4OQZA 5EIBD 2VDWB 2Z4SA 5JFOA 2HO4A 4G5OA 5AD1A 1V16A 3NNNA 2YVAA 4FDUA 4OVKA 3R6TA 1TE2A 1GZUA 5G3ZA 2NTJA 1LSUA 1J9GA 5LXTF 4R01A 1AKRA 2O2HA 3DLAA 3O75A 4OY3A 3IEKA 4R6WA 3DPUA 3FDFA 4G8BA 5CA0A 2IPOA 4MV3A 5C81A 2W37A 2ODNA 4D79A 5JATA 3R6GA 1UBSB 5C31A 2CUZA 2P6PA 5BV1A 2EJUA 3VI3B 3RJ5A 1L8QA 4ZEXA 7REQA 3ZHUA 4JI6B 1JSXA 1OWPA 2BGKA 4D81A 1KRXA 1WVMA 2PZJA 3FJYA 3L0DA 4NL4H 5A4FS 3Q9NA 4HUJA 1IXYA 2FN4A 2AQKA 2Z95A 3PGMA 5B30A 4HNGA 3W90A 1C30B 1QWSA 4F11A 4P92A 4AI6A 1X87A 3DCIA 4KBYA 3KYCA 2NQ8A 4NOKA 3G9ZA 2ZK7A 1SVMA 2O50A 2SKEA 2LKCA 3G79A 3V8NA 4DTCA 1LSSA 1WXFA 3CONA 3Q9SA 2I3DA 3K53A 1FTGA 3OUTA 3PT9A 4Q3LA 1UJCA 4QELA 3TS1A 3UXHA 1Z5WA 1ZK3A 4E22A 4ENSA 2O0HA 2XMZA 1U28C 4BNLA 4GBED 4B0PA 4KWTA 2B4TO 1DDOA 1HEYA 1XE3A 4HAVA 4MJLA 5DHSA 5CM8B 2P7HA 5KJEA 1U2EA 3E5HA 4YJHB 2NZYA 1I0ZA 2HCJB 4MCAA 4Z9AA 3EOAI 2AMYA 2H4XA 1I7SB 2R7MA 4IIVA 1WBBA 3CMCO 1VPWA 2W6QA 3HGQA 2IXGA 4O8CA 1XTTA 4KE7A 3LDUA 1WL8A 3B6IA 2IXBA 3WRXA 3QY9A 2OILA 4MB0A 4A6XA 3LT0A 4XFJA 2WTXA 3ZY4A 2SCUB 3I76A 4U9IS 4MQFB 3H9JA 4PYNA 4KQMA 2F2TA 5AXAA 4TTQA 1YB6A 1WU8A 2A8YA 2K87A 2O8CB 2R6CA 1M33A 2Q1TA 4JJKA 4PSCA 1EXWA 2GM5A 3HXQA 4X60A 1KETA 1WZUA 2O2GA 3O83A 3DAYA 3N39C 4MVYA 3THSA 2BSQA 5IEBA 3B9BA 4FDTA 1H6DA 1BTOA 1Z5ZA 1ZUNB 2ARKA 1K97A 2R00C 3A1CA 3BULA 3TRIA 4EEKA 2JGDA 4EYOA 5JY1A 5KINB 1OFTA 4NXMB 1IN1A 4KPFC 2ZT8A 4DPKA 2O8BA 1VSQA 1YNOA 3LA6A 2OORC 4ARUA 3MRXA 3R2JA 3PCRB 3RYCB 4FFVA 3DXFA 1THZA 4UU8A 3DMHA 1E98A 3EY9A 1BMTA 4DXAA 4GOOD 5IJ0B 1ODLA 1XZNA 4FLFA 4UM7A 3UA4A 4ALLA 1UZLA 3KJZA 1MAHA 1MA3A 3EIHA 1EWVA 5ENDA 3OIFA 3RTCA 2NUAA 1YU9A 2PNFA 1DRUA 3C7DB 3WQSB 1QV7A 1OB5A 4ND5A 3KQVA 2A1IA 3H9UA 1GZ6A 3PNYA 2O8DB 4XD7D 1MAWA 2FWMX 2F9FA 4IH9A 4IYRA 5IULC 5DHUA 4PY2A 4C89A 4P35A 4XRRA 3FG9A 2JHGA 1RM0A 2Y1EA 4FYMA 4UVDA 1NUHA 1HDOA 3DZGA 4GI1A 5CLJA 1F6DA 1M72A 2YR0A 4GLOA 3MJSA 2YWBA 5KYGA 3SVLA 1TJ3A 4BVEA 2UZ4A 3T7IA 2HSWA 3TOVA 3MD9A 5GV7A 2F1RA 3QKSA 4UHCA 1YVRA 3SF8B 4N5MA 1DRJA 3GUHA 4B48A 1KDTA 3S8MA 2F8TA 4Z8XA 4ZDWA 5A4KA 1U0JA 1SH7A 1XLTC 1R9JA 4WKPA 3Q0EA 1CF4A 3TQTA 1M54A 4IMIB 4G9BA 1BRMA 3GGDA 1RZ3A 5GP1A 3M2PA 3BAZA 1N9ZA 1SCNE 3EFEA 1S3SA 2X2PA 3VUFA 4CPDA 4JVNA 4QBTA 2C7OA 2ORWA 3ZD9A 4JBHA 2LUOA 1OC4A 4D97A 2QYHA 3I5XA 1PGQA 2ZBVA 1EQUA 4LZJA 5AW8A 1IBMB 4EDFA 3BMQB 4CIBA 4ZI7F 5JH7F 1UBCA 1KY3A 3NTUA 2MSNA 1RXYA 4HN2A 2Q7XA 2ZJ4A 5AM1A 1GDHA 3A4VA 2P41A 4IL5A 1N77A 1XROA 2F9MA 3QOXA 1Q7BA 1GYRA 2A58A 3CIFA 3N2GB 4UHHA 1IXRC 2A14A 5L3SB 1T4GA 2FSIA 3KQKA 2VI5A 3WB2A 3L7KA 1IY9A 4XGNA 4ALNA 4BL5A 2UYQA 1E7YA 1WD5A 5EQJB 1EJ2A 4IP0A 1DOHA 2CCJA 1J22A 2ZI5A 2VSNA 2F4VB 3PNOA 2FPSA 1ZA2A 1BXKA 1LY1A 3R3WA 3KR1A 4ZJUA 1NWHA 3RUCA 4KR3A 1NBMA 3I5YA 4ZU3A 3LIPA 2AG5A 3SN6A 4LI3X 2CDRA 4FYYA 4B6EA 3NBMA 1QNFA 2WB2A 5A0FA 4HDNA 1WMBA 3RT9A 4YDQA 5HUJA 4ZTZB 3C74A 3H5NA 1TTHA 2H3HA 2QRQA 5EUBA 1WS6A 1F20A 4L8YA 2IYVA 1QRRA 4B4UA 4B3CA 4DLSA 2ODQA 1QF6A 1RQLA 4F5WA 3GZ4A 1TQ2A 1XBTA 4L8FA 2R62A 3O95A 3CUUA 3EISA 3QBJA 4AC9A 2FDCA 4KCGA 1M3SA 2X9QA 4YUWA 2RB5A 5EFOA 2QU8A 1ORRA 2IDKA 2O1EA 2O5RA 3D4LA 4JI7B 4JH0A 1N9KA 5JCOA 5ADUS 5KOHB 2CV1A 2FGJA 3MUFA 4V0NA 1XMSA 3TMYA 1IWBB 1X1RA 2D8MA 4ZMBA 2X0RA 3LWBA 1N5DA 5JO9A 4P83A 4WH0A 4E31A 4OJNA 5EHQA 2UUCB 5COQA 1QOZA 4O2RA 1LGYA 4AG5A 2EATA 2LD4A 3QX8A 5L45A 3W9UA 3D59A 1IPFA 4CKYA 1UWCA 3GJQA 3IB3A 2ZAYA 2ZTMA 3FGPA 3FKQA 3E22A 3PQ7A 5FWAA 4Z49A 5BSTA 1QX4A 1VBKA 1RWWA 4U7PB 4UBLA 3KQTA 4IQ8A 4L1KA 2Q3DA 4EO9A 1R3DA 1PGNA 1ZWLA 3IAAA 2EAUA 2H59A 3T7CA 3TIFA 3V7NA 3RFXA 1TGYA 1T5SA 1ZG3A 5A9SA 2V9PA 2FE1A 3KYDA 3N2LA 2WILA 3OD1A 5DHAA 1MR3F 4Q18A 1FXUA 1MW9X 1PUXA 3W5IA 2VXOA 4J94A 1JQ3A 2BYTA 2X9VA 1CD5A 2WZQA 2NXWA 3PEFA 4MSUA 4F2DA 1KY2A 1IU9A 1R4AA 2BOVA 3N0WA 4R51A 4Z3DA 3KQUA 1SRRA 3HI4A 3HP7A 3L8HA 4YFYA 9LDBA 4GDMA 5AVZA 1NXVA 4GWKA 2FPOA 1QORA 1CPYA 1Q22A 2I1VB 2FMUA 4C4SA 3R74A 1WHSA 3DMYA 4TXJA 4B6JA 1D9XA 1ZSYA 2HRZA 3EMVA 4I99A 1N8KA 3UAGA 3F2VA 1I5EA 3GRPA 4JCCA 1IM5A 1NMQA 3TI7A 2OTCA 1UJ2A 1YR3A 4GE3A 1MIOA 3GLTA 1ZI6A 5KX5A 3IESA 1NATA 2VDNB 3WL3A 3HLYA 4FXPA 1ITZA 2AXNA 1XRJA 2WHEA 3A3NA 4MW7A 1E3IA 3CGWA 4FTWA 3RVSA 4CKEB 1YZUA 5IT5A 1LW7A 2V6JA 5LUBA 1VE7A 5AHOA 4QU5A 4E3WA 1E0SA 1R0CA 4FR0A 5B58T 4MHOA 5I7SA 3G85A 2Y1XA 5LBUA 5GIOE 2GBGA 3L1UA 2ONYA 5SV2A 3K6SA 1JHRA 4NG5A 4XCVA 1C9NA 4I5DA 1VCNA 2NO4A 1K5DA 2J48A 3HJNA 4YRJA 2IHKA 3S3TA 3LDGA 2R7AA 5ILQA 2EZTA 1Z8DA 1GPJA 5AHXA 1BNCA 4M8LA 4PFKA 4IIGA 1DBIA 1GKYA 2GD0A 2I4MA 1T0UA 5JYDA 4WHMA 4JU8A 3TLCA 3S27A 2PH7A 3LL4A 5JS7A 4XIFA 2X0IA 4ENUA 2I9PA 3IS3A 2G1PA 1XRPA 1ZH8A 3DZJA 3EVFA 3ROMA 1EUDA 2R7LA 4NH4A 2OCAA 3WNVA 4YRMA 1D6NA 4MV0A 1SXJA 2OHHA 4X8HA 3I9OA 3ROFA 2B6NA 3K5HA 1BQ4A 4R1OA 1YL7A 1XWIA 4IJUA 2Q9CA 3OOHA 5GONB 4B7XA 4BJ6A 2A5YB 2FW9A 2QQ5A 4AKHA 1BAPA 2X3FA 1QOQB 1KEZA 4IJ6A 2QNIA 2Z8ZA 2ZJBA 4LDZA 4NDZA 3FIUA 3K31A 5HYVA 3AGPA 2UZ0A 1E8DA 2OKCA 3W3AD 1A82A 4I1IA 1W2GA 3STXA 4KI0A 5HUHA 2X4IA 3FHOA 1PR4A 2B1IA 4X9XA 2P4EA 1TT5B 3IIJA 5CIYA 3M1IA 5JJLA 1GTZA 1LXCA 1J0DA 4FYHA 1JX6A 2DBVO 1NSFA 4HATA 4RQAA 1PJ2A 3WWDA 4MJXA 3ABOB 1AK9A 3ETDA 3Q0IA 1CV2A 4H08A 4MXDA 2F17A 1UDAA 4CCWA 4TRJA 1PZXA 2PCLA 2Z2KA 1PDOA 3OZDA 4CBVA 9LDTA 3B85A 1HLPA 1DXQA 1FZQA 1Y0BA 1BFKA 2ATCA 2FG6C 1FW8A 1QH9A 5BUQA 7GPBA 5KBYA 2QJTA 2ST1A 4KITB 1RTTA 3KXKA 3N7TA 2XWPA 4O4LF 2TMKA 4IAOA 1KFCB 2HMWA 4C2TA 2DUJA 1DQZA 1KDZA 2ETVA 1SQ0A 1ZW6A 1RPTA 3P4XA 2ZVJA 4RW0A 3KZ1E 3KLPX 1E79A 5FADA 4FGLA 4LSZA 2FNAA 1NQOA 1KYZA 3L2OB 4FOSA 4G1EB 3OZIA 3M70A 2PMCA 4YREA 4D57A 4IXTA 3TL6A 2LDXA 4TRRA 4Z1MA 1HDIA 5LNK1 4DPMA 3EGXB 4URUR 2WMNB 1OAOC 4B3IA 3EMBA 2RCNA 1MGOA 1YQEA 1FFCA 3B38A 3PITA 4JOCA 4BFTA 2UXDB 5CFRA 3RS7A 2J8ZA 2AG6A 2IHJA 4PRYA 1XMVA 3VYUB 2J0SA 2FP3A 1KK1A 2AFIE 2NU6A 2C4HA 4LYJA 2PRJA 3LSTA 4AYTA 5JAPA 4JC5A 2R68A 5K2MA 4ENTA 4DQXA 2O6LA 4PHHA 2AFRA 4RPHA 2F3QA 3GP5A 1GJRA 1OT3A 3HBFA 3LNTA 3JSAA 5ALMA 2FFAA 5CA0F 4QTTB 4MCIA 5IX8A 2HMSA 1ULSA 1JA0A 2DOKA 4NNJA 3WKAA 4RPJA 3A2NA 4UMDA 5DI9A 4TYYA 3B8EA 3IQDB 2WQZA 1KJ8A 4FMDF 5EMJA 3ZJTA 4LZPA 4R1MA 3OQNA 1G9SA 2H7YA 4DMFA 5DXAA 1G8KA 1VL8A 2YFQA 4D5EA 2FU5C 5J1TB 3T9DA 4BAZA 1T1IA 3HCPA 3I45A 3EIQA 5JMOA 5FL3A 3PEWA 2VJBA 1S89A 3D64A 4FVTA 3FSJX 1QMGA 1J8MF 1JIQA 3R44A 4YI5A 2H1IA 4W5NA 4EW2A 5COAA 2Q3EA 3ZIDA 5MN5A 1AA6A 5LMCA 1N0WA 2YBEA 3R4VA 5L40A 1VLZA 3FW1A 4XEUA 4RCVA 5FPSA 4EB6B 1G3IA 3L7LA 3LX5A 5JBNA 5BSWA 4GR5A 3GWGA 3RABA 2R3SA 4YRSA 4H6XA 1AUQA 4Q3EA 4XGQA 1L7PA 4Z6KA 4HGNA 1T2AA 3DTTA 3VQTA 2GBPA 3QFRA 2IYQA 4K7JA 4HC4A 2GEVA 2FUNB 4MLCA 4R6XA 4UEKA 3V80A 4YAUA 3KKEA 1DO8A 4IVQA 4EGJA 2VAVA 5B1EA 1SG0A 1RXVA 2GN2A 2WD8A 4HNAA 5E4JA 4QNNA 3WLMA 3ZWWA 5KU1A 3HDJA 3NTRA 4EQ6A 3D4IA 2HCTA 3U6BA 2WFMA 1GITA 1TZJA 3CH6A 1QCCA 1E9BA 2ZRLA 5HIKA 5J5AA 5D3QA 3ROZA 1Y37A 3EUEA 4EFDA 1WQ1R 4UARA 3SC4A 4QZVA 4PX9A 5LLDA 3PEYA 1UQUA 4QU0A 4ZZ3A 1NMYA 3ND8A 5B57C 5FV7A 4V1CI 2ZJ3A 1C8KA 2HF8A 3EDCA 5HJ2A 3ID6C 4ZAXA 5BWMA 3QVWA 4AP9A 1Z6QA 3NT5A 1ZYUA 1HEUA 1QB8A 1E6LA 2FPIA 1G21A 2NT3A 2WA2A 3OFND 4ZCPA 1ZBDA 3RWBA 3CR3C 1BX3A 3CEJA 4U7HA 3M5DA 3OCJA 3QU9A 2AOTA 2HJ9A 2JFNA 2GOYA 3IKMB 5TX7A 3TPZA 1W93A 2J45A 2PBZA 4IOKA 5LP6F 1EXDA 2NUTA 2WWIA 3UKJA 5CU7A 1DQNA 3EXFA 4AG6A 1P5FA 2DCMA 2A59A 1AMUA 1USWA 2I7DA 3NANA 4JBGA