1H6AA

Reduced precursor form of glucose-fructose oxidoreductase from zymomonas mobilis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
381
structure length
381
Chain Sequence
ATLPAGASQVPTTPAGRPMPYAIRPMPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Precursor Form of Glucose-Fructose Oxidoreductase from Zymomonas Mobilis and its Complexes with Bound Ligands(,)
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Protein translocation
molecule keywords PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
total genus 129
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2001-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h6aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h6aA01
5ICMA 1GV1A 1NYTA 1T1SA 4TRJA 2HK7A 5CEJA 5JCXA 4R4JA 2XOXA 3INTA 1JKIA 3B1JA 3RUDA 3ZWNA 3ZWMA 3TL3A 1UR5A 2UYYA 4CV0A 4DYDA 2WMDA 1W4ZA 1YBVA 3ICPA 2Z1MA 1PZEA 5A9SB 5G4LA 2HMUA 5I7FA 1O89A 4LW8A 2YDYA 1ZNQO 3RVDA 1Y6JA 4J4HA 1XG5A 3RSHA 4TKLA 1ULSA 1YOVB 4B3JA 3VZPA 2CNBA 4IY1A 3I9KA 4LN1A 3GH3A 1WP4A 3GMDA 4KDFA 2QYSA 4UEOA 2CDBA 3PHJA 1DXYA 1I10A 1ZW1A 5KKAA 5AXAA 4BNUA 1XKQA 2ZKLA 4IDGA 3KYCB 5JY6A 4DIBA 1EVZA 4S1VA 1BTOA 2JKVA 3KYDA 4I08A 3I4CA 3WXBA 2A94A 1KIFA 2IEDA 1BGVA 3LF2A 3FNFA 1N1EA 4DRYA 2O3QA 5DT9A 3JYOA 1ZUD1 1ZIDA 2B5VA 3QW2A 1YXMA 1EQUA 2XXBA 4AJ2A 3HDQA 1W8DA 1SMKA 2EV9A 4KMSA 3BMQA 3W8FA 4IINA 3RUEA 5U4QA 2ZATA 2JFFA 3VPXA 3WSVA 1EE2A 1FXSA 5KVSA 4EI2A 3ANMA 3P2OA 2DKNA 3VZSA 5DZSA 2EKLA 1C1XB 3BXXA 3DBRA 4BVAA 1LUAA 2JCVA 4XQEA 3H9GA 3I9LA 4H7PA 3RUCA 2WM3A 1ENZA 3AM5A 3PFFA 5F5LA 4XA8A 1PWXA 4J49A 3I6IA 1UZLA 5F1KA 1Z45A 1W73A 4M87A 1QMGA 1EK5A 3EYWA 3X2EA 4BKRA 3OJLA 4TRRA 2PV7A 3JD2A 4ESOA 1IL0A 1B8PA 4YRAA 1JN0A 3FI9A 4E5KA 2HUNA 5IDXA 1VM6A 2QHXA 4Y98A 3PJFA 2EG9A 4J4BA 4LVCA 3WGTA 4CMKA 2PKRA 1Z82A 3MCVA 5EJ2A 1K5HA 3HSKA 1Y81A 2BFPA 2C2YA 1OBFO 3SLKA 4FGWA 1NNUA 1E1LA 4RVGA 2EIHA 1H5QA 3ETGA 4R5MA 4WCDA 5GZ6A 2GRAA 1MG5A 3IJPA 4JN6B 3CIFA 1TEHA 1KVUA 3OP4A 4QEDA 1D1SA 1UDAA 2V6BA 2OHXA 2C5AA 3M1LA 1A71A 3QWHA 4WCFC 2VHVA 3B1KA 2PZKA 2YFQA 4KWHA 3FNEA 1LLCA 3C1OA 5B4VA 1I2CA 5GY7A 1VSUA 2FSVA 2I76A 1E3EA 3NDIA 4E2ZA 4ZRMA 3TZKA 2NM0A 1P0CA 3U4CA 4EUFA 5A5FA 3ON5A 1P45A 1ONNA 3BMOA 2VUUA 3K5PA 4GLLA 1PJCA 1W6UA 3NTQA 4HXYA 1EE9A 1PS0A 1PJLA 4YCAA 2AEFA 4BHTA 1P0FA 3W4IA 3AUTA 2O3UA 2G0TA 2I67A 1Q7CA 5C7LO 1LDGA 2GF2A 2Q1TA 2JD2A 5G0SA 3PHLA 4L73A 1MP0A 4J91A 4N18A 4XJTA 4BO2A 2NVUA 3IQDB 4ND5A 4R01A 3D4PA 2RHCA 3NYWA 1HLDA 1EVJA 1UXKA 2HLPA 2VTEA 1FDWA 1F14A 1ONPA 1ZSNA 3NT4A 1DAOA 2G17A 1A4IA 1WDKA 4BQPA 4GL4A 4B3HA 1IB6A 3X2FA 4WJZA 1SAYA 3BHIA 5FWNA 3DXFA 3W6ZA 1R0SA 4QO7A 3AY6A 5A9TA 1DBVO 1GCOA 1GYQA 1ZBQA 5CDUA 3RI3A 4RVSA 1KVTA 2HSDA 5IZ4A 2A9FA 1MB4A 4L4SA 1OMOA 4MPDA 3JQGB 1KBZA 4NG5A 4IDCA 1J0XO 1QXSA 3DAFA 2ZYAA 4XIYA 3KZVA 4E21A 1DRUA 2F1KA 1QR6A 3PJDA 4L8VA 2DUUA 2BF7A 3ICCA 2RBEA 2W8ZA 3TWOA 2Y1OA 5KVVA 3U4DA 3K30A 1GPDG 4GPD1 4ZD6A 1BRMA 4P22A 2LDBA 1Q0QA 3VVBA 2NTNA 5T57A 4WGGA 3MJCA 4YACA 2I6TA 3U0BA 2UDPA 5JC8A 2C0CA 3GFGA 5JMWA 3V2UA 3U09A 3EK2A 4E5NA 1PL7A 1YRLA 3GF4A 2VNSA 1SC6A 3OJ0A 4OXYA 4GQAA 3JD4A 4CODB 3VAZA 3QVSA 5T8KA 1VJ1A 4CV1A 4CMJA 1HDXA 3BMNB 5A9RA 4G81A 1E7RA 4ND2A 5IG2A 3F47A 3G1UA 3LLSA 3HWRA 2XAAA 2IYPA 4P4LA 3E5MA 1BXGA 1ADBA 2Q1SA 3B1FA 5JAZA 3PZRA 3ONDA 3L6DA 1ENPA 1JLLA 1R0KA 3GZ4A 1GAEO 2BHLA 3DFZA 4GKVA 4B4OA 1K6JA 3GEGA 3VVCA 4BNHA 3O38A 4ID9A 1U4SA 4YPOA 4LRSB 3EC7A 2YQ5A 2P4HX 3L0DA 1A27A 2H5LA 3W1VA 1SEVA 5COAA 5JMPA 3T7CA 3JQ7B 4GI2A 3KBOA 3NT2A 2GD1O 4XRGA 1MX3A 3GOHA 1QYDA 2IXBA 2R6JA 4DLAA 4FQ8A 3WQRA 3GVHA 3ZV5A 4FPXA 4EDFA 4TWRA 1H94A 3C24A 3TPCA 3L4BA 3WGYA 4HY3A 5HS4A 5L51A 1ADFA 2EEZA 3ZV4A 5IXYA 1T4DA 5HM8A 2HMWA 3LSYA 3IKVA 4AJHA 3U3XA 5L7WA 4HFJA 3LLVA 4IJWA 3UCXA 2HU2A 5IN4A 4H3VA 1LXCA 3JQBA 1R6DA 4YJGA 3H7AA 3FD8A 1KVQA 1SB8A 3PLRA 3OQBA 1HE5A 1RWBA 1FDSA 4ND4A 2QRKA 2PZJA 2AE1A 3HE3A 2J5RA 4DL9A 1MA0A 2GO1A 5H82A 1WLYA 3O8QA 3OFSA 4WNCA 5EN4A 3PDUA 4XWYA 1R15A 3ST7A 5JDCA 1TVEA 4XQCA 1JVBA 3H9UA 3MJTA 1LU9A 3WB9A 4B4UA 4E12A 3JYLA 2YY7A 2FY8A 4ZHSA 4CLOA 2FOIA 3D5QA 4U8GA 1HLPA 4A10A 2YHIB 4YXFA 4RQUA 4UREA 5T5QA 3DBLA 4B79A 1YQDA 1LLUA 3HDJA 7MDHA 1GY8A 4EW6A 4U6SA 3MJ4A 4PZEA 4MOWA 2OOSA 1ADGA 4DMLA 4F3YA 4BKPA 5JS6A 1U8XX 1PJ4A 3O4RA 2IXAA 1NHGA 1SOWA 5LC1A 3H6KA 4DC1A 3OQ1A 1YL7A 4DC0A 2JL1A 3DHYA 1GV0A 4NJMA 4GX1A 4UVHA 4EITA 5IXSA 1I2ZA 3I9NA 5IF3A 2CD9A 3GRPA 3VH2A 3N7UA 1WPQA 1DC4A 3MWEB 1E92A 2C07A 4IBOA 1I24A 1NQAO 1A4UA 3GUCA 1C14A 1BVUA 2G76A 2DTXA 2J5QA 4AJEA 2HO5A 4IDDA 3IKTA 4K6FA 3I52A 2Q2WA 3ZNNA 4JBHA 4AJIA 2E6UX 2GSDA 3E9NA 1U28A 4RF3A 4CR7A 2ZYGA 3COSA 3TFQA 7ADHA 3L6OO 1ZK1A 5AXCA 5KJEA 4Y8VA 1M6WA 1HE2A 2Q45A 3O26A 1PZGA 3WJ7A 2W2LD 4A2CA 5CDGA 1J4AA 5THKA 5TLSA 3QQPA 1UP6A 1HDRA 2Z95A 4L75A 1F17A 2DBQA 3RKUA 2YV3A 5BNFA 4GX5A 3GMSA 3PWSA 3HZZA 1P3DA 5DF1A 3EAGA 5JYEA 1LSSA 3WQSB 4EZBA 1IULA 1HE3A 4J1QA 4IIVA 3MJSA 4I9UA 1O0SA 1RJWA 3CXRA 1R4NB 4KQXA 3W8EA 2HRZA 1A72A 4D42A 3RD5A 5I7VA 4J43A 5ILOA 2VT3A 3JV7A 1XELA 4UUNA 1DC3A 4XYGA 4Q3CA 3H3JA 3QHAA 1I0ZA 3NDJA 5HS6A 2C82A 4JXKA 3CZMA 4RORA 4CL8A 3FTNA 3MTGA 2PA3A 3HG7A 3WGOA 4J9UE 3RBXA 5A5EA 5JFOA 1XEAA 3UH1A 4HFMA 3GVIA 2VZ0A 4E4YA 2AMFA 2EERA 2AQ8A 2O7QA 3AUSA 1C0KA 3JQEA 5CPBA 2QX7A 2VYVD 1L7EA 1LC3A 4ND1A 1OOEA 4UUPA 5B37A 5KKCA 1TLTA 3ZWPA 4MVJF 5ES3A 3AM4A 4AJOA 5JPIA 2H9IA 3PP8A 1YDEA 1CDOA 4E6PA 5ER9A 4K1LA 4OXKA 1ZK3A 2C7GA 5TNXA 2VHWA 1EQ2A 2BLLA 4OSOA 3NJ8A 4QXMA 3PDJA 1OFGA 1KY4A 1ONOA 3A1NA 3KEQA 3W8DA 3O8QB 4BNTA 2QW8A 1T26A 3NGLA 2Y0EA 4FJ0A 1XHLA 1N9GB 4IQ0A 4LMRA 4NZ9A 3F4LA 1DIBA 1ISFA 2AW5A 3DZIA 3QRWA 4RLSA 1HYHA 3FWZA 1GUYA 4XKJA 4GWGA 1LRLA 1S6YA 3PQDA 1LLDA 3NX4A 4B8ZA 5JDCC 4JQCA 5AOVA 1DIHA 2FZEA 4FDAA 1YH3A 2ZTVA 4DBZA 4OH1A 1P31A 1O95A 1Z7BA 4GX0A 4FFLA 1GQ2A 3I23A 1JAYA 1JVSA 2GZ3A 2Q99A 3E8XA 3JQAA 2I3AA 1PGJA 2VRBA 5DCYA 3ZNQA 1X0VA 5FI5A 2OP1A 5B1YA 3JQBC 3ENKA 1V9LA 4A7PA 2HJRA 1DC6A 4ALIA 4EJMA 4E0BA 3VTFA 1DJQA 4J0EA 2CF5A 2P5UA 3AOEC 3F4BA 3PGXA 4D3DA 4MVJP 1PZFA 1XDWA 1ZSVA 3JQDA 2ZTMA 1ZXLA 3DBLB 4J7UA 2WD7A 1QV6A 3AM3A 1AUPA 2AG8A 4LCEA 2Y67A 3M1AA 2ZK7A 5KJCA 2IE0A 5AYVA 2Q4EA 1P1JA 3GN2A 5F3RA 4CM5A 3UUWA 3QA9A 3PK0A 3S2EA 1KVRA 4KDEA 2X9GA 1Y9EA 1XIVA 5KJ6A 5EERA 3FNGA 5CDTA 5F1OA 4TSKA 2AQHA 3H2SA 2FZWA 2EP5A 1O9BA 4H16A 4R1TA 4GX2A 4GGOA 5HBRA 2HMSA 4B8WA 1U9JA 1JWBB 3E18A 1SOVA 4W99A 2VUSA 4BO4A 4YJGB 4IQGA 4DQUA 2Q50A 4CM9A 2NTJA 4YEDA 1VC2A 3I3OA 5JO9A 3WSWA 3JYQA 1ZJYA 1WMAA 3DONA 4FOSA 1CQJA 4R5HA 2E4AA 2ZYDA 4Y67A 5ENVA 2CFCA 4DBVO 3ASVA 5TRTA 2NADA 2JFHA 4K9DA 5G2OA 4PG7A 4I1IA 3KO8A 4W7IA 2F00A 4NDNE 4NMHA 3DOJA 3V5NA 2B0JA 3NT5A 1YS4A 3FBTA 3P2YA 3WFJA 5CDYA 1NTOA 1NVGA 3AI1A 3WWYA 1HSOA 3VHRA 1JKJA 1M76A 3L6EA 4R1SA 4ZQEA 3OH8A 4Z3KA 3JQ7A 4NJOA 4A73A 4ZGWA 3IP3A 3F6YA 1PS9A 3IC5A 4PLPA 2DLDA 5EINA 2Y66A 5L45A 1EVIA 2CSUA 1NPDA 3VKUA 1YE3A 1JQBA 1U3VA 1BG6A 3WLEA 4BO6A 5BSEA 3F5SA 1YQGA 4WEOA 4E5MA 4KTTE 4L76A 4I5DA 4D79A 4G5HA 3FSRA 4J2HA 1BXGB 4BMSA 5M6DA 1Y8RB 4C7JA 1AE1A 4F6CA 4CMEC 4IS3A 5K0ZA 2BI7A 3CZRA 3H9JA 1SB9A 1BW9B 4D46A 3MTJA 5DNAA 1LI4A 3DMTC 5G0WA 3DAPA 3PXXA 4W9NC 3DDNA 3OICA 2YHUA 3SC4A 1XCBA 4FS3A 3INRA 4IM7A 5A3VA 1EDOA 1GEEA 3CUKA 3QVOA 4M86A 1H6DA 1QV7A 2VRCA 3MJEA 1YKFA 2DTDA 4O63O 3BMOB 4FGSA 3PJGA 5B4TA 1X0XA 4R1NA 1R0LA 3GZNB 4OGWA 2DBZA 3QLJA 1ENYA 5F5NA 1QYWA 5BSFA 3ROMA 5L3ZA 3RU7A 3FF4A 3KOUA 3WGZA 3GEDA 4BGEA 1U7HA 2EF1A 3ZWXA 2YUTA 2X7HA 4IXTA 1N8KA 3K8ZA 2J6IA 2AA3A 4FFPA 3HNPA 1JAXA 2JHFA 1D1TA 4YT5A 3SEFA 1DHTA 4PRKA 4XRRA 2X23A 4C4OA 2PLAA 3GUYA 3IDSA 3FR7A 2CVQA 1VJ0A 3R3JA 4QSMA 3NEPX 1G1AA 3UVEA 4CM6A 1ZMTA 3D5TA 1RYEA 2R00C 3O03A 1R16A 1PWZA 3FPLA 3TOZA 1ZJZA 2WYVA 3Q11A 1WW8A 2CZCA 2C59A 3Q2IA 1YGYA 2DFDA 3S2IA 2D2IA 2DM6A 1ISMA 3INGA 4YJDA 5G4KA 3AU9A 2HK8A 4RPJA 1G6KA 1T2DA 3A28A 3IJRA 1J6UA 1YONA 1ZK0A 3ZNPA 1IYZA 4LMPA 3KTDA 4Q3NA 5TJ9A 2PZMA 3PHHA 4RCVA 4GLOA 1FDVA 4MINA 4MO2A 1I3MA 5DP1A 4UAGA 5A02A 3LT0A 1NXQA 1YO6A 4JROA 3CMMA 2P2SA 3NKLA 1LTHR 2X22A 3Q0EA 1FK8A 4YJFA 2WD8A 4WOKA 3L9WA 4BNJA 4Z9YA 2X0JA 1MUUA 1E7MA 3ANLA 3KSUA 4WUVA 4WEQA 1X14A 1HT0A 2ZCVA 3C1TA 4IMPA 3GC6A 1SEPA 3ULKA 5JYFA 1Q7GA 5DN9A 1KEVA 3ZWOA 1VL6A 4QTZA 5JAQA 3DB2A 2YQ4A 4YJFB 1M66A 5A1TA 1AHIA 3STHA 2CUKA 3IL2A 3KVOA 1GZ3A 1I01A 1DFHA 1UP4A 1B2LA 3PI7A 5C7OO 5DULA 4R41A 3D7LA 1BXZA 4XDZA 2I5PO 3R6DA 1TB4A 4PLVA 4PLWA 3ZU3A 3DBHB 4BGIA 4IZIA 1DLJA 1UZNA 1ZK2A 3PPIA 3W4JA 4KZPA 5TX7A 4NK5A 4JJGA 4J2OA 1PJ3A 1NR1A 3L9XA 3IOYA 1YVEI 2FPPA 1BHSA 3H5NA 4EUHA 5JAIA 1OC4A 1D7OA 1V3VA 2UUOA 3F1KA 4AVYA 1C3VA 5I8WA 1UH5A 2V6MA 3UFXA 2D8AA 4II3A 4MKRA 5TC4A 3AY7A 2RAFA 4BKOA 4ZU3A 1E7SA 2ET6A 2XPCA 2BKAA 1AN9A 2JCXA 2Y99A 4TMFA 4CQLB 1JKFA 1UAGA 5MDHA 2IZZA 5EIOA 2O3JA 3CPSA 1Y5MA 4FBGA 4YB8A 1UXHA 1EK6A 1EMDA 2VCYA 4XJSA 4CM7A 2YW9A 3OF2A 1CQIA 2TMDA 4BS9A 3ZHXA 4XYEA 3ZWAA 3JQ9C 1E3WA 2Q1UA 1TT5B 3F5QA 1I3NA 2SCUA 3EGOA 5BNTA 3TDKA 3PYLA 5JSFA 1MFZA 4BO3A 1T25A 4W9NA 2X86A 5KIAA 3VPFA 2O3TA 2A4KA 2EW8A 1EDZA 2GN4A 4GKBA 5BNIA 5I9NA 1U3WA 4L0QA 3EZYA 3KYDB 2PK3A 4WECA 2IZ0A 3DWFA 1U7TA 2Y1FA 1QYVA 2BH9A 3M2TA 1TXGA 1B26A 5C3MA 4YQZA 2BMAA 4E2XA 1QG6A 3WFIA 1WDMA 1PU2A 1L1FA 3A4VA 3H5RA 9LDTA 1V35A 4RPKA 4UEJA 5CG2A 1NBOA 3ITKA 2ZQYA 5TSDA 3LC1O 1PTJA 3LDHA 2I65A 3V1UA 2V6GA 3C1AA 1Y1PA 3UXYA 2J3JA 1PQWA 2OGUA 1XWFA 4TVOA 1B16A 4ZRNA 6ADHA 2DU8A 1E7QA 3DZJA 3RU9A 4I9NA 4PLCA 3RASA 3WYEA 5CDSA 4J1TA 1U5AA 5JCJA 1E3JA 1T2FA 2NNLD 3LQFA 2POQX 3ABIA 4LSMA 4CR8A 2OL4A 2YFHA 4RQTA 5IAAA 3G1TA 2J3HA 3EDMA 3GPIA 3H2ZA 4Q9NA 2ZJ1A 3PJEA 4FIZA 4BNZA 2DPGA 2Y1GA 1VLLA 4J1NA 4XCVA 4CLEA 3Q9UA 2AQIA 1DRVA 4RF4A 3ENNA 2J3KA 3UGKA 4EEZA 3BIOA 1NFRA 2W2KB 3WYBA 4CM3A 4WLFA 4KWIA 1E7WA 4KUEA 4N5MA 1E0DA 2NVUB 3DZKA 3RC9A 1SNYA 4IDEA 5CEEA 3ZCXA 3GNTA 1PJTA 2VHYA 4LISA 4CMCA 3WQQA 3MOGA 2UUPA 3T7EA 4HX5A 3RUHA 3IMFA 1GD1O 4W4TA 4MVJE 5G0TA 2BGLA 1ZEJA 3HB5X 3L77A 1BDMA 4AJJA 5L40A 3SX2A 1DB3A 2OBYA 4F46A 2DVMA 4YJHB 2EXXA 3NAQA 4KP7A 4R68A 4KQWA 4UVEA 2ZTUA 1DJNA 1IY8A 3GT0A 3PGJA 1BW9A 1UAYA 1YQXA 1P44A 4OSPA 4OOEA 1Z6ZA 1EFKA 4NH4A 4CMIA 2GN6A 3VPGA 3QY9A 1E6EA 4J6FA 4DQVA 2O23A 3ANNA 2E49A 2WTBA 2A35A 3D4OA 3GDFA 3K96A 5EL0A 4BNMA 4F6LA 1CRWG 3GN1A 5H81A 5FEUA 3U4HA 4YTEA 5AVOA 2VWPA 4Z6KA 3HJAA 5L7TA 4DLLA 1NAHA 4NBRA 3VDQA 3KHUA 4FJ1A 1H9BA 2PD4A 1B8UA 3DHEA 1GZ4A 1C0LA 2I99A 4MDHA 1VRWA 4Z9XA 1TT7A 4YBZA 2OBNA 1KERA 1H6AA 2CY0A 5GMOA 3ZW9A 1ISGA 3HN7A 5I9MA 1JTVA 1I3LA 1Y8QB 4ZQGA 1D3AA 4CPDA 2Y1CA 5CEFA 4AICA 4CV3A 3IUSA 5AQ1A 1P1FA 3DAGA 4I9HA 4WKGA 5JE8A 3BZUA 1A5ZA 2CDAA 4OXNA 2D1YA 3NJ4A 3ONFA 1VL0A 4G2NA 5T67A 1R4MB 2C20A 4NBVA 2JD0A 4PVDA 1KOLA 1Y7TA 3F1LA 3KLPX 2VOJA 1VE9A 3DC2A 4I8XA 5C5IA 3FTPA 2FMUA 2D4AA 6LDHA 2YV2A 2IEBA 1E3IA 4XGIA 4BNVA 3GVPA 5DCUA 2ZB7A 1MC5A 3KSZO 2EJVA 1Q0HA 5I7EA 4CUZA 2FHSA 4FFNA 2IODA 1X13A 4WLVA 4DA9A 3TRIA 3ZHBA 1SCUA 4ILKA 1QYCA 1NX6A 3GGOA 1WAMA 3LC2O 4XB1A 4LSWA 1RM5A 3OMLA 2WDZA 1NAIA 3KRTA 1A7KA 2VN8A 4ALMA 3A06A 1PEDA 1XYGA 2D5CA 4IGFA 3RC2A 2B36A 4EJ6A 2ZCUA 2EKQA 1O5IA 4JBGA 2Q49A 4NHEA 2P9GA 4Z3DA 2B5WA 4ALLA 4ZQFA 3WMWA 5ICSA 2WE8A 5JO0A 1DIRA 3ZV6A 4QX6A 3QWFA 3TZQA 3F3SA 3GG9A 1E3SA 4CMGA 5A3JA 4Y9DA 1N9GA 4NPCA 3JQCA 1PL8A 4LK3A 2NQ8A 1OZAA 3BMNA 4RZIA 4BNGA 4ALJA 4ZJUA 2Z1NA 4MIYA 4JLWA 1QSGA 1G0NA 4LGVA 1WMBA 4R9RA 2HQ1A 2EKPA 1GYRA 4Q3EA 3RAJA 2I9PA 2HMTA 1HYGA 2X4GA 3AUAA 4CM1A 3V2GA 1EZ4A 1NHWA 3TSCA 4JIGA 3HFSA 4RVHA 3DEYX 3JQ8A 4HKTA 2WE7A 1LBEA 4IDAA 3FR8A 3WICA 5T73A 3JQ6A 4RPLA 3TZ6A 1DPGA 1E5LA 3H9QA 5B4UA 4PG4A 3DTYA 4FD3A 2FPGA 3QJ5A 3WNVA 2ILTA 3RC7A 4ALNA 4DMMA 5BSGA 5KVCA 5JYAA 3WIEA 3ROQA 5FF9A 1MLDA 4Z0PA 1P1KA 1PQUA 2OZPA 1YJ8A 4R1UA 5DBIA 3I1JA 3W4KA 4IXWA 5U1PA 3ZWCA 4O59O 1RM3A 4RJTA 1DDOA 2Y05A 3VOSA 4WCFB 4WLOA 2B4TO 1E5QA 3SJUA 4MIOA 4EEXA 3WNQA 4GVLA 4IIUA 2FRDA 3A14A 5LDHA 3FBGA 1H9AA 1GPJA 1B7GO 1LRKA 2EWMA 3CEAA 1Q0LA 3WGGA 1ZMOA 2UVDA 4D3SA 4XYMA 4OIMA 3AI3A 4PLHA 3U62A 2JD1A 3PQFA 4NFSA 3K73O 2J8ZA 3JQAD 4TZTA 4CQMB 4NBTA 4IMRA 4KUHA 3DHNA 5KVQA 3TZCA 1OI7A 1HF3A 4D0RA 1C0IA 3OQ6A 4XGNA 2H6EA 3EW7A 3E9MA 1X7HA 2NVWA 2YYYA 4O5OA 4ZVVA 3TN7A 3I83A 3LU1A 1B8VA 2HKIA 1U2DA 3RBVA 2O3SA 4NU5A 5JYDA 4E3ZA 1I33A 4JGBA 2RIRA 1XU9A 3DBRB 4RO0A 5T8KC 3S2FA 4BO7A 2HMVA 2QG4A 2ZJ0A 2HCTA 4IDBA 1YJQA 1TI7A 2EGHA 1B3RA 4FFOA 3UHAA 1HKUA 2W4QA 4BNLA 3ASUA 1I5RA 3ZZNA 1C0PA 1GZ6A 2BFMA 3GHHA 4KUGA 5GZ1A 3MJVA 4WLEA 3P19A 1D8AA 3PQEA 2VWGA 2W98A 4CUKA 4BV8A 2Q46A 3UCFA 4YAKA 2O3RA 2JJYA 2FR8A 4YAEA 1H6BA 5EQDA 4HNGA 3S2GA 2VYVA 4Z0TA 4BNIA 4TQGA 2PTGA 3JD3A 5CHEA 3QE3A 2AQKA 1M67A 4CV2A 1H93A 5HA5A 3WBFA 4NQZA 5COQA 1IZ9A 1XU7A 3ZWYA 1A7AA 4NIMA 5CPFA 4N5NA 4DUPA 3V8BA 2J5KA 4XDYA 3E82A 4BO0A 1WXDA 4OHUA 5L7YA 3VPHA 2Y0DA 4E30A 1UDCA 1FMCA 4CMBA 1KC3A 1PSDA 5C7IO 1LDBA 4FOOA 4OJNA 4J7XA 2GYYA 3ZGYA 2NU7A 3G49A 3GAFA 2VHZA 2X1HA 3BMCA 3LVFO 4J4TA 5DOVA 5EMHA 2WJPA 2EW2A 3WWZA 4UUMA 4PG8A 3GAZA 4GMFA 4BNXA 1FDTA 5JAMA 1DC5A 1DLIA 4O1MA 3JQFA 2X9VA 1WZIA 1HRDA 2WEKA 5TQVA 4B7CA 3KXDA 4PCVA 4MVJG 3TL2A 4BO8A 1EUDA 3ROPA 4XX0A 1I36A 2GERA 3GVXA 1GU7A 2FWMX 5JBIA 4D7AA 3PFWO 4IQ8A 3FNHA 5JDIC 1JU9A 4J7CA 2PGJA 1QLHA 4OM8A 1I3KA 3U5TA 5K6AA 2YHIA 3HDHA 3M6IA 2PY6A 4D43A 2Q4BA 4E2YA 2D3TA 3RC1A 1LNQA 3ZHYA 1B14A 1J5PA 1MXFA 2C7VA 1ZH8A 4AJ1A 1PGPA 4JX8A 3TOXA 1VKNA 1VI2A 4GSLA 2HDHA 1ENOA 1W0CA 4JP2A 3BYZA 2V65A 5CG1A 3U4IA 3E03A 3SXPA 3TF5A 1ULUA 1V3UA 3QV1A 1RM0A 2DT5A 4BKUA 3GEMA 3G0OA 2CDCA 4EYEA 3ZWWA 3E5RA 4DPKA 1GTMA 3DZHA 1YB5A 2GCGA 3G3EA 1Y8QA 3JQ9A 3GGPA 3WBBA 3QWBA 3M2PA 4ITUA 4NR0A 1BVRA 3D64A 2UV8A 3WX0A 5GZ3A 3Q1LA 5G4KB 2O4UX 4UEKA 1ISJA 4FC7A 3ROKA 4BB5A 1GDHA 1ZO8A 5A06A 4R9SA 1Z7EA 2R2GA 3ONEA 3HHPA 5FFFA 1PR3A 1RPNA 1BWSA 3NTRA 4OO3A 1HWYA 1I32A 3R0IA 3TZHA 3ZU5A 2X5OA 4X54A 4D41A 3C7DB 1OC2A 5K6AC 3TJRA 2GN9A 3CMCO 3PWKA 1G0OA 4AL4A 2PZLA 3FN4A 3T4XA 4TKMA 4DQXA 1MC4A 4J16A 5FYDA 3ORFA 1N2SA 3KLMX 4BL5A 3TNLA 2JCYA 1LA2A 1E77A 3D4NA 1MG0A 5TGDA 2QZZA 2P4QA 1QORA 4HWKA 4FW8A 2BI8A 1CYDA 1XGKA 3F9IA 3VH4A 4MVJA 2GASA 1NASA 1B0AA 4MJLA 1QKIA 1PS8A 1L7DA 2Y68A 4ND3A 3G17A 3GZNA 4OYRA 5MGBA 1RKXA 4CLDA 4EBFA 3IAHA 1T1RA 1P77A 3BTSA 2X5KO 3FWNA 5IJZA 3GLQA 3BAZA 3DBVO 2FSSA 3NV9A 1KETA 4E33A 4HFNA 5I9LA 1GFSA 3V1YA 1QRRA 5ITVA 3AOEA 4PGFA 4RPGA 2P9CA 2AE2A 5G0VA 3NRCA 4GVXA 4BNWA 5KJ1A 3FHLA 1FF9A 1EUZA 2CVZA 1WNTA 2X58A 3VDRA 2CVOA 4L9RA 3OHSX 4WOJA 1HEUA 3EMKA 1R4MA 3RUFA 1HZJA 4TVBA 4BQRA 2DBRA 3ZW8A 3OA0A 3R3SA 4FFRA 4OQYA 1HDZA 4P4GA 4DTIA 3K92A 3RKRA 3ZU4A 1DIGA 4YVFA 3LT1A 4PRLA 3ZDFA 3ZNOA 1HYEA 2AEMA 2C29D 2QZ9A 3AWDA 3DTTA 2XXJA 3T4EA 2B4RO 1GADO 3IIEA 3RIHA 4OMUA 5A05A 4FSHA 3ZU2A 5JNLA 5L4SA 4JJFA 1N7GA 1YOVA 1PGNA 3RJ5A 4IJUA 2BFOA 1S7CA 2TMGA 2VYNA 1VPDA 5JLAA 2OORA 2VTDA 4AJNA 3ZI0A 5JCJD 3FRJA 2NV6A 5IN5A 1K6IA 4IGEA 4L74A 3TQHA 2Y93A 4NFYA 5KCZA 2Y1EA 2IYOA 3WMXA 2NUAA 1IPFA 3ZV3A 3CKYA 4UULA 3GHYA 1ML3A 2PGDA 4XQGA 2Q22A 4BMVA 4YT8A 3L07A 4I5GA 3LT4A 2VZ8A 1A9ZA 2YJZA 3HN2A 4YAGA 1Y9AA 2X9NA 5L95A 3GY0A 3U9LA 4NFHA 3AI2A 4W82A 1C1XA 4CMIB 2PKQO 5J9GA 1XLTA 1Z75A 3WYCA 4U5QA 3HFGA 5IDYA 4ZN6A 1LJ8A 3BTUA 5IDQA 2VYND 1AHHA 1LSJA 4U0KA 5DP2A 3MWDB 5IZCA 3PVZA 1U5CA 2VHXA 4CM8B 3R1IA 2X0RA 1WZEA 1SZJG 4DXHA 3QVTA 4XQ9A 1HZZA 4D3FA 1E1MA 4PG5A 3I4FA 3JQFC 1E1NA 3VC7A 4J3FA 3KYBA 2PWZA 5C37A 4JJIA 4CQLA 3WTBA 3UCEA 1VJTA 3E6AA 2VZ9A 4IJVA 4A27A 4RGBA 4LRTB 3UW3A 1MGOA 3KB6A 5KNLA 1UXIA 4R51A 1IHXA 3OA2A 2A92A 2G82A 5HRUA 2GPTA 2BD0A 1R4NA 3F46A 1P1HA 2NACA 4J0FA 2UAGA 4Q3AA 4ALKA 4BB6A 2YDXA 4CM9D 1CJCA 4JNKA 1F0YA 1ZK4A 3VZRA 4YA6A 3RQSA 4OQZA 5ILGA 3JYPA 3G79A 3K2BA 3BTOA 3RBZA 1NQTA 2DBVO 4Y6SA 1HETA 4YDRA 3C3XA 4CLRB 1MXHA 2P91A 5BQFA 1GQQA 1LDEA 3QVWA 4WASA 2O4CA 3PIDA 4WLNA 1N5DA 4JP3A 4HP8A 1EBFA 4E5PA 3N74A 3AJRA 1ORRA 4GBJA 2XF8A 2GR9A 1GEGA 3GFBA 3CINA 3C8MA 1IZ0A 4YAIA 1IUKA 2PH3A 2E82A 4PLTA 4N5LA 4HFRA 4WK6A 3WGIA 3OJOA 1CERA 4AJPA 4MVJM 3QWIA 4DVJA 2NTVA 4GH5A 2X5JO 1T24A 4JBIA 3WTCA 1X1TA 4S3MA 3VZQA 1KEWA 1LX6A 2R00A 3E1KA 5I8ZA 3LC7O 4P38A 4AG3A 3AFNA 3HUDA 4BMNA 1K3TA 4DIOA 1B15A 2BGMA 1NFFA 1LEHA 4YT4A 1DEHA 2AXQA 1NP3A 3QSGA 1H6CA 2NWQA 2EP7A 4CQMD 5F1PA 3JQAB 4MVJH 3V1TC 4BGVA 1HDYA 3C85A 1LSOA 3E9QA 2WYUA 1K0UA 2BFAA 3AK4A 1HDOA 3I6QA 3DZFA 4UVGA 4II2A 3BHJA 1P33A 4H15A 3ZWBA 4J90A 3S8MA 3BTVA 2CF6A 3DZBA 4PIVA 4R69A 3RFVA 4E13A 3SLGA 2VOEA 4RZHA 1EUCA 4M8SA 4WE3A 1F8GA 3H9EO 3CE6A 1N92A 2FN7A 4ZQHA 1IOLA 3UICA 1LQUA 4N54A 4WLUA 4PG6A 2X8LA 3UAGA 2Q2VA 2Q1WA 2RCYA 4Y6RA 1CWUA 4Z9FA 1SBYA 1Y5RA 4CL3A 4HADA 4ROSA 1F8FA 1ZSYA 3GR6A 4UVDA 1JA9A 4XYLA 2JFGA 3DMTA 5JXWA 1I8TA 3CSDA 3SJ7A 1HDCA 4NU6A 4FCCA 3D0OA 4O0LA 1FJHA 4HUJA 3GNSA 1M6HA 4GWKA 3Q3CA 2X0NA 3K31A 4Q3DA 5JY1A 1U3UA 2PFGA 4BNFA 2NQTA 2OP0A 4MKXA 5EESA 3PEFA 3KUXA 4MP8A 4XZ3A 1YBAA 4NJMB 3OEWA 1V8BA 3NTOA 3OM9A 1P74A 1ZKMA 1LLQA 4YYZA 3E48A 3JD1A 2OMEA 3D1LA 1CEQA 1EEHA 3ITDA 1D4FA 3D3WB 1SO8A 1DFGA 5U9CA 4IS2A 1ZZEA 3LF1A 2ZB4A 5I7SA 1IHYA 1ZEMA 3GG2A 3TFOA 1PJBA 3EHEA 3DR3A 3HDYA 9LDBA 4PLFA 4EUEA 4W6ZA 2GUGA 3JQ8B 3PYMA 3SC6A 3BA1A 3IUPA 4OKIA 4QT0A 1ZCJA 1Z73A 2IDZA 3EY4A 1Y8RA 4BNNA 4P4NA 4PZDA 2PKQP 2VRCD 2VQ3A 4TROA 1IPEA 4BO1A 2DC1A 1K6XA 2HAEA 2PD3A 3AU8A 5TT0A 1PX0A 1YB1A 4M89A 2G1UA 2GDZA 4FR5A 1UDBA 4HNHA 5FI3A 1CF2O 4DPMA 2GNAA 4TZKA 4XD2A 4AFNA 2HRBA 3A9WA 1E3LA 2Y1DA 3SVTA 2O2SA 1HSZA 3JCZA 4RVUA 5T64A 5ITWA 5CFZA 1UUFA 4U6QA 4NBUA 1PJQA 4OL9A 1PZHA 4FJ2A 4A5OA 3AW9A 1RYDA 4CMHA 3DFUA 3U49A 3WR5A 3FPCA 1O8CA 4W7HA 5L53A 1I2BA 1BDBA 1X15A 3NUGA 5L4NA 3HB4X 3KM0A 1NQ5A 5L9AA 4R3NA 2PR2A 1UP7A 3GDOA 4YQYA 3O9ZA 1MV8A 3ZHZA 3D3WA 1EFLA 4TRMA 2I66A 3LZ6A 1M75A 4CR6A 2QYTA 4RVDA 3SBOA 5A03A 3EVTA 4OOFA 4BKQA 3JQGA 4DLBA 4BNKA 4I5EA 2WSBA 1XA0A 3JYNA 2QIOA 3LT2A 4J1SA 3WG9A 4E5YA 3W6UA 3GNQA 3BMCB 3I9MA 1NVTA 2OXIA 4QFDA 3C7AA 3NDRA 4E2WA 3PHIA 3PIIA 4LVUA 4Q3BA 4FB5A 3DMYA 2EHDA 3WS7A 4AJLA 2RHRA 1DO8A 2B69A 3LK7A 4CLXA 4DWVA 5IFLA 4PFJA 1Q2XA 1P1RA 1NVMB 5J23A 3GK3A 4QFCA 4FN4A 1Z74A 1ZVMA 1DHRA 4NI5A 4YJHA 4ZQBA 4HV4A 4CMEA 4GSKA 4CLHA 1EBUA 1VKOA 1P1IA 1WWKA 3LYLA 2AEJA 1U8FO 3RJ9A 5DDIP 3VKVA 1DOHA 2NU9A 2X6TA 4M1QA 2VNAA 4NBWA 4RF5A 4U0JA 4A03A 1LSUA 3K9QO 2BGKA 4D44A 3OETA 1H2HA 4B7UA 1F12A 3EUWA 3GGGA 4IDFA 4K26A 4IJKA 1GL3A 3DZGA 5AXBA 2QRJA 1C1DA 5T6BA 3Q6IA 4CM4A 3VPSA 3Q2KA 1KC1A 3B70A 1R37A 4OAQA 3VTZA 1HXHA 1U3TA 1E6UA 4R54A 2DPHA 4INAA 5IDWA 1PGOA 2HK9A 4BV9A 4KOAA 1KEPA 2V6FA 3IS3A 1R66A 3QVXA 4IUYA 1GYPA 4J9VA 1UJMA 4YT2A 2BELA 1F06A 3Q9NA 5THQA 2D0IA 1BMDA 3DQPA 1YB4A 1V6AA 1OAAA 2PGLA 2DFVA 1KEUA 4R16A 1AGNA 3AOGA 5TT1A 4D0SA 2Q2QA 4JK3A 3ETDA 2D5AA 1LQTA 3DOCA 4B3IA 5B12A 4JCOA 2DTEA 1N1GA 2ZB8A 1X7GA 2GGSA 5H83A 1XSEA 4GAEA 2X0IA 3JSAA 2NVBA 2B83A 3K6JA 1HE4A 4A0SA 1ARZA 3RUIA 4F45A 4MVJI 2ZQZA 3RROA 3WIDA 1AXEA 2YV1A 1BSVA 5HWSA 4UUOA 3RWBA 2B35A 3NGXA 4R3WA 4ONEA 1Q1NA 5TF4A 2AG5A 4IZHA 3B6ZA 3WGQA 4CLRA 3EZLA 3OIGA 4XGKA 4DIFA 4PZCA 3GQVA 1UXJA 4Z0HO 5CP8A 1ID1A 3OEYA 2ZIZA 1LDYA 2P68A 5DBGA 1ISIA 3FCOA 3WDSA 5K9ZA 3WJAA 5TJHA 1TA4A 2IZ1A 3KETA 3ZN2A 3H8VA 5TS3A 2NLOA 4RL6A 5TIIA 2RH8A 2BRUA 2ZB3A 4WNIA 3S1LA 4URFA 1DRWA 2V7PA 3V2HA 2EGGA 2FP4A 1Q7BA 4EGFA 4YR9A 1JWAB 4RV9A 3KV3O 4RDIA 1J49A 5DBFA 5A9SA 1YL6A 4A26A 1NQOA 1YBMA 3OJFA 4B4WA 3GVCA 4XB2A 2WWRA 3PHGA 2H1SA 4XYBA 4P8RA 4NNJA 3PRJA 1A9YA 5LCXA 1PQPA 4E32A 3B20A 3AUUA 2I3GA 4M55A 3WGHA 2E48A 1KY5A 1K2WA 3D3EA 1GUFA 3DOOA 2IRWA 3JTMA 1NR7A 5LDGA 1CETA 1WVGA 4BO9A 1KS9A 1HDGO 3WOHA 1HTBA 5BT9A 1WDLA 4MP6A 4DYVA 4WCFA 1VL8A 4YRBA 2VWQA 4L4RA 4XR4A 4O6VA 1O6ZA 4ZICA 5KWEA 4RPHA 1DAPA 3ETEA 1U4OA 3BHMA 4ZA2A 1LRJA 4B4VA 1NWHA 3GA0A 1YDWA 1LDMA 3ZWVA 3PZBA 2OFPA 5A04A 1H2BA 3H5AA 3KEOA 5JW6A 4G65A 5DOZA 3PWZA 3S55A 2NSDA 1VSVA 2B4QA 1YL5A 3I5MA 5BR7A 4RVFA 4CQMA 1MFPA 1E3WB 4D45A 5JDIA 1M2WA 3UF0A 2YZ7A 2VT2A 1U1IA 3RUAA 2JAHA 4BO5A 3I9OA 3L4BC 4BIIA 4CLOB 1K89A 2GN8A 1NFQA 3H4VA 4LCJA 3HADA 3RFXA 4AJ4A 2C54A 2JAPA 3UOGA 2WD7B 2E37A 3OJEA 3ZH2A 2OUIA 3VH3A 3PYXA 3ADOA 1R12A 4RDHA 3N58A 1DFIA 2O2YA 1FDUA 1RM4A 3GPDG 5AXDA 4XR9A 2GZ1A 4DREA 5JC1A 4NK4A 3K2EA 1NM5A 4YRDA 5A4DA 4BGUA 5KOIA 1E6WA 3GRKA 4FC6A 4M49A 4BNYA 3UKOA 1LC0A 3OIFA 3MZ0A 4PN3A 1KYQA 1E7YA 5ENDA 1IE3A 3PLNA 3CH6A 1BXKA 2PNFA 5COBA 2O7SA 1TT5A 4MKZA 4RLHA 2NU6A 3BMQB 2Q3EA 2QRLA 2Z5LA 3QWAA 1NWCA 2QQ5A 3DBHA 4L4XA 3RCBA 4CM4B 5BSHA 4FFMA 4N7RA 3JD0A 4MVJD 1PIWA 1C1DB 3VH1A 4KTVE 1T2CA 1CIVA 1GR0A 3AY3A 2J3IA 2JHGA 1N7HA 3MOIA 1XQ1A 3AFMA 4CMAA 5L4LA 3C7CB 4YAJA 3RFTA 2FR1A 1ZXBA 3P5SA 4OKNA 3QP9A 3OSUA 4XIJA 5KTKA 3HQ4O 2VUTA 5ADHA 3OBBA 4GMGA 2H63A 4U7WA 1QYXA 2C2XA 3ADPA 1ADCA 4GGPA 4QECA 1KVSA 4E31A 2FPIA 8LDHA 1PR9A 1EVYA 3OIDA 4PLZA 2W90A 1PJ2A 3UN1A 4K6CA 4MIEA 1NPYA 3GDGA 2FR0A 4Y6PA 1JDJA 1ZFNA 3H65A 3L4SO 2LDXA 5DCWA 2PH5A 4WPGA 3DO5A 5CAEA 4PVCA 5HTOA 4B7XA 5IZCC 3H3FA 3OECA 4CJXA 4K28A 1NPTO 1XQ6A 3MEQA 1T2AA 1SPXA 2GLXA 1GCUA 1DSSG 1P9LA 1X1EA 4QUKA 1V3TA 4BOYA 4QO8A 4EJ0A 1O94A 1HL3A 2HJSA 5KJFA 2C5EA 4I5FA 1UZMA 4AJKA 2EJWA 1QP8A 4UVIA 1AXGA 1QLJA 4YWJA 4PLGA 2O50A 2CMDA 3WLFA 3EVNA 1XR3A 2O48X 3KSDO 1YWGO 3P7MA 1GQYA 4DPLA 1GUZA 4XEHA 2VWHA 4DGSA 8ADHA 2DQ4A 4C7KA 4HBGA 2DAPA 1T4BA 2AHRA 2ZTLA 1H0KA 2GZ2A 3QIVA 2NU8A 1JW9B 1ISHA 2B37A 3KYCA 2RH4A 3IP1A 5EQFA 4TRNA 4IPTA 1U2GA 2WYWA 1PJSA 1B3BA 2P9EA 4RF2A 1T2EA 1DIAA 3CTMA 4CM8A 2OO5A 1V0JA 2Y0CA 4PLYA 1I30A 4MP3A 5F21A 1PGQA 4M54A 1UXGA 3I9JA 2DUWA 2W2LA 4QQRA 2PD6A 4Q39A 2G5CA 3DL2A 4BUCA 2W2KA 5G0UA 5ER6A 1LDNA 2P5YA 1PL6A 3PTZA 5EPOA 4CUJA 1X7DA 1E1KA 2D59A
chains in the Genus database with same CATH superfamily
1Z15A 3TCKA 1QVRA 1SVIA 2QVBA 4CHTA 4K46A 1GV1A 1NYTA 2WT9A 4HAXA 3TTXA 4BVJA 1CS0B 5ICMA 4TRJA 4U8HA 4R4JA 4DTCA 1ZAYA 3C4QA 3NHFA 1JKIA 2N1MA 3A7EA 3RUDA 3ZWNA 1TYAE 5K3AA 1U2GC 3GIWA 4A1OA 3DMRA 2H7CA 1OIXA 1W75A 3LT5A 4CV0A 4EKGA 2WVJA 3D5EA 1W4ZA 4AT1A 5JQGB 3HR7A 3I62A 2MJLA 3SS9X 4AP5A 4CG2A 3KQYA 5E4YA 2QE7D 3AHCA 2HMUA 4FHZA 1O89A 1X80A 1EWRA 4IKOA 1CY4A 2WWWA 5I7FA 3RYCA 4DR1B 1WXFA 3NIBA 3DKKA 5E9JA 2C94A 2IYUA 4GW3A 1ULSA 1YOVB 1KK0A 4XXHA 3BSYA 1PAUA 3AQIA 1UMCA 2F8LA 2GO7A 3KJEA 3GH3A 4G5QA 4IWNA 2AZTA 2AUTA 4KDFA 1BKSB 1JJVA 2MMGA 4Q7EA 2G5GX 2CDBA 2WU1A 4PS1A 5I47A 3WP1B 3D4IA 1RPTA 2ZR7A 4YUWA 3JAMA 2AK2A 5KQLA 1E79D 4DDHA 1XKQA 4IDGA 3D4LA 3SC2A 2OAP1 4I9FA 1AXRA 3QE0A 4I08A 3ZLUA 1MJNA 4M1MA 2A94A 2IEDA 3ESXA 1BGVA 2P2YA 3LF2A 3N6XA 4NNPA 3UWPA 5ALHA 1DUSA 1N4DA 1QS0A 2G36A 4GT1A 4AXBA 4WY8A 4BASA 2V9PA 1ZUD1 2XUJA 1EQUA 4Z6KA 4ZTZB 1MA3A 3HDQA 1W8DA 3H9BA 3QFTA 1DV1A 1E5XA 4X24A 4KPFC 2K6GA 2R84A 4IINA 4WQMA 2X8BA 3GT7A 4RK0A 1Z68A 2IOQA 3A31A 2BFBB 3EGEA 4ND8B 1RXYA 2FUNB 5DLYA 4DLSA 4MQUA 4FZJA 4MI3A 1BWRA 3KVRA 2EKLA 3PFIA 1YA6A 1XL1A 1IHUA 1T43A 3I9LA 1A04A 2VHQA 3RUCA 3UZUA 3W0LB 3MWEA 1ENZA 1PWXA 1YB7A 3EVDA 3I6IA 3IBSA 1Z45A 2Z9DA 3TIFA 4M87A 4E88A 1X7ZB 1B6TA 2FOLA 3X2EA 7AT1A 4PYIA 4ESOA 5CVDA 4TRRA 4M0KA 3OX2A 3ETJA 4GYJA 4GOLD 3RHZA 2M6LA 1OVGA 2VF7A 1U7DA 5A3QA 2HUNA 2FPNA 3D6FA 5IDXA 2QHXA 5K03A 3U6BA 3KKLA 2I0FA 2WJYA 1SZCA 5JJ5A 1VFNA 5DCLA 3WGTA 4CMKA 13PKA 5AVJA 4QGHA 1QRAA 2DT8A 3OF3A 5AM0A 2OLJA 2WWFA 3QU9A 1QIMA 1NNUA 2J6CA 3ETGA 1G66A 1G8GA 1H5QA 2YFYA 3F6PA 2JDIA 4WKPA 4XTCS 1CEYA 3FH0A 5GZ6A 3VQTA 1MG5A 4QL3A 4JN6B 1JPVA 1Z63A 3HRIA 3MG9A 3OP4A 3TE6A 5TR9A 2QTTA 1EWKA 2OHXA 3IILA 1XZAA 2Z2YA 3NNNA 5JANA 5ALKA 5JXJA 2H4WA 2P6MA 1NKTA 3X1ZA 2CBGA 5FR2A 3B1KA 2PZKA 3REQB 3FNEA 5E1OA 2GJAA 2O1EA 2R6DA 5GY7A 4HQRA 5GQSA 5EVJA 5KB3A 2RJ3A 4ZRMA 1P0CA 4PZUA 4HGRA 4TWJA 1AZTA 4WIAA 1P45A 1ONNA 3BMOA 2VUUA 4RWEA 3MCTA 1W6UA 3NTQA 5B57C 2VPQA 1OFIA 4QICA 6Q21A 3BXPA 2AKEA 1U2RA 3A4LA 1SU4A 3EEBA 2O3UA 4GC9A 2P0AA 4XIGS 4ZI7F 1Q7CA 5C7LO 2PVCA 4IG4A 1Y1TA 4RPIA 2Q1TA 3CWCA 3P9CA 3G82C 4MVYA 4G5YA 2WG2A 1XEXA 4TUYF 2FUG1 1FFWA 3PHLA 3QI2A 4L73A 4MAMA 4N18A 4XJTA 2X8JA 3IQDB 3KB8A 4R01A 4JXXA 3E2MA 2I3DA 3D4PA 3NYWA 2HLPA 4GM0A 2AN9A 2VTEA 3LUKA 4NU8X 5TMBA 2QG6A 1ONPA 5D5HA 1F7VA 1NVKA 3PPYA 1WDKA 4UM7A 4L8FA 4B3HA 2IS6A 3CKKA 3HVUA 4MQ6A 3BHIA 2QXTA 2O2GA 3P27A 4KQ2A 3JXEA 1PI3A 3E70C 1QO0D 4GWLA 4HDNB 4R83A 4JEMA 5FPTA 5FT9A 4AO6A 3FSGA 1PYDA 3DUFA 3L82B 4HDSA 3RI3A 1G2PA 2HSDA 4RGQA 4RIEA 2H52A 1VYTA 4KC0A 4L4SA 5IBRA 1FLDA 4Q9HA 5MN6A 2IKQA 1KBZA 1E4YA 3JQGB 3NATA 1J0XO 1QXSA 5KYXB 3HBAA 4G4JA 2QBYA 2XT0A 2ZYAA 1ND5A 2ATCA 3QKTA 1NBMA 1USKA 3DZ8A 4U2EA 1QR6A 3DEAA 3KFLA 3ROGA 5HCIA 5D5QA 2WA1A 5FAKA 3P71T 3IUBA 1G63A 4HLQB 3U4DA 5KVVA 4CQJA 1GPDG 1KGSA 1FP6A 1ODFA 2I7DA 2Z3VA 1OGJA 4KQKA 4PICA 5CYFA 3ZS8A 1ZM2A 3P9IA 1HORA 3VFDA 4JFAA 1Z16A 1QG0A 5DMHA 1M7HA 2ZYVX 4D0NA 1KFCB 3H18A 3QM1A 1BFUA 2QBYB 2A33A 4X7BA 3OCCA 5T57A 4AG5A 1ODIA 1U94A 1NVXQ 5G41A 1QYIA 3HSSA 2UDPA 4D4MA 4YV2A 1A97A 3IBYA 3OLYA 3Q7PA 4WXEA 3LBIA 3TUTA 1SKMA 3QJGA 4YDHB 4RD1A 4W8OA 3U09A 4IFTA 3EK2A 4E5NA 1YRLA 1XLVA 3KSRA 2VPWA 3TMKA 4CN8A 5BNWA 5CFPA 1PLJA 3OJ0A 4GQAA 3JD4A 1LV8A 3C6ZA 1T1JA 4OXYA 4RGYA 2CD7A 1UBGA 1YVDA 1P7WA 2Q3HA 1OLOA 2R25B 1N2EA 2RGXA 3B6KA 3NONA 2O8CA 5IG2A 3BGSA 2R68A 3T1NA 3IUJA 3FLEA 4G0QA 4R2KA 4E15A 3LLSA 3RVQA 2XAAA 4P4LA 3E5MA 2Q1SA 3I01M 1G5FA 1VIAA 2F3SA 5KSPA 5EIFA 1R0KA 1GRCA 3FG9A 2WHRA 1GAEO 4X85A 4EJSC 2UU9B 1L7BA 5JQGA 2OCAA 3DT8A 1QGED 3GP5A 2PT9A 1B73A 4HPXB 1KJIA 2EARA 2RHTA 2YQ5A 2QJFA 3QELA 4RETA 1DZIA 1E9BA 3RNLA 1CY6A 2P4HX 2H5LA 1XZGA 3C3EA 3ANTA 3K2IA 3ND6A 1QO7A 4RK7A 5EWLA 2I6XA 5CCEA 3T7CA 3JQ7B 5BRJA 5KC9A 1F4VA 2GT1A 3KPUA 4BFTA 5JFGA 2Y6VA 5HPYB 1I0IA 4RNDB 3ZZ0A 1EDBA 3SQNA 2IXBA 3ZU6A 4ZZ3A 4O4JB 5CFQA 1RAEA 2IEYA 3C24A 1ZH2A 2QWXA 3TPCA 4RLFA 2XOKA 3CGGA 3WKBA 4BQNA 4PIPA 4UHDA 2CYCA 4JYMA 3VZDA 4MKGA 5IXYA 4MR9A 4AF8A 4ZDIA 3NDPA 1T1EA 3I64A 4P32A 1SY7A 5ERXA 4ENVA 2BMDA 3U3XA 2VDKB 3JWPA 4YUAA 2C3PA 3U44A 4ZARA 5IN4A 2ZT7A 4H3VA 4ABTA 1N6NA 2ZJ6A 3T7JA 1R6DA 3NVMB 3DNFA 4FZ5A 4YR7A 1FU7A 4A92A 1SB8A 3EFBA 4GR5A 4B3GA 1BDIA 4FHEA 5JD3A 1FDSA 3K1YA 4BFVA 5DHTA 2PZJA 3TG2A 4WZBE 4BX2A 5GAJA 1MA0A 2GO1A 2C9CA 5H82A 1K7CA 1DJLA 1RKVA 4XX1A 4GEGA 5C80A 4JKIA 4JZYA 2EWWA 2Y6UA 2XHEA 1QOPB 1XXHB 1YA4A 2V5VA 3HPRA 1AG9A 3JY6A 1R15A 2RIPA 3PDUA 4EHHA 2FZLA 4AN0A 4U39A 2PZFA 3FYDA 3GEBA 4Q1BA 1F1BA 3VR3A 4B4UA 1YZTA 1H2FA 4COOA 4D9JA 4E12A 3TUIC 3COVA 4MW0A 4KOEC 3H19A 5AI4A 4D8WA 4M9XA 4QREA 2FY8A 2IEGA 3V3TA 4A10A 1HLPA 1Z25A 3A11A 1UBUS 3ABZA 5ANRB 3S40A 1RQ2A 2HK6A 4HD8A 4B3DA 1V1RA 1S8OA 2JCSA 3DBLA 3PKIA 3HDJA 2W7TA 1GY8A 2HDOA 3TQSA 4EW6A 2OGTA 2OOSA 5FTNA 1XMQB 4F3YA 1XZNA 4EHNA 5JS6A 1U8XX 4KGZA 2DPXA 2H18A 3P2KA 3G6KA 4KO1S 4Q48A 4AY6A 1LF0A 1NHGA 1SOWA 4LBZA 3L18A 3QPCA 1HH4A 2E21A 3HKEA 1YL7A 3VU1A 3SICE 3ZHCA 4DC0A 1V16B 3GLUA 2KI5A 3QOWA 4H31A 4M0UA 2KBEA 1F38A 3EH2A 1I2ZA 5AVRA 3U44B 1KZ1A 1YVRA 2W8BA 3FDJA 4GNKA 4IV0A 3ZVMA 1U8YA 3NAZA 3Q7SA 3VJLA 3VH2A 4RHCA 1G1MA 2LKCA 4LGCA 3V6MA 3O92A 1DC4A 3AJEA 1QAOA 4IBOA 4RMHA 1I24A 1P8AA 1NQAO 2H2FA 3CRQA 1UF9A 3NNDA 5K1ZA 1JILA 2VHUA 2WIAA 4QGSA 2G76A 3LX5A 2VAPA 5HTKA 1E0SA 1HY3A 2J5QA 2O1WA 4QYXA 4WY5A 4AJEA 4BLSA 5K8JB 4REQA 2QLBA 3E5NA 1P5ZB 4UMVA 3AX6A 2ST1A 4JU9A 4UD2A 4X7MA 1TAHA 4D26A 2GSDA 2XV1A 2B0CA 4RXTA 4R7TA 1L5KA 5AI0A 4KIWA 4F71A 3COSA 3JZFA 4XDGA 5G53C 3TFQA 7ADHA 2VNKA 3QQ5A 3U56A 2XUIA 1JR6A 3KFVA 5ULLA 1MRSA 4ZODA 1Z18A 2WNHA 1H2YA 4BJHB 4YCJA 1N0WA 4QHTA 1Z2EA 1Y4SA 2GHIA 3HCFA 2YWFA 4Y8VA 5AM4A 1YJCA 2H3HA 2W2LD 2I4LA 4K9MA 4TSFA 2NU8B 5TLSA 3QQPA 1UP6A 4MGKR 4QQNA 4L75A 1FB5A 4MS3B 4HNTA 1Q6YA 1AO3A 2Q0QA 5AJWA 3F96A 1DU4A 1RYNA 3LVQE 4BJ1A 3HZZA 1H66A 3VSCA 1Z5ZA 5DV9A 1JQ3A 2QTVB 4YV7A 2WNSA 1SIWA 3EAGA 3WQSB 3R7BA 4EZBA 2OCLA 4G86A 4IIVA 3WIVA 1TUGA 4DW8A 3D3QA 3LA8A 3RD5A 4HDOB 4MRSA 3JV7A 3GV0A 4WA7A 3DW1X 1DC3A 4XYGA 3PFBA 3FF1A 3H3JA 1JPJA 4Q47A 3QHAA 3WL3A 3NDJA 5HS6A 4G26A 2JGRA 2WUDA 1WETA 1W46A 1LI7A 4BVLA 4RORA 3NEJA 2I7VA 2YOGA 3L84A 3OU6A 4M0PA 3ZDQA 2MINB 5F3WB 2Q41A 3R0XA 5TMDA 1V4BA 2YXBA 2O8NA 4P0QB 3WGOA 2F1JA 1SRQA 4J9UE 4N6NA 3RBXA 2FW0A 4KGXA 5A5EA 5KVAA 1QH9A 1OLSA 2AMFA 2AQ8A 5SY9A 1BJRE 3I01A 1C0KA 4MUMA 3JQEA 3K9NA 1IWOA 2EBUA 1DWUA 1SVUA 1QKKA 3UJ9A 3RW9A 3LZCA 1VKRA 3EG9B 4OJTA 3SF8B 4ND1A 5B37A 5KKCA 1TLTA 3L93A 1PWHA 4UKDA 3SU8A 3OQVA 2ZS9A 1N8NA 3C3DA 1YDEA 1MH9A 2C7QA 3RHSA 4M3NA 4QAJA 1KAGA 1ZK3A 2A0UA 2C7GA 5TNXA 3SZMA 4DV6B 1J0BA 3CEHA 4MCIA 4OSOA 3AEKB 4CNBA 1YS6A 3KR1A 2I3ZA 5EZYB 4HDNA 1UK8A 5HG0A 2Q4RA 3Q85A 3O8QB 4Q4JA 3AVWA 3NGLA 1XHLA 4IDNA 5B1YA 4G36A 4L27A 4RLSA 2WM9B 1ISFA 3DZIA 1EFVA 2R5NA 4F3KA 4C0LA 4A8JB 3EYAA 4XKJA 2C88A 3PQDA 3ESBA 1Y63A 2ZANA 5H9WA 3QTLA 4YREA 4DANA 4JQCA 1DIHA 3LHSA 3PQ8A 3IQWA 4ZMBA 1YH3A 5DO9A 1RHMA 4HDCA 2X7XA 3ISVA 3M4XA 4H9GA 1P31A 4PO3X 1IJFA 2SCUB 2OOKA 1ETUA 3DL0A 5IKXA 5A5VA 4FQ7A 2EZUA 3L0SA 1NF8A 5MN4A 2L0XA 3PCTA 2BGTA 2JIQA 4O2AB 4TKUB 3H2YA 1PGJA 2QRNA 2K2WA 3CWZA 3IBFA 3OOEA 4YP0A 2VR1A 3W6PA 5K0GA 3DDWA 3CRW1 1IIRA 5CB0A 3FFWA 4B33A 1Z37A 2Q9AA 4LZJA 4PZZA 1K8QA 5JJIA 2IS2A 4RD4A 4ALIA 3SE0A 1BS1A 4CDRA 3T1VA 2ZVJA 3GEEA 2P5UA 3FPFA 3AOEC 1S2NA 3L5KA 3R6GA 2Y4OA 2IFTA 3AEUB 4ND6A 4EGSA 4ZKDA 4D3DA 3A7DA 2PS1A 3NM5A 3GLGE 4RCZA 1HQYE 2PT7A 1PZMA 3Q88A 3INYA 1WV1A 3H8WA 1ZXLA 3N2NA 3PNYA 3PE3A 4J7UA 1XQYA 3MTIA 1E2UA 2WD7A 4MCJA 1QV6A 1SIUA 4IF6A 4IH4A 1ZRNA 1D2EA 1TF2A 2C5BA 2Y67A 1ZLYA 4LE1A 5DW0A 1XQVA 3OFKA 3W5VA 3QYAA 4EY8A 1ZBDA 3LCCA 5EXXA 2BGIA 1AHNA 1O5OA 4YLYA 3UUWA 1X80B 1D0IA 2PX6A 4TX1A 3BS4A 1KVRA 3S2EA 2VH5R 3Q1KA 4JYCA 4HQFA 3SIRA 4MQEA 3T6KA 2FDXA 3FNGA 3VU9A 4JODA 2QRUA 1Q11A 2FZWA 1O9BA 3P2EA 4UFOA 4F8JA 3D6JA 1PT7A 2RGEA 3IEUA 4O8ZA 4R1TA 4EHJA 4CEJA 1FYVA 4C4YA 4GGOA 2PS9A 4DEXA 1OWPA 1WUJS 1SVNA 4B8WA 3PTAA 2KBFA 1JWBB 4UM8B 5T7BA 2OZLA 1RI2A 2X2PA 2IIBA 3V7WA 2CLEB 2Y9PB 3QPUA 4LAFA 4DQUA 4QU5A 2IY9A 4PR3A 4XASA 4QJBA 5JO9A 1V1RB 1C50A 5CT6A 1SOAA 1ECJA 1JQ5A 4V0MA 1EA5A 4LXTA 5ENVA 5CIQA 2VCEA 2OQIA 3ASVA 4C7VA 1D4ZA 3E8MA 2MDTA 5ALGA 3PI6A 1DKMA 3SJZA 4K9DA 1QRDA 5G2OA 3KXPA 4I1IA 3ZXXA 3FYUB 4G56A 3FFTA 4GYKA 3RU2A 3DOJA 1YS4A 4QE3A 3P9QA 3BK2A 4MV7A 1Z13A 4NV3A 3K0FA 1E96A 1RQNA 3BGDA 1MO3A 4JBWA 4JI6B 1ABEA 2OCPA 4WFKA 1L6IA 3L6RA 3NOVA 3RTAA 4EGAA 4QNMA 5AESA 4A73A 4ZGWA 2GVNA 5FUMA 1CEEA 3AR9A 3R41A 3O31A 1DBWA 2LP4Y 1S01A 5CA1B 2H5EA 3TOCA 3KVVA 5EINA 4YFYA 1UBHS 5L45A 2CSUA 1NPDA 4G0OA 1YE3A 2H2AA 1K3UB 3P97A 5J63A 2A0YA 3T5MA 4YRSA 4RSGA 4GICA 4Q7QA 4I1PA 3F5SA 2C96A 5HJEA 1VPEA 1QCZA 3I58A 2YY5A 3JALB 4WEOA 1OPXA 3BE8A 1NZJA 4BFXA 4G5HA 4J0IA 4J2HA 4RY2A 1BXGB 2W83A 4BMSA 1IN4A 1QJCA 3T5GA 3C1UA 5K0ZA 2BI7A 3CZRA 3O4GA 1TM5E 3MTJA 1V2HE 4FOTA 1LI4A 1H65A 1XLWA 3IURA 1DKRA 2P0YA 4JA2A 4O3FA 5AVSA 3TLYA 5IARA 3LQQA 4LUCA 2YIMA 3NHWA 1KRWA 2QJOA 3WHLA 3UBMA 4DCPA 3DDNA 2E87A 2XMDA 2YHUA 1XCBA 3OICA 5AVZA 3UJPA 4FS3A 1V8FA 1RXSA 2GJ4A 4H7FA 1DCMA 1GEEA 3CUKA 3LQYA 2A3RA 4M53A 5KNBH 4FZVA 4MULA 4FSDA 3TQCA 2Y27A 1ZM3A 2ZDHA 4KYIB 3MJEA 1YKFA 4C4TA 2I2AA 4LJ5A 3EXIA 4QWMA 4L9WA 1TZJA 2P9YA 2ZE8A 4R05A 2BEWB 3QF7A 2RARA 3U4QB 4OGWA 1KDPA 3TLAA 1AOXA 1ENYA 4M38A 3G9TA 4HNVA 1KAEA 4BU1A 2CZQA 1Y6FA 5L3ZA 1XV5A 3JS5A 1T4MA 5T4HA 4L8LA 1GN8A 1TX4B 3VO9A 2JI6A 5HJ2A 3WGZA 3GEDA 1TJ4A 2ZSAA 3EF3A 1TVKA 4MDYA 5IHPA 2ROQA 1XVIA 1CQPA 3K8ZA 2J6IA 4FFPA 1DPFA 1JAXA 4INPA 3D2BA 2JHFA 1D1TA 5EY5B 1Z39A 5EMLA 1H0SA 4PRKA 4S1OA 3DHWC 1K08A 1E1CB 1RE1A 4KK3A 3S99A 2PLAA 4F8YA 5J4KA 4YPFA 3GRAA 3VDMA 1EJ0A 2NZWA 1DBSA 1PSWA 3ZE9A 3D0RA 4MRNA 3AVPA 2HB6A 2CVQA 1VB5A 1PR1A 5IT9A 2NSJA 5CX1A 1KAHA 1X7YB 5BOSA 4JNCA 4OCZA 5LWHA 2WA2A 1O8BA 1RYEA 2R00C 3K5IA 4EY7A 4WESB 4YCDA 1U81A 3WK7A 2WYVA 4MPPA 3Q11A 2IHBA 2OK8A 5FBKA 1YGYA 3F90A 5E8JA 2D2IA 4MQMA 3OM8A 3W7AA 4ZEVA 4LF5B 2GEDA 3UJHA 1QC5A 4R2MA 4ZVQA 3WKCA 5JNWA 1C9JA 3CLUD 4DJEC 4CF7A 5HHTA 4AIIA 3A28A 4Y0AA 5CGZA 1L4EA 1O3YA 2LTAA 4WD3A 3CVJA 1J6UA 4JJ6A 1ZK0A 2XTJA 2QLNA 5JSHA 2FF7A 5JG7A 5IC5A 5ESRA 5AI8A 3DHVA 4GLOA 1KI4A 3SEQA 4V0ME 5FWAA 5JFTA 1UFOA 2DWQA 4MINA 3J7TA 3KV1A 4YNBA 3L04A 4AUKA 1G38A 3FRIA 3U5ZB 1XTUA 4EJSA 2GHQA 4RXMA 5FUQA 3ZCVA 3PKZA 4DCOA 3CMMA 3WP0A 4M1ZA 4MQLA 4MR7B 1ZUWA 1YR9A 3RJMA 3K0SA 2IYXA 2FMFA 1S5PA 5T4EA 2ZBQA 4Z51A 4WOKA 4CKEA 4Q00A 1DAMA 5CM8B 2L19A 2JEOA 1M1NA 2ZS8A 4Y2UA 4Z9YA 3JVIA 4BNJA 3R9IA 5ARBA 4NOKA 3EPKA 1RBZA 3TNFA 1C9NA 1NNSA 2XMPA 3RBAA 4UHHA 3W2IA 4RHTA 5IKEA 1HT0A 4MGEA 1IN8A 3FWYA 3C1TA 3U3DA 2Z5FA 2AX4A 3ZJXA 1SEPA 2H92A 5IKPA 5LPNA 5JYFA 2C2ZA 3UMBA 1KEVA 1TE2A 2KW5A 3K05A 3WA7A 4I50B 2QRVB 4CTNA 4I99A 1ONSA 4JVOA 1Z0UA 1Q1AA 1M66A 4KFSA 2BBOA 3V8PA 1NBHA 3CX3A 1GZ3A 1I01A 1UP4A 3K1AB 4YO7A 3KTAA 1Y80A 2Q21A 3L92A 4GBMA 3D7LA 4BYGA 1XLUA 1CY8A 3USZA 4QPZA 4Q1FA 3IDOA 3R6DA 2ECQA 5AW9A 1L5NA 5J2TA 4C0KA 1TGYA 1YOBA 2MHCA 1KHHA 4C04A 4PLVA 1NC1A 3CLUC 3ZU3A 4BGIA 3PQVA 1DLJA 2BAGA 1XRJA 1TFUA 2WI8A 2GJ8A 3EIEA 4PSAA 3GBVA 3MRVA 3T5DA 1BHQ1 1POWA 2PLRA 3C3PA 5CAEB 2I1QA 4J2OA 3TQIA 3AJ8A 3X1YA 4UFPA 4CI9A 4M1TA 4Z4FA 1XLTC 4E2FA 1M0TA 2GBGA 3EA4A 3JZMA 2FPPA 2WUEA 4ZCPA 4KR7A 3AP3A 4ZIRB 3SZ3A 4YCMA 1Q19A 3GLFA 3TCXB 5J58A 4GBED 3NHBA 4HDKB 2OBXA 3V4PB 4AVYA 3U3OA 4KAJA 5I8WA 3DOIA 1VRVA 1F2VA 1XU4A 5AIAA 5ALZA 4N5HX 3UFXA 1MDFA 1OXXK 2ZBRA 4II3A 4KE6A 2H4JA 5TC4A 2I7CA 1EWTA 3AY7A 2ETVA 3SE7A 5JBQA 4BKOA 1OJ7A 1X8XA 4FFDA 2JK0A 1T3LA 4ZYZA 3RVPA 2I6FA 1JKFA 2L82A 5IAJA 1SK9A 1JE1A 1QK4A 3N8IA 5MDHA 1GNQA 1YQWA 2MSWA 5D5PA 4WKNA 5BUZA 4U5XA 3PC7A 5ITZB 1EK6A 4JJ8A 1RC8A 1EMDA 4XJSA 1KQGA 4FUQA 3K0CA 4PXYA 3SF8A 4JI5B 1B41A 1ZIYA 1JLMA 2PGXA 1BMFA 1EP1B 2TMDA 1DAGA 3C8HA 3ICOA 3QU5A 3R4CA 2OYRA 1K6MA 1YASA 3A4TA 3HM2A 3GGDA 1KWGA 1GPYA 2Q1UA 3FTCA 3G5LA 4B7AA 3EIOA 1MHMB 1I3NA 2ZPTX 5JATA 5FHQA 1V41E 2CJXA 4N3CA 4OHKA 4TT3D 3TDKA 3WMEA 5J2UA 2B3TA 4BO3A 1QKJA 3VPFA 2VBIA 4ZEWA 5BNIA 1HDIA 1TUBB 2GN4A 3DKPA 3M6FA 5F12A 4LQDA 4KQHA 3JATA 4U3JB 1HT1E 1U7TA 3D54D 2Y1FA 3LV8A 3V4SA 3R7AA 4IDPA 2FUG6 1TXGA 2REQB 4TS3A 5C3MA 2AFHA 2TS1A 4XFKA 4K6GA 4YQZA 1FOEB 3CO5A 2JLUA 1BWQA 1WCYA 3LX4A 3OQNA 4Q03A 2GPSA 3H2BA 3OE5A 1POXA 2F8SA 1JU3A 1BCSA 1NQWA 3ITKA 3K0AB 2NO9A 3QXSA 4MR8A 3T4UA 4GOOD 1YAJA 3TE7A 1ZNXA 3D8TA 3OJCA 4P1ZA 1JZSA 3OCUA 4R8LA 3UPTA 3HI6A 1Y1PA 3UXYA 1WJGA 2J3JA 3DLPX 4NEQA 4TVOA 1B16A 2ONCA 4W5TA 1HNWB 1UC9A 2MR6A 1E7QA 1H0RA 1ZVJA 3KJXA 3H5IA 4NF2A 4F84A 3IEIA 3KXIA 3RVSA 4C30A 3WYEA 1GG9A 2WSLA 1J90A 1U5AA 3QKRB 1E3JA 2IOYA 1VMIA 5C18A 4KH1A 5C1DA 4CR8A 3TD9A 3ABIA 5CT8A 4LSMA 5J9FA 1DEOA 3A9TA 5FAXA 5K6RA 4N7BA 2DPGA 5EZ6B 4NOLA 1I4OA 2W6JD 3QXCA 5TPZA 3UFBA 4H6WA 3STXA 5ESWA 3Q9UA 2AQIA 1DRVA 3GQBB 1RYMA 3UGKA 1NFRA 4EYKA 4Y2RA 4TMKA 4KWIA 5B2FA 2PJUA 3QBJA 1O4VA 2NQ2C 3RC9A 1WQ1R 2VT6A 1PL0A 4W5JA 4YBRA 2E7ZA 2C99A 4E03A 1W30A 1XE3A 4CMCA 1W0KA 2ONKA 5DWQA 4CN9A 1G6HA 2BN4A 1EPUA 3T7EA 5FOTA 4WA8A 4HX5A 1RACA 1T9BA 1XCJA 3RUHA 4AC9A 1GD1O 3G2JA 5G0TA 4MVJE 3DDOA 1M8JA 2KLHA 1J99A 3L77A 5HZMA 1GPKA 1YI0A 4OUDA 1XPOA 1JEQB 2AC7A 4BVHA 1QH8B 3AEKA 3KUCA 3M3HA 3KYIB 4B47A 3X1DA 4F46A 3LUFA 1XZ8A 4ZU6X 4Q6WA 4KP7A 3GD5A 2ZTUA 2PWAA 2Q6VA 3EP7B 4X95A 4RJKA 1BW9A 3RRFA 1YQXA 1P44A 2OUKA 3EXHB 3R77A 6CHYA 3ERCA 1Z6ZA 4NH4A 4CMIA 4QELA 4FXOA 2GN6A 2XUHA 3BRCA 3HYTA 3PQ5A 2PKYX 4KFCA 2HRCA 5JH7A 4HWOA 5DNWA 4HO1X 5CIWA 4F6LA 2AZ4A 5EL0A 3QGMA 4CDMA 1E0AA 5FBRB 1WHSB 2P7IA 3NYRA 1NW5A 5EXEA 5H81A 3AL0C 4YTEA 4A6EA 4HUQB 5AVOA 1U65A 2VWPA 5CA1A 3FZGA 1YQ9A 4AK1A 4IG9A 5GM2A 3GLKA 4P3XA 4R2IA 5I9TA 1T1GA 1QAMA 4ZT6A 1DARA 2GNPA 4FJ1A 2PD4A 4LBVA 2GBLA 4MHOA 5J2TF 1B8UA 3RTBA 4DCJA 4CXMA 1W36C 4RY0A 4PN7A 3CJRA 3DHEA 1WMEA 3QUCA 4FFSA 4QM6A 1C0LA 4MDHA 2B99A 1VRWA 4G4IA 4AZ0B 5GOTA 2OQRA 2QPTA 2OBNA 2XOKD 3AO0B 3WADA 1IEWA 2CVFA 2GEVA 1A76A 2CY0A 4PYRA 5AP9A 2AF4C 3X43A 1ZISA 4YQFA 3CR7A 1ISGA 3HN7A 5FKJA 3QIAA 4QBKA 1I3LA 1Y8QB 1MOPA 5CB4B 2LR0A 4OHFA 4CPDA 1KL7A 1Q1GA 3VR6H 1I1OA 2IDJA 3EOBI 5KNCH 5KHOC 2DMRA 3LWDA 4U2DA 5DXFA 4OK5A 3ROTA 4ARUA 3ZY5A 5K5EA 1P1FA 1ZC3A 3DAGA 2QJTA 5JE8A 5EWLB 3IT1A 5IYZB 2CNNA 1A5ZA 3GJ7A 3HY3A 4OXNA 4PEVA 1K86A 1OAOA 2D1YA 2N46A 2ZYTX 1TU0A 3BMXA 1VL0A 3NJ4A 4G3XA 4JJEA 3NIWA 4Z2YA 4RTQA 1Y82A 3B1WA 3MIIA 3K0BA 1UBLS 3WO0A 4E5VA 2QTBA 5T67A 4NBVA 2JAXA 2P40A 1KOLA 4HDKA 1Y7TA 3OLWA 4X6UA 1KIAA 4RM2A 4WXMA 5EAIA 3DC2A 2C3UA 3PQ4A 5EHGA 2HU7A 3AFGA 2FMUA 3FHOA 2VJKA 4GOMD 4QTXA 1TRHA 2YV2A 4DJ5X 3GUUA 2CKDA 2Y1XA 2AJTA 5EFOA 2BM0A 4JR0A 1ZC4A 4Y0NA 1YC2A 4BNVA 1ATZA 1PUIA 3BREA 3GVPA 1NXVA 2ZB7A 3PUIA 3R3ZA 1MC5A 2EJVA 2I03A 1SCQA 3RAEC 3HU1A 5H59A 3GDWA 2GLTA 2IODA 4RSRA 2RKOA 4MHTA 4ZDWA 2RFLA 4DA9A 4AZTA 1QYCA 4FT4A 1T3HA 3LQ1A 1Q12A 3TTUA 2FQWA 4DC9A 1W4BA 1WP9A 2QEQA 4XB1A 4U7TB 1ZHOA 2ZT6A 5TEWA 1V16A 3F2IA 2WDZA 2LE0A 3IIIA 3U3ZA 2QTGA 2VDPB 3CCFA 4PO1A 1II8A 2VN8A 3VSBA 1OYOA 4V39A 4ALMA 5KZMB 4DR7B 5L3QA 2SKEA 2WD9A 1R0YA 3CRVA 3D1VA 1XYGA 2WHQA 3BDVA 4IGFA 4P5PA 2ZCUA 4O89A 2EKQA 5DPMA 2P6UA 1UBMS 4BGDA 4H4CA 4PZLA 4H7IA 5AW0A 4K9LA 4L57A 3COZA 2D2EA 3A70A 3PFNA 1YI1A 3GZJA 4L8GA 5LQCA 2B2CA 2ZXEA 3DT6A 4QX6A 2ZJBA 3QWFA 1GR1A 4FTWA 4PONA 3TZQA 1E20A 1HYQA 5EJFA 1TO1E 2FNAA 4UD6A 1KZ6A 2ACKA 2IUYA 1PE0A 2R6GA 2ZYWX 4DQDA 4P2BA 1NSYA 1FYXA 1OZAA 3UY4A 4LF6B 4DAEA 2GPBA 1RXVA 1J1UA 1EZ1A 2L69A 3BFKA 4ALJA 3L8DA 4ZJUA 3UXHA 1B6SA 4JLOA 5LQDA 4MUKA 3I2KA 1GDTA 5EGNA 1P4SA 2EKPA 2WKPA 5HOQA 1H5NA 2JI7A 3WSTA 4DSTA 4KRYA 3KQUA 2C9OA 1HYGA 2IHTA 2X4GA 5E1MA 3GMTA 1FFDA 2IPOA 3AFHA 2E5LB 4AKIA 1CB7A 2R4UA 3V2GA 2VTVA 2Y76A 1OFTA 1NHWA 1YZUA 1XDUA 3OD1A 4GGMX 4OXQA 1ODKA 3TSCA 3V8NA 3DEYX 4HKTA 2WE7A 4PBTA 1OKKA 2BFBA 4BUJA 5FL7A 3PEVA 3P9SA 3V4VB 3T99A 3ZHOA 4UPEA 1EUQA 1QONA 3GH1A 3H9QA 3DTYA 2YYAA 1AA9A 1J8YF 2CMHA 4O29A 2ILTA 4P6VF 4YDSA 2GFHA 2HTFA 3AC0A 4ALNA 4DMMA 1EFCA 5KVCA 5L3QB 4RTOA 1A9SA 4B2YA 1TYCA 2HO4A 2VJAA 1B42A 1RMQA 3KKEA 4MYDA 4OLFA 4JYZA 5EWMA 1L9KA 3KEFA 1PQUA 2OZPA 3ZIAD 4CEHA 4R1UA 5KMGB 5TVKA 2QTCA 2XNKA 3OIVA 1UKVY 3I6ZA 4K05A 2LIVA 4ZOCA 3UT5B 1E61A 3W4KA 4XLZA 1JIUA 1OAOC 1F20A 1RM3A 3ZWCA 4RJTA 5ALDA 5BN4A 1JVNA 3SIWA 1E3MA 3QFFA 3VOSA 4WXYB 3ZXSA 3NUZA 5I4KA 3MUOA 3WL6A 4GVLA 1NUUA 1V1MB 1JG3A 2O5RA 3FBGA 2D3WA 2GTHA 4O2LA 5LDHA 1GPJA 4ZCMA 2V74B 2EWMA 4HDQB 4L2IB 2Q5CA 3O2QB 1U7UA 4YIHA 5T6MA 1MZVA 4D3SA 4IICA 1R88A 1U5BA 2AMJA 3LPLA 2PBLA 4XYMA 5AOAA 2JFOA 2JD1A 5EP4A 3G7UA 3PQFA 3K73O 2W9XA 5CT5A 1AIPA 5JWHA 5C34B 1E58A 4JV5B 3WLMA 3GNLA 4NBTA 3BK7A 4KUHA 1OI7A 3OZVA 4D0RA 1JJBA 3B82A 4Q4HB 3QF4A 2B1RA 3EW7A 2I55A 3CKLA 2IKSA 3QG1A 4BLRA 4O5OA 3ZXUB 4EFKA 2CLSA 4C9BA 2ZRNA 1E3QA 1UMDA 2RB4A 3KDPA 2F3UA 5K45A 3SXJA 4H0FA 1U2DA 4YROA 3OO1A 1TZMA 1UQUA 3LFHA 2QDKA 4IXNA 1FUUA 1HQCA 2WVHA 2E1RA 1JHXA 3EUAA 2VCHA 4RO0A 3S2FA 1KAOA 4Z7NB 3O75A 5E0KB 2VSXA 1LBHA 2ZJ0A 2QTNA 3OCXA 2BH2A 4MYTA 1XJCA 1LS1A 4ZDKA 1X7XA 3ASUA 4LJ4A 3ECSA 4GMHA 2O54A 2XF2A 4KE9A 4K86A 5GZ1A 2AOTA 3FCUB 3HCEA 2OV8A 1D8AA 3LIIA 2VWGA 3PQEA 1T8RA 4FYXA 3OU7A 4A6PA 2O3RA 3I2YX 4TGLA 3DYVA 3USES 2CUTA 3BD7A 4HNGA 3SQLA 2VYVA 1ILEA 2WK1A 4EO9A 4TQGA 5AVVA 3QFSA 1NMYA 5FWYB 4BX9A 4RAOA 4DNOA 5KNCA 1LZLA 2QP4A 4N1AA 4QARA 5HA5A 1XCPA 1OA0A 4R1OA 5COQA 3UV7A 5L3SA 2JW5A 3QEBZ 3IWDB 1A7AA 3P2JA 1JJIA 2YXDA 4A8PA 4CFZA 4DUPA 2BIFA 3V8BA 4PSUA 5JJCA 5KYTA 4XDYA 4BE7B 5M7EA 1FFGA 3B78A 4JUFA 4YMIA 3AHGA 3G7NA 4JC0A 3VPHA 4C20A 4DRXB 5HFNA 5JD5A 4CKBA 3EXHA 5FO1A 3B52X 4EG1A 1GA1A 1OLUB 2X3FA 1YFKA 1MB2A 3DW3X 3NFYA 1E62A 3HYCA 1Z4JA 4OJNA 3QTBA 1LDBA 5GVRA 1NQVA 3EEIA 3LPAA 1UMDB 5E7IA 2J6BA 2ZDQA 3REFA 2H1VA 1CBUA 5KDLA 3HWX1 1S02A 4KODA 1HMYA 2ODNA 4J4TA 3T0FA 3UJ7A 2XUKA 5EP2A 2H8KA 5BUSA 2XWQA 4FBMA 3ZX4A 4DDKA 4GMFA 8MHTA 3KQWA 3U9SA 4BNXA 4YMWA 3OZTA 3WK4A 4B5KA 2ZUDA 2VHCA 3HC7A 3WWDA 5K6TA 2O2IA 4R2JA 1CS0A 3G2LA 1WEKA 3FUXA 2WEKA 4B7CA 3IE1A 2FZ5A 2WZCA 5SY4A 2NO5A 4Z4CA 1EGAA 3DVQX 1C8LA 1IVYA 3LHKA 3TL2A 3RC8A 4M99A 1NBAA 2O8BA 3L7CA 4B09A 1I36A 4UCFA 2HPVA 4UCWA 2ZSKA 2CE2X 3PFWO 3HB7A 3M4NA 3FNHA 4HXEB 5CW2A 5JDIC 1JU9A 4J7CA 2V45A 4OM8A 1P72A 1S3GA 4M22A 4MUFA 4WFQA 4MHSA 5K6AA 2EP8A 3HDHA 2EZTA 3NG1A 1L5LA 3F71A 3IR5A 4E6PA 4L8YA 4E2YA 4EENA 5JMTA 1T13A 2OKCA 4MARA 5I6DA 1NOKA 3ZHYA 2GILA 1B14A 4HG2A 5HBGA 2BJVA 1M8PA 2Z5GA 1WTCA 3F98A 4BAGA 4AJ1A 3OY7A 2GBLC 4JX8A 5A4IS 1I7QB 1FFSA 1VE6A 4EL0A 4LJSA 3GLIB 2D7JA 1CE8A 1Z29A 2M32A 3WLJA 1J5EB 3QUTA 4J2TA 2UYGA 4XE5A 1FX1A 2WPNA 3SXPA 2QQFA 3WDKA 1V3UA 5JCOA 1KDVA 1IBCA 4P0PB 1RM0A 1GIAA 4OAPA 4BKUA 1RCFA 2FH5B 4QRHA 5DLEA 3D2AA 1Q91A 5F7ZA 2BGJA 2F67A 2DFLA 3AI7A 2ZRMA 3HXPA 1LW7A 3EGWA 5KOJA 2DR2A 1YK0A 3OZAA 2VF8A 2QL5A 2ZJFA 1V7ZA 3UHPA 2IQ5A 4F1KA 2P90A 2GCGA 2NPOA 4B3BA 2O8CB 4EY4A 3WBBA 1GTVA 1GZSA 4I1OA 3L1IA 1BQ3A 4O2RA 2O4UX 3MT8A 4V38A 4ZVMA 121PA 1GDHA 1UMKA 2YC4C 3EGVA 5A06A 4JB0A 3NFRA 1W6RA 2IP4A 3WYGA 3TLEA 2G40A 4PWYA 3EPPA 4M0FA 3BFVA 3RB8A 1PR3A 1QVZA 2W93A 4HGZA 4OO3A 4ZFNA 2VJDA 1I32A 2ECKA 5LYJA 3HJNA 3CF2A 3R0IA 1H8ED 3QEMB 3TZHA 1O94C 3ZU5A 1RBMA 3OP1A