1H6AA

Reduced precursor form of glucose-fructose oxidoreductase from zymomonas mobilis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
381
structure length
381
Chain Sequence
b'ATLPAGASQVPTTPAGRPMPYAIRPMPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
publication title Crystal Structures of the Precursor Form of Glucose-Fructose Oxidoreductase from Zymomonas Mobilis and its Complexes with Bound Ligands(,)
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Protein translocation
total genus 129
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2001-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h6aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h6aA01
1DHTA 3BA1A 4H3VA 5U1PA 5G4KB 5IDXA 3L77A 1C1XB 5AXBA 5KKAA 4HNGA 1NQTA 3EC7A 4N18A 3HN7A 3TF5A 3GVPA 3OP4A 3I9LA 4HP8A 2CZCA 2ZQZA 1DC4A 2W98A 4IGEA 4INAA 4Y9DA 2DQ4A 3EAGA 3DAPA 1EVZA 9LDBA 1O5IA 4AL4A 3F46A 4ITUA 3ROQA 4G81A 3NT4A 1I3LA 2WDZA 5FF9A 1DBVO 3JQ6A 1Y5RA 2ZATA 1ENZA 3U4HA 1UXIA 4L73A 4GX5A 2XPCA 1WP4A 2O50A 1PGJA 4FIZA 2HJRA 2NVWA 2GR9A 4I08A 5COAA 4WKGA 2X58A 5GZ6A 3I5MA 3K2EA 3KYDB 3MWEB 2V6GA 1OZAA 1Y81A 5KKCA 2POQX 3WB9A 2HMUA 3GN2A 3OF2A 5L7YA 1U5AA 1X7HA 2O3SA 3U4IA 5JMPA 4Y8VA 4OIMA 6LDHA 4LISA 1B0AA 1EE2A 3LZ6A 4KQWA 2O7QA 4BO7A 4BO3A 4LCJA 5EERA 1BXGA 1JVSA 1PGQA 4W7IA 4MVJF 4Q3EA 5T67A 5U9CA 2IEDA 5KVSA 1ADBA 2ZK7A 4YAGA 4CLHA 3ASVA 1I10A 2EWMA 3ZHZA 5KCZA 1LC3A 2G0TA 3P5SA 3PYMA 1GYRA 1ZVMA 1D3AA 3ON5A 4Y6SA 3MJCA 2J3JA 4OQZA 4B4OA 1LEHA 5IZCA 1X7DA 2W2KA 1XKQA 4CMGA 4WUVA 2J3KA 4DMMA 4FJ1A 4BGVA 3H9JA 2DBRA 1PZHA 1YB1A 2EF1A 1JTVA 3SLKA 1KETA 1UXHA 1I3KA 3I9OA 4JIGA 1GQQA 3DOCA 3DBLA 1HYHA 2H1SA 2B4RO 1QYDA 4IIUA 5DZSA 1TT5B 2WD7A 3MJVA 1VJTA 2EERA 3V2GA 3WFIA 2VRBA 2OMEA 2QRKA 3AK4A 3KHUA 4GL4A 3H5NA 3EVTA 1R4NB 3HB5X 3M1AA 4LMPA 4CM5A 1QORA 3F5QA 2B4QA 3A4VA 1VRWA 1A27A 1X0VA 4OGWA 4MIYA 2OGUA 5CEJA 4GSKA 3KSUA 1IHXA 1M2WA 4EEZA 2BI8A 1Y9EA 4YJDA 1DRVA 1DIBA 1HDOA 2OP1A 4L75A 5DULA 3V8BA 1UP6A 1Q0LA 2VYND 1A72A 1LSUA 3UCFA 2GN9A 2GUGA 5JLAA 3JD2A 2OHXA 4UEKA 4DQUA 1PL6A 2XXBA 3ZNNA 5THQA 3QV1A 1B8UA 3OQBA 3UN1A 3ST7A 5K0ZA 1DLIA 2B69A 4RF4A 3C7AA 4BIIA 4E5NA 4ZGWA 5DDIP 4C7KA 2IODA 1U28A 1KEWA 3E8XA 4ZICA 1HDZA 4R9SA 1JN0A 2C20A 2YY7A 3OQ6A 2WTBA 4FDAA 1DC5A 2RH4A 4G2NA 3L6EA 3RCBA 2I67A 3COSA 5T64A 4QUKA 4E2WA 4KP7A 4BKRA 4ALMA 1G0NA 3ZWMA 3TZHA 2D4AA 2ZQYA 4N5MA 3CE6A 3HUDA 4UULA 5CFZA 4O1MA 1NFFA 5T8KA 2VTEA 2HUNA 4ND4A 3LDHA 3ZGYA 5MGBA 5DN9A 1LX6A 2EV9A 3JQ9A 4J4BA 2GZ2A 5JW6A 5LCXA 4WOJA 3K2BA 2QW8A 2Y1EA 2YUTA 2Z1NA 3H9QA 1EBFA 2JFFA 4YJGB 3PQEA 2PH5A 3GHHA 4DPMA 4DA9A 4FD3A 4YTEA 1HE2A 3ZW8A 4AJLA 3RUFA 2Y68A 1AXEA 4Y6PA 1MLDA 1MP0A 3G79A 1WPQA 3F1LA 3HWRA 4U6QA 4BQRA 4RPKA 1NX6A 4ZQEA 1HE3A 2I99A 3KLPX 4J43A 1GPDG 1HL3A 3U62A 2WSBA 3MTGA 1JLLA 1WNTA 3NRCA 3AW9A 5I7EA 1OBFO 1U9JA 2NTJA 3GG2A 3IUPA 4DLBA 5G0WA 4JLWA 2Y1OA 4M87A 4CPDA 4WGGA 1KERA 5C3MA 2AE2A 2W90A 4IXWA 5IN5A 1E3WB 4BVAA 5I7FA 4J1QA 1JVBA 4FFOA 3VVCA 3DFZA 4DRYA 4ZQBA 1E3JA 3D3WB 2DTDA 1LSJA 4BV8A 1U8XX 4XX0A 5IJZA 1ZUD1 2C07A 3JTMA 1DSSG 1R37A 1HZZA 1VJ1A 2B5WA 3K5PA 3H5RA 5JE8A 3H4VA 1VKNA 4Z0TA 4Z9YA 1KEUA 2X8LA 2HLPA 4BGIA 3PHIA 5JS6A 5AQ1A 5DOVA 4BNIA 4BO4A 4Z6KA 5C37A 2IDZA 4BMSA 1IOLA 1ISMA 4I1IA 4NJMA 3GF4A 1ISHA 2OP0A 2AW5A 1H2BA 2Q50A 1B26A 1ENYA 1LSSA 2DBZA 3GFBA 1YB4A 1ZMOA 4LSMA 5IFLA 3L9WA 1X7GA 1LLUA 3ZWWA 2O2YA 2HMWA 1EVJA 3NDRA 3R0IA 4GVLA 3GG9A 3T7EA 4NMHA 4Z0HO 1YBAA 4EBFA 3DHEA 2B5VA 3ABIA 3H2ZA 3QRWA 4OOFA 5G4KA 4GAEA 3DMTC 1U3TA 3Q9NA 4JN6B 1C1XA 3KRTA 4ND5A 3ZV6A 1F8GA 2AEFA 2EW8A 3DDNA 3ZW9A 3RVDA 2PTGA 4DQXA 4TRNA 1I24A 1M6HA 3KYCA 1OI7A 1VL6A 3F47A 1K5HA 3C1TA 1MA0A 3UCXA 4IMPA 2QYSA 1F12A 4D45A 4OO3A 2QRJA 3GLQA 4RF3A 4MVJA 1CJCA 3H8VA 1WZIA 1ONPA 1SCUA 4GH5A 3O8QB 4CL3A 1R12A 3JQAB 4URFA 3S55A 3QVXA 2VWPA 3GPIA 1UXGA 3LC1O 5A3VA 4J7XA 3DMYA 3GGPA 4E2ZA 4A10A 2AXQA 1QLJA 4XDZA 1CETA 2CMDA 4GI2A 4CR8A 3OA0A 3KYDA 1JAYA 4GGPA 3ZWXA 2ZCVA 2X86A 3CMMA 2AEMA 1J6UA 4PLWA 4DUPA 1FXSA 1GEEA 2VRCD 5A04A 5L7WA 1NQOA 3EUWA 1QRRA 4IJUA 4YXFA 5A9RA 2O3UA 3MWDB 3GDGA 5EN4A 1U2DA 4WASA 2HAEA 1ZNQO 1ORRA 3DO5A 3RC1A 2QQ5A 3WBBA 3H7AA 4MP6A 2VHZA 2LDBA 4K26A 4XCVA 1LC0A 1PJSA 1XELA 4XR4A 3U09A 3VTFA 3DZHA 4S3MA 1T2AA 3SJUA 3K8ZA 4P38A 2FSVA 1SC6A 5HRUA 4XA8A 1S7CA 4M54A 4JGBA 4JJFA 4NG5A 1NPDA 4XQCA 4ZVVA 1XU9A 4E0BA 2J5RA 3NTQA 1EQ2A 5I9MA 2Y1FA 5TS3A 4FGSA 2IXAA 3NAQA 4D46A 1E3IA 1ONOA 4IGFA 2GRAA 2V6BA 4J9UE 3RFXA 4E5KA 2DLDA 1NBOA 2WYUA 1BVUA 1EUDA 2EP7A 2J3IA 3F9IA 4QQRA 5ENVA 3ZV3A 1JKFA 5GMOA 3DR3A 3WGZA 5AXDA 1YOVB 1YVEI 3SLGA 5ICSA 3MJTA 1YL6A 1HDCA 1IE3A 1V3UA 3ITKA 3JCZA 1IUKA 4PLGA 3FTPA 3JYNA 1C3VA 4YBZA 1I3MA 3TPCA 3NDJA 4D7AA 4O5OA 1RWBA 4EUFA 1UXKA 1VC2A 4R3NA 4DREA 1O89A 3VH1A 1HE4A 4XYEA 3BIOA 3HDQA 1JU9A 3PVZA 3PZBA 2IYOA 4YJHB 2OBNA 2YV3A 2PGDA 3ADPA 5ER6A 3GY0A 4HFJA 4J7UA 1XIVA 4R16A 3WYCA 1BW9B 2Z95A 3LC7O 2VN8A 4IDAA 5BT9A 1DHRA 4DMLA 5JNLA 4WK6A 1I5RA 3HADA 1NPYA 5COBA 4DPKA 3CINA 1UP7A 3WLFA 4HXYA 4CM4B 3I9JA 3WS7A 3GNQA 2P9EA 4Q3CA 2VYVD 1GZ3A 2VWGA 2DAPA 2GASA 2IZ0A 4J0FA 1M76A 1F06A 2NLOA 4BV9A 2CF6A 3CUKA 4CM9D 4YWJA 1HZJA 3FI9A 3RBVA 4LCEA 1WW8A 3TL2A 1LRLA 1V3VA 3PHHA 2Y1CA 4HBGA 1E7SA 2EIHA 5HTOA 2VNSA 1TA4A 1PGOA 4WLEA 3L6OO 1O94A 2NTNA 2J8ZA 4XYGA 4ALLA 3DZJA 3LT1A 4DIBA 1ZFNA 2B4TO 2HU2A 1YH3A 4IQ8A 1W73A 3INRA 1Q7GA 3QQPA 2VZ0A 3MJEA 3RFVA 4WLOA 2BELA 4E4YA 4WJZA 3OJOA 5EQDA 5JAQA 4NBTA 4YRAA 3DFUA 5ADHA 5IDQA 3QVWA 4OXNA 3NJ4A 4OAQA 3X2FA 5L95A 1S6YA 2G5CA 3OSUA 2QG4A 1FDVA 3EMKA 3GAFA 2ZYGA 4TVOA 3AFNA 4YT5A 4CLXA 3TFOA 2JAHA 3B1JA 2Z5LA 4ALJA 4B4WA 2WJPA 1E3EA 4WLFA 4B7CA 1PR3A 3QP9A 3C8MA 1KY5A 1VI2A 1WDKA 5H83A 4MVJI 1GL3A 4PLPA 4MPDA 2VQ3A 3OJFA 5TJ9A 1N1EA 5M6DA 3KV3O 2JD2A 1Z7BA 1PWZA 3RROA 1U8FO 2HK8A 4OSPA 2GYYA 3QWBA 5KVVA 1N8KA 2XOXA 1KVTA 5F21A 3PJGA 5IDYA 4J2OA 3SX2A 4J4TA 4AFNA 3RUEA 4JJGA 1Z45A 1KBZA 4AJHA 2GDZA 1IULA 4KDFA 1C0IA 1GCOA 2CF5A 2AE1A 3ETDA 3AM4A 3WBFA 2EJWA 3GR6A 4IQ0A 4ROSA 3L9XA 4GWGA 4BO0A 1RYEA 3OECA 1LQTA 2BKAA 1ZO8A 1Y8RB 2WMDA 3INTA 3QWIA 4FR5A 2YJZA 4QECA 1DJQA 2OFPA 4Z3DA 1BWSA 1Y9AA 4XKJA 4YAIA 4B79A 2DBVO 2JJYA 4K9DA 4M55A 4LVUA 2G82A 2JD0A 4L0QA 1PGPA 4RL6A 4BNKA 3D3WA 3K9QO 1DC3A 3BMQB 2X7HA 1EK5A 3ICPA 1O0SA 3ZWCA 4NU6A 1GADO 4IJWA 3SC6A 3PPIA 1P1JA 1P31A 3BZUA 5DP1A 5TIIA 1P0CA 3QJ5A 1PTJA 4Q3NA 2GN6A 3I23A 4BNUA 2P91A 1XSEA 1A9YA 1IY8A 3VPXA 4XD2A 3WLEA 5BNIA 2QX7A 3WIDA 4AJ2A 5KJCA 3OJ0A 3VDRA 4NBRA 4EJ0A 4CQMD 4I9NA 1G0OA 3VZQA 1H6CA 4N54A 1LLCA 1UH5A 4MINA 1XQ1A 3ZV5A 3A1NA 4YQZA 2X0JA 3PHGA 1K6JA 3SXPA 2Y0DA 4AVYA 1PJTA 3IIEA 2GLXA 3SJ7A 3PWSA 3PRJA 1SZJG 2EP5A 3UCEA 3QLJA 4OOEA 2P2SA 1E7MA 5KJEA 5T73A 1MV8A 1O8CA 2PH3A 1HLPA 4B4UA 2H6EA 3LT4A 4BS9A 4CM8B 4WE3A 3TSCA 3H3JA 4A7PA 1A4UA 1XG5A 4BGEA 1H6BA 3RC2A 4HFNA 3O8QA 3PI7A 4OQYA 1LNQA 4P4LA 2YFHA 1PSDA 3B6ZA 4WCFB 1R4MB 2C5AA 4XIYA 4XYBA 2OL4A 2JHGA 4NFYA 3MJSA 1ZXBA 3GRPA 2AQ8A 4DQVA 4FBGA 4YT2A 4HFMA 3G0OA 3GN1A 4NBUA 4A2CA 2Y99A 4Z9XA 2E49A 2WEKA 1GUZA 1Y1PA 2DT5A 2YV1A 4U7WA 1GZ4A 4Y6RA 2Q3EA 4IY1A 1H6DA 4RVUA 3W8EA 2P68A 1PQUA 4KUHA 4J0EA 3HN2A 3VOSA 5TGDA 3UUWA 3DEYX 1SO8A 4EI2A 3ZV4A 4IS2A 4BNFA 1BMDA 1TB4A 2Y1DA 3WQQA 2AQKA 5LDHA 1V6AA 3GUCA 4HADA 5T8KC 4UUOA 1R15A 3T4EA 2YQ4A 4CQMB 3AUAA 3MZ0A 3GFGA 1UZNA 5HWSA 5HS6A 4J7CA 3KOUA 4IZIA 1Z7EA 1GQYA 3EGOA 3T4XA 4BO5A 5TQVA 4IQGA 5KJ1A 5BNTA 3ZWOA 1TI7A 4HY3A 4LRTB 1HDGO 4Z3KA 1B3RA 2ZB8A 4J3FA 1B14A 3E18A 1NYTA 4E6PA 5F1KA 1YQGA 4IIVA 4JBGA 4QFDA 2ZYDA 3UGKA 4CV3A 3GA0A 2Q2QA 3OMLA 3GAZA 2PK3A 3D0OA 5ICMA 3TZQA 2Y0CA 3CZRA 4R51A 5TT0A 3PJEA 3OEYA 4Q9NA 3AM5A 4WNCA 1OAAA 1T24A 3F1KA 3D1LA 1I2ZA 3JD4A 4RLSA 1NR1A 4AICA 4PFJA 5KVQA 4WNIA 4UVGA 3ENNA 1P1IA 4NK5A 3TZ6A 4MIOA 3FCOA 1NFQA 1DFGA 2GCGA 3CTMA 3FWZA 1I2BA 1LI4A 3JYOA 1X1EA 3X2EA 3NTOA 3G3EA 5TLSA 5TT1A 3Q2KA 2YHIA 3VHRA 4DBVO 5K9ZA 2NNLD 5F1OA 2FPGA 3GGOA 3H6KA 3S2FA 1Z73A 1EQUA 1I2CA 2C29D 4FOOA 1LRKA 5DCWA 1DC6A 2HMVA 4ZQHA 3R3SA 2VHXA 2V65A 1KS9A 2AHRA 3ZU5A 4CM4A 4BO6A 2BGLA 1Q1NA 4DLAA 5JO0A 4FFLA 4FB5A 4JNKA 5L4SA 3MJ4A 4M86A 1YL5A 1GFSA 2EEZA 3I4CA 4LW8A 4RJTA 4PLTA 2WD8A 4QTZA 4CM7A 4UVDA 1BDBA 2BFPA 3PK0A 3BMNA 3HB4X 3VKUA 3A28A 1EBUA 1W4ZA 5BSGA 3PTZA 1YJ8A 5IAAA 4FSHA 4QO7A 1BSVA 1E3SA 2OBYA 2JKVA 5TJHA 4PG5A 4CV1A 3G17A 3CIFA 3TZCA 5ILOA 2OXIA 2ZTVA 4YDRA 1ADGA 4YPOA 2XAAA 5H81A 1JWAB 4NPCA 4J91A 3WOHA 4IJKA 4O59O 2FZWA 3AM3A 5AVOA 5A9TA 4CLRA 1HDXA 3JQDA 3ZWPA 1OOEA 3ZCXA 2C7GA 3IMFA 1U3WA 3E1KA 3BTSA 4EYEA 1E1NA 4WLNA 1EE9A 1DB3A 5CPFA 1PJ3A 2JCYA 1ZK4A 4R1SA 3RUHA 5H82A 4BKQA 4PCVA 3I52A 4IUYA 2R6JA 1UUFA 3WTBA 3VPHA 3D5QA 1B2LA 5JDIA 4PVCA 3F4LA 3KSDO 1UZLA 4Y67A 1JQBA 1Z82A 4KOAA 5JYFA 1VLLA 3QHAA 2DFDA 5IZ4A 4ESOA 4BNJA 1B15A 2R2GA 2YFQA 3PDUA 2ZCUA 4XR9A 3BMOB 5A05A 5JDCA 3DOOA 2D0IA 4LVCA 3M2TA 4R41A 4FC6A 2PY6A 1YJQA 4UVHA 1NASA 2GN4A 5A9SA 1SEVA 1H9BA 1ZK3A 3WIEA 1U3VA 2GF2A 4L4SA 1ENOA 3FWNA 4X54A 1P45A 4ZU3A 4CV0A 4DXHA 1T2EA 2HDHA 4AJKA 3U4CA 1A9ZA 1PQPA 1WLYA 3WJ7A 5TX7A 4GPD1 1OFGA 3WSWA 5JYEA 1ISGA 1LXCA 3ZHXA 3H5AA 4BNWA 3K73O 3LYLA 5L51A 3V5NA 4RVSA 1T1SA 1ZW1A 4RPGA 1MC5A 2GPTA 1FDUA 4KTVE 3DOJA 5IN4A 2ILTA 3CSDA 2QYTA 3LT2A 2P9GA 4NIMA 1PIWA 2PGLA 4CMEC 3NT2A 4D43A 2GZ3A 3B70A 4L76A 4A03A 1A7KA 3LF1A 3OEWA 3ZWNA 2CVQA 2BFAA 1B16A 2HK9A 2V7PA 1JA9A 1P44A 1EVYA 3L07A 1HLDA 3RBXA 1YS4A 4J2HA 4JROA 2RHRA 3JQ7A 4PLYA 3U5TA 3WGIA 1NP3A 3W6ZA 2D3TA 1X1TA 4TSKA 1D7OA 2CVZA 1HSZA 3BHJA 1V3TA 3NEPX 3JQEA 4FFMA 4YJFB 5LDGA 8ADHA 5IXYA 1W8DA 2F00A 1RKXA 4AJOA 1E6WA 4TZKA 1DXYA 1NTOA 1UR5A 1GEGA 3RIHA 4J90A 1FDSA 3ADOA 3PIDA 3QE3A 4CM8A 3I9KA 4OMUA 3ROMA 1PL8A 4GX0A 3DHYA 3OETA 4E30A 4EJ6A 4OKIA 2VNAA 4E21A 2FZEA 4GX1A 2EG9A 5T57A 1YDEA 4E31A 5L40A 1OC2A 3FSRA 2FOIA 4WCFA 4N5NA 3EZYA 3JQAD 5IDWA 4FFNA 1C14A 3W6UA 3W8FA 5JY6A 3FNFA 4E13A 3QIVA 4GMFA 1MXHA 5I7SA 1D8AA 1XEAA 4L8VA 5BSEA 4J1TA 4FFPA 4RPJA 2X5KO 4CMIB 2RHCA 3ASUA 5J9GA 2OOSA 4O63O 1SB8A 3S1LA 3KLMX 3PYXA 1NQ5A 1PEDA 5DF1A 4BB5A 3U9LA 2D2IA 4AJ1A 2I76A 1I8TA 1QLHA 5B4UA 3ULKA 4EDFA 1NVGA 3KETA 1BGVA 3JQ8A 2FY8A 2FWMX 2YV2A 4LGVA 1H5QA 3WYBA 4NBWA 4AJJA 2O3RA 4ZRNA 3P2YA 3B1FA 4JQCA 1CYDA 3U4DA 2HCTA 5JCJD 3STHA 4TQGA 4YCAA 3TOXA 3LVFO 3DAGA 1PZFA 2CDAA 1CDOA 1N9GB 2WM3A 4Y98A 2B37A 4UVIA 3UAGA 1ZKMA 2B0JA 4R54A 4Z0PA 4TWRA 2BGMA 3GQVA 4D79A 3PYLA 1GQ2A 3CPSA 1YQDA 2P9CA 4ND1A 5ILGA 5B4TA 1ARZA 1P1FA 3FRJA 9LDTA 5ITWA 3VTZA 2YDYA 5F5LA 1P1HA 1Y6JA 1GYQA 3FF4A 1E0DA 3AOGA 3EZLA 1ZCJA 4I9UA 4M49A 3JYLA 4D41A 4NU5A 5L9AA 1CRWG 3HNPA 1D1SA 2RBEA 2ZJ1A 1N2SA 1B8PA 3GMDA 2VWHA 5JMWA 4KDEA 3A9WA 1R0SA 1X14A 5EINA 4M8SA 2NU7A 1Y5MA 3ENKA 4LK3A 4MOWA 4NZ9A 1HXHA 3LLVA 3GUYA 4ZN6A 2AQHA 3JQBC 3BHIA 2R00A 3C1AA 1EVIA 1E7YA 1LBEA 1ZSYA 2X9NA 4KMSA 4RQUA 4JX8A 2JAPA 5CP8A 3E9QA 3FPLA 5TSDA 3EDMA 2DC1A 3BMCB 2B83A 2J3HA 4ND2A 4RLHA 3WQSB 3GZNB 3MOGA 3OFSA 1ISIA 4XGIA 1KVUA 1DFIA 3WWYA 1AGNA 4IDEA 4WOKA 5DNAA 1A7AA 3QWAA 2CY0A 1NFRA 2PKQP 2VOJA 1OC4A 1D1TA 5JC1A 2X9VA 3AY3A 3RWBA 1T2DA 3C1OA 4A5OA 1NHGA 4RGBA 2PFGA 4ILKA 3DHNA 5KOIA 2EGHA 2VUTA 4CLDA 4BO2A 4B3JA 1P77A 1VL8A 1PZEA 4D42A 3ETEA 3E5MA 1H0KA 3VPSA 1E5LA 1Z74A 1UAGA 2O3TA 3S2EA 2J5KA 4PN3A 1AN9A 5CAEA 1LLDA 3DZBA 3BXXA 4UREA 1HEUA 1ONNA 4BHTA 3UICA 2E6UX 1B3BA 1D4FA 3IP1A 3R6DA 1RM0A 4RVGA 3WGGA 3WQRA 3GDOA 3SVTA 4BNLA 5C7IO 2G1UA 3PIIA 3TFQA 1V35A 2TMDA 1LDMA 4NH4A 3DWFA 1LLQA 2Y0EA 2FMUA 1KVRA 4UUNA 1HETA 3QW2A 4A26A 3U0BA 3QVOA 3AU8A 4YR9A 1LUAA 4CMEA 1TT5A 4MKRA 1YBVA 4CM1A 3I4FA 2PZKA 4LSWA 4ZJUA 1A71A 4L74A 4NNJA 2PWZA 2NU9A 1E7RA 2IE0A 3DBHB 3NDIA 4F3YA 4EITA 1C1DB 4RF5A 5THKA 1R4NA 1BVRA 4H16A 3BTVA 2E48A 4K28A 1OMOA 4Q3AA 1K3TA 3LSYA 4RQTA 4OJNA 4W9NA 4YQYA 1H6AA 2X6TA 4CMCA 1IPFA 1RJWA 3FD8A 2H5LA 5U4QA 3DZKA 4NR0A 3OHSX 1N7HA 3D4OA 1NAHA 3ROKA 1E3LA 1MFZA 4B7XA 1U7TA 1PU2A 4PG8A 4NFHA 4BNZA 3AOEC 3PJDA 4KWHA 1PGNA 4CM3A 3PEFA 1X15A 4HFRA 3N7UA 4XYMA 1IZ0A 2YDXA 1Q7CA 3K92A 1ENPA 1KIFA 4BNVA 3OIGA 2C59A 1XCBA 2A92A 3QVTA 3PP8A 2IEBA 2QZZA 1BHSA 1LSOA 4I5GA 1UDAA 3KB6A 3AUTA 1ML3A 1TXGA 3AUSA 1ADFA 4EZBA 3F4BA 5C7OO 5CG1A 3I6IA 3QWHA 2BRUA 2C7VA 3VH3A 5ITVA 5CDGA 4B3HA 1JKIA 1JAXA 1WMAA 1VL0A 3IJPA 2ZIZA 2JD1A 4DIOA 1VE9A 2VT3A 1DIHA 5DP2A 4PIVA 1WWKA 3OICA 4MVJM 2WWRA 3TOZA 4E2XA 1BXGB 2ZKLA 4FC7A 4PG4A 4IPTA 4BGUA 4DYVA 1NR7A 3I1JA 5EL0A 1CEQA 2FPPA 1LDNA 4XIJA 3ZI0A 3DL2A 2DPGA 3HJAA 4QXMA 4MJLA 2H63A 4TKMA 5CG2A 5IXSA 1UXJA 4YJGA 3NUGA 2WYVA 4CR7A 3FR8A 4YB8A 3KZVA 2JFGA 2DU8A 4BNTA 1NVMB 1MG0A 2W2KB 4UUPA 4ZD6A 3GT0A 3RKUA 1ZH8A 3SC4A 3I3OA 1PS9A 1IB6A 1PJCA 4CJXA 5JY1A 1AXGA 2Q1SA 3OH8A 5EESA 4QFCA 4DC1A 2GSDA 3GEMA 3N58A 3RUAA 4DGSA 4PRKA 1JKJA 4PLVA 1NAIA 1WMBA 3DBLB 3WSVA 1YWGO 2VYNA 1ULSA 5L45A 2V6MA 3HFSA 4P22A 3VZSA 2X9GA 3D4PA 4L4RA 5EMHA 1K89A 3GVIA 1F14A 5A1TA 8LDHA 1ZXLA 2WYWA 1XYGA 1ZJYA 2Q1UA 3IAHA 2Q1WA 3V1YA 1E3WA 1Z6ZA 4E2YA 2D59A 4KUEA 2B36A 3JQBA 1PWXA 2HRBA 1E7QA 4MP8A 4CMIA 3UVEA 4BQPA 3ONDA 3FHLA 1EK6A 5MDHA 3O9ZA 4XQGA 4E33A 2NU6A 3WGOA 2ZB4A 2PNFA 1ISFA 3KBOA 5B37A 3ZDFA 4D3FA 1PJ4A 4CMAA 4QX6A 3GGGA 2X0NA 3K6JA 3OBBA 2HRZA 5HM8A 1VSUA 3C3XA 4FN4A 4AG3A 2JCXA 1AUPA 5CDSA 1VKOA 4CUKA 4D0RA 3W4IA 1P1KA 4EUHA 1PL7A 4CLOB 2NACA 3NGXA 2CVOA 3MCVA 4U8GA 2HMTA 4UUMA 3DBRB 5BSHA 2WE8A 3AI2A 4ZQGA 2AG8A 2IZZA 2FPIA 2EKQA 4YACA 1CF2O 2GN8A 3AU9A 2C2XA 3ICCA 2FR8A 1SMKA 3GDFA 4IDDA 4OKNA 1ZEMA 4IDCA 2ZB3A 1EFKA 4Q39A 4W4TA 3IDSA 2PGJA 2O2SA 1RPNA 2BI7A 4GLOA 1H9AA 3ZU4A 5JDIC 1M66A 3ZWVA 4RDIA 1MX3A 4NK4A 2X0RA 4U5QA 1DJNA 1SOWA 1LDYA 2DBQA 4HNHA 4EW6A 3ANMA 4YVFA 2NQTA 4GLLA 1DFHA 2X1HA 5JDCC 2HSDA 4RF2A 1J5PA 5DOZA 1RM3A 5G0VA 3GC6A 2ZTMA 1J4AA 3JQAA 1GYPA 4XQEA 3FBGA 1YXMA 1HWYA 5L3ZA 1NWCA 2NVBA 3NKLA 3UOGA 3WMXA 4RCVA 4CLEA 2PLAA 3U3XA 3HG7A 4CMBA 2A9FA 2X22A 3ZZNA 1QV6A 3KEQA 4JBHA 1E6UA 1KOLA 5FWNA 2RH8A 1VM6A 2EXXA 3D7LA 1YDWA 2FSSA 1LU9A 5EPOA 3F5SA 3NV9A 2DTEA 3RJ9A 1IHYA 1HYGA 2FP4A 4DWVA 3AOEA 3JQGB 1UAYA 4U0JA 1ZBQA 3IS3A 4E3ZA 1QYVA 4D3SA 2OZPA 1GPJA 1GV0A 1U5CA 3WMWA 3RSHA 5JCJA 4OL9A 5G4LA 3PFFA 4BNGA 5FYDA 4II2A 3DTTA 1T4DA 5CDUA 4J9VA 4TZTA 3IKTA 4WCDA 4RVHA 3W4JA 3KVOA 1P0FA 2RIRA 1DAPA 2JFHA 2BFMA 2PD4A 3UKOA 2PD6A 4I5EA 3L0DA 1WXDA 4BMVA 4TRJA 5JAIA 3ZWYA 4PZDA 4XYLA 2I3GA 3FNGA 3KXDA 3OJEA 2JL1A 3HDYA 1BDMA 2UUOA 4ZHSA 3C7CB 4NBVA 4NJMB 4E5MA 4HWKA 1EDOA 3RBZA 2RAFA 2VWQA 3WX0A 3OA2A 3IKVA 4FCCA 5DBIA 1QXSA 4AJNA 1E7WA 4LMRA 1BG6A 1YOVA 2SCUA 5CDYA 4A73A 1QYXA 4ALKA 3D3EA 4Q3BA 5EJ2A 2UVDA 3DBHA 3WGHA 4TVBA 4WCFC 3FPCA 4R69A 3AUUA 4BL5A 5ER9A 2E82A 4D44A 5I8WA 1UDBA 3EY4A 4LN1A 4BUCA 4JBIA 3PDJA 3WYEA 3DZIA 4J6FA 4KWIA 4NQZA 5A03A 1DO8A 1QG6A 4ONEA 1T25A 3V2HA 4M89A 2HKIA 4IXTA 4YJHA 2WE7A 3KYCB 1E1MA 2CSUA 3GRKA 3ONEA 2Y05A 1UZMA 5AXCA 2NV6A 1T1RA 3NTRA 5KIAA 1BW9A 1UJMA 2Q49A 3CEAA 1NNUA 3FBTA 5ENDA 1F17A 2VRCA 4AJPA 2NUAA 5CEEA 2EKLA 3CZMA 4FPXA 5DCUA 3C85A 1HF3A 3PZRA 3D4NA 3R3JA 3JD3A 1YE3A 4LRSB 1N7GA 3V2UA 3GPDG 1I0ZA 5DCYA 3DZGA 3VH4A 1BXKA 3ZN2A 1YQXA 3E5RA 4YAJA 4HKTA 1ZSNA 4UEJA 2W8ZA 3RQSA 3WXBA 1P9LA 4II3A 3M1LA 4TKLA 4MKXA 1FMCA 2DM6A 1SB9A 1MFPA 2GZ1A 3VDQA 4DTIA 5L4LA 2AQIA 3RUCA 4XWYA 5F1PA 4XQ9A 4JCOA 3G1TA 1HTBA 4J4HA 5BR7A 3PWKA 2XXJA 1XR3A 3AJRA 4H15A 3TZKA 2D5AA 2Z1MA 5IG2A 3VZPA 4I8XA 4K6CA 5JAZA 2I3AA 4B8ZA 3S2GA 3H9UA 5GY7A 2GNAA 2Q1TA 5GZ1A 1AHHA 1QMGA 2GO1A 4R01A 1IZ9A 5C7LO 1BXZA 3CMCO 4RVFA 3ZU2A 3RC7A 6ADHA 3IJRA 5JYDA 2ZTLA 3ZNQA 3PFWO 3I6QA 5G2OA 1KVQA 2P5UA 5A5EA 4N7RA 4F6CA 3GMSA 3TL3A 3GZ4A 1HDRA 1EMDA 2DKNA 1N1GA 2R00C 3JYPA 3ZWAA 1PJQA 4NI5A 1O6ZA 1DRWA 4NHEA 1Q0HA 3GOHA 3QY9A 5A3JA 1U1IA 2IZ1A 2DFVA 1YGYA 5BQFA 1TVEA 2CNBA 2UDPA 3JD0A 4A0SA 5A02A 2DPHA 2C0CA 1LQUA 3JV7A 2Q4BA 3GEDA 2UYYA 2UUPA 1Y8QB 1YO6A 4WPGA 1LTHR 2VYVA 3KO8A 4EJMA 4B7UA 2IYPA 4YRDA 1Y8RA 2FN7A 3RJ5A 3UFXA 4CM9A 4HV4A 2D8AA 4BKUA 5DBFA 5TF4A 1J49A 2PV7A 3IC5A 4OM8A 2AMFA 3LC2O 2OUIA 3L4BA 5A06A 3KUXA 4M1QA 2QHXA 1MGOA 1IPEA 3WR5A 4DVJA 1W0CA 2Y67A 3A14A 3WTCA 1CQJA 1XWFA 4I5DA 3BMQA 1YBMA 3HFGA 3MEQA 3WNVA 3MTJA 3C7DB 4CL8A 4CMJA 2H9IA 1X0XA 2I9PA 5KNLA 1YL7A 3TRIA 1I3NA 4R5HA 4HX5A 2YYYA 2E37A 5KTKA 1P1RA 2TMGA 4U0KA 3NGLA 4KZPA 1RM4A 1A4IA 1EZ4A 1DPGA 1XU7A 2G76A 1SPXA 4GMGA 3PXXA 4QSMA 1AHIA 4WLVA 2PZMA 1T4BA 4F46A 3NYWA 1NXQA 2B35A 3D64A 3WFJA 1NWHA 3Q1LA 1KEVA 3TWOA 4CLOA 3RASA 4XRGA 4GBJA 3FNEA 2DVMA 3DBRA 3EW7A 4K6FA 4I9HA 4JXKA 4DL9A 1PJLA 4BO9A 1LRJA 4J49A 2EJVA 1L1FA 1FF9A 1KY4A 2AEJA 4PLFA 3VPFA 3RD5A 4MVJG 1MB4A 3GVXA 1DDOA 1KEPA 1DIAA 2O23A 3Q6IA 4OXYA 4O6VA 3Q3CA 1O9BA 3PQDA 4ID9A 4W9NC 1GV1A 3F3SA 4XB1A 3VKVA 3KTDA 3IUSA 5JCXA 3PGXA 2I6TA 2C82A 1EUZA 1H93A 5FI5A 2O4UX 1GY8A 2FR1A 4CUZA 2NSDA 4PLZA 1R0LA 3V1UA 2GD1O 1KYQA 2LDXA 2EHDA 1WVGA 3C24A 3PWZA 4DBZA 2CFCA 4C4OA 2PZLA 3TN7A 1R0KA 2AG5A 4MKZA 3M2PA 3W8DA 5CHEA 3WGTA 1QYCA 3OIFA 4F6LA 1JDJA 3EVNA 2Q4EA 1T26A 1R4MA 1MXFA 2C2YA 3WDSA 5EQFA 3O03A 7ADHA 3S2IA 3MOIA 1LJ8A 2NADA 4GQAA 2JHFA 4J1SA 4WECA 1EEHA 3OM9A 2Q2WA 1U4OA 3I9NA 3E03A 4R3WA 1LA2A 4KQXA 3L6DA 4FJ0A 4D3DA 1XDWA 2F1KA 1CQIA 1U7HA 3JQGA 2UV8A 1V0JA 1C0KA 1PR9A 3WGQA 1P3DA 4R1NA 5A4DA 4WEQA 3FTNA 4YA6A 1I36A 3HDHA 1CERA 4W99A 3ZNPA 5I9LA 1GR0A 5JO9A 4RZIA 1GD1O 1NHWA 4W7HA 4PVDA 1HE5A 5HA5A 1YRLA 4CQMA 1Y7TA 2A94A 2ZB7A 3P2OA 5T6BA 5LC1A 3H9GA 3RUIA 1HRDA 3SBOA 5JAMA 3GHYA 1ID1A 3W1VA 5KJ6A 2FHSA 2NWQA 2W2LD 1K6XA 4IS3A 1Z75A 3I9MA 1GAEO 4XGKA 2DUWA 2BGKA 3DB2A 2NTVA 2UAGA 2ZYAA 3NJ8A 5BSFA 4ZRMA 2GGSA 2D1YA 2PZJA 5L7TA 3JYQA 3K96A 1DOHA 3HDJA 3P19A 3L4SO 2YHUA 4C7JA 1HDYA 3GNSA 1XA0A 3GEGA 4S1VA 3AFMA 4ALIA 3WJAA 1I33A 4NJOA 4E32A 1FDWA 1V9LA 1EUCA 2O48X 2X5OA 3RKRA 1YB5A 3A06A 5K6AC 5ES3A 2VHYA 3VVBA 2IXBA 2FR0A 2Q45A 1PQWA 5COQA 3AI3A 1ISJA 4CMKA 3DQPA 1NQAO 5JSFA 2BH9A 3GVHA 1E77A 5CPBA 4PGFA 5IF3A 4RZHA 3VAZA 3IL2A 3ZHYA 2EW2A 1C0PA 3BTUA 4MO2A 4OH1A 4GKBA 5JBIA 5L4NA 4B4VA 4B3IA 5CDTA 3ANLA 4W82A 2EKPA 5TRTA 1VPDA 1GZ6A 2NVUB 1R16A 2QIOA 4E12A 2Q46A 2HK7A 3WGYA 1IYZA 4RORA 5JYAA 2OO5A 5DT9A 4ZA2A 1SOVA 4IINA 4RO0A 5AYVA 2BLLA 4YT8A 2X5JO 1J0XO 3LQFA 4CQLB 5FEUA 1CWUA 3G1UA 4YAKA 5L53A 5DBGA 2PR2A 4EEXA 2OORA 2E4AA 2VHWA 3ROPA 1WDLA 2ZJ0A 3Q0EA 2VCYA 2XF8A 2NM0A 3ZH2A 4QO8A 5B1YA 3E82A 1WDMA 4R4JA 4BNXA 4TRRA 3KYBA 4FS3A 3E9NA 2Q22A 1KC3A 3B1KA 2X0IA 4DYDA 4XZ3A 3CH6A 4J16A 4W6ZA 4TMFA 4BO1A 4PZCA 4MIEA 3RU7A 3JSAA 1XQ6A 1TEHA 3JQCA 4R1TA 4BKOA 4DIFA 3AWDA 4GKVA 2VZ8A 1NPTO 4E5PA 1PJBA 4YRBA 1V8BA 1Q7BA 4BOYA 1QSGA 4AJEA 4P4GA 5JXWA 5KJFA 4A27A 1HSOA 3LK7A 1I01A 2W4QA 2Y93A 4P4NA 3ZWBA 1M6WA 4EGFA 3CKYA 3DXFA 3DAFA 4BNHA 3HQ4O 1ZMTA 1ZEJA 2A35A 4GGOA 1EDZA 3PHLA 2QRLA 1DRUA 3CXRA 4DC0A 1TLTA 1N92A 2C5EA 3RFTA 1LDBA 7MDHA 3ORFA 4IDFA 4XDYA 3H9EO 3ZHBA 1A5ZA 2G17A 3BAZA 5FFFA 3RC9A 1QR6A 3GK3A 2NU8A 3RAJA 3ITDA 3OQ1A 1Y8QA 4HUJA 3R1IA 1H2HA 3GNTA 3BMOA 4Z9FA 1K6IA 4FW8A 3H3FA 3JQFC 4IBOA 3H2SA 4TRMA 2VTDA 3K30A 4YEDA 2VT2A 3AY7A 1RYDA 1WAMA 4R1UA 3RU9A 4IM7A 1U4SA 2BD0A 4KTTE 2ZTUA 3H65A 4NFSA 1I30A 2QZ9A 1K2WA 1ZK0A 1TT7A 2YHIB 1PJ2A 2VOEA 4FOSA 1XLTA 3ONFA 3TDKA 3G49A 1BRMA 3DBVO 3TQHA 2P5YA 3VH2A 4JP3A 3WWZA 3UH1A 5I8ZA 1HYEA 1U3UA 3OJLA 3QVSA 2V6FA 1DAOA 3LT0A 1C0LA 3LF2A 4RV9A 1GTMA 3O4RA 3W4KA 4DLLA 2HQ1A 3GVCA 1ZSVA 1E1KA 2I65A 1PZGA 1LDEA 1QYWA 5I7VA 2X23A 3PGJA 2J6IA 3B20A 1DEHA 1ZJZA 2IRWA 3BMNB 4KUGA 1DIRA 3GH3A 4J1NA 1N5DA 1ADCA 4YJFA 1T2FA 5J23A 4CM6A 3ZNOA 3INGA 1F8FA 3EK2A 4EUEA 1FDTA 1PS0A 2FRDA 5CEFA 1Q2XA 1MG5A 1R66A 4P8RA 4BNYA 3Q9UA 4CR6A 4OSOA 1PS8A 2VUSA 3FR7A 1DIGA 4JJIA 4WEOA 4CLRB 2DTXA 1I32A 1X13A 3PJFA 3S8MA 3E6AA 4QEDA 2BHLA 1PX0A 1FK8A 4RVDA 3HSKA 4BB6A 2WD7B 2CD9A 3QA9A 3VC7A 4XJSA 1GUFA 1MC4A 2GERA 1UDCA 4O0LA 3V1TC 1DLJA 2Q2VA 2Q99A 3Q11A 4R9RA 4TROA 4K1LA 5C5IA 3F6YA 5K6AA 3UW3A 3UHAA 4CUJA 5G0SA 1O95A 3LLSA 3IOYA 3DMTA 3E9MA 4MVJP 2BMAA 3FNHA 3JD1A 3P7MA 4XGNA 4D0SA 3BHMA 3I83A 5T5QA 5EIOA 5KWEA 2EGGA 4UVEA 4CV2A 2J5QA 4G5HA 1H94A 4IDBA 5BNFA 2YW9A 3VZRA 1GUYA 3M6IA 4BKPA 3OIDA 4FFRA 1QP8A 3EHEA 5TC4A 4G65A 1MUUA 1UP4A 2CDCA 2PKRA 4IMRA 4YAEA 1SEPA 4XB2A 4MP3A 3BTOA 1M67A 4L4XA 5I9NA 2JCVA 4AJIA 5GZ3A 3QSGA 1YKFA 1L7DA 2YQ5A 4QT0A 3RUDA 4ALNA 4PLHA 4U6SA 3AY6A 1G1AA 5A9SB 1CIVA 5JFOA 3E48A 5A5FA 2I5PO 2HO5A 1L7EA 4FJ2A 3EYWA 4IZHA 1IL0A 1N9GA 3HE3A 4MVJE 2P4HX 3K31A 3BYZA 5HS4A 2O3JA 5JC8A 4GWKA 4UEOA 3HZZA 1NM5A 4UAGA 3PQFA 3WNQA 5IZCC 1XGKA 2O4CA 3ANNA 4ND3A 1R6DA 4CMHA 1K0UA 3SEFA 3UF0A 5HBRA 4FGWA 1ZK2A 4NDNE 1XHLA 1SNYA 3DONA 4RPHA 4WLUA 1U2GA 2BF7A 3PLNA 5F3RA 4RDHA 4L9RA 3PLRA 1B7GO 3Q2IA 1VJ0A 3JQ7B 3ZU3A 5TNXA 5G0TA 1HKUA 3TNLA 4B8WA 4IDGA 2VUUA 1FJHA 4BMNA 2HMSA 4PZEA 1P74A 4RPLA 1KVSA 1SBYA 1ZK1A 3AI1A 3L4BC 1E5QA 2BFOA 3D5TA 2AA3A 2I66A 1QV7A 2P4QA 1KC1A 1E6EA 4BNNA 3BMCA 1EFLA 2DUUA 1P33A 3GZNA 4GVXA 4GSLA 4PG7A 4JK3A 4MDHA 4E5YA 5KVCA 3NT5A 3KM0A 3DC2A 2NVUA 4OXKA 3DZFA 3IP3A 1JW9B 4BO8A 5F5NA 5B12A 3O38A 4MVJD 2PD3A 1GDHA 4PRLA 2CUKA 1LDGA 4CQLA 2VZ9A 3JQFA 4FQ8A 1AE1A 1F0YA 3LU1A 3ETGA 3T7CA 1E1LA 1QKIA 3WG9A 2O7SA 3RI3A 4GX2A 2C54A 4N5LA 1BTOA 2RCYA 3U49A 3UXYA 2O3QA 3DTYA 1SAYA 2W2LA 2Y1GA 1B8VA 4YYZA 3NX4A 4AJ4A 4XEHA 3VPGA 3FN4A 4PG6A 5AXAA 1ZZEA 3IQDB 1Q0QA 4R5MA 4I5FA 2Y66A 3KEOA 3KSZO 4BNMA 1GU7A 4OHUA 2VHVA 4OYRA 1W6UA 1ULUA 1YONA 2ET6A 4IJVA 3O26A 3JQ8B 4PLCA 4YT4A 5FI3A 1G6KA 5B4VA 4Q3DA 1ZIDA 2CDBA 1VSVA 4H7PA 3PHJA 1HT0A 2YZ7A 3HHPA 4MVJH 1GCUA 2NQ8A 5AOVA 4ZQFA 3TJRA 3QWFA 1NVTA 4XJTA 3JQ9C 5G0UA 4XRRA 2HJSA 4DPLA 1WZEA 3N74A 2D5CA 5JPIA 2PA3A 1JWBB 2PKQO 1M75A 3WICA 1T2CA 4F45A 4R68A 1C1DA 4JP2A 4CODB 1E92A 2X4GA 2A4KA 1RM5A
chains in the Genus database with same CATH superfamily
1JSCA 3BA1A 3RSGA 4P3NA 5U1PA 4BNDB 5G4KB 4LV8B 3DAOA 4LGMA 5CUQA 1MKYA 4IW3B 4ZYTA 2RH9B 4KK4A 1C1XB 1Z12A 3F6SA 2GBPA 4DDHA 10MHA 3D31A 4QYXA 1DINA 1YNSA 3TBHA 3GCDA 1NQTA 3CKMA 5FDFA 3H2IA 5BSUA 3E3MA 1ULHA 3H17A 1R4ZA 3HN7A 3GVPA 3TF5A 1RAGA 3I9LA 4BMDA 5JXIA 3T7DA 4PGHA 3KJNA 5ECGC 2DQ4A 3LW8A 4LA4A 4AKEA 1U0LA 9LDBA 3ZLJA 4D9CA 4M7RA 1AK1A 1Z62A 2YHAA 4C0WA 4UTNA 5B7PA 2GX6A 4JQZA 2IITA 4D9GA 4AURA 3PFIA 2PX0A 5LU8A 2CLOB 4NBLA 1DX9A 3MWGA 2GBLA 2V6IA 2PX5A 5J2UA 3MM4A 2GBGA 4U4AA 2G6BA 3P27A 1Y5RA 4LQCA 4BE4A 3OCUA 3H11B 3CFYA 4WSOA 5FT9A 1IG0A 2FDCA 2AN5A 3BD8A 5EMKA 1J25A 1TW3A 4FIZA 2FMHA 1Z5GA 5ALGA 3WZLA 5FTMA 5COAA 3IQXA 3MWFA 2X58A 3I5MA 4XGRA 4QJBA 2P9FA 4EHKA 3UMSA 4CIBA 1P2BA 1FVXA 1Y81A 1C9KA 1MRZA 2POQX 3WB9A 3AP3A 1M6VB 4PXYA 5KKCA 3U4MA 1XPJA 1GPLA 1XD2A 5ALJA 5LD2C 5L7YA 1GJRA 4EB0A 5JMPA 3BE4A 5K8VA 3PD7A 4DJ5X 4K5QA 1EE2A 3LZ6A 4BO3A 4NS4A 1UINA 2JBWA 5EUBA 4LCJA 4ARCA 4R8SA 3LY7A 2PUDA 4Q3EA 5KTSA 5U9CA 3DC7A 5KVSA 4JHXA 2OB2A 1KMIY 1TMKA 4ESHA 1I10A 3ZHZA 5A4FS 5KCZA 4XAQA 4OHBA 5CX1B 4AZ3B 4OHXA 2I4NA 2QGFA 4PZZA 3TB6A 1X38A 1I7PA 1AF7A 1XTIA 3PXEA 5IT4A 2XQIA 3WXMA 4Y6SA 3RHFA 3PLAE 4Q6WA 1C5KA 2GK6A 5HIJA 4OQZA 5JH7F 3NBXX 1E79D 3C6QA 4IIFA 3SYTA 5IZCA 4RHUA 1XKQA 4C7VA 2PL9A 3EWAA 4RZQA 4CMGA 4Q9DA 1I2DA 2IXEA 3NC4A 4ENSA 1QFXA 2IHYA 1NMYA 3LFUA 4HDMB 4N8EA 2DBRA 2ZDHA 1RHKA 1Y4DE 2BKXA 5DIFA 4R7GA 1H3NA 3DKKA 4KIGA 4OBEA 4D4MA 1UXHA 3V8NA 2RG1A 3CBGA 1E9BA 2QRGA 4ARZA 1QOPB 1VYVA 3KKQA 2VLIA 4DA6A 3ESCA 3GFRA 5DZSA 2WD7A 4DSUA 2XYHA 3L0YA 4PV7A 4RGYA 3LCCA 5EQTA 1MAWA 3MJHA 2I4OA 2RKOA 1KRHA 2P3QA 4OJKA 3VAAA 1I7BB 3UAVA 4BFUA 4BVGA 1D9ZA 2IC5A 3SF8B 3H5NA 1SM4A 1IB0A 5K5EA 3JY6A 1EYZA 1GG8A 3P20A 3K71B 4DZRA 1FQKA 1OLUA 4N9QA 2RB5A 1MO5A 4M76B 4FNAA 1M2KA 4R3UC 4CM5A 4KB5A 2MSCB 4LZJA 1FP7A 1VRWA 1ZESA 2ZUTA 1K97A 4QPPA 3KSUA 4BX9A 4US1R 1JEQB 1IHXA 1M2WA 3D8TA 4KPUB 4MS1A 5KO2A 4KQFA 3TKAA 5DULA 1DIBA 4L75A 3MTIA 3R5HA 3AC0A 3P0HA 1C7QA 5ALPA 1UP6A 3AHIA 2QV0A 4M8NE 1QOQB 5GGYA 3N0VA 2H1RA 3UCFA 1B0ZA 3K15A 2ZR9A 2RGBA 3LY9A 4DW8A 3KDPA 4BQOA 3RTAA 1KAOA 3OWOA 1RI5A 3TEFA 2QG9A 3BGIA 3LY5A 4KXXA 5L6MB 4DR5B 3QV1A 1TW2A 4RA9A 1JBEA 3OQBA 1CDDA 1G8HA 1H2EA 3FPEA 3ST7A 3L7KA 4RF4A 2O0HA 3C7AA 2WHRA 2PYDA 2FP3A 5DDIP 4EUSA 2XVZA 2QVGA 3HP7A 4CL2A 1BHO1 2NUTB 4BP9A 4S1WA 5MHTA 3C3PA 1AQNA 4ZOEA 4FDAA 4BFYA 4DCGA 1GPUA 2MYTA 3L6EA 2HGSA 3RCBA 1JVNA 4BLTA 4E2WA 2OHOA 4OQ4A 2HA7A 2QT9A 5BP7A 4MGIR 3W05A 5GOTA 4X7BA 3TD6A 2COKA 2ZUCA 3QLVA 1SU7A 2WSYB 2AKEA 5J47A 1Q14A 4RPCA 3HVKA 1ZU5A 4LYEA 5I7OA 5HILA 3N0XA 1MVLA 1NFFA 4O1MA 1C29B 2HF9A 5AUQA 5T8KA 4BJ5A 3WB1A 3ZGXA 4MQBA 1EWKA 3ZGYA 4RFVA 3NU1A 5DN9A 1LX6A 1XLWA 2EV9A 2W6JA 3JQ9A 4J4BA 4RM2A 3T7TA 4X8MA 3W3AD 5C52B 4FZ5A 2Z1NA 4HEHA 2I1QA 3UATA 3H9QA 2JFFA 3EIQA 3O90A 4DPMA 2HWKA 4DA9A 4FD3A 2RIPA 1U9IA 1ISPA 3B5JA 4Q9HA 3VZBA 4WJLA 1HE2A 3PXAA 4A2PA 1K8QA 2VDQB 1AXEA 3GI1A 1MLDA 2LE0A 4U6QA 1JHOA 1AUOA 1DNPA 1L7AA 1ZDMA 2CWWA 2QVZX 2HCRA 4PZ0A 4DV3B 5M7EA 1HE3A 1FMFA 2GVDC 3L0BA 3KLPX 2QEQA 3H42B 3OCZA 1GPDG 1UXOA 1FFCA 2VP4A 1PKEA 2XCTB 2WSBA 4IGKA 3TRHA 3PR3A 2O2EA 1WNTA 3CF4A 4GO1A 4LDNA 2O2JA 4MCIA 1OBFO 3UYKA 1JTFA 1EVLA 5BXYA 3GG2A 1UPTA 4ZC8A 4DLBA 2X4LA 5G0WA 4F5DA 1V8FA 2CB9A 4JLWA 4PONA 2Q3BA 4CPDA 1KERA 3MQ2A 4DCPA 5C3MA 3W3AH 2FWRA 4HRAA 2W90A 1TJ3A 2RJOA 4RTOA 3CR8A 1O5OA 3U7JA 4BVAA 4ZYYA 5I7FA 1TJNA 5BXQC 5CD1A 2WKWA 4FFOA 3EXAA 4Q1BA 3VX3A 1QGED 2HDNB 3HJHA 5JU6A 3NMUF 1MENA 4KXUA 4ZQBA 1O94C 4N6GA 3JAMA 1Y33E 1LSJA 2DECA 1N5RA 1U8XX 2DTDA 1AQJA 4E11A 2HUPA 1A7JA 3AY0A 2SKDA 3DVSX 3V80A 4QG3A 1QYRA 3H5RA 3G9UA 3P9PA 4Y6QA 1OLXB 1VKNA 1J2RA 3AVQA 4WKBA 4CTKA 5LZ9A 4H6VA 4TT8A 4Y2RA 3PHIA 4X84A 1TVMA 2P90A 4BO4A 1QF7A 4RHEA 1NQUA 5C37A 1ONSA 2Q5OA 4BMSA 3ER9A 4NJMA 3H2JA 2AW5A 3FRIA 3SS7X 3C3CA 5IJ9A 2J6BA 1NP6A 3JATA 3LNTA 4LJYA 1PTKA 3GRZA 2Y1LA 2QP3A 1YB4A 3E3AA 1S8NA 2JLCA 1NA5A 2GNPA 1K1EA 1QH8B 2JIZD 1X7GA 3FNQA 2OQIA 4MZDA 3DXXA 3UM9A 3VM6A 3ZWWA 2IH4A 1SKAA 3OO1A 3Q7TA 3NDRA 4WBNF 1V6CA 1QRSA 2G1AA 3D6TB 1ORWA 2QTVA 2CJWB 3H4MA 4EBFA 3NASA 2B5VA 2W2XA 3H2ZA 4JQOA 1THGA 4B33A 4KR0A 4OXIA 2OTCA 4G0WA 3Q9NA 5E1MA 1W59A 1NMEA 3S7ZA 1L7RA 1BRTA 1NJ8A 4LBWA 1F8GA 2E4WA 3T15A 3DDNA 4X0EA 3ZW9A 1APBA 1OFIA 3KYCA 1M6HA 2FPSA 3F47A 4U7GA 2O7NA 1K5HA 3C1TA 3AUJB 1MA0A 4FMCF 3EZ2A 1JFVA 2DWOA 4D45A 4NNPA 2XNHA 2QRJA 3COPA 4M7PA 3UAZA 3ELWA 1RIIA 3H8VA 4KQCA 5AW6A 4MJXA 4JI8B 3RTGA 4CL3A 3IPLA 3WADA 1V16B 3RARA 4G4SO 1R12A 2VBCA 4URFA 3E22A 3S55A 1U98A 3QVXA 1SVIA 2VWPA 3GPIA 2BFFA 4Q1AA 3WP0A 3VR6D 1JDZA 1KEZA 1NW3A 3DMYA 4A36A 5CLIA 4E2ZA 5FV4A 2AXQA 3I5YA 1QLJA 4MZXA 3L40A 3IE1A 3HR4A 3FZNA 1CIPA 5ITZA 3A7EA 4ZCQA 5BV8A 1NVXQ 4MRNA 4RL4A 1L4NA 3CLTC 1G8SA 1GSHA 1RRPA 3AL2A 1FNNA 1II0A 3OA0A 3FUWA 3KYDA 1BMQA 1XZGA 2ZCVA 3R3ZA 3MWEA 4IIDA 3UMRA 3UT5B 3VX4A 3WK5A 1H5NA 1WCXA 2VTKA 2X86A 2O8BB 3QVUA 4C1BA 4HC4A 1JKXA 2NZ2A 1W0KA 3C2QA 5TGTA 4PLWA 4DUPA 1VE7A 4HWTA 2VZLA 3N5CA 1Q74A 4UARA 5JATA 3WKAA 2VRCD 2AFRA 2IELA 1WW2A 2JFXA 5ESRA 2PKCA 1NQOA 1DELA 2Q3MA 3HP1A 5LYJB 4GNRA 1Y3AA 3A05A 4NBKA 1JSXA 1U2GC 1XJQA 1YDHA 3GDGA 2H2HA 2MSKA 5EEGA 5A3JA 1C3XA 3HHEA 5EAIA 3KQLA 3DO5A 1UFQA 3ZJVA 1PR1A 1UQTA 3H7AA 4O4IF 3KQSA 1Z0UA 2VHZA 1OT5A 4K26A 1LC0A 3LAWA 1PJSA 1XELA 2GHRA 4X6YA 3HABA 1S0UA 1ILWA 1TA0A 4RHFA 5FWXA 1RPZA 4ZT7A 4QZVA 4CNQA 2IH2A 2FSVA 5DNCA 5JR3A 1UMDA 4CIDA 2IOFA 3FW1A 3P5BA 2TMKA 1IZ7A 4YMHA 3M4XA 2C3OA 2HPZA 2QE6A 1MW9X 2FW7A 4XQCA 3HKEA 4E0BA 3WYGA 5LQUA 1EQ2A 1V1RA 3EFEA 5TS3A 5K3FA 3VVCA 6REQB 1GTJ1 3PD0A 2X9QA 4ZOLF 2MOKA 1E3IA 1ONOA 4MW4A 4IGFA 4PPFA 5BR8B 2PBRA 2HLDD 2XX3A 5MFZA 2VJPA 1RADA 2QF7A 1IBSA 1BVUA 1EUDA 2EP7A 1I2MA 4E08A 3OCWA 3S2SA 4D9KA 1E2HA 5FWYA 1JKFA 4QDZA 4CNBA 4F4DA 5KZMB 1SKQA 1YVEI 3SLGA 3MJTA 5A7FA 4X1KA 2ZW9A 1A4XA 1U0GA 3W90A 5F73A 3D6HA 3ITKA 1TEVA 3JCZA 5B58C 2I7DA 4PLGA 2I9KA 4G85A 2OFFA 3V00A 5I48A 3SJCA 4YBZA 2C03A 4MPJA 3MWKA 1BD4A 3NDJA 4Z1OA 1S8OA 2WWTA 1CR1A 4O5OA 1UJ2A 4D7AA 3LQ1A 3CRZA 1RWBA 4B3MB 3ZBTA 4BCCA 4LYDA 1HG0A 4G25A 1O89A 3PT5A 4XYEA 4FEEA 1L5NA 3FOZA 4JJKA 3PVZA 1Z6PA 2IYOA 3GBVA 3AR3A 3EVDA 1NDUA 3ED1A 3PC8C 5I4IA 3ONWA 3ADPA 2HYIC 1HL7A 1QANA 1I4EB 3SZMA 1F6BA 5KJ6A 1Z4JA 4R16A 3WYCA 1BW9B 4IDAA 1SK8A 4QUDA 4AF7A 2HPHA 4KQ2A 3MHTA 4TTAA 3DMFA 1I5RA 2WIKA 2AFIA 3K05A 3HADA 3KL2A 1QQ6A 2ATEA 4I55B 2YWGA 3FVRA 3UENA 3V1KA 4E3WA 3WLFA 1UP7A 4W5HA 2A2ZA 3BQMB 2VO1A 1Z5NA 3OPQA 1LPSA 2P9EA 1OBVA 5DWDA 1KORA 3TTVA 4ANFA 1TYBE 5JCOC 2R1ZA 1RHRA 2GASA 3N8GA 1JDSA 4MRPA 3KQYA 5HF9A 4KVAA 3BSFA 2QUKA 1G4HA 1S5PA 1Y9JA 2GRJA 2IZ6A 3WE7A 4BC1A 3IUBA 1A95A 3DT8A 4CEIA 2JGDA 3FYSA 4LCEA 1XWWA 2BMEA 3TL2A 1LRLA 2C4VA 1S9HA 3PHHA 4EFLA 1QPGA 4PTZA 1MHPA 3ZCSA 4C7XA 5DM4A 1Q1AA 4D57A 3DV0B 2J4DA 2HU8A 4JT8A 5FEMA 1JL3A 1KPGA 2VNSA 1TA4A 4ZI7F 5ICCA 1AKUA 3NLLA 1O94A 3Q8WA 3ESXA 1UL1X 3NIWA 4MV4A 1FL9A 3ZXXA 2NXEA 4ALLA 4OH7A 1V43A 1ZFNA 2B4TO 1SCBA 4DG5A 2HU2A 2WP8J 2O2ZA 4IQ8A 2ZREA 3FJ1A 3INRA 3LV8A 1RHJA 2OV4A 3L8YA 3QQPA 3QM1A 2QS9A 4WZBA 3RFVA 1AU9A 5DK6A 2BEJA 5F7JA 2VDVE 3DFUA 2ORWA 3K5HA 1R88A 1ZOSA 3NC1C 2FETA 3QVWA 3L1JA 5KREA 4HT3B 5L95A 5M34A 2V8OA 1B4DA 1QBKC 2DQSA 2NZ8A 2QG4A 3CRW1 3EMKA 3N05A 3K0EA 4W5WA 4YT5A 5FO1A 4RZXA 4F21A 2JAHA 3EP5B 2FEMA 2Z5LA 4MI1A 1TCBA 1FA9A 2X1LA 3I9FA 1PLLA 1QB7A 2G06A 4B7CA 1DRJA 4BFVA 4EQ6B 2PRZA 1A2QA 2BEWB 2KBFA 3U1TA 1I7QB 3IEUA 2Q8PA 2CUZA 3SZOA 2XZTA 2VQ3A 1XRPA 3OJFA 1GGFA 2OB1A 1ISSA 3NP9A 4OP2A 2DMRA 4DCSA 4EO9A 1POXA 4YIHA 3VR5A 4YY3B 3D4BA 5FQNA 1E94E 2JD2A 3JASB 2YZ2A 3OF5A 2C2HA 4WXPA 4LTDA 2RD2A 2HYDA 3PEVA 4OSPA 1NYLA 1B6GA 1TO2E 4OXQA 3SM3A 4WH0A 1T8UA 221PA 2BGIA 1N8KA 1S8AA 3ZIAA 5AKEA 4Y6OA 5KVVA 1G38A 4YIKA 3FOCA 1PEKE 3I1FA 2GPYA 3I30X 3PXCX 3QKSB 3FFXA 2EBUA 4QYMA 3SX2A 5JAOA 4A15A 5P8WA 1UBGA 2QTTA 2CYCA 3RUEA 4QJ3A 1IY0A 3ZZ0A 1VJGA 2A9KA 2CLHB 4KDFA 3QBDA 5DYWA 1H8HD 4KOEC 4A8PA 3L8HA 1K6MA 3ZQJA 2IUEA 4IQ0A 4FDLA 3AHFA 3OECA 2BKAA 1Y8RB 1ZM9A 1DJQA 2OFPA 3RABA 4PYNA 5J2TA 1YQQA 5AMXA 4B79A 2C9MA 4EG7A 2O07A 2FEAA 1GLGA 4EI8A 7REQA 3OX1A 3B9BA 5JPDA 1ILEA 4L0QA 1SHUX 3WK8A 2XKKA 1DC3A 4EELA 4AS3A 2X7HA 3ZG6A 4WGFA 3BFXA 1O0SA 3ZU6A 2A5YB 1GADO 4L85A 4A4DA 4CTOA 2ZJ6A 3RVQA 5ABPA 3M82A 3PPIA 1P31A 3EB9A 1QFSA 5CCBA 2QN7A 1OH7A 3PRHA 3QJ5A 2QPOA 5HQ3A 4Q05A 4YYEA 4FN5A 4TX1A 4N0QA 3I23A 4BNUA 1RXWA 5EOVA 1A77A 5CTJA 5HQJA 4YP9A 1C2TA 1OFTA 1RI2A 3QPVA 4HWPA 4XD2A 3WIDA 4AJ2A 3AVOA 5EIAA 4XWOA 1XP8A 3GBPA 2RC5A 4PANA 1UM8A 4I9NA 5FNVA 4X00A 3VZQA 5BR4A 4D97A 4MINA 1XQ1A 1M5TA 1E2BA 1QO7A 2C42A 2FWPA 3FAZA 1EXMA 3F3KA 1P7WA 3ZE9A 4FMDB 2WHEA 3DLCA 3LKDA 3SXPA 4COKA 4KI7A 1CY0A 2BP7A 2YYAA 4FMPA 1P3JA 4NVRA 1TKAA 3W5VA 1WSAA 3U31A 2WU3A 3PWSA 3FTCA 3UCEA 3A9RA 1KI4A 3G8YA 3UKJA 1VLZA 4GQBA 1Z7YA 3MT8A 2AN1A 4FNMA 4R40A 3UXHA 4EKNB 4F56A 3LTEA 4ZI5A 4ZMRA 1BYIA 1DRKA 1LPMA 3CNLA 4AWAA 3BJZA 6GPBA 3D43A 1UPFA 3DOUA 2PH3A 4X9XA 2Q6VA 3TMKA 3E7PA 2RGGA 3AW8A 1IXSB 1SFRA 3HI6A 4WE3A 3VHLB 4OQEA 5A5GA 3T9AA 1EFTA 3O3OB 5BV0A 3S28A 3B1VA 3HFRA 1ECFA 3AI7A 2C04A 3O4JA 2WNHA 4HQKA 4KJXA 4QLAA 5BOSB 1SHKA 4P80A 4DJFC 1GNRA 1THZA 1NJSA 3SYNA 2VDWA 4BXOB 2QNRA 3D9QX 1LNQA 3MELA 1RBMA 2YFHA 3LLMA 4PW0A 1TOAA 3L93A 1GWNA 3B6ZA 1XQXA 5F35A 3TIVA 2VTVA 1SXJD 3I28A 1C4WA 1PKXA 2OL4A 1ZIYA 2PCLA 3V4SA 3EZ9A 3PEYA 5EJIA 2QW1A 3Q7RA 3GRPA 2AQ8A 2YWDA 4DQVA 3KQHA 1O6GA 3OLQA 4A91A 1S3SA 1IY9A 3KOWA 1G17A 2E49A 3A6PC 1GZ4A 3R5SA 1UPUA 3PC8A 2SKCA 4WA7A 2PMBA 5HKBA 2Q3EA 4HB2A 4DCNA 1PUJA 1PYDA 3KXIA 1Y6GA 1I79B 2JCBA 4EMSA 1RHQA 3LUKA 1R8YA 1E2EA 4JR0A 1XLUA 4KUHA 3WK4A 4KREA 2I1WA 3JAWA 2E85A 4DUGA 1R1DA 3HKDB 3OLYA 1O4WA 2AOWA 4RZUA 2H00A 2OM2A 4QGHA 1TQHA 1KF0A 2IVZA 4QXQA 4DCUA 4JT2A 2PBLA 1BMDA 3RIGA 5JCOA 3WQQA 4G63A 5TLSA 1V6AA 4HADA 2IU6A 4UUOA 1J2YA 1T6YA 3OZWA 4I3HA 3KYIB 3AUAA 4HEJA 1EG2A 2ECQA 5EWMA 3KQWA 2ORED 4AROA 5I4KA 4M1TA 1UZNA 2GZMA 1TYAE 2WIGA 3LY8A 1PV2A 1WB4A 3DE0X 4MEBA 1JDVA 3N9IA 3VHQA 1GQYA 3T4XA 4EG5A 1EFPA 4FZ3A 4F9EA 4WHMA 3UGJA 5SZKB 2I62A 4J03A 4RFLA 1VE1A 4HY3A 3DKRA 4Z3KA 3MFQA 4H18A 5J58A 4Z4IA 2ONKA 1CZHA 3D8NA 5CB4F 2H9YA 4HDOB 3RU3A 1Y9DA 1HYQA 4IIVA 4JBGA 2B21A 3TSWA 1IBLB 4LF7B 4CV3A 4KNYA 2W11A 3VNUA 1U0SY 4KKXB 4B9AA 1TMOA 4XTCS 1WCIA 2AV6A 2C57A 3D0OA 4X8HA 3IOCA 2OSVA 1SOUA 2Y0CA 3DMDA 1MX5A 2FW9A 3AM5A 1U7XA 2R7NA 3C5WP 4ZTBA 3ZGOA 1L7PA 1CTQA 3QPUA 4IJ5A 3TLJA 2JGIA 4FLMA 1T24A 4FXOA 4LF4B 5G41A 2CYBA 1SQSA 3F1KA 3ZKWB 1I2ZA 2IYLD 3ZJ5A 2HO4A 3CNNA 4A8JC 4AICA 1UT5A 4EECA 1IRIA 1JHQA 3U9TA 4WNIA 4M9SA 3ROFA 3UFBA 4YCNA 2H1OA 2WZQA 3ZY3A 4QQFA 1SXJB 16PKA 1BCRA 1TTPB 2OLEA 2ZBGA 3M1YA 4XX1A 1O7JA 2QY9A 2ZYHA 4KQ6A 4TXHA 4YCBA 1X1EA 3FCAA 5YASA 3NTOA 3C4JA 3G3EA 2VH2A 4KXQA 4M1KA 3GAAA 3JZFA 2QZJA 2YHIA 5TT1A 1Z4LA 1WE2A 3LO5A 1TCUA 2QT1A 5LOVB 1GGHA 3GJRA 1OTXA 3GGOA 4ZZ1A 4NRDA 3EVEA 4OREX 3FFTA 1X1CA 4R2JA 4WAUA 3EG5A 1Z73A 3RIMA 3WC4A 1E58A 1OIWA 2GLTA 1DC6A 5LQMA 3R09A 1M7GA 1NVDA 2EL9A 5AJTA 2VAVA 5E7IA 5L8VA 2O0KA 1KS9A 2AHRA 5C4MA 3SHTA 1N2IA 3AEQB 2P77A 4ZFNA 1V1JA 2BGLA 3P0FA 1Q1NA 4OFWA 3M5WA 1KL7A 4O2BA 4COOA 4W7SA 5CFLA 2GZHA 2NPOA 5A3QA 1GFSA 1KAQA 1Z4IA 3KKNA 3I4CA 3K8YA 2DE0X 5E6RA 3L6BA 2WD8A 3R9IA 4US2R 1DEXA 3G23A 4UVDA 5JT1A 1K8ZB 3AUFA 3PK0A 1X1SA 3HC7A 3A28A 1EBUA 1W4ZA 4K9QA 4PO3X 4YJ2F 4Y30A 1YJ8A 4EY8A 2IYEA 3R9XA 4QO7A 4RMHA 2W6CX 2XQFA 3ASYA 4ABTA 4M2LA 3O7WA 2JKVA 1QO9A 4QNRA 3H0CA 2GWHA 3GLFB 2X3UA 3G17A 1Z3IX 4LYYA 1XMJA 3JZMA 3A9UA 1JLSA 2M6RA 4MW5A 4BLRA 5BQ3A 5ILOA 2CLDX 2QQ0A 2J6HA 4ARBA 4F7DA 4K2AA 4R7TA 1ANKA 3K53A 2FMTA 1YS7A 2XQGA 2ADOA 3L6RA 5DKFA 5L4LA 2XAAA 4DADA 5A4MS 3PVCA 3JALA 3IAS1 4TLBA 2FZWA 5LBTA 3A9SA 4ZYZA 1VRVA 2W37A 5LP6B 2GO7A 4C0KA 2Q28A 3FYHA 2OESA 3JQDA 5EZ5A 1OOEA 1FSPA 1PNVA 2VJCA 3GP3A 2RGRA 3M5CA 2C7GA 3TLGB 3TR6A 2KWIA 3NXKA 4GYKA 3LBFA 1C8KA 3AEUB 3S5UA 2FEXA 1D1QA 1N4DA 1PJ3A 3SR0A 4EY7A 1KAGA 1UCFA 2B1RA 3QEBZ 3E5HA 1NJ1A 3D3QA 3HNRA 4PCVA 4A23A 4TYNA 2QI9F 3FETA 4EUKA 3N2LA 4MULA 1AV6A 1XZJA 3C6XA 1SKUA 3LYAA 5JDIA 1XMIA 2HTFA 4ERXA 3KSDO 4I50B 4M99A 1X80B 1EJ2A 1XF1A 2AFVA 1JQBA 5JYFA 1NL3A 3MBKA 2DFDA 4RKYA 3F5DA 1HQDA 1XNRB 1KFEB 4B5LA 1DKOA 1XXLA 4BNJA 3RBAA 3GP5A 4D4GA 3PDUA 2ZCUA 5C1BA 3FZEA 3GLGB 1WKBA 4BFWA 1FTYA 5A05A 1MNQA 3LUFA 2A0XA 1YE5A 1YZKA 4R41A 2PY6A 5TQJA 1KS2A 4XASA 1LW7A 3OIWA 2A57A 1SEVA 3GLHA 2Z4TA 5EC8A 1WP9A 2LRHA 3WIEA 4L4SA 3ZDBA 1BMFA 3CNHA 4YDQA 4FK8A 5LMZA 4UXIA 2JF0A 2DHRA 4ZU3A 4TYYA 1PR2A 2GCPA 2DUMA 1N6OA 3DG9A 1EZ1A 4DXHA 2AJCA 3QFTA 2PWBA 3EFOA 1OFGA 4MMYB 4Y9SA 3AESA 5JZMA 1LVGA 1OVMA 2BHRA 2W70A 4B32A 4HSEA 4ZKDA 1LXCA 3E84A 2QJRA 2Z2YA 2Z4SA 1P4JA 3ZHXA 3X0DA 4BNWA 2QVBA 4X20A 1GRCA 3W5HA 721PA 2CV2A 4I0WB 1YCHA 2V45A 4RVSA 1T1SA 3L6CA 2AZ4A 1GCGA 4OQNA 4RPGA 1MC5A 3HCRA 2ZJZA 3H18A 3QYAA 2DR2A 4BBAA 3CNOA 1S2IA 3VR3A 5IN4A 4O4JB 2ILTA 2WD9A 4NIMA 4MV6A 4YO8A 2GZ3A 2I4RA 3AX6A 1A7KA 1XMSA 3ND6A 3VBCA 3OEWA 2CXXA 2CVQA 4G8DA 3B12A 5KOJA 1B16A 2V7PA 4G0MA 3V6MA 3RFCA 1X92A 3JWJA 1F1BA 4I3GA 3JQ7A 1IU9A 3WGIA 2JLZA 5I01A 1QTIA 1EP3B 1H66A 4MPRA 4RGQA 3FKSA 3W6ZA 1X1TA 2CVZA 1JNYA 2Z8ZA 3AFGA 3ESZA 3JQEA 4UNQA 1G3MA 1QHXA 2GEBA 2Q6TA 1RKXA 4V0LA 5IAEA 4X24A 1UBCA 4YMSA 1E6WA 4TZKA 3PUJA 2WSLA 4YV0A 1VMIA 1GEGA 1ECPA 4TT3D 5C8XA 4J90A 4LF5B 2JJMA 3IT1A 4TXLA 3EIOA 4MRMB 3G0DA 3ROMA 1PL8A 3EPKA 1FSFA 3QU4A 3DHYA 3OLWA 4Q24A 5IC4A 1XAGA 2IU3A 4L50A 1GG5A 2VNAA 3GJ4A 4OKIA 4XCXA 3U0VA 2FZEA 4WJKB 5T57A 5AK4A 2YTZA 3FSGA 3DO8A 3FMFA 3ECSA 2RBKA 1OXXK 2OCIA 2NOAA 5UKDA 4OK6A 3DEFA 4A8JA 5K8IA 4N5NA 2C5LA 3DKVA 4UTPA 2QAJA 1TGVA 2R86A 3IODA 3W8FA 3RDPA 4W9RA 1ZVJA 5JEDA 3FNFA 2XZLA 3QIVA 1PDOA 3EARA 4G89A 1LVUA 1QK4A 1MXHA 4LG1A 2PXHA 4UCXA 1Q95A 5DTMA 3LFTA 3TINA 5I7SA 4PR3A 2X7XA 4L8VA 2PT5A 3M9LA 3F2IA 1O0CA 2QXUA 4B75A 4RPJA 2OCLA 3H0EA 3JWIA 5KYUB 2N75A 4A5SA 1MB3A 1ETHA 3ASUA 5J9GA 2KLBA 3WB2A 1M0SA 3KLMX 2A4MA 3PYXA 5E0OA 5DF1A 2JVJA 4ASUA 4OQMA 5JPCA 3DZ3B 2EARA 4Q02A 5FR2A 1KOGA 4P7FA 2R8YA 1N2JA 4MYTA 1YR6A 4YHBA 3ZQ4A 4EDFA 2FWBA 1SIUA 5K01A 2H7VA 2WFAA 8ATCA 4MUNA 4P33A 1Z0DA 2I4TA 3R24A 2XB4A 2YV2A 2HGZA 2BSAA 4AJJA 2O3RA 2SKEA 2YH2A 2ZBQA 1Q15A 2WILA 1CYDA 2IYNA 3MOSA 2J5BA 1P5HA 4M0FA 2EL7A 1RC8A 3STHA 2XNCA 5CK5A 5EY5B 1HUQA 1T1JA 3VR4H 1A5SB 2CDAA 3LJKA 1L8QA 4PIMA 1X9GA 1R6VA 4X93A 1PF7E 4JBYA 1UIMA 4UVIA 1ZKMA 1UJCA 2B0JA 2VHEA 4Z0PA 3CB2A 3GEHA 2PLFA 2YY6A 3GQVA 1XJWA 3PYLA 2G9RA 2QD2A 4R7ZA 5AVRA 3CPSA 5B4TA 5GADl 4ND1A 5ITWA 3VYWA 1P1FA 3FRJA 4UMDA 5T41A 4IKEA 4LJ4A 3R7AA 3VTZA 1I4WA 3NAZA 2YDYA 4O5AA 1JF8A 4QVKA 5KWJA 3W2IA 5CBPA 1DVRA 1Y6JA 1GYQA 1UANA 2H52A 3HR7A 3N7AA 1L5MA 1YVDA 2C4HA 2R44A 1Z5VA 3CX7A 3FFBA 5FLYA 3SDBA 1MORA 5KOYA 4M49A 2PBFA 4DZZA 2DT8A 1NVAA 5GWXA 2Z2XA 4I66A 3TRDA 5C1IA 5JNSA 4NU5A 1VOTA 1CRWG 3HNPA 1D1SA 2RBEA 5I47A 1SVUA 3QX3A 5AKJA 3ES9A 3L1UA 2I6QA 3O2NA 5CDHA 5JMWA 3QBTA 4LQ4A 2EOAA 2GI4A 1X14A 5AK0A 2NU7A 1W36D 2BFCA 2JK1A 4LK3A 4XFJA 3PQ4A 4MV5A 4GPEA 1KJIA 3LLVA 3VO8A 3DS8A 3GUYA 4R9NA 1VP9A 5IWAB 1XZAA 2XNDA 4ZN6A 3TW8B 2FGKA 1XTBA 1WXGA 2VK2A 3EPLA 2DB3A 3FUXA 3C1AA 1J1ZA 1EVIA 4FFSA 1RFGE 2CL6X 2BL4A 5A0VA 1OGYA 2B4AA 2EBFX 3LP8A 5TSDA 3EDMA 1U9ZA 4WOCA 1G5TA 1GPKA 1Z6TA 2G1KA 2YYZA 1DFIA 4QREA 3WWYA 1XT6A 4HPJB 4B4KA 4D9MA 2PANA 1OZFA 1PTJC 5AVJA 2CY0A 3QW4B 1CVIA 1YI8A 1AKEA 3B51X 3ZBPA 3VMFA 2RBGA 2WHPA 4AQ7A 2R1TB 3AY3A 3ZCQA 4A5OA 3J80A 1G8PA 1W88B 1WSWA 4ZO4A 3K6SA 1FS6A 1KP2A 1RLOA 5CK4A 4HLUC 3SIRA 3ANTA 2HX1A 3G2NA 1FTWA 5DH9A 4H31A 2RGWA 4CLDA 3D6AA 1JIKA 2FMKA 2PRSA 4OB8A 4B3JA 4AYTA 4AX8A 4AWBA 5H3HA 3WYDA 1FS5A 3H7IA 1K9VF 1NG9A 1Y4AE 2FW0A 3FZYA 5EZYB 1H0KA 1VP3A 4N40A 3LHKA 2HCBA 2MU1A 1CYEA 2M98A 3O4FA 3G9TA 1XNQB 3B1YA 4R31A 2P9BA 5IANA 3PXUA 1K68A 1W94A 4KLZA 3ZVLA 1V7QA 1UK8A 1RM0A 3BXHA 1N2GA 3IP1A 4KX5A 5CJJA 3FF1A 4ZYXA 1Q7TA 4HGOA 5BSRA 3IQZA 3PIIA 2LWIA 2G80A 1NVVR 1LDMA 3KR2A 1R10A 5G1PA 1WHTA 4AUMA 5JEEA 2Y0EA 4I4CA 5TEVA 3QW2A 4A26A 1KJNA 4MGHA 1XZBA 4QAQA 4F93B 4WZAB 3RS5A 1MMFB 1DBPA 1YBVA 3CRNA 5AM5A 2PZKA 4LSWA 3VBEA 1T3TA 3FDFA 3O8LA 5FQOA 2CD7A 5B7NA 2G9UA 2NU9A 3AIKA 5JRZA 2IE0A 3EGWA 3DBHB 3NDIA 1VPLA 1OYVA 1C1DB 3IIIA 5THKA 4B44A 2NO4A 5ARBA 1OLOA 5E4TA 4TZ0A 1KK2A 1WO8A 1FJGB 2GB4A 4CKZA 1KDVA 1KOJA 1C0EA 5IH3A 1K3TA 3LSYA 2FZVA 4FKBA 4OJNA 4Q9AA 2AFHB 4YQYA 4WINA 2X6TA 4RQBA 4H35A 1IPFA 4L5BA 1INLA 3KT8A 1P18A 1T9ZA 2H5LA 4G67A 4NCIA 4UU7A 3WY9A 1O97D 4EZEA 1OTHA 2MMGA 3E27A 2IWHA 4B7XA 5L3SA 4C20A 2H0AA 4GBGA 2CJYA 4NFHA 4QU0A 4Z8YA 3AVVA 2VF7A 3VO1A 3ANSA 3IWCB 1IDOA 2OFOA 1BFUA 1PGNA 4CM3A 2GPSA 3DZCA 4AY4A 2WFLB 2HF2A 1DJLA 3N7UA 1IZ0A 3JR3A 1Q7CA 3K92A 2IUFA 5JXGA 3ZDDA 1XCBA 3T61A 2PT7A 1HPLA 1SUCA 2WR8A 4KKVA 3PP8A 4PXSA 1Z6QA 3TOCA 4CEJB 3CRQA 3KWLA 1UDAA 2YIMA 1L4BA 3VGPA 3ZCUA 5D3MB 3PNBA 4D02A 4EZBA 2FLVA 2Y9PB 5C7OO 3QTTA 3I6IA 3VRHA 5CG1A 2QJFA 1QH0A 1XNJA 2C7VA 1AD2A 2PKXA 3VH3A 3ZXSA 4AP9A 4OQLA 1VXRA 1N57A 3RGGA 1ZC3A 4B3HA 5BV7A 5CDGA 3B9RA 3COJA 4PZAA 3OIYA 2ZLBA 3LNCA 2O19A 1YACA 3W5AA 4KIWA 3SZ3A 3Q40A 2ZRJA 1RZUA 4RE6A 1G7CA 5DP2A 3MRSA 3OICA 4IDOA 4FYPA 1M2GA 2ZAOA 1NLUA 1TF2A 3DMGA 4JEUA 3TOZA 2NUPB 4GZLA 1H1LB 2YV5A 1D0SA 2ZKLA 4FC7A 2PS3A 1YCDA 2A8YA 2GKSA 5IT9A 2BSXA 4DYVA 4QNMA 4LIPD 1XTKA 4GT1A 4EDHA 1ZRHA 3I1JA 2AUTA 2P6MA 1HC7A 1W1UA 2OZLA 1KDRA 1U31A 4X1IA 3W1WA 4RIEA 4X6LA 3EGDB 3HXMA 1YJAA 2ZJ5A 4O2BF 3A4MA 3DL2A 5ALUA 1KY2A 1EK0A 4EPWA 2BGTA 1WZCA 3C15C 2XB8A 1BGXT 2OKGA 1RWPA 1Z2CA 2WM8A 2Y6VA 3B78A 1L5GB 3FR8A 3KU4A 5AI8A 3KZVA 2XA2A 5AOAA 1WVIA 3A1CA 2PT9A 1CIJA 1V8PA 4ZD6A 2HMAA 1XCPA 4G56A 3RKUA 2JLSA 4AMYA 5HEKA 4OM7A 1PJCA 5K2MA 5CNJA 5CA0B 5IEJA 1L7BA 3N0WA 1AKNA 3RB8A 4K6GA 2Q1SA 5FR1A 5IJ0A 4DC1A 3WRYC 4FNGA 5C2JB 4ZO8A 3BQNB 3EPAB 1WMBA 5ILQA 3WSVA 4HB0A 2AZDA 1ULSA 1CP3A 1YULA 4QUJA 3QUQA 3AHGA 5DE3A 5L45A 3GLIA 4LJRA 3OFND 3T3EA 3VKUA 1CRPA 1E3QA 2PS9A 9GPBA 5IBQA 3FVTA 5A1TA 1V8OA 5DNWA 3V4LA 3V7FA 1SCKA 2R87A 3ENQA 2PU5A 3DHWC 4A1FA 3RQIA 2ZJFA 5CXUA 3PB3A 4HEA6 1U8AA 3V1YA 1FRFS 5LU9A 3DEZA 5E2IA 3DWEX 1FIUA 3MINA 3UOWA 4JBNA 3TE6A 4LQDA 5KPDA 3NH9A 2HRBA 4P1ZA 2HEIA 4U7PB 4CMIA 3UVEA 2QSZA 4BQPA 1KFCB 1CQJB 1FU8A 4JB3A 3FHLA 1SOAA 4JYBA 1CEEA 2AB0A 2XIQA 2Z1DA 1EK6A 4Z7QB 4XQGA 1ZJ5A 1ATZA 2X5NA 1JI0A 1UFKA 2ZJ4A 4W5RA 2PNFA 5CRIA 4JGGA 1NJ6A 1W47A 4D0GA 2A5LA 4KLCA 5MFPA 5I7HA 4Z2AA 1NXWA 4FN4A 5BMVF 2GN0A 5JLJA 3J81A 1BFKA 1AUPA 1JEEA 3R41A 4N0DA 5CDSA 1V47A 3HGMA 2O5VA 1P1KA 1H22A 4TKUB 1ZJWA 1QP7A 4A9AA 4CLOB 4DCCA 1FNMA 2CVOA 1PHRA 3NGXA 2F1JA 4UUMA 2HMTA 2AG6A 3D7MA 3UWDA 1PFYA 1QTRA 1USWA 2YVUA 3H8WA 1Z22A 1M0TA 1L6IA 2FPIA 2FRVA 3A10A 3HM2A 4YACA 1CF2O 1KO4A 5LQSA 2GN8A 3CIOA 1ZWLA 2P3LA 1IJFA 2YBDA 3AU9A 3ICCA 1SMKA 3LYHA 4FFDA 4IJMA 2JGLA 1K6EA 3DV2A 4LBZA 4OKNA 5T4EA 3RF6A 5JJKA 3ZK8A 1QDUA 1RXYA 1W19A 4MHSA 1H9AA 1RWMA 4DCJA 3KHKA 4DNFA 1HTWA 1U0BB 2IV7A 3ZWVA 1QE5A 3EBOA 3OP1A 1AQ6A 3QXXA 5IFKA 1KEKA 4U5QA 2P4EA 3GJ7A 5I9TA 5FTWA 1LDYA 3L1KA 4Z4CA 4CT5A 2ZAYA 3MIIA 2HEGA 2ZG6A 2WIJA 4YVFA 4EX6A 3SMQA 3W8RA 4MW0A 1DFHA 2X1HA 3G2PA 4LY3A 3MYRA 1IUNA 4GSYA 1CLUA 3E05A 2XD9A 3FBGA 4C08A 3T3NA 4C6HA 1TU0A 1GDTA 3MRXA 4JYPA