1H6AA

Reduced precursor form of glucose-fructose oxidoreductase from zymomonas mobilis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
381
structure length
381
Chain Sequence
ATLPAGASQVPTTPAGRPMPYAIRPMPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein translocation
molecule keywords PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
publication title Crystal Structures of the Precursor Form of Glucose-Fructose Oxidoreductase from Zymomonas Mobilis and its Complexes with Bound Ligands(,)
pubmed doi rcsb
source organism Zymomonas mobilis
total genus 129
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2001-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h6aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h6aA01
1C14A 4PLWA 1BDBA 4GMFA 4Y6PA 1ZCJA 3K73O 2EWMA 2WE7A 2DC1A 4YJHB 4ZQBA 3JQEA 2X9GA 5B4VA 1JW9B 1ZFNA 1JAXA 2PGDA 2NNLD 3JD4A 3KB6A 3RUCA 3UUWA 3GOHA 4GWGA 4O59O 3R1IA 3DZGA 5F5LA 4ND4A 3O8QB 3PWSA 4GVXA 4K6FA 4DQXA 3VTZA 4Z0TA 4AJPA 1XR3A 1YBMA 1BVRA 3D0OA 2NLOA 4XQ9A 1R4NA 1SOWA 2HQ1A 5K0ZA 4XZ3A 3DTYA 4K26A 3OECA 4Z9XA 2H9IA 1EZ4A 1PSDA 1LLCA 1UDCA 4DUPA 1JKJA 3AM5A 3EK2A 3DO5A 4CL3A 4E21A 1XCBA 5DT9A 4HXYA 4ND2A 5A06A 4S1VA 2IZZA 4QFDA 1PL7A 4YBZA 4AJKA 4IQ0A 1P74A 1O6ZA 1HXHA 2H63A 3VKUA 3GAZA 2P9GA 1LSOA 4D46A 3QWHA 4YAJA 1HEUA 2DU8A 3IUSA 4QX6A 3CH6A 3U62A 4ZGWA 4Q3NA 2P4QA 2BHLA 3L9WA 3LT2A 2VT3A 3NTRA 4BOYA 1E1LA 1R6DA 1P1HA 3OQ1A 3W4IA 2GR9A 1WWKA 2FRDA 1SAYA 1EE9A 1P0FA 4FGWA 3CZRA 3E9MA 4YACA 3UICA 1LRLA 2O3JA 1KVUA 1ADFA 4LK3A 1IOLA 1VPDA 2R00A 1VKNA 1J49A 4K1LA 4WEOA 4OGWA 1W4ZA 1SPXA 4D41A 1NPYA 2Y0EA 1NFRA 1R4NB 3JQ7B 2VCYA 1GYPA 3E48A 1C1XB 4H3VA 2W2LD 1M76A 1OZAA 3GLQA 1P0CA 4RORA 1X1EA 3P19A 4NBRA 4OSOA 3GPIA 4G65A 4YQYA 1Y1PA 3GGOA 1Q0LA 4B4OA 4FS3A 2DFDA 4A27A 4CL8A 4TWRA 2Y05A 4RDHA 1HZJA 3EMKA 4IJUA 3E18A 2BFMA 4CV1A 5L95A 1UH5A 2Y93A 3C7CB 4FC7A 3ZHZA 4J7UA 1P45A 3TL3A 4IS3A 2DBRA 4R4JA 4P8RA 3I9LA 1LRJA 1PJQA 3FBTA 3KOUA 3WTCA 3S2IA 3WTBA 3KZVA 3JD1A 4CM3A 5L45A 3JCZA 3RC1A 2EG9A 5B12A 1Q2XA 2O7SA 4CLRB 3DC2A 5L3ZA 3TZ6A 3NEPX 2CF5A 2NQ8A 2FHSA 4N18A 1ISJA 1U3UA 2CVQA 1Y7TA 1GYRA 4NK4A 3NYWA 4TROA 3PZBA 3DAGA 1N2SA 1FDVA 3VVCA 4PG5A 4HY3A 2CDBA 5JYEA 4I5DA 1PQPA 3M6IA 2PD3A 3GT0A 1E0DA 4J0EA 2YQ4A 3HN7A 2GD1O 3MCVA 4UUOA 5BR7A 2JKVA 4JLWA 4RVUA 4L76A 4NDNE 3H2ZA 3TFQA 3QWFA 3ZI0A 2H6EA 4YJGB 4B8WA 3HHPA 1Q7BA 4RLHA 5I8ZA 3WYEA 5BSHA 3PVZA 4JIGA 1MUUA 4EW6A 5EN4A 4DWVA 3MEQA 1I2ZA 3VZQA 1N7HA 2YQ5A 2FWMX 2ZTUA 1HLDA 3JQDA 3ABIA 3OEWA 1H2HA 3ADPA 3EUWA 5AXDA 1ZK3A 3BXXA 4O6VA 1DBVO 4PZCA 4BGVA 2OGUA 4DPMA 5IAAA 3GMSA 3RC7A 1B8VA 4UVGA 2VQ3A 3TDKA 1NHWA 3DOOA 3IDSA 3SVTA 1E3EA 3H9EO 1MX3A 3GVPA 1ZMTA 4J6FA 4OXNA 2ZQYA 4URFA 2Q4BA 4D43A 3GK3A 2JFHA 4CM6A 1GYQA 4Q3EA 1EVIA 1XSEA 3H4VA 4D44A 1GCUA 5AQ1A 1T1SA 5I9NA 1YWGO 5JDIC 3GA0A 2R6JA 4LVUA 3VH3A 1TA4A 1E3SA 2HMVA 2YV1A 1PL6A 2VZ8A 4FQ8A 1D1TA 1C1DB 1PZHA 2PR2A 3N7UA 4R5MA 1E1NA 4W4TA 4NFSA 4RVHA 5KKAA 4MIYA 1KVQA 3EYWA 3AU8A 4ZRMA 3HFSA 1Y5MA 1WNTA 5U9CA 3JYPA 3S8MA 3ZNNA 2PZLA 3D7LA 3U09A 3I52A 2IEBA 4A10A 2YHIA 3U4HA 4CV3A 3K30A 8LDHA 5G0UA 4BV8A 1QXSA 4RQUA 3IS3A 3RUIA 1J5PA 5THQA 1PWXA 1R0KA 3C7DB 1X7DA 2VRCA 3SEFA 4CUKA 5BSGA 1YVEI 3NAQA 3DEYX 4RVSA 5ICMA 4E4YA 3OHSX 4B4VA 4O63O 1H6CA 3QP9A 4KOAA 4R1UA 3UHAA 5JC1A 3RCBA 2Q2QA 4FOSA 4D3SA 4E5PA 5I7VA 3H7AA 3SJUA 4DXHA 5L40A 1DIRA 1DXYA 3TZCA 6ADHA 2B4QA 4FPXA 1UR5A 5DBIA 3G1UA 3VH1A 5CP8A 4E5KA 4DC0A 1GV0A 3ASUA 5TS3A 1ZEJA 1UDBA 2NVUB 3TPCA 5GMOA 4M1QA 1IZ9A 4GI2A 4XEHA 1HDZA 2X0JA 3AI1A 1I24A 1G6KA 1XEAA 2YY7A 4HFRA 2OUIA 3HFGA 2EP7A 4B3JA 1T2FA 2YHUA 2V6MA 4GGPA 5DZSA 2DUWA 4CMIA 1DEHA 4DA9A 4G2NA 2DPHA 1G0NA 2I6TA 1U7TA 3SC4A 2ZK7A 5ITVA 4WLUA 4B7XA 4XR9A 3AI2A 1YL5A 2NACA 4IXTA 4CM4A 2XXJA 3EAGA 4HNHA 4ESOA 4LSMA 2OL4A 3F1LA 3I9NA 1SO8A 4CM1A 1KEUA 1R4MA 1NXQA 1NYTA 3LLSA 3RFTA 5JCJD 4WUVA 3WGOA 3AOEA 4GBJA 3DMYA 4HBGA 1DPGA 3ETDA 3ICCA 5TJ9A 3KEQA 1FDWA 2AHRA 3KXDA 4BGIA 5B4UA 1JVSA 2Z1NA 3F4BA 4RPLA 3QVWA 1C0KA 2UDPA 3DOJA 3JQGA 1B3BA 1JWAB 5F3RA 1HZZA 5T57A 4TQGA 4BKPA 3PIIA 1RM0A 1TXGA 4JJIA 3UCFA 3OBBA 4CQLA 1V3TA 4J7XA 4Z6KA 1AXGA 2I9PA 4CMEC 4UAGA 3ICPA 3WQQA 2CUKA 5GY7A 4OQYA 4AJJA 5TF4A 4RZHA 1YOVA 5A3JA 3NDIA 1PIWA 4JP2A 3GY0A 1U8FO 4ZA2A 2VN8A 1Y81A 4MVJM 2IDZA 2P4HX 3QHAA 4BNMA 3HNPA 1LSSA 1JKFA 4C7KA 1ID1A 3V2GA 1B15A 2ZB8A 3MJSA 3QV1A 4TZTA 4CMBA 1A9ZA 3DZIA 1E5QA 4CM9D 5IXSA 1BTOA 5TC4A 5JYFA 2EW8A 3TL2A 3JD2A 5FEUA 3O4RA 2X0NA 4CMIB 4BO7A 3OA0A 2VWQA 4EITA 3PHIA 1S7CA 3BMQA 5HWSA 3ANLA 9LDBA 2YV3A 4BO0A 4R41A 2AXQA 2GN6A 3NX4A 1D4FA 1ZXLA 1B26A 2ZJ1A 1ZH8A 4E3ZA 2CVOA 4ND1A 4GQAA 1BSVA 1VI2A 1LBEA 3AUTA 2NQTA 2A35A 4HP8A 2DBVO 1R4MB 3AU9A 4YAIA 3DWFA 1O9BA 3PRJA 4M89A 3OIGA 1EFKA 2HK7A 3BZUA 1Z7EA 3RFXA 1N5DA 4IZIA 3GQVA 4EYEA 3PJDA 2CZCA 1QYXA 2PD6A 4GX1A 1W8DA 1JWBB 1XWFA 1Z82A 1DIHA 5EJ2A 3E9QA 3MTJA 1LDGA 3WB9A 1UZLA 3JQAD 3K8ZA 4BNFA 1A4IA 2CSUA 4R1TA 3NTOA 3GRKA 3WIEA 1GDHA 1EVJA 4TKMA 5ES3A 3ZN2A 1ISGA 1QRRA 3EY4A 3L6DA 3ZWNA 3F1KA 3E82A 4PLTA 4KWIA 4WOJA 4CQLB 5L4SA 2AEMA 4S3MA 1CQJA 3V2HA 1EVZA 3BA1A 1MG0A 1F12A 2FPGA 2ZTMA 3I9MA 3WDSA 4KUGA 3H8VA 1OC4A 1OI7A 1HKUA 1RWBA 4BNZA 2Y1OA 1I0ZA 3OEYA 4CUZA 1ZK1A 2FOIA 2Q1UA 4BNHA 3L9XA 1X7GA 2OFPA 3E1KA 2O50A 1IY8A 3WR5A 4Z9FA 5JAQA 2ZTVA 3LDHA 3RAJA 4OJNA 5JLAA 1O5IA 3EVNA 4BIIA 2WEKA 2EERA 3LVFO 3RASA 2O2SA 3U4IA 3B1JA 3KYCA 4NIMA 4IJVA 3JQ9C 3OH8A 2HU2A 2EKQA 5DBGA 4ROSA 4I8XA 2OBYA 3SXPA 1VJ1A 4IDCA 5CEEA 4PLGA 3LT1A 3RFVA 3ZWCA 1FDTA 5BNIA 2VOJA 3CE6A 2H5LA 4BV9A 4OIMA 5KKCA 1QYCA 3LT4A 4MIEA 1LNQA 2C2XA 2YUTA 2NTJA 4FCCA 3WOHA 4FFNA 2ZYAA 3PHJA 4P4LA 1BXZA 1TLTA 3FI9A 3GMDA 1A7KA 5A5EA 5I8WA 5LDHA 1FK8A 3NT2A 3DBLB 3ONEA 3ROKA 1I36A 3VHRA 1AGNA 1P1FA 4OKNA 3FPLA 3PYMA 4CR6A 3MJCA 2V7PA 5H81A 5IFLA 2BI8A 2GYYA 3KSUA 1WPQA 2Q50A 3QVSA 3MJEA 3AI3A 4UVIA 1ONNA 3QRWA 4KUEA 5AYVA 3KLPX 4W99A 3F5QA 2QG4A 5DBFA 2Q2WA 1CRWG 4BNTA 5A9SA 2W8ZA 1K3TA 2D0IA 4AJNA 1Y6JA 1K89A 4E31A 1LC3A 5I7EA 3IAHA 4RLSA 3FN4A 1W0CA 4NR0A 2FP4A 1BXGA 4UEKA 3DOCA 1DFHA 3VKVA 1GQ2A 3IP3A 4ZQHA 2AG8A 2HMWA 2IE0A 3ZWWA 1LJ8A 1ZBQA 3D5TA 1F14A 3D3WA 3G3EA 1LDBA 1DRUA 1ZO8A 4QXMA 4NBTA 4U7WA 5ILGA 1G0OA 4BO1A 1K6IA 3FR7A 3GG9A 1WZEA 1GTMA 2PGJA 4CV2A 2E48A 1NVTA 1NPTO 2OOSA 3ADOA 4EBFA 4Z0PA 4BNLA 4MVJD 1CDOA 4CLOA 5G2OA 4CLXA 2DLDA 3PIDA 4HKTA 1T25A 4D3FA 4J3FA 4EJ0A 1YB4A 5L53A 4DPLA 1VL8A 5GZ1A 2NADA 3L6EA 3NKLA 4HX5A 4IJWA 2ZCVA 2P5YA 4RF4A 4R3NA 5LCXA 4BNGA 1BWSA 3RSHA 4FJ2A 2QRKA 4BNVA 2X9NA 4Z3KA 5THKA 4F45A 5B4TA 2OZPA 2AW5A 1DC3A 2P68A 3K2EA 1ORRA 1X0XA 4PLZA 5AXCA 1PJCA 4GLLA 5TJHA 3PTZA 3DONA 4DQUA 2GGSA 3AUAA 3E9NA 5JY6A 2O7QA 4RJTA 3TN7A 1TT7A 4MP6A 2J3JA 3KVOA 5KNLA 2C5AA 1YE3A 3ZNPA 2I67A 4HV4A 2NVBA 4Y98A 2PK3A 3RBXA 2VHWA 1B8UA 3PJEA 3H5RA 3SLGA 4E6PA 3ZU5A 4QO8A 2FN7A 5ER9A 1QV7A 3JV7A 5A9SB 4I5FA 1X14A 4WEQA 2W98A 5HA5A 4ALJA 3ASVA 4J0FA 1N1EA 1JU9A 4MP8A 3GDOA 1BW9A 2QZ9A 4PGFA 4P4GA 4EEZA 1KVRA 3D3WB 4XYBA 1I32A 3C3XA 4YJHA 2I99A 2WD7B 1OC2A 4JBIA 4DLAA 1I2BA 5IN5A 3ZU2A 4CLEA 1IHYA 2VYNA 3WG9A 4Y8VA 3ITDA 1Y5RA 4CLOB 3JQAB 3O8QA 4IMRA 2Q22A 5ICSA 2BRUA 1YQXA 1DRVA 3JQ8B 5KJ6A 3PLRA 4RF3A 1E1MA 2JHGA 1E3LA 1GEGA 3NTQA 4CM5A 2C82A 3VPSA 3H6KA 4WCFC 4YT4A 1TEHA 4BNIA 5CDUA 3GF4A 1LX6A 2PH5A 4FFLA 4YWJA 3IMFA 1XDWA 4PG4A 1F0YA 1SMKA 3ZNQA 3H3FA 2O3QA 2J8ZA 4E2ZA 4NI5A 2VT2A 2RH4A 4IMPA 2FR8A 2QQ5A 4FN4A 3W6ZA 4B3HA 4AFNA 4PLVA 1QYDA 2UV8A 3VC7A 5IN4A 3D4OA 3WGIA 1MGOA 3RJ9A 3LC1O 4R16A 4CR7A 3HUDA 2JD2A 1JKIA 3ZV3A 4OOEA 1BW9B 4NBVA 3LF1A 4CQMD 5EINA 2PKRA 1I01A 5F1KA 1HDGO 4WE3A 3RKRA 4WLNA 4YT2A 1NHGA 5EL0A 1EE2A 2VYVD 4RF5A 1BMDA 1U4SA 2W4QA 4OHUA 3W8EA 1GEEA 5L7TA 2X7HA 1HDCA 2Q4EA 3FF4A 3L07A 1SNYA 1UAYA 3B1KA 1PJSA 1XQ6A 2XPCA 2I3GA 4JK3A 3IJRA 5KJ1A 1PZGA 4U8GA 5H83A 1U8XX 2OP0A 4F46A 2HSDA 3JQ7A 1O95A 1C1XA 3GHYA 1TI7A 5JDIA 1IPEA 1GZ3A 1GL3A 4ONEA 4UULA 3R3JA 4BO8A 4RVDA 4XDYA 3NUGA 4BB6A 2VZ0A 1XIVA 1EUDA 1EBFA 2V65A 1T4DA 4A7PA 3ZWMA 4H7PA 4XGKA 2BD0A 4YCAA 3IKVA 1V6AA 1NQ5A 1TVEA 1HF3A 2ZCUA 4R54A 2OBNA 2PKQO 3DTTA 3P2YA 1ARZA 5G4KA 3K96A 1YQDA 4J4BA 2AE1A 4BKQA 1ZXBA 1V0JA 5CFZA 1UXIA 1HE4A 2B4TO 2EV9A 5CDGA 1U3TA 4ZN6A 3DZJA 3WJ7A 1HWYA 3OIDA 4MIOA 2V6FA 4CLRA 1AHHA 3GR6A 1PZFA 1T2EA 1ZEMA 2C7VA 3PLNA 3COSA 3RU9A 3C1AA 4NJOA 5JO9A 3RUEA 4N5NA 1E7WA 1X15A 3EW7A 1GR0A 3FNEA 4GAEA 4IXWA 1NVGA 3QIVA 2HMTA 4RO0A 4FD3A 2YW9A 4E2XA 2E49A 3B1FA 1VSVA 4WCDA 3UAGA 3MOGA 1H6BA 5TX7A 1T24A 2RIRA 3LT0A 1BHSA 3P5SA 4FIZA 1EK5A 2J5KA 4YJGA 3RBZA 1VC2A 1QYWA 1OAAA 3I83A 3VZPA 4LISA 5A3VA 4DGSA 3ETEA 4H16A 2FMUA 3JQFC 1NQAO 4JXKA 4YRDA 4DLLA 1ONPA 2AQIA 2X4GA 4U6SA 2F1KA 3WGYA 5DCWA 4WOKA 4CMJA 3UCEA 1A5ZA 1PJBA 3WWYA 3OSUA 3ANNA 1PL8A 2PKQP 3HADA 4BHTA 2YFQA 2QYTA 5K6AC 5EERA 1F8FA 3CSDA 4LW8A 2HDHA 1PGJA 3JD3A 5ILOA 1NX6A 1NAIA 5G0VA 3ST7A 5G4KB 3ZH2A 3LC2O 5TQVA 5U4QA 1UZMA 1NFFA 1VSUA 4FB5A 4IUYA 2P9CA 4CM7A 2NVWA 4MVJH 3JD0A 2POQX 1P1RA 2UYYA 3AM4A 4BUCA 4EZBA 3FPCA 4IGFA 1OFGA 5JDCC 1HDYA 1C1DA 2Y66A 1ISHA 4YYZA 5L51A 3ORFA 5A9RA 5JO0A 1P33A 3VZSA 1R12A 4W9NC 3LU1A 5T73A 1IYZA 4JBHA 1NR1A 4KZPA 5CDYA 1LSUA 3PGJA 4HFNA 4JGBA 4RPJA 4CV0A 3FHLA 3KTDA 4LVCA 2Q99A 3ZHXA 4AJ2A 1AE1A 2J3KA 4OYRA 4CMEA 5JBIA 5L7WA 2X22A 4BKUA 1YH3A 4E5MA 3A28A 4RPGA 2P5UA 1PR9A 4YVFA 4J4HA 3RU7A 2P91A 3OETA 2YDYA 4PZDA 1UDAA 5AXAA 1TT5A 2AG5A 3RJ5A 4N5MA 3WMWA 4ALMA 5BNTA 3VOSA 3WGQA 4I9NA 5CPBA 4ITUA 3M2TA 4RL6A 1X13A 2G0TA 4M86A 1ONOA 2VWGA 4YEDA 4DREA 2D5AA 2DKNA 4MDHA 2CDAA 1NASA 1UXHA 3RC2A 2VNAA 2AE2A 3D64A 3GHHA 1WVGA 3EHEA 1KEPA 1PJ4A 4EJMA 4LRSB 4RCVA 2W2KA 1N92A 1XG5A 3NV9A 4Q3BA 1DIBA 4YAGA 4BMNA 3W4JA 4AJ4A 2I3AA 3HSKA 2NVUA 1ZSYA 3WS7A 1DAPA 2C59A 3V1UA 2YV2A 1PGPA 2H1SA 4OH1A 4CQMB 5DF1A 2ZJ0A 3GVCA 1GCOA 2JFFA 2ZQZA 3WFJA 4GKBA 1OBFO 1U5AA 4EGFA 1MXHA 4U0JA 2GZ1A 5ADHA 2CFCA 4R01A 1NQOA 4CMAA 4B8ZA 1XLTA 1A7AA 2C07A 2JCVA 4XYMA 3RUFA 4CODB 3VPHA 1MFPA 2Q45A 1C3VA 3N74A 4FFMA 4XYGA 2C0CA 2PFGA 2Z1MA 4YTEA 4E13A 3PGXA 3CZMA 3ZWVA 4D79A 4ALKA 1I3KA 1FJHA 1K6XA 3NJ4A 3ZGYA 2GNAA 5IDWA 1CERA 2WDZA 3OM9A 3ONDA 4XGIA 3W6UA 3GVHA 3JTMA 2D59A 2C5EA 2W2LA 4JX8A 1DC4A 5JCXA 2B35A 4W82A 4W7HA 5CPFA 3UXYA 3OP4A 1LXCA 4YJFB 3UOGA 4Z3DA 1NTOA 4OL9A 4FSHA 1TT5B 2VHXA 5T8KC 4CLHA 2Y1CA 4J43A 2X8LA 3GUCA 4A03A 2PGLA 4BNJA 2X1HA 1QMGA 2O48X 4NJMB 2ZIZA 3CMCO 3TZHA 1NWCA 3G1TA 3G17A 2FY8A 3JQ9A 4GGOA 3RUAA 3WGTA 2DTDA 1DDOA 1YKFA 4OAQA 2W2KB 3W1VA 1U9JA 1A72A 4B7UA 1ZW1A 5CAEA 2Y1GA 4E0BA 4KTTE 9LDTA 2PV7A 5G0TA 1YS4A 2B36A 4NMHA 4DMMA 1R16A 1E7SA 3LF2A 4D45A 5TT0A 2WMDA 4BO4A 1Q0HA 3L4SO 3AK4A 5A4DA 1KC3A 1MXFA 3HDYA 4JROA 4YAEA 3F46A 4DYVA 3ZU3A 2WE8A 1H6AA 4IDDA 4WGGA 4Q9NA 4A73A 1WDLA 2VHYA 4K9DA 2HRBA 5A03A 3UN1A 3I3OA 2DTXA 2VHVA 2IEDA 1D7OA 2XXBA 1H0KA 3A1NA 3U3XA 3AY7A 4R5HA 3JYOA 3DL2A 3E5MA 4BNNA 1O0SA 1JAYA 3K9QO 1YO6A 2X86A 3HWRA 4OO3A 3IOYA 2G1UA 4J1SA 3ZWBA 1VM6A 2VUTA 2BELA 4WPGA 2RBEA 4JNKA 4N7RA 3FNGA 4I9UA 1MFZA 1U1IA 4EEXA 2C20A 2G76A 1DRWA 3IQDB 1GUFA 1KY5A 2ZB4A 3D4NA 2QYSA 3RBVA 1GQYA 2Y67A 3LYLA 4RVGA 4UVHA 5KVSA 2PA3A 4F6CA 4M55A 4QT0A 3GNQA 2NTVA 2LDBA 1DAOA 1WDMA 1PEDA 3H3JA 2CMDA 5FFFA 2PWZA 1PGQA 2ZB7A 1M66A 3KBOA 3EZYA 2BFPA 1U2GA 4NFYA 1V9LA 1GQQA 1YDEA 3DZFA 3C7AA 3IP1A 1QR6A 4I5GA 5IZCC 5A04A 1GU7A 1UZNA 5IJZA 1LEHA 1LQTA 3NGLA 3UKOA 1WW8A 4I5EA 3INTA 4NNJA 3WQRA 1XU9A 4KDFA 4BMVA 5A5FA 3Q1LA 3H9QA 4PN3A 4YRAA 2XOXA 4XA8A 2IYPA 5BT9A 3ROQA 5KJFA 1QORA 2GN8A 4B4WA 4PLPA 5BQFA 1P3DA 2VHZA 3WSVA 2IXBA 2QZZA 4PFJA 1R15A 3ZHBA 5COQA 1HLPA 1N7GA 3Q3CA 2TMDA 3GH3A 5DN9A 4BO9A 2WSBA 5LDGA 3GEMA 1HRDA 3FBGA 3GGPA 1DO8A 1GZ6A 1Z45A 3OJ0A 3QVOA 2JFGA 4BO3A 4PVDA 1DHRA 1PU2A 1EDOA 2JAHA 4IDGA 1E3WB 1ZK2A 2O3SA 4N54A 2IZ0A 1PJTA 4II2A 4HFJA 3VPXA 2J6IA 1QG6A 4GSLA 2AQ8A 3BTVA 3C1OA 3Q11A 5FI5A 2J3IA 2ZKLA 2I5PO 5EIOA 4E30A 2EW2A 4G5HA 3FWZA 3CUKA 1SB9A 5IZ4A 1KOLA 2E4AA 4IBOA 3DBLA 4ALIA 4OM8A 3Q2KA 4DQVA 4EDFA 3GFBA 5CEFA 1LLQA 3TZQA 3GAFA 4L9RA 1WLYA 1IL0A 4LN1A 1PJLA 1ULSA 4JP3A 7ADHA 1DJNA 1N9GB 4G81A 4B3IA 1Q7CA 2AEFA 2OO5A 2WYWA 4FW8A 3KSZO 2NTNA 4YT8A 4L0QA 1PS0A 3GNSA 4PZEA 4NQZA 5COBA 5I7FA 3DDNA 3HQ4O 1U4OA 1Z73A 3LZ6A 3CEAA 3S2GA 5FI3A 4WCFA 5LC1A 2EHDA 3V8BA 5JSFA 1IULA 3C24A 4NBUA 3RUDA 1AUPA 3IL2A 1YGYA 2O3TA 5K9ZA 2Q46A 2EXXA 3K5PA 4L4SA 1Z6ZA 2VUUA 1U28A 4PG7A 3ZV5A 4BQPA 5JCJA 3F47A 1YL7A 1M75A 1EEHA 1I3NA 2Y99A 3RI3A 2Q1SA 3HG7A 1IE3A 3DMTC 3VH2A 1T4BA 4YRBA 4K6CA 1D3AA 3F9IA 4CR8A 2E6UX 3HB5X 2VWPA 1ENOA 5JMPA 2A92A 3K31A 3ZCXA 4UREA 1CEQA 4C7JA 3AUUA 5L4LA 5BSFA 1Z75A 4BO6A 2RHCA 3PZRA 2WM3A 4J91A 2OP1A 5JY1A 4PG8A 1EK6A 3D5QA 4L74A 4IDBA 4O5OA 4AVYA 3F3SA 1T1RA 3AM3A 1U2DA 1E6WA 1SEVA 3O03A 1WZIA 3VDQA 5J23A 2GDZA 1BGVA 1FF9A 1V8BA 3CXRA 3PFFA 4GVLA 2BGKA 4UUPA 1JTVA 4WLFA 3JQCA 4UUMA 1NP3A 4LCEA 3S2FA 4DLBA 3I23A 3PQEA 4D3DA 4J2OA 1L1FA 2HO5A 1EMDA 4MVJG 5ER6A 1Y9EA 3PXXA 5KIAA 4LRTB 1T2DA 4CM9A 3WBBA 3PYLA 1LDMA 4ALNA 1L7DA 4C4OA 1U3WA 1E5LA 1YJ8A 3L4BC 3PWKA 4BB5A 1KYQA 5JAIA 2HUNA 1W6UA 4FJ0A 4IZHA 4GWKA 3R0IA 4U6QA 1H93A 4WCFB 4W7IA 4B7CA 2PZKA 1NWHA 5CG2A 4BVAA 5HS4A 2FPPA 1WDKA 2C29D 4D0RA 5BSEA 1P9LA 4DIBA 2BGLA 3QA9A 3K92A 2WYVA 2HK9A 3NT5A 5L7YA 1ENPA 3V2UA 2WD7A 4MPDA 4ZD6A 4GPD1 3DZHA 4YXFA 4GSKA 5I7SA 4IIUA 3WSWA 4GH5A 3GRPA 2J3HA 1HSOA 1HETA 4JBGA 2EJVA 3BTSA 3BTOA 1RM5A 2DM6A 3PDUA 5JS6A 3JQAA 5KVCA 1I3LA 5F1OA 1I8TA 4BO2A 3RC9A 3IJPA 3JQ8A 2AQKA 3MJ4A 2BLLA 1O94A 5I9MA 1PJ3A 1P1IA 1RM4A 5KCZA 3QW2A 1HSZA 5EPOA 3N58A 2F00A 4NH4A 3LC7O 3QVXA 4XB1A 1JVBA 2AEJA 4RQTA 3FTNA 1VJ0A 4PCVA 1HE2A 2X58A 3GZ4A 3CIFA 5G0WA 1EBUA 2GLXA 3ENNA 3I1JA 4QFCA 4ZQEA 1N1GA 5B1YA 2D2IA 5JC8A 2NUAA 1O89A 3LSYA 3T7EA 5L4NA 4L8VA 2J5QA 3TQHA 5JXWA 4EJ6A 3GG2A 1U5CA 3KETA 3OQBA 1HL3A 1UP4A 2B5WA 2EEZA 4J49A 2EP5A 1VLLA 3WYCA 4BO5A 4DIFA 1BG6A 4P4NA 4UVDA 1YRLA 4XYEA 4BKRA 4IPTA 4J1QA 3MJVA 3QLJA 4PLCA 1W73A 4JCOA 4ZRNA 2EGGA 4CPDA 3KYDA 2JJYA 5C7IO 3FRJA 3VDRA 1NAHA 1AXEA 3ZW8A 3JQFA 3WWZA 5IDXA 3HDJA 5A05A 3ZNOA 1G1AA 4MVJP 5HM8A 3QWAA 2XF8A 4Y67A 2B83A 4NZ9A 5EMHA 3AUSA 2NU6A 3RKUA 5K6AA 4WLOA 3E5RA 4DBVO 1GZ4A 2EKLA 4ND3A 4CLDA 1NFQA 4RPHA 3BMCB 5JYDA 4Q3CA 2D4AA 4TZKA 1VL0A 3QE3A 2WD8A 2D1YA 4YPOA 1GY8A 4TVBA 5HBRA 3ENKA 4OXKA 4PLHA 4M87A 2PZJA 3W8FA 3AY6A 2Y1EA 1ZKMA 5JMWA 2I76A 2HK8A 4RPKA 1MC4A 4XKJA 1SCUA 3WLFA 1JN0A 4RV9A 3WX0A 4CMGA 4D7AA 5JDCA 3B6ZA 5ENDA 3KYBA 1DJQA 3PJFA 2CVZA 3NT4A 1DSSG 2YJZA 4W9NA 1PS8A 1GADO 2GN4A 5KOIA 4NU6A 4GX2A 4CM8B 2WYUA 3QVTA 2C54A 1BVUA 3KRTA 2HCTA 4JJFA 3WQSB 4YQZA 1VKOA 1J6UA 2IZ1A 3FWNA 4YDRA 3H9JA 2O3RA 3DAFA 4MP3A 4AJEA 3DB2A 3TFOA 1X7HA 4IDEA 4AL4A 2OMEA 1XHLA 5AVOA 3WIDA 3KYDB 3L0DA 2BF7A 4DL9A 1EQUA 3BMNA 5MGBA 4MOWA 3GDFA 3VH4A 3U5TA 5HS6A 4CMKA 3PWZA 1CYDA 2V6GA 2GO1A 3BMOB 1NNUA 3NJ8A 4MVJA 3DBRA 2GZ2A 3ZHYA 3PPIA 1NBOA 2EF1A 3RUHA 1NM5A 5U1PA 5A1TA 2X5KO 2BMAA 5TLSA 1KEVA 4D0SA 3OMLA 3G49A 5AOVA 3TNLA 5H82A 4F3YA 5TNXA 3AOGA 3H2SA 3CPSA 4PIVA 5G0SA 4GX0A 5GZ3A 3U4DA 4Q3AA 1Q7GA 2ILTA 3OJEA 2FPIA 4ID9A 2AMFA 1Q0QA 2FZEA 3DZKA 4FJ1A 1FDSA 5DULA 4FGSA 5TSDA 3HJAA 5JW6A 3G79A 1ADCA 1PGOA 4YT5A 4BKOA 3SC6A 3PFWO 3WNQA 2A4KA 4DYDA 2FSSA 1UXKA 1KVSA 3DAPA 4I08A 2X9VA 1Q1NA 3VAZA 2NSDA 1V3VA 1A4UA 4KTVE 4GL4A 1J0XO 4NBWA 1OOEA 4QO7A 4WNCA 4BNUA 3KHUA 1DLIA 3VPFA 4OQZA 4CMCA 3GN2A 5J9GA 2CY0A 3Q2IA 5T8KA 3HZZA 4TRJA 4B79A 1F8GA 3GZNA 4TRRA 2B69A 3BMNB 4MVJF 1A9YA 3LQFA 4M54A 4PLYA 3M1AA 3KV3O 5L9AA 3IKTA 1ZZEA 4B4UA 1P1JA 3U9LA 1YB1A 2I65A 3DBRB 4JN6B 3R6DA 1PGNA 3I4CA 4E2WA 4AJ1A 3GFGA 2GN9A 4OSPA 5IDQA 2D5CA 3UCXA 3FD8A 2DFVA 3AY3A 3JSAA 3IIEA 5TGDA 3E6AA 5TIIA 1N8KA 1HE3A 1DB3A 4RGBA 4XIYA 3SX2A 3ZU4A 1PX0A 5C3MA 2Q1WA 1E7QA 1R37A 4IQ8A 1O8CA 4FFRA 4XQCA 2X0IA 4R68A 1E77A 1PTJA 4EUHA 5EQFA 5EQDA 3GVXA 3INRA 4P22A 1ZJYA 3O26A 3JQBC 2HJSA 5C7OO 2UUPA 4ILKA 4R69A 5CG1A 4TMFA 1GUZA 3KSDO 1LSJA 3BIOA 3PHHA 1HE5A 2B5VA 4BNYA 4MKXA 5KVQA 2IODA 1ZIDA 1IZ0A 3EGOA 3FNHA 1J4AA 1P77A 2W90A 3QQPA 3PK0A 2CD9A 3TWOA 2XAAA 2SCUA 3SBOA 2BI7A 3TRIA 2BFAA 2DTEA 4ZQFA 4LCJA 3MWDB 4XWYA 4CQMA 2OXIA 4KP7A 2VRCD 1E7MA 3GZNB 4XQEA 3DHYA 4E32A 4J2HA 2HKIA 4IIVA 2VYVA 1JA9A 1EDZA 1M6WA 3GNTA 4TVOA 4WECA 2NU8A 2X23A 1NR7A 5MDHA 5DP2A 4A0SA 1IB6A 1KERA 5JPIA 2HAEA 3RD5A 1B3RA 4XIJA 1XQ1A 3P7MA 4KUHA 1VJTA 4ZQGA 4HNGA 3OA2A 2ZYDA 3TSCA 2B4RO 5IZCA 1CETA 1V3UA 1DIAA 1L7EA 1Z7BA 2Y0CA 3I9OA 4DC1A 4YJFA 3GEGA 4J1NA 3A14A 4L73A 1H94A 2HRZA 4IJKA 4YR9A 1GPJA 6LDHA 1PJ2A 2EKPA 5KJCA 2JCXA 1XGKA 1LDNA 3UF0A 5DNAA 1HYGA 1UP7A 1WMBA 2G82A 5F5NA 5ITWA 4NJMA 1JQBA 3JYQA 2Z5LA 3DHEA 4MKRA 3FR8A 1SBYA 1D8AA 3MTGA 3A4VA 2P2SA 1HDRA 3MWEB 4XRGA 4U5QA 1KBZA 2Z95A 3I6QA 3FCOA 3GPDG 1PQWA 3GC6A 1CQIA 2FSVA 3PEFA 3ZV6A 1SOVA 2A9FA 3Q9UA 4Y9DA 4ZJUA 3PQDA 1AN9A 2UAGA 2BH9A 1KC1A 1CF2O 3R3SA 2VTDA 3PHGA 2P9EA 3D4PA 1A71A 2GSDA 4MO2A 3UVEA 3BYZA 4E12A 2ZYGA 3AFNA 3NRCA 5KWEA 3PHLA 1Y8RA 1M2WA 2JAPA 2B0JA 3PP8A 4H15A 1XU7A 2UVDA 4HFMA 1VRWA 5JE8A 1TB4A 1LLUA 4GKVA 1I2CA 2PTGA 2QRJA 2Q2VA 1ZK4A 3KO8A 1SEPA 2VWHA 2GERA 1CWUA 1C0LA 5M6DA 4JJGA 4I1IA 1H5QA 1GUYA 4XRRA 2BKAA 5T67A 3ITKA 3K2BA 3B20A 2PY6A 4AICA 2LDXA 1LTHR 5I9LA 4J9VA 3WYBA 4RVFA 1FDUA 2DPGA 3SLKA 1HTBA 3HN2A 3ZWAA 1C0PA 4LMPA 4AJLA 1XELA 1WP4A 3BHJA 3OIFA 3PDJA 1DC5A 1V35A 4EUFA 2X5JO 3BTUA 1RM3A 1FMCA 2ET6A 4BL5A 3TOXA 1H6DA 4IINA 4J90A 1DHTA 4BGEA 3WGZA 3LLVA 5IDYA 4FFOA 1YBVA 3ZZNA 3JYLA 3DMTA 3BAZA 1LI4A 1KEWA 4FBGA 1H9AA 4FOOA 4KMSA 2E82A 1D1SA 4CUJA 4J4TA 4BMSA 5DCUA 1I10A 3E03A 3STHA 2X0RA 1M67A 2JL1A 1MV8A 2GPTA 4IQGA 2IXAA 1NPDA 3CKYA 4NG5A 2ZATA 1Y8RB 3HDHA 4IM7A 3RIHA 4W6ZA 2D8AA 2R00C 5EESA 1F06A 3GDGA 4ZU3A 2HLPA 1ZSNA 4R9SA 3M1LA 1B14A 4UUNA 4BNKA 3JQ6A 3OICA 1OMOA 5KTKA 1KS9A 3Q6IA 1R0LA 4TSKA 2O4UX 4XYLA 3CTMA 1ADBA 1H9BA 3E8XA 4XX0A 4ZHSA 5FF9A 2Y68A 4Q3DA 4AJHA 1KIFA 4QSMA 2WJPA 2IYOA 1E3WA 1K2WA 1LDYA 4R3WA 4MKZA 3L4BA 3S55A 1BDMA 2O4CA 4Y6RA 2WWRA 3X2EA 3DR3A 3B70A 4BNXA 3QJ5A 4IS2A 3H5AA 3ANMA 1IUKA 1AHIA 3ULKA 5F1PA 1BXKA 4WJZA 2IRWA 2YHIB 3RWBA 4DTIA 1PQUA 3UW3A 3SJ7A 5DDIP 1FXSA 2X5OA 3MOIA 2X6TA 1YXMA 3Q0EA 4KDEA 2Y1FA 3I4FA 1T2AA 1DOHA 1I3MA 1H2BA 5C5IA 8ADHA 2JHFA 1RYEA 1N9GA 4KWHA 1VL6A 5BNFA 5FWNA 4XJSA 1F17A 3QWBA 3HE3A 5C7LO 3LK7A 4TRNA 4I9HA 3L77A 2PZMA 5A9TA 1GD1O 3EZLA 3G0OA 4UEJA 3ONFA 1XYGA 1T26A 1KETA 2EIHA 3CINA 2FZWA 4OXYA 5C37A 2DQ4A 4GLOA 4DVJA 4U0KA 3WGGA 3UFXA 1PR3A 2C2YA 2NWQA 1QSGA 4X54A 3RQSA 1R66A 4AG3A 3H9GA 3WNVA 4EUEA 3F4LA 3FTPA 3DFUA 2HMUA 3D3EA 3FNFA 1I30A 2JCYA 2B37A 2PNFA 3EVTA 4WASA 3WMXA 2HJRA 3UGKA 3WBFA 4E5NA 3PYXA 4J1TA 4UVEA 2OHXA 3HDQA 1B8PA 1U7HA 4PVCA 1ZVMA 4WLEA 4R1NA 4J9UE 1HYHA 3L6OO 1YONA 3V5NA 3ZWXA 3NGXA 3VVBA 2GRAA 3ZWYA 3OJOA 3OQ6A 1HDOA 4XDZA 2DT5A 1EFLA 1MC5A 2NV6A 1K6JA 1UJMA 5FYDA 2AA3A 2G17A 4PG6A 4CM4B 3V1YA 4IDAA 3QWIA 4QTZA 4XB2A 5DCYA 3S1LA 3WXBA 3DHNA 4ALLA 3I6IA 1E7YA 3X2FA 4CJXA 3RROA 4WKGA 3ZWPA 1LRKA 4BS9A 4L4XA 1DFIA 1Y8QA 1E92A 4XQGA 5HTOA 1RKXA 5JFOA 3T7CA 1YBAA 4Y6SA 1XKQA 1MA0A 3GVIA 3KEOA 4J16A 3ROPA 3ROMA 3T4EA 3TOZA 1B2LA 1CIVA 3JQGB 1Y9AA 1K5HA 4IY1A 3ZW9A 3A9WA 2JD1A 3I9JA 2EJWA 3WFIA 4RZIA 4OOFA 4XGNA 3TZKA 2I66A 4DMLA 1WXDA 1P44A 3OF2A 1SZJG 4MVJE 1MB4A 3QSGA 4WLVA 4YA6A 1YOVB 5B37A 1U3VA 2PLAA 1LQUA 3ETGA 1ULUA 2RH8A 3KM0A 1ADGA 4NPCA 3I5MA 5T6BA 1NVMB 4D42A 1S6YA 3IC5A 4KQWA 1C0IA 2QX7A 3H9UA 3TF5A 5ENVA 1R0SA 3DQPA 5T64A 4AJOA 1E1KA 2NU9A 1E3JA 4L75A 2GF2A 1ISIA 5KJEA 2VUSA 2CF6A 2J5RA 4WNIA 2V6BA 3C1TA 3UH1A 7MDHA 2VOEA 1PWZA 3DFZA 3OFSA 4FR5A 3GUYA 2Q49A 3DBHA 2GCGA 4HADA 1QV6A 3BMQB 3ZDFA 3D1LA 4GX5A 3W8DA 1QP8A 1LU9A 1VE9A 4XCVA 4E5YA 4L4RA 3ZV4A 1P31A 4LMRA 4BNWA 2PD4A 3AWDA 1LUAA 4R9RA 2QIOA 4ZVVA 2Q3EA 2GUGA 1ISFA 4QECA 4Z9YA 4II3A 1ISMA 2VYND 2VRBA 1Y8QB 3WLEA 1KY4A 1JDJA 1UXJA 2O2YA 4QEDA 3INGA 4XR4A 4J7CA 1X1TA 1IPFA 1WMAA 4RF2A 1SC6A 4NFHA 5CHEA 2HMSA 1WAMA 5DOVA 4A5OA 4A2CA 1YQGA 1YB5A 4O0LA 3O9ZA 3C85A 3CMMA 2GZ3A 2QHXA 3PQFA 4A26A 1SB8A 2C7GA 3DXFA 4INAA 4E33A 4FFPA 3A06A 3U0BA 2FR1A 5TRTA 1GFSA 2R2GA 5T5QA 3VTFA 5JAMA 1B0AA 5COAA 3NDRA 1LDEA 5DOZA 2E37A 1EUCA 3AOEC 2CDCA 5A02A 2Q1TA 2VZ9A 1YL6A 4DBZA 1MLDA 2VNSA 1ML3A 1E6EA 3BMCA 2OORA 1GAEO 2DBZA 2RHRA 1RYDA 2G5CA 1HDXA 2O3UA 4FDAA 1ZJZA 4HWKA 2DAPA 3IUPA 3OJLA 2QRLA 3KYCB 4JQCA 3DBHB 3T4XA 4F6LA 4QUKA 4MINA 2NM0A 3FSRA 5CEJA 5CDSA 2YDXA 4TRMA 2CNBA 3NDJA 1JLLA 3S2EA 3WICA 1UP6A 3MJTA 1Z74A 3WGHA 2BGMA 2YFHA 1M6HA 1QLHA 1UUFA 3H5NA 3KUXA 3EC7A 1I33A 1PZEA 2TMGA 4LSWA 2O23A 3VPGA 3GEDA 3F5SA 1B16A 4CM8A 1EUZA 4N5LA 1A27A 1T2CA 2GASA 1MG5A 4YJDA 2DVMA 3U4CA 3ON5A 4K28A 4BQRA 1YDWA 4TKLA 1GV1A 4GMGA 1DC6A 3PI7A 3PJGA 5TT1A 4DRYA 5HRUA 3ZWOA 2BFOA 2ZTLA 3W4KA 1ENYA 1ENZA 3TJRA 3JYNA 2YYYA 3F6YA 4KQXA 5JYAA 3U49A 2YZ7A 3DZBA 1P1KA 4LGVA 3P2OA 1E7RA 5IG2A 1LLDA 3JQBA 4DPKA 1EQ2A 4AJIA 1DLJA 1K0UA 1E6UA 2PH3A 3BMOA 3V1TC 1HT0A 4PRLA 2Y1DA 1X0VA 1EVYA 4FC6A 4R51A 5CDTA 1RJWA 3VZRA 4MJLA 3MZ0A 4M49A 4PLFA 2EGHA 1HYEA 4NHEA 5GZ6A 1BXGB 4E2YA 3GN1A 1YJQA 3M2PA 2A94A 3AFMA 2UUOA 3O38A 4RDIA 2RAFA 2AQHA 1I5RA 4Z0HO 5KVVA 3KLMX 4PRKA 4ND5A 5AXBA 3C8MA 4MVJI 5F21A 4M8SA 4O1MA 4IDFA 2VTEA 1LA2A 2NU7A 4YB8A 1UAGA 4YAKA 1BRMA 1ZK0A 4EI2A 4HUJA 1UXGA 1DFGA 4BGUA 4NU5A 3AJRA 1RPNA 1XA0A 1ZSVA 2D3TA 2Y0DA 4OMUA 3BHMA 5JAZA 3HB4X 1ZNQO 3WJAA 3BHIA 2DBQA 3OJFA 3H65A 4IGEA 1NQTA 3Q9NA 2QW8A 1DIGA 2ZB3A 4XD2A 2JD0A 4NK5A 3GGGA 3I9KA 1E3IA 2FR0A 1LC0A 4ZICA 1B7GO 3AW9A 2WTBA 4P38A 4DIOA 4QQRA 1CJCA 2RCYA 4WK6A 1KVTA 3DBVO 1IHXA 1PS9A 1QLJA 5IF3A 5IXYA 3QY9A 1ZMOA 5DP1A 2DUUA 1ZUD1 4OKIA 4XJTA 4UEOA 4CMHA 1GPDG 3K6JA 1MP0A 1QKIA 4Q39A 3RVDA 3EDMA 5JNLA 1QYVA 5G4LA 4R1SA
chains in the Genus database with same CATH superfamily
4QRDA 1QANA 1C14A 1VE6A 1BDBA 1N1MA 2R751 3OM8A 5ESWA 4DYHA 2FI1A 4IHJB 1P4SA 4Y6PA 2FETA 4YO7A 4LJSA 2EWMA 4OUKX 5BVHB 5HK9A 4F9TA 3G9ZA 1ZM7A 5B4VA 3SNHA 1CD5A 1JAXA 2RBKA 3TECE 3RUCA 4RNDB 2DR3A 3UUWA 1D2EA 2VNKA 2KPOA 3WHPA 1BU8A 3DZGA 4A8JC 1YIDA 2BBWA 2NV0A 4ND4A 1NXOA 5P21A 3EGCA 4M38A 4K6FA 3E9DA 2RHWA 3ECCA 4HQKA 4RGVA 5FFNA 2CNDA 4LBWA 1E4EA 1SURA 4AJPA 3AVUA 3A1FA 2ZVDA 3A9CA 4M1TA 4MK4A 4XZ3A 4K26A 5LBTA 3OECA 1FRZA 5HUHA 4PICA 1PT7A 1TF2A 1P4JA 2AOUB 5BT8A 1YZTA 3EEOA 1V3QE 1VLHA 1WTCA 3AM5A 5AK4A 1IK4A 4P7JA 1JG3A 1I2AA 3T9FA 1X74A 3BERA 1XCBA 4EO9A 5BOSA 3VC3A 1KO8A 3L43A 3AFGA 5B7PA 2JASA 1AT1A 1CUSA 2GFIA 4ND2A 4U7JA 4UPDA 5ALOA 1MAUA 1EIZA 4EKGA 2PZBA 5HM6A 5JJLA 5KYGA 3RLIA 2R11A 3LP8A 4QYSA 4BMZA 4G9GA 1W5SA 4QFDA 1X7WB 4F4IA 3HA7A 1KBOA 1PL7A 1X7ZA 2FPRA 4PY2A 2DR0A 3TIVA 2XXAB 1IN6A 3E8SA 1O6ZA 2HFJA 1ISPA 1HXHA 4IV0A 2NSLA 1H8ED 1LX7A 3OJWA 4FGUA 2QGFA 1N0UA 4WXRA 5DNDA 3QW4B 4YAJA 1DO0A 3NVMB 3KELA 1JXOA 3G0GA 5BVGB 6CHYA 1G3QA 4NLLA 2JH3A 3E7PA 1Y9JA 5K3BA 1K8YB 3PDWA 3FLMA 3IUSA 3BWBA 5MN5A 1JYSA 3G0CA 4ZGWA 3OM0A 4Q3NA 1Z5UA 5FQNA 5IBPA 4TLBA 5BSVA 1CQWA 4JUFA 2JI4A 4ZWNA 1RU3A 3VU0A 4LF9B 2JIBA 2W42A 1L9KA 3W5UA 4LHWA 4O4LA 4DB4A 3LT2A 3EP9B 4L78A 3NBAA 4EHDA 4KR2A 3N2KA 3R5JA 3LHKA 1MOPA 1YQQA 1E1LA 1R6DA 3IV9A 5B2FA 5HQ3B 1CRLA 4MW9A 1WB5A 1HC7A 2A58A 2GR9A 1UBLS 2FRDA 2PL3A 2A5JA 3QX9A 4CW7A 5IKXA 1SCDA 2DB3A 2OYCA 1T6BY 1GFWA 1LRLA 1GNLA 1XALA 2FFRA 2H2AA 2O52A 2O3JA 3EG9A 1XZLA 4GYKA 4ZC8A 2J46A 2AW3A 4G1FA 4RH3A 5ECDA 3DEIA 2BW0A 1J49A 1G5FA 1TIPA 3PC8C 4IGAA 1E2HA 4K1LA 4PS0A 4GPAA 1MA3A 4M8LA 5EYPB 4ZU1X 4QODA 3T15A 1JBEA 1OE0A 1ORIA 3ZYZA 4LF8B 1KDOA 1CR4A 1WUIS 2H7CA 3FUUA 4HZIA 1LW6E 1R4NB 4G0ZA 1JJAA 4AYXA 1K86A 4QC2A 3VDXA 2CNOA 4RORA 5B64A 5JS1A 2QUJA 1QS0A 4DADA 4NBRA 1JKJB 1RADA 1ZESA 4G65A 4YQYA 4QLBA 1OH6A 4QHTA 1UBGA 5EHGA 3EVGA 3AL3A 4FS3A 3RT9A 5K8CA 4CL8A 4W1QA 4MCAA 1HZJA 3EMKA 3L46A 2FZCA 3ER6A 1DS6A 1UH5A 1YAHA 4IX9A 4Q4LA 4B6SA 4J7UA 1X70A 5FV7A 5EHZA 2PUJA 4NV3A 4CDMA 3P9CA 3D6VA 4QDTA 1Q0RA 2DBRA 2E9SA 3UJNA 1LRJA 3IHWA 1PJQA 3FBTA 1X94A 3KOUA 2BUAA 3S2IA 3THRA 4E7PA 3OOJA 3DLTA 3KZVA 3ODPA 5HIMA 3JD1A 3UUGA 4CTOA 4EG3A 4RK1A 5CDHA 4LX8A 2PBZA 3MS4A 3Q5DA 4FX5A 5C1PA 3S1AA 2EG9A 1WB9A 1ZINA 4CLRB 1NNLA 2O7SA 2R6R1 4LE1A 3H2HA 2FEOA 4DEXA 2P9FA 4LNAA 3I01M 2VK2A 1MIOA 1XEFA 4BLVA 3I6MA 1ES9A 5AI0A 3RIMA 2VXYA 3IIIA 2NIPA 3KJHA 1GYRA 5IJXA 3NYWA 4P5DA 3PZBA 2Y77A 1RQPA 4PYRA 3X1YA 3OWOA 4A0HA 2OC4A 4M88A 2CDBA 1W4CA 3CA8A 3EEYA 3H2KA 1GDTA 1IMJA 3WQBA 3TXYA 3EAQA 1MU0A 1FSPA 1LH0A 3L40A 4UUOA 2XQFA 2YQ4A 4MGKR 4XM2A 1JQKA 3WI7A 4EG1A 2G04A 2JKVA 4RVUA 4B4KA 2C0PA 3H2ZA 4Q47A 1U7ZA 4TM7A 3TFQA 3UO8B 3W9BA 4NCIA 2YVUA 1Q7BA 4RLHA 2EP8A 4MUHA 3PVZA 3IQXA 4M37A 9ATCA 3O1IC 5KSOA 3TGPA 2J7KA 5DJ5A 5IUKC 3QKTA 5EIXA 1KDPA 3AUXA 2QI9C 3R7SA 2FWMX 1HLDA 3JQDA 5MN6A 1T9GR 2BM0A 3G0IA 3MERA 2RI1A 2ZDHA 1H2HA 3ADPA 4YROA 5ERXA 4LI0A 4TMYA 3VSDA 3RAEC 5C9ZA 2R97A 1ZK3A 2YWXA 3FFBA 3BXXA 3HMKA 3JR7A 4YRJA 4EY7A 3WNDA 1F48A 2J0UA 3KPYA 4YJ2F 5NULA 3WZ2A 1BE0A 4HD8A 2QLTA 1XMSA 5BN1A 2HT6A 4FIDA 1B8VA 2JCGA 4K0RA 5K0BA 2IH2A 3TDKA 4HWGA 3HCNA 5SZJA 1Q1GA 1D2AA 1MB9A 2XSZA 3F6SA 1Z0FA 2GLTA 4H1TA 4AZ3A 1MX3A 3GP8A 3GVPA 4IF6A 4B2YA 2HA3A 2ZQYA 3GK3A 4M6WA 3AF2A 5F4ZA 4N8EA 4BQOA 2FPKA 3GFOA 3KOXA 1VL2A 1OPRA 1XSEA 2C8KA 2K7ZA 1L7VC 3A4LA 3CZ4A 4MV6A 4RKEA 1E2QA 5AQ1A 3T0GA 5JDIC 4ZYWA 3VR5A 3F5FA 3HCAA 3LFTA 1YI0A 3A6DA 3SIRA 3HKEB 1C1DB 3VM6A 1E2IA 1VJDA 3B9PA 3N7UA 3ZVKA 1E1NA 5GJWC 2FK7A 3W6NA 4MIYA 1M2VB 2QJTA 2BEVB 2HU8A 1YS7A 4J0GA 1TM2A 2QMYA 4OHMA 2W6PA 1KHHA 3H0EA 4K86A 2I2WA 3ZS9A 4Z54A 2UVQA 1Z13A 4I9GA 4NECA 3L4EA 4XX1A 4F7DA 3HR8A 1P2BA 2YHIA 1U2PA 2DP4E 3U4HA 1I0IA 2JJ1D 1TL7C 1U31A 4KGVA 5EZYA 1T15A 5C31A 1OTXA 4M9UA 3MF4A 4N3CA 3RUIA 4BMOB 1B73A 1C9EA 1O3YA 3QF4A 3IMKA 2JGLA 2Z5VA 3OX4A 4GBMA 1K63A 2QDXA 2SNIE 1OTYA 3AEUA 3CCBA 5EKDA 3KCNA 3SEFA 1YVEI 4F93B 3I62A 3MTIA 5AIBA 4PIPA 4E4YA 5D3MA 4DZZA 3RRZA 2PWYA 1H6CA 3B78A 3PFHA 3WLKX 3ZG6A 5HGJA 3JTEA 4KOAA 4R1UA 5CNKA 1YS6A 1CUUA 3UHAA 1WPRA 1YASA 3D31A 4FOSA 3U39A 3LQ4A 2QX6A 4KVZA 1T10A 2YJNA 3QPUA 3SJUA 1DXYA 4KQMA 1L5YA 1M54A 2JFPA 2XVZA 2B4QA 3H1TA 3NHBA 1HNXB 2GK6A 4MQMA 4E5KA 1KYTA 3HNRA 5A5DA 1DX4A 1R9GA 1DARA 3ES9A 1JL3A 5DYNA 3MWKA 3PNYA 4NZMA 3H8SA 5DWVA 4LFAB 1ZEJA 1GWNA 1UDBA 5ANRB 1QFYA 4M1QA 2VHTA 1W87A 1IZ9A 1J0CA 1CQZA 1WPXA 3AEQA 1ZCZA 3JVDA 1GUDA 1R8JA 1MJNA 1F2UA 2O05A 3RFXA 1KO7A 1I24A 4G0UA 1WNFA 1F4LA 2EF0A 1ABBA 4HFRA 2WJGA 1DDIA 4KDCA 1RAAA 2WTMA 4M98A 3HFGA 3K0AB 1EJ6A 2IF0A 2XMCA 4B3JA 5A1JA 2GXAA 1E2PA 5DZSA 2DUWA 1II0A 1J42A 1EWQA 1CEXA 1YR7A 3KUDA 3DAHA 1R0WA 4DA9A 2Q9UA 2C9BA 4TTSA 1WZNA 2NUTA 2ZJ7A 1U02A 2ZBEA 2OCPA 5FORA 2IE8A 2VK1A 4BLWA 3AI2A 2VNHA 2ZSIA 4QZVA 2CDNA 2XXJA 1K08A 3DV0A 4HNHA 1RHMA 3J7AC 2VF5X 4H2DA 1UJ6A 3I9NA 1GGEA 1EP3B 2GWRA 1JIUA 4G8DA 3RJMA 3AILA 3DMYA 3ETDA 4FS8A 5IWAB 3KEQA 2OE2A 3ZLUA 3W6PA 4BGIA 1G20B 2ZYTX 1THZA 3O0TA 3F4BA 4CEIB 4KV7A 2QD4A 3T1NA 4W5HA 2AOVA 1WD7A 2VJKA 1BHQ1 3DOJA 3DMRA 3JQGA 3HJHA 3LBIA 1J70A 5F3RA 1HZZA 4C6SA 5ESRA 1E79A 1ECFA 3NXSA 3H84A 4MR9A 5T57A 3TLJA 3UKJA 4BKPA 1UK6A 1REQB 2EL7A 2QTMA 4JJIA 4B75A 2C1ZA 3OO0A 4CQLA 4DR4B 4MV8A 3ZZ1A 3GL9A 2I9PA 2LGJA 3LHIA 1IXRC 3BULA 3OT5A 4E7OA 1TMKA 2WQ7A 4HDKA 5GY7A 4TLDA 5TF4A 1YOVA 2Z2KA 3NDIA 1XZFA 4MLDA 4JP2A 1KPIA 3EUEA 3QMWA 3VZBA 1NXXA 4R1PA 3RV3A 2C57A 2Z4RA 1UOEA 2FPWA 5DKFA 4C7KA 4MVWA 3HNPA 1LSSA 1JKFA 3T1TA 4NE7A 3V2GA 4EY5A 3H1AA 1E1QD 4CM9D 1WSAA 3EPJA 5GONB 3FF1A 1SIBE 5TC4A 4EMTA 3EQ2A 3D8UA 3ETNA 3E2PA 3L0OA 3L6RA 3O4RA 3PD1A 4IIJA 5FEUA 5CVDA 2HCFA 2W2PA 1S7CA 4F2DA 5HWSA 1XKTA 4HDAA 3OUUA 4MH0R 5D3ZA 4R41A 4X8HA 3NX4A 1B26A 3RIEA 1Z25A 4R6XA 3T4UA 2RAUA 1LBEA 3AUTA 4XD7A 1ZGCA 3O75A 4HP8A 4OP1A 5C18A 2XKJE 1YI8A 3X0DA 1G21B 3EWAA 3TUXA 3GQVA 2QG9A 4WX2B 4EYEA 3PJDA 5ED4A 2VTVA 1IM8A 1QYXA 2PD6A 1W8DA 2Q6TA 1Z82A 2ZRIA 3C45A 1DIHA 5EJ2A 2X0KA 1TRHA 3OAAD 5G3YA 1LDGA 3DEAA 3K8ZA 4LJRA 2D1QA 1A4IA 2FLVA 2WVGA 4AD8A 1NY5A 4NYIR 3WIEA 5DGCA 4JH0A 5KB3A 1O94D 1Z4PX 2R47A 3HWX1 3D4IA 5EWMB 1JR3D 3ZCQA 4KE8A 1QH8B 1PN3A 1QFMA 2QX4A 3BZWA 4MS4B 5H02A 4PLTA 3SPXA 4WOJA 1UKBA 4ME6A 4S3MA 1MRSA 1GXSB 4JUIA 4OI0A 1EVZA 3P9PA 3BA1A 4JVSB 1N36B 3ZKWB 3SBEA 3VQTA 3SZ3A 2B98A 3B7GA 5NLLA 3W5VA 3WLPA 1O08A 4JI7B 1NVFA 1OI7A 3EA4A 2MSWA 4NQRA 4TS9A 1RWBA 4L2IA 2BGTA 2F3RA 2UUAB 3MD9A 2Y1OA 4DRXB 1DGQA 1ZK1A 3NO4A 2JFOA 3L9XA 1X7GA 1QB8A 1MR3F 1K3FA 2GJSA 3L1JA 4LCBA 3RSCA 3SK0A 1IY8A 5FA8A 2BFWA 2IZ7A 2H7VA 1NGSA 3D8HA 4WNAB 2PX0A 4RWZA 3RAJA 2Q5QA 1NULA 1IJFA 3EVNA 1Z6PA 4BIIA 2WEKA 2WF8A 4BX9A 2PT5A 2JBAA 4DA4A 2O2SA 3KYCA 4NIMA 5HKBA 1CNFA 2ZRKA 4RD6A 3AQ4A 2EFGA 3GRYA 4I55B 4A6PA 2GBGA 3AP2A 5IJ0A 1JEYB 10MHA 3BSYA 2IX3A 3EFBA 3OH8A 3A2MA 2QVYX 2ZBGA 2EKQA 2EZUA 2FMHA 3TRJA 5I7WA 4RTMA 1IXYA 1SXHA 4R0VA 2FW9A 4IDCA 4OXRA 3PUKA 5TMDA 1FTWA 1D6NA 1DJOA 2J3MA 4QBHA 1R8XA 2C9ZA 5B30A 4MICA 2IHYA 1TQ6A 1PUIA 1FDTA 1U11A 2PT6A 3O4VA 2YN4A 1O97C 1GPYA 3DWEX 1FNDA 1OBVA 2H5LA 4KX3A 5CVEA 1IUOA 2YUTA 2Z0MA 1W52X 2FWAA 2CMFA 3NHJA 3ZTYA 3PDHA 4BWGA 5JSUA 4FCCA 1MZPA 1JHOA 3FAKA 4MQUA 1XRQA 2ZYAA 5CB8A 1MD9A 4KQ9A 2JCBA 1BXZA 3GX1A 1TLTA 1N77A 4O4HB 5LDHA 4FHEA 4PINA 4NEHB 4PQGA 3MTQA 1GG2A 2Z8ZA 1N2IA 4M9CA 4NOMA 1AGNA 1P9RA 3PYMA 2IZ6A 2QVLA 2AMVA 2H0RA 4HDQB 5HF8A 1OGJA 1XZ8A 4FHGA 4L22A 1BYUA 4R8MA 5H81A 4D4KA 3O7MA 2FPGB 5IFLA 2XCRB 5CDFA 4KPUA 4DV0B 1WPQA 3S2SA 3QLVA 2J6HA 1NXPA 4U1RA 3M0EA 1FNNA 4PO3X 5EIAA 4ZYTA 5DBFA 1RZ3A 2A1UB 1OFIA 2WF7A 3NIWA 5I45A 1UL1X 4WXPA 2WKQA 1NP7A 1CRWG 2ZSEA 3C6QA 5A9SA 3I5YA 2BMEA 2W83A 5H8WA 1ZI9A 1K27A 4M7PA 1NYQA 2JGJA 2A3RA 4NHOA 1K89A 4AJNA 4E31A 1LC3A 1LWOA 4EHIA 2DFKB 3C15C 4HJXA 4RLSA 3TTUA 1CJTC 2F8MA 1W36B 1VG0B 3Q3EA 1OILA 1H9CA 1BXGA 3DOCA 3JARA 5IVIA 1NUPA 4N82A 3CLKA 5FP0A 4BMPB 3ZWWA 1YR8A 3D5TA 2WTUA 4MUAA 5DCLA 4QXMA 3SCZA 4PZ0A 2ZP1A 3BIJA 1RR6A 1EJ0A 4RK0A 5ILGA 4FBMA 3RFCA 3GG9A 3SJCA 3I0NA 4BO1A 1WZEA 1GTMA 1E9AA 4MUMA 2IHVA 4KQIA 1TK9A 2E48A 2FJUA 4C30A 3TTVA 1G6OA 1NVTA 1NPTO 3RPEA 2Q3JA 2OOSA 1DMSA 3LVRE 4Y1GA 2BKXA 1XTBA 4EBFA 3I61A 4TX1A 5K0LA 3ICOA 2ODPA 1RAIA 4F06A 5G2OA 2DLDA 5KTTA 4B3DA 2WIGA 3N2GB 4XPIA 4QPJC 1PNQA 2QVXX 4C4TA 2REQB 4X6YA 5GZ1A 1MEOA 2RGNC 3O8BA 2C9YA 4R3NA 1KSHA 3VZCA 1AV6A 2AS0A 4FJ2A 3RSHA 3URMA 4E15A 3IAS6 1QGDA 1UKEA 2A5LA 1P75A 1TPYA 2ZYWX 5THKA 3T9DA 2R5WA 2RHGB 2WKWA 4F45A 3THWA 2V6IA 3K2EA 4RY0A 5FA6A 3E70C 4GICA 3NONA 1PJCA 1WTAA 1FP6A 4D4HA 1T3SA 1KNXA 2P6NA 3F7NA 2GCEA 2BM9A 3TUTA 3AUFA 2O7QA 2HA2A 2HIGA 3TN7A 2HRDA 4E08A 3KVOA 3DLHA 2C5AA 4L9AA 1G59A 3ZNPA 1NSFA 3N0VA 2I67A 3TRHA 4HV4A 2FJ0A 4Y98A 1H2ZA 1FS5A 3W5IA 2VAWA 1B8UA 1R0YA 1KSFX 2BR5A 4B81A 2MYNA 4INOA 3GLIA 1W0KA 3TX6A 1XZGA 3JAKA 3JV7A 3MC1A 2WA1A 4L6AA 5ALRA 4I5FA 3UMRA 3WMRA 4Q18A 1X14A 2R7AA 3AF5A 2W98A 1QONA 5HA5A 4MCJA 1EHYA 3GIWA 4QFMA 1JEOA 4J0FA 4P2GA 1N1EA 4P82A 4UCWA 5AHOA 4MA5A 4EG4A 2O8BB 5CM2Z 3MG9A 3T8YA 3VO1A 2ASEA 3U4GA 3D3WB 1XRSB 2XKBA 3FVQA 2OOKA 3A2NA 3GLHB 4FDLA 4DUYB 1FSFA 1X80A 1IHYA 3Q4GA 1Q12A 2UUCB 4RNCA 2BKUA 3RWOA 5FNZA 1KO1A 1M0EA 2VJDA 3ITDA 3WL6A 1MOSA 2CHGA 4UU7A 1Y5RA 3IT1A 4IKEA 3OOWA 3JQAB 1VGRA 4X95A 2R4UA 1J9EA 4FYVA 1YQXA 4UM5A 5KJ6A 2I7XA 1PAUA 4KGDA 1KYXA 2IUEA 5EI5A 1XVUA 2JGFA 2HHJA 1TC1A 2VJQA 4QU5A 4DSZA 1T29A 2CLSA 2V8OA 2HLNA 3ZDCA 4H60A 4ZVRA 2PUFA 2JLRA 2C82A 1H0HA 3E7XA 4QXAA 1S4QA 4ROTA 4WCFC 4YT4A 1WBJB 3SHFA 3U17A 2AFIB 4XWOA 1V9SA 5CDUA 2LCQA 5TMBA 2YKGA 2JIPA 3OT1B 2C95A 4X62B 4KBYA 4LQCA 1XJCA 2C4UA 4EW3A 5CYOA 4YMGA 2YQZA 4HDNB 1AK9A 1UT8A 1JIXA 2B25A 2I7DA 2E89A 3EEQA 2O3QA 3NAMA 5CCDA 2GCIA 1UQUA 5DVZA 3IEXA 4NI5A 4OUDB 1HPLA 4AX4A 2QMZA 4HDOB 2AJTA 3BL8A 5K7SA 1QRUA 1P73A 4C5BA 1O77A 5EMLA 1VJRA 4FN4A 3CVUA 1A9XA 3IBCA 3K20A 1A9RA 1QYDA 1TYBE 2GEBA 2UV8A 2IYXA 4WL0A 2C2ZA 2QRVB 4I4IA 3T3DA 2HR1A 1KL7A 1XHFA 1NJ6A 1MGOA 1K98A 2J9RA 4OQ4A 5FWYA 3LO8A 1ZRMA 1AF7A 2A0UA 4TGLA 2PZ8A 4TLCA 3HUDA 4RTPA 3ZV3A 3BKXA 4K3VA 4OOEA 4ZO8A 2EJCA 4LGYA 3IA2A 1FW6A 1DT5A 1SXJC 3LF1A 4C5CA 3AKCA 2PKRA 5D6NA 2R6CA 821PA 4YP6A 4WE3A 3RKRA 4LZZA 2G7ZA 4A3SA 1EE2A 3CX8A 5E1MA 4DNOA 1U4SA 2XCUA 2W4QA 3W8EA 5L7TA 2HGZA 2PO5A 2X7HA 2J41A 3AXTA 3FF4A 1SNYA 3FCEA 3B1KA 1PJSA 1XQ6A 3X1XA 2JK0A 3DE6X 2XPCA 4F6RB 3ESBA 4DNPA 3TRDA 1NN5A 3E9CA 1PZGA 3AHCA 1U8XX 1EXMA 2NN3C 3NIBA 1E96A 3LRPA 2XNHA 2D7DA 3QKUA 2FQ1A 5F76A 5CK5A 2P4EA 5KQPA 1KTVA 1SCNE 1Y6ZA 5J5VA 3S44A 4IRXA 5FX2A 2ZW9A 1EVQA 4D9BA 3A70A 3RC3A 1ZM9A 1JFRA 4BB6A 1Z9BA 4PHFA 1EBFA 2B6NA 1JI0A 2E2WA 2NG1A 1V4NA 4YS6A 1L8QA 1YDMA 1AKTA 5HF5A 2GM5A 2BD0A 3PXUA 3SD7A 5EJ8A 4W7SA 5B2EA 1IY9A 3ZE9A 3QUBA 2JFVA 3IQEA 2ZCUA 4R54A 1G3RA 1QF7A 3NUZA 1LBQA 2PKQO 3NYRA 1VRVA 3P2YA 4HH1A 4L0DA 2NSYA 4RW0A 4J0KA 4ZO9A 5AVQA 1YQDA 2QI9F 1VZ3A 2C4NA 2LXNA 4AUEA 2EL9A 1HE4A 4ZIRA 5CDGA 1JLKA 1U3TA 4TYYA 4ZMSA 4ZO4A 1UBJS 1HWYA 4TN1A 1JG7A 3OIDA 2EFHB 1IRXA 1AHHA 5ADUS 5B3JC 1T2EA 2C7VA 3PLNA 2DRIA 2OV8A 1M0SA 4MR7B 3C1AA 4MRMB 3RUEA 2ORED 3U2QA 4DCNA 2DQSA 2IHNA 1P4HA 2BSAA 2H5EA 3HYNA 1IXZA 1KI9A 3HUUA 4GAEA 3W9SA 1L7PA 1UT5A 4M1ZA 2HMTA 1N8NA 4Y1FA 4GUDA 3ZDQA 1C7JA 3PF8A 4HZGA 2ZS8A 3MMSA 2X9QA 2TMYA 4JHLA 4N03A 4E3WA 2ODEA 1RLTA 2AUTA 1T24A 3LT0A 1BHSA 3P5SA 3DDWA 1E5XA 1J39A 1DRJA 3O4IA 2FN3A 4PZYA 1EK5A 4K9SA 5MFZA 2C7QA 5A71A 1OH7A 1Q1ZA 5BUZA 4ZODA 2E5WA 4IYRA 3ROEA 5K2OA 1EK2A 4DGSA 2WTXA 2FCAA 1XA3A 1JG6A 3KGDA 1K68A 3A8TA 4XM0A 5K0EA 3WGYA 1PK7A 2QN9A 3DW1X 3SGLA 5ADVA 1A2QA 3R6TA 5FUMA 4DCCA 3OSUA 3ANNA 1PL8A 1SUPA 5H3CA 3HADA 3KD3A 2V98A 1V4VA 3ZE2B 1F20A 4B3CA 5LDDC 1SZCA 4QD3A 3H42B 4M7OA 2ZIFA 2HDHA 4UAVA 2CKMA 2HY7A 4AY4A 3ESRA 1QU3A 3ZHSA 5JWOA 1NAIA 4PNPA 1RTTA 3FGOA 3AI7A 8ATCA 5BNWA 3H3XA 5CU7A 5G4KB 3LC2O 2GFQA 3GLUA 3MTDA 4UPVA 1QCZA 1WM1A 2IZ5A 4QYIB 3DTVB 3TIFA 3CLTC 1DTSA 2H31A 3DGFC 2LZ0A 3GOQA 2C3UA 3PXBA 1BDJA 2Q6OA 3GGSA 1E2UA 1CBUA 3I34X 2UYYA 3AM4A 3MT7A 3PCTA 3LM8A 3L8MA 3GCZA 4B85A 4BUCA 2EYUA 1RYYA 3LTEA 2VNJA 5BN5A 2JHPA 1KAHA 1QZXA 1T0HB 5IM4F 2Y66A 2NQ2C 2FEMA 2WFMA 2O8CB 3MELA 1KIAA 4W9NC 1BVHA 3FYCA 4KZPA 2G0NA 1HK7A 1R18A 2EC5A 2XDQA 4HFNA 3IGFA 2FEKA 4JYBA 4CV0A 3B5EA 1YE8A 2CLKB 2IWRA 3KNZA 2J3KA 2ZRDA 4OYRA 4D4LA 1XDSA 5L7WA 1BA2A 4AUMA 2A5YB 3M1YA 4FW9A 1E9VA 4HQNA 4E5MA 2GUWA 1Z7GA 4JP5A 4PTYA 4Q4HA 5I7RA 4LV5B 5AKYA 1PR9A 4F7WA 2D0DA 4GE3A 3DH0A 2FKNA 3EP7B 2Z3ZA 4I1PA 4KQ6A 2YBEA 3MJHA 4HGRA 3BAFA 4HUTA 3G1WA 2ZUTA 2PH1A 3DEFA 5F78A 1U2EA 2AG5A 3KDAA 2R5NA 4GR5A 1XCMA 3LAWA 5AXAA 5BNTA 3RJ5A 3W6OA 3RS3A 1L4BA 4EKIA 2OVBA 3DAYA 5IHXA 3DDZX 3M2TA 2P6UA 1X13A 3ZEIA 1ONOA 4DREA 4L7QA 4M9ZA 4MDHA 2CDAA 3GJ3A 1NASA 1ODCA 4PNHA 1WVGA 1ZGAA 2WIKA 3CO0S 1H8EA 4YV7A 1PJ4A 1P3Y1 2CXTA 4M22A 3AETA 5EWLA 1NM5C 3BRQA 3BUSA 3VDMA 2W2KA 1MBZA 1XG5A 5BWMA 1AK2A 5BR4A 2AK2A 3OF3A 3W4JA 3EP4B 3VR3D 5FOUA 2VF2A 2PYZA 5IMSA 2Q3BA 4NRDA 4QBTA 2C59A 3VFDA 2C96A 2YV2A 4BAZA 1ECJA 3SEZA 3O0DA 2ZJ0A 5GM1A 2JFFA 3EIWA 2A8YA 4GKBA 2BM1A 4U0JA 5ADHA 5FLYA 1WUHS 4EHFA 2G88A 3NANA 3DLPX 4B8ZA 1L1EA 2IYFA 2NGRA 4EHHA 4OIFA 2OWEA 4XYMA 5K2MA 3LUDA 3V6LA 1O0BA 1MFPA 2H57A 1SIOA 1NP6A 3N74A 4FFMA 4G4SP 2O9JA 2C0CA 2PFGA 3PNLA 1OVGA 2WVHA 2C00A 4HTAA 2G9UA 4EYSA 4D79A 2ZITA 2PBFA 4L0CA 2WF5A 2ACKA 2ENWA 3NJ4A 4R8RA 4RBNA 3RHZA 3VNUA 5JMTA 1FYXA 4AMGA 5IDWA 2HYIC 3ONDA 3T7RA 1WF3A 4MXDA 1HFEL 2PXAA 3CF2A 4FBLA 5H70A 1C8BA 2WPDD 4HO1X 2MSNA 5CPFA 2VPWA 1XO1A 4PHCA 4G9EA 4AMVA 2FFBA 1JRLA 4NCJA 1U1GA 1IRIA 2VHXA 4FSHA 5SZIA 1GTZA 1E61A 2J9ZB 16PKA 2CYCA 2X8LA 5A0TA 3GUCA 4HC4A 4BCBA 3RVBA 1IVSA 3CNEA 2GA8A 2I34A 4NJMB 2WVAA 2ZIZA 4PEVA 4R8LA 5G53C 3R8FA 1QX4A 2JJ8A 3G1TA 4OEHA 3JQ9A 4P81A 4H3KB 5DM60 1L7NA 4MW7A 2V8BA 2DTDA 1DDOA 1TOAA 1CC1S 1YKFA 4OAQA 4WA8A 2JJ2D 1HQYE 2G0AA 2GVDC 2OGWA 3TD6A 3W1VA 4I19A 4FCWA 1CIJA 1IHDA 1N8SA 1PYGA 2QZSA 3CG4A 2KWIA 3CXUA 2PV7A 3PNPA 1II9A 3F3YA 2B36A 2FJPA 3IOCA 3R0JA 4H4EA 1EPUA 2F43B 1U1CA 1X92A 3OZFA 4D45A 2FF7A 3UBMA 2WMDA 2ZBVA 3L5OA 3O8RA 5A4DA 5BW8A 5CD9A 3H11A 1TVMA 1WZ2A 3FSGD 4B84A 1I79B 4UHCA 1CY6A 4G0YA 4RCYA 5IULC 1H6AA 3F74A 4A73A 4F72A 1WDLA 5GINE 2R2AA 4LC9A 3UGQA 1MC1A 4RJ2A 2VHVA 2BGRA 4K8OA 1M5UA 2IUYA 2V97A 1W30A 2IEDA 2YNMC 3EJWA 3PT5A 1H0KA 4G4IA 2GPAA 3AY7A 2ZUBA 4QPPA 2VS1A 4BJ3A 2JCSA 4RZSA 4ZT6A 3KKMA 1YCDA 4Z4GA 1YO6A 4QTXA 1U8UA 3W8NA 1MQAA 5DB4A 3ZWBA 2XZLA 3N0WA 3A9SA 2BC9A 3HCDA 1IN4A 4N40A 2W2XA 5HOQA 3PQ4A 5DHUA 4G8JA 5EFZA 4WPGA 3B3JA 4I4TB 4QIHA 3TRKA 4NX2A 3FNGA 4CHGA 1YD7A 3NQ41 3UTCA 4I9UA 1R8SA 1BRTA 1KZ1A 4HYQA 2WP0A 4XASA 3SXUB 5BRJA 3CEJA 2C20A 3ZD8A 1SC3A 2GBFA 1E4OA 4K8RB 3RBVA 4XGRA 2A0WA 2OV2A 1J33A 1GQYA 2HC9A 2OGZA 3QVMA 5CH5A 4UVHA 1K7YA 5PGMA 5KNCH 5MHTA 3AEKB 3A3YA 2CVPA 3PPVA 4M0EA 4QT0A 4BVBA 3D4BA 2LDBA 1WDMA 4LZWA 4B8YA 4GOJA 4PGAA 3IKMB 1II8B 3H3JA 1Z15A 3LDAA 2WIFA 4XGQA 2KS6A 3SQLA 3EZYA 2QRGA 2J0VA 3HXPA 1W1IA 4GQBA 4DMHA 1CUBA 1JFFB 1GQQA 5LYJB 2C78A 4ETNA 1P1BA 3U40A 2HLHA 1GZ5A 4L0MA 1RVDA 5A04A 1AS0A 1JKXA 1JDBC 1FLNA 1S1MA 4BFCA 3FJ1A 5LOVA 4JKYA 4J29A 4A92A 4CGYA 3RAFC 2CLCX 1WW8A 4I5EA 3ZX5A 2O0JA 3QOFA 3UB3A 2Z98A 1W0JD 1XU9A 2CV0A 3HZOA 5HR5A 3V7FA 1XVTA 3TDNA 4PN3A 1FYWA 1E8DA 3Q87B 1TQ8A 3HDVA 2X3YA 2I2BA 4XLLA 3SBDA 1F9AA 1VJ5A 2G9ZA 3U1TA 3FI0A 2GN8A 3T99A 3VU9A 4MVXA 1NSTA 1A8HA 2JJ1A 4PFJA 1R15A 4PSKA 5LZ7A 1HLPA 1ZA2A 3OQJA 4B87A 2D6FA 1MX9A 2EZ4A 2F90A 3EGIA 2TMDA 2Q4RA 3RV4A 1QPZA 5ALVA 1HRDA 4XX0B 1M0TA 1SZPA 3D8RA 1CFZA 1RZVA 3NALA 2HREA 2J9FB 4Q9LA 4BFVA 4BLSA 5LJIA 2JAHA 5BYBA 2O2EA 1E5TA 4ZAFA 1CJMA 2AWOA 3O1JC 1AURA 1GSIA 1PJTA 3QPCA 1T8UA 2G67A 1D2CA 4HL6A 4Q34A 1QG6A 2F67A 2POCA 4R05A 4KMMA 1NN1A 4OB6A 5SYMA 2AQ8A 4CIDA 5BMVB 2NP6A 3A2KA 1PUXA 1WKCA 2J0SA 3EARA 4GPIB 3UMJA 5F4BA 5IZ4A 1N6KA 1KOLA 3L2OB 1P7YA 1UMKA 3WLHA 4OM8A 4WZAA 4DCMA 4E4TA 2YN0A 3NUQA 3TPFA 4R81A 4G1EB 2PU5A 1MZVA 1YQUA 2GLUA 3UY4A 4N4AA 4UD2A 3TZQA 2C7OA 1FJGB 5ICEA 3F9CA 4DV6B 3Q7SA 4QBGB 1IL0A 5IPFA 4LN1A 1ULSA 2HUPA 2QRUA 1OT3A 1SU6A 4JP3A 1NRWA 1N9GB 1C9MA 1QJ4A 3A1SA 2RONA 4ZOLB 2JLWA 3DWGA 4P2BA 2PUWA 2OO5A 5CH3A 5J43A 3QX3A 1CJVC 1SKYE 4HQ0A 4ZO7A 3A9TA 4HGZA 3IPCA 1PS0A 2QLLA 1Q19A 3GNSA 2DWPA 2ZWVA 2CBZA 4L5AA 3F2IA 3T3PB 4CKCA 3PEVA 4JEMA 1AN0A 4B48A 2BZSA 3CEAA 2GHTA 2IYVA 3S2GA 3TMYA 2AG6A 2WMOB 4H08A 5K3DA 2O8NA 5LXTF 4IVNA 3SIXA 2H3EA 2PA0A 5JSFA 4NBUA 4F2GA 4KAXA 3UWSA 1AUPA 1WXGA 1ODTC 4FSDA 4E5VA 2Q46A 3VPDA 3IUEA 5KYUB 1U28A 3PDIA 1QH1A 2V55B 1V16B 2XB6A 1V7CA 1W93A 3F47A 1Q92A 1K8XB 4MS1A 1I3NA 2B82A 4CN8A 1IE3A 3DMTC 2QXYA 3OZBA 3PNMA 3HJRA 4K6CA 3F9IA 5KJFA 3F3MA 4QHYA 4FX2A 2AK3A 3W05A 1ZLXA 2IOHA 3AUUA 4R6WA 4RKRA 4AQ7A 2ODTX 3I04A 5DIZA 5C4MA 3PZRA 4LOAA 3MMZA 4KPEC 2JGKA 3IRUA 1MRZA 4PG8A 1EK6A 2Q07A 2VDWB 3D5QA 2EDCA 1DAHA 3ROTA 1GNQA 1DQZA 1YRBA 2EBWA 3K0CC 1Y6RA 1T1RA 3OD1A 1U2DA 2IXDA 3KPUA 2CL6X 3I2YX 4AVYA 3SX4A 1QQ6A 3E9ZA 1B8NA 1E6WA 4GOOD 2F48A 4FFBA 2W6ZA 3FPAA 4GRDA 3OY2A 5CB6A 2BEUA 2GDZA 3PFFA 4IUCS 2JK1A 3T7SA 4JOSA 4Q9KA 3R5SA 2V0NA 1T36A 1JTVA 1NOIA 2Q5IA 2VH1A 5DLYA 3D2CA 2IVFA 4QJ4A 3VAYA 4A1FA 4QVIA 4W5RA 3ELWA 5FPHA 3AEXA 1NMYA 2D1RA 4LCEA 4N0PA 1TJ3A 3S2FA 4X65B 1WX1A 4URUR 4HYTA 2HO5A 1L1FA 1AXRA 1P81A 3ELDA 3PC3A 2CXXA 2PR7A 1Y9EA 2WJZB 3MN1A 4G5RA 4CI9A 3PXXA 2O8FB 1N6IA 4Y6GB 2QQEA 4J0JA 3WBBA 4CM9A 1DG1G 4KJXA 3R75A 3G8DA 4NE2A 3HEAA 2P27A 1T13A 1IY2A 1U3WA 1H65A 1JHYA 1H2EA 4KR9A 2HUNA 1W6UA 5A5GA 4PQFA 3LE8A 2ZUCA 4QU0A 4H35A 3CM0A 1FU8A 4QDJA 3M5WA 4CF3A 1GUAA 4U9IS 2V5AA 2VP6A 1SC4A 4I3HA 5LQMA 2D62A 1QE3A 5IJ9A 1EI9A 4EB3A 2A59A 3K92A 1XZHA 4X6LA 2LWIA 5TY0A 1P0PA 2C97A 3B48A 5L7YA 3B6MA 4CG2A 3V2UA 2YRFA 4ZD6A 3PC6A 1U80A 4I8IA 5JD6A 1JPJA 3DZHA 4G6ZA 3DE4X 2HPZA 4IIUA 1NMEA 3UJ9A 1PFYA 1ZVVA 2Z8XA 4Z9BA 4JBGA 4FGZA 2GZSA 3BTSA 2NU9B 3R41A 3G0HA 1USVA 3OAAA 1WLSA 2PL5A 1PVVA 3I0ZA 5IVDA 4BO2A 2YY6A 3P0RA 3FKSD 3MJ4A 4YN3A 4OXXA 3KSRA 4QDXA 1O94A 2NZXA 3A1EA 3M6UA 4QASA 5EE9A 4M7RA 1P5FA 3VRHA 3FZYA 5KC9A 2XD9A 1JR3A 2QD2A 5AK0A 4XOIA 1OX5A 5EPOA 4UEWA 1ITZA 2CBGA 3N58A 5TVKA 4NH4A 3OPQA 1RXCA 2ETXA 1DEXA 1PT5A 3DEJA 5CA0A 4XB1A 1JVBA 1ULZA 4RQTA 5FOXA 3FTNA 4DEVA 4AN0A 3PDCA 1R3DA 2IS4A 2X58A 4MAFA 3CIFA 4KJZA 2ZIWB 5F51A 4AZWA 1HT2E 2VTBB 3ZQ6A 3ZXSA 2QU8A 2D2IA 1O6BA 3LSYA 4IRUB 5JD4A 2V4ZA 4G5XA 1PV2A 2CXQA 5YASA 3UG7A 4ZAXA 5L4NA 5JXWA 4PZUA 3GG2A 5M5BA 1U5CA 4BJ5A 2GKSA 1KXZA 3EXAA 2SECE 4NAHA 1M0WA 4RELA 1VLLA 2EP5A 3WYCA 1GA6A 3U3OA 2RKOA 1I0LA 4LDZA 4P4NA 2XQGA 3B1VA 1OQAA 4TV9A 3UANA 4XYEA 3VKFA 4Y9SA 4BFWA 2Z9DA 1XVAA 3F5DA 1C1HA 5EFOA 1P2VA 4JCOA 4O29A 1KAGA 3WLNA 2I7TA 2PRZA 3TD9A 4DOMA 3G9UA 3T7KA 1LCIA 1NAHA 1DQNA 3E1GA 1RJGA 1TU0A 4Z2YA 1RE0A 1IDN1 3W2TA 1I7PA 1VE3A 3CVJA 3NWPA 3DCIA 3Q7IA 3OWXA 4O02B 1BWPA 3NNDA 3EPPA 1G1AA 4NFLA 5ALTA 4MVJP 1ZN2A 1VYHA 3A4IA 1WMEA 4H1HA 3TIXB 4AG6A 2ZKIA 2B83A 5BWNA 2J0QA 3O8LA 5FFMA 3AEZA 5AM5A 4GR4A 3MILA 1XD2B 4QU8A 3RYHA 1VA5A 1UANA 1XF9A 1PSWA 2LKDA 4ND3A 4D8XA 4RPHA 3DV9A 4FYIA 4CRWB 4ZVTA 3K3PA 4HNRA 4TZKA 1CNEA 2X8WA 4K5QA 3L1HA 1GPLA 3CYFA 2OQVA 1XTTA 2QAGA 4P92A 4IMJB 4TVBA 1RRKA 5J40A 4ER6A 1R5NA 3GRUA 2H1LA 4FT4A 3AY6A <