1H6AA

Reduced precursor form of glucose-fructose oxidoreductase from zymomonas mobilis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
381
structure length
381
Chain Sequence
ATLPAGASQVPTTPAGRPMPYAIRPMPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
publication title Crystal Structures of the Precursor Form of Glucose-Fructose Oxidoreductase from Zymomonas Mobilis and its Complexes with Bound Ligands(,)
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Protein translocation
total genus 129
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2001-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h6aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h6aA01
2O23A 4PLYA 2VRCA 3O38A 2VYND 3QV1A 3QJ5A 3LSYA 1PJBA 3KO8A 1YOVB 1PIWA 1YB4A 4KOAA 1EQ2A 1N5DA 2CDBA 4CLOA 4LRSB 5JSFA 3ZWOA 4B8ZA 2BMAA 4ZQHA 3HZZA 2P5UA 1QR6A 4LRTB 1GZ6A 1ZMTA 2C0CA 4OH1A 1XIVA 3K2BA 4YAJA 3WIEA 3ONEA 1NQOA 1VSUA 5TT0A 3UHAA 5KWEA 1EVJA 4BIIA 1Y8RB 3WGOA 3A1NA 1HLDA 5C7LO 4I9UA 1QV6A 5KOIA 1DO8A 4GI2A 1H6DA 1P1IA 2DUWA 2YZ7A 3I4FA 4LW8A 3ZHBA 3CTMA 4XX0A 5IJZA 1LDMA 2CVZA 3H3FA 4U5QA 2VHVA 1LSSA 2C5EA 4DPKA 1N8KA 3K2EA 5A9RA 5I9LA 4QUKA 2QRKA 3VPXA 2UDPA 2NVUB 3MJ4A 2O3SA 4CJXA 4TSKA 1XLTA 2FRDA 4ZN6A 4GSKA 3ZHYA 4BGEA 2ZCVA 1MFZA 1XG5A 1I36A 1IE3A 4WASA 4GL4A 2BH9A 2GF2A 7MDHA 3TFQA 3V1TC 1GAEO 3D4OA 4DGSA 3FTNA 4XGIA 1LRJA 4R01A 1NPDA 3RU7A 4FJ2A 3L6EA 4E5MA 4YR9A 1LNQA 2BI8A 2C7GA 3RU9A 4UVGA 4MKZA 4YYZA 3RAJA 3FNEA 2Y68A 5IXSA 1PR3A 3LK7A 3JYLA 1PL8A 4P4NA 1SOVA 4O5OA 3G17A 1ZZEA 3ZU3A 3FNHA 3F5SA 4OXYA 3ZW9A 4BS9A 5AQ1A 4IM7A 4BQPA 3AFNA 4G65A 1WDMA 1E6WA 1I2ZA 3WGIA 1DIRA 4Z0HO 2BGKA 2DUUA 5U1PA 4PG8A 1DPGA 1N1EA 4J90A 4J1QA 2NVWA 2NU9A 3LLVA 3FPLA 4BOYA 1CQIA 2Y1OA 3P7MA 1AUPA 3EMKA 4N7RA 1WDKA 5JPIA 3HG7A 1QXSA 3PFFA 3IIEA 1I0ZA 1O95A 4IGFA 4TROA 2RCYA 3X2FA 3AUAA 3RJ9A 1R4NA 1ADBA 4B3IA 1K89A 3H9QA 3P2OA 1XHLA 4AJ1A 4O63O 5GZ6A 5EIOA 4L4RA 3NAQA 5KKAA 2BHLA 5JBIA 1AHHA 1VE9A 5CPFA 4ZRNA 1PQUA 1X14A 3C1AA 2P9CA 3Q2IA 5BNFA 2X5OA 1E1LA 3U4IA 4FDAA 4QECA 1YS4A 1P1KA 4YCAA 4IJVA 4NBVA 4CPDA 3Q2KA 5KVVA 1A9YA 3ANMA 1KC3A 4M49A 1X13A 1R12A 4JBHA 2B4TO 1YJQA 4A03A 9LDBA 1UXJA 2X9VA 3ANLA 3I5MA 2PZKA 3GFGA 4MVJF 4XRGA 1IZ0A 1H6AA 3T4EA 1Q7GA 1NPTO 3OSUA 4QXMA 4NIMA 3GUYA 3EHEA 3F9IA 1PJ3A 2WWRA 5G2OA 1R4MB 5CDGA 4CR6A 1PWZA 3N58A 5KTKA 1JTVA 2DTXA 1JKFA 4AJIA 5JW6A 3E9MA 3IC5A 2JD0A 1E6UA 3TL3A 5DDIP 3GVIA 2IXBA 4UREA 3NJ8A 5C37A 1H0KA 4I1IA 3S55A 4NDNE 3PYMA 2I3GA 3ETEA 4II2A 4Y6PA 1BGVA 1MLDA 1SAYA 4R5MA 1UUFA 4ZQBA 1T2AA 4YAEA 3KEQA 4IY1A 3JSAA 1U2DA 4GH5A 4TVBA 4XYGA 1PJ4A 3WDSA 3GEGA 1LX6A 2P91A 1SMKA 4GKBA 2X0RA 3IAHA 2O48X 1SB9A 3IQDB 3GNTA 5THKA 4QEDA 4HX5A 3H9JA 4XQEA 4CV2A 1QLJA 4D42A 4IQGA 3L6OO 3AM3A 3EY4A 1WLYA 4HFNA 1X7GA 1LEHA 2QIOA 1O6ZA 3D4PA 4N5MA 4XYMA 4YJGA 4CQMA 4EJ0A 2E82A 4XGNA 3GH3A 3OP4A 4ZVVA 1VL6A 3UH1A 2VUUA 3WJAA 2YV3A 3LU1A 3WTCA 1XGKA 4GPD1 1PJLA 2OXIA 3ADPA 4NU5A 4JQCA 1T1SA 1C0KA 3OH8A 1YRLA 1U1IA 3BTSA 5JY1A 1FDUA 1ZJYA 2JHGA 3GQVA 2IDZA 4MP3A 2VN8A 2R6JA 3H5RA 4IIVA 4BGIA 1LRLA 1YB5A 3COSA 5JE8A 4PLFA 5EINA 3S2IA 3OIFA 4IPTA 2RIRA 4QT0A 4UEOA 4E4YA 3PWKA 1HE3A 1ZIDA 4RPLA 3ZWCA 5C3MA 1T2DA 1AGNA 3I1JA 4U7WA 4ZHSA 4U6QA 5T5QA 2X5KO 3RIHA 2GZ2A 2X86A 3TDKA 4GVXA 2W2KA 3P2YA 3PRJA 1E3JA 2EP7A 1NFQA 1M6HA 4NBTA 4WCDA 4F3YA 1G1AA 3PJDA 3O9ZA 3INRA 5G0VA 4WNCA 1I01A 1E7WA 2VTEA 3LLSA 2B4RO 1GEGA 1NFRA 2C07A 5TJ9A 3PHGA 4Z0TA 3RFXA 1R16A 4OOFA 2ZB3A 2V6MA 3H9EO 3CXRA 4LISA 4RCVA 3ENKA 1T25A 3PWZA 5I9NA 2J3JA 1JAYA 2E48A 4WPGA 1C1XB 3GVCA 4UVDA 3HNPA 2JHFA 2IYOA 3GVHA 4KUGA 1HRDA 4MVJE 5HM8A 3JQGA 2BELA 4KWIA 5LCXA 1DIGA 1YL7A 5EESA 1GYRA 1YBMA 4M86A 1SNYA 3E48A 5FI5A 4D7AA 4C7KA 3EAGA 3MTGA 4B3JA 4PRLA 1HYGA 2DTEA 1SBYA 2JCXA 4JROA 1IHYA 1HXHA 2YYYA 2EW2A 3I83A 3KVOA 4J6FA 1ISIA 3W6ZA 4CQLB 3QVSA 3JD1A 4ND5A 3EVNA 1LLQA 1ZCJA 3DQPA 1A72A 3OJLA 3FR7A 5A9SA 5CEFA 5EN4A 4E6PA 3HUDA 2HLPA 1PZEA 3MJCA 3GT0A 2B4QA 3LF1A 4GWKA 4L8VA 4PLWA 1T26A 2B37A 1SC6A 1J5PA 2PGJA 4BO4A 4PGFA 5HTOA 1Q2XA 3GMSA 3KYDB 4XQCA 4YAIA 3OQ1A 4JJIA 1I30A 3PLRA 1YH3A 4YJDA 2Y0EA 3OM9A 3I9KA 1BRMA 4OO3A 1E7QA 4PLVA 3RUHA 1JVSA 2CDAA 1RM0A 3O4RA 1TXGA 4AFNA 4J0FA 3M6IA 3VH1A 5L7TA 5TQVA 4RV9A 3RWBA 3PZRA 4B4OA 3AK4A 1D3AA 1KERA 2F00A 4BV8A 3DBHA 1TEHA 5FEUA 1UP4A 4Z6KA 5JMPA 4MKXA 5I9MA 3E03A 3QWFA 5COBA 4YBZA 2A9FA 2ZQYA 4K6FA 5KIAA 3FWNA 1K5HA 1B2LA 2BI7A 4NJOA 5ILOA 3ZV5A 1A4UA 1N7HA 4DLBA 1LLUA 2I67A 1DB3A 1ZK1A 1BXZA 4G81A 3AW9A 5T6BA 4CLXA 1VSVA 1N1GA 3VTFA 4BNVA 2DAPA 1U4OA 4EZBA 3OIDA 4BNHA 2NADA 1HZJA 4FS3A 4DWVA 2ILTA 3QVTA 3F5QA 5L9AA 3N7UA 1EUDA 4JJGA 4E31A 4YT2A 3PVZA 3GK3A 3E5MA 3QE3A 3WNVA 4CM3A 5CEEA 1D1SA 2PFGA 2R00C 1F12A 1ZSYA 4HNGA 1YBAA 4RPKA 3BHIA 4GX5A 1EUZA 4GX1A 4CM6A 2EW8A 5IXYA 4JP3A 1FDTA 3GG9A 2NU8A 1Z7EA 3WGQA 2V7PA 3RUFA 3B1FA 3FBTA 3PIDA 4YRDA 1XQ6A 3C7DB 1OI7A 3ZH2A 3WGHA 3VH2A 3WJ7A 4R41A 2H63A 2FZWA 4FFPA 2RAFA 4IS2A 3CEAA 1HSZA 2AEJA 2H9IA 1BXGA 3IS3A 4Y67A 3V2GA 2QQ5A 3D3WB 1NP3A 3DMYA 3Q9UA 4U0KA 3DFUA 4BL5A 1SOWA 3PXXA 2ZJ0A 3PGJA 1YL6A 3NDIA 1FJHA 2IZZA 2WYWA 3L6DA 3NGLA 3BMQB 5F1PA 1BVUA 4IUYA 3ROPA 1HWYA 4FCCA 3ZWNA 1JQBA 4OGWA 4XYBA 1DJQA 1PL7A 3OQBA 1T1RA 4GX2A 4XB1A 3TRIA 3CZRA 3VZSA 4J7XA 1FMCA 3JV7A 3DBLB 2DFDA 4DPMA 1ISGA 1NHWA 5B12A 3RFVA 3QHAA 1KS9A 1OMOA 1W73A 1I5RA 4J0EA 4ZA2A 5L95A 6LDHA 1UXIA 5JFOA 3FNGA 2EJWA 2VTDA 1LLCA 4I5EA 1MX3A 1C3VA 2F1KA 2VWQA 4QQRA 4CMEC 5CG1A 4JBGA 4ZRMA 4L75A 3QQPA 1ISHA 3DZFA 3JQCA 3DFZA 3RJ5A 5A4DA 1CERA 4J7CA 3GHHA 4NZ9A 3D1LA 3KM0A 2EXXA 4C7JA 1ZK3A 4OSOA 3RUIA 4IDAA 3STHA 1F14A 1LTHR 5EMHA 3DTYA 1KYQA 4AVYA 2B36A 2WD7B 2HO5A 2D5AA 4JCOA 4CMKA 2J5RA 3H5NA 1C14A 5DN9A 1XR3A 4FIZA 2R00A 2VNAA 5I7SA 3VKUA 5FFFA 5H81A 4R1NA 4YTEA 1P9LA 4J9VA 5JAMA 1E3IA 1M66A 1GD1O 2O2SA 3GGGA 3IKTA 3AM4A 3NX4A 4QFCA 3IUPA 2CZCA 1P44A 2ZYAA 3OQ6A 3GRPA 1PJSA 1R0LA 3GMDA 1Z6ZA 3VZQA 4MVJD 3TF5A 3U4DA 1CQJA 1MGOA 3OA2A 1QKIA 4I5FA 3F4LA 2PKQO 2YQ5A 3NUGA 4OL9A 4BNLA 2BFPA 1SO8A 4CMCA 1DIBA 2AQIA 4GMGA 1O94A 2AMFA 5A06A 4A27A 2IYPA 3TSCA 5JCJD 4J2OA 4OOEA 1ZK2A 3ST7A 2AXQA 2J3KA 2X1HA 1LC0A 1RM3A 1DIHA 4JBIA 4CLRA 2XXBA 1P74A 1BHSA 5JNLA 2QG4A 3ETGA 5M6DA 5IDYA 4RPGA 4FC6A 4GX0A 3TZKA 1I3KA 4BNNA 4HKTA 1R4MA 4L0QA 4J1TA 3PEFA 3L07A 1I3NA 3EUWA 3L4BC 2Q46A 2GD1O 2GR9A 2GGSA 1F17A 3GLQA 3PDJA 1P33A 5JYDA 4RF5A 1QP8A 3GZNB 4AJHA 4GWGA 4YACA 1PZFA 1ZO8A 3D7LA 3WB9A 4CMEA 3E5RA 5DP2A 4Z3KA 4NG5A 5BSGA 4R16A 4F6LA 1SPXA 2YFHA 1HDYA 1BW9B 2C59A 2UYYA 3BTVA 3DAPA 3H5AA 4XRRA 4CUZA 3DO5A 4BMSA 1E3WA 2NNLD 2GPTA 3ASUA 3PLNA 3WG9A 3JQEA 2PK3A 3OJOA 3BMOB 2J5QA 3FWZA 2W8ZA 4RLHA 1XU9A 3EW7A 4LCEA 3JQDA 1HYHA 3WYBA 5IDQA 2DTDA 1E1KA 2HMWA 3V5NA 1YO6A 2OL4A 3BHJA 4U0JA 1NYTA 3S8MA 5J23A 4AICA 2Y0DA 2Y0CA 3B1JA 3GNQA 3OJFA 2P2SA 1NQ5A 1ADCA 3C85A 4RDHA 5I8ZA 5KNLA 1LBEA 1ONOA 3UICA 4DREA 2GASA 4NH4A 3FI9A 5A1TA 1ZJZA 2XXJA 1MUUA 1E6EA 4S3MA 1YQDA 3NKLA 1HKUA 3OIGA 5COQA 5KJFA 3I9LA 1WDLA 2H1SA 1HE5A 2E37A 4CM9D 3UVEA 1KY4A 3HB4X 1VC2A 2P68A 5K0ZA 3G79A 4RQTA 5DCUA 3CMMA 4DIBA 1ULUA 1Z74A 3OEWA 2X5JO 3DHYA 3WNQA 1X1TA 1O9BA 4L4SA 2QYTA 1EDOA 1CF2O 5CDUA 1A7AA 1ZEJA 4KUHA 4EUEA 1P31A 1SB8A 3FBGA 4IDBA 2ET6A 3I23A 3IOYA 2B5WA 4RVFA 5IN5A 4ZICA 3RD5A 5AXDA 2QW8A 2Y1EA 1EK5A 2GNAA 4TQGA 2EIHA 2E6UX 4J1NA 3AI1A 1Y8QA 4CLDA 4XR9A 1J4AA 4WGGA 1NNUA 4FN4A 1KOLA 3H6KA 5F3RA 3K73O 3F6YA 1ZBQA 4G5HA 1GV1A 3QVWA 2GN8A 5KKCA 1T2FA 2VUTA 3VH4A 3QVOA 4GAEA 5HS4A 2ZCUA 4MJLA 5GY7A 1E3LA 1E7YA 3HDHA 5H82A 4R1UA 1Q0LA 2D1YA 4NFSA 5BSEA 2Y67A 2PR2A 2I9PA 1PQPA 4YJHB 8LDHA 4WEQA 3NEPX 4BNKA 1MXFA 1MC5A 4KQWA 1UXKA 2OBYA 4YAGA 1ISJA 3HE3A 4J16A 1PZHA 1XELA 3Q11A 4Y6SA 2WTBA 3KEOA 1U3WA 4MDHA 1PR9A 3RBZA 2VHXA 3M2TA 4BB6A 5ICSA 1VL8A 1FXSA 1YGYA 2Q2VA 3U62A 2B5VA 3I4CA 3I52A 4I8XA 5A5FA 3NT2A 2V6BA 2PGDA 5IN4A 2GO1A 1UAYA 1HDCA 2PKRA 4LMPA 3JQ7B 2X9NA 4RJTA 4RVHA 4DBZA 4FJ0A 1WP4A 2VWPA 2AQ8A 1YE3A 1DFIA 3BMCB 4IZHA 2AEMA 3E9QA 4OSPA 2IRWA 2O2YA 3MWEB 3O8QA 3W4IA 4CM8B 1GUFA 3VPSA 2AHRA 4OQZA 1BWSA 2NSDA 3IJPA 2WDZA 3G49A 2JCVA 4IMRA 4K28A 4IDCA 1HE4A 1UDCA 3QWHA 3ZN2A 5JO0A 4O6VA 4P4LA 1UZNA 5BQFA 3O26A 4N18A 3L0DA 2VT2A 4Z9YA 1PX0A 2Q1WA 4BNTA 4QX6A 5BR7A 1DFHA 3P5SA 3I6QA 3T7CA 1H5QA 4DL9A 4FOSA 2A4KA 4XYLA 3JQAA 2YUTA 1DAOA 4E3ZA 5KJ1A 5DT9A 5KVCA 4W7HA 3DC2A 3C7CB 2GERA 1T24A 4FOOA 4EUFA 3UCEA 1I2BA 3JYPA 3H2ZA 1W6UA 4AJ2A 3F1KA 3WYCA 3CMCO 5GZ1A 2YV2A 4RVUA 4OAQA 4IXTA 1LDEA 2VHYA 5F1KA 1PGQA 1DEHA 1NWCA 3IUSA 2W4QA 4NR0A 2QRJA 2WJPA 4EITA 5L4NA 2B83A 5EL0A 3ZWBA 1U5CA 5JYFA 2HSDA 3DHEA 3EGOA 3RQSA 5A3VA 2Z5LA 2WYVA 2GDZA 4J7UA 3TZCA 3VHRA 4CMIB 3IKVA 2JFHA 4PZEA 6ADHA 1R0KA 4R5HA 3E8XA 1UXGA 4UULA 4PZCA 3AU8A 1DC5A 1YKFA 3Q9NA 1C1DA 4DQVA 2FOIA 2SCUA 4NK5A 4CM5A 3HADA 1EBUA 1T4BA 3SC4A 2B0JA 2NQTA 4OMUA 2PLAA 3QIVA 3B1KA 1KEWA 2ZB7A 1I32A 1DFGA 2RH4A 4ND1A 4WJZA 4OJNA 4XZ3A 4KMSA 2EGGA 5C7OO 1A27A 4QO7A 1ULSA 3S2GA 2BGMA 3W6UA 2GN6A 1WMAA 4XIJA 1HEUA 1NQTA 2HRZA 3AOEC 4RLSA 1K6JA 1SCUA 4AJOA 3TWOA 4LSMA 2FWMX 1UAGA 3PJEA 4KTTE 4MIYA 4L9RA 5KJCA 3SVTA 3UUWA 5JDCC 3SJUA 1D4FA 1EK6A 1ZEMA 1GFSA 1Y81A 1MP0A 2TMGA 4EJMA 5TF4A 1DJNA 3VDRA 3V8BA 1WXDA 3DEYX 4YPOA 1TT5B 2HJRA 1X0VA 3BMQA 4B79A 1PTJA 2XOXA 2NACA 3B6ZA 1QYVA 1UJMA 2ZYDA 3DZKA 3JYQA 3OETA 5F5LA 2ZKLA 1W0CA 4YQZA 1S7CA 1EVYA 1R37A 2Y66A 2IZ1A 3DOJA 5DP1A 3TOXA 1NBOA 3M1AA 3KYCA 4AJJA 2OHXA 3C24A 1OZAA 2Q45A 4GKVA 4ZQEA 1LDYA 1GYPA 5G4KA 2HMVA 3WFIA 1B3BA 4NBWA 4TRRA 1U3VA 3RUEA 3U49A 2PV7A 3UF0A 3EZYA 4BNYA 3GZ4A 2YHIB 4TWRA 5CP8A 3UGKA 3F47A 4D3SA 1DC3A 3ROMA 4MVJA 4J91A 4MIOA 2QRLA 4YRAA 3F3SA 5JMWA 4ALKA 5KJ6A 3ZV3A 3K6JA 4WCFB 1TLTA 1SEPA 2DBVO 1IPEA 1UXHA 2VHWA 2WSBA 3EZLA 2GN4A 5HS6A 4BKQA 2ZB4A 4FQ8A 2YQ4A 2OFPA 4CR7A 3VTZA 3RVDA 2FY8A 1EFKA 1GUYA 1OAAA 3ETDA 5ENVA 4IJWA 4E5KA 1N9GA 4GGPA 2W90A 2GZ1A 3DR3A 4WECA 4BKUA 2XF8A 4JN6B 5I7EA 4UVIA 3SBOA 4EBFA 4MVJH 5JXWA 2UUPA 3U09A 4JIGA 2DPHA 2D3TA 3RC7A 2NV6A 2PTGA 4J43A 4TRJA 4B8WA 5CFZA 3IP1A 4AJPA 4UVEA 1O89A 2GLXA 2FHSA 5DZSA 3JD0A 2VZ9A 4Q3NA 3AY3A 5JO9A 1PJTA 3DXFA 4UVHA 3ZCXA 3WMXA 4FSHA 2J5KA 1ENYA 3AOEA 4BNIA 4EYEA 4TVOA 5ER6A 2D59A 5JDCA 1BXKA 1JU9A 4FFNA 4R9RA 2G82A 4IJKA 1DBVO 3WOHA 4BKPA 1F8FA 4E33A 1ADGA 4YT5A 4XJSA 5B4VA 1NR7A 4OKNA 2VHZA 5FF9A 4BO9A 1NXQA 1DRUA 2W98A 2BGLA 3JQ8B 1YJ8A 3WFJA 2DT5A 1IB6A 4R9SA 4YJFB 5IG2A 1LQTA 1E5LA 3TOZA 1N2SA 1GV0A 1FDWA 3HJAA 3E9NA 1ZNQO 1PGJA 2I76A 3Q6IA 2VWGA 4YT8A 3VPFA 1QLHA 2DFVA 4AJNA 4NJMA 3IL2A 2O3TA 4YT4A 1WPQA 4GLOA 4J1SA 4OXKA 1VLLA 4RPJA 1M76A 1U2GA 4DLAA 2A35A 2ZQZA 4BQRA 2FSSA 3GRKA 3VDQA 1M67A 1LC3A 5ICMA 5TGDA 4KZPA 3WYEA 4CM9A 3CIFA 1GEEA 2JL1A 3QY9A 3BMNA 2V6FA 1B8UA 4PCVA 2VUSA 3QRWA 2JJYA 3A28A 3Q1LA 2IEDA 2LDBA 3HDQA 3ZWMA 1HT0A 3NYWA 4I08A 4IDFA 1NPYA 1E77A 4HFJA 3KSDO 4XD2A 4KP7A 1PGOA 1YL5A 4E32A 2EERA 3PK0A 2CUKA 1PS9A 2CY0A 2O50A 4B7XA 2BFMA 1XA0A 3AM5A 5L40A 4PVCA 3FF4A 4CL8A 2YHUA 3C7AA 2Z95A 2GCGA 1B15A 2EGHA 1MXHA 1IHXA 1PGNA 4FR5A 2ZB8A 3DBRA 3TFOA 2B69A 1ID1A 1U8XX 3SX2A 4RVSA 5C5IA 5AXBA 3JTMA 4CM4A 1Q0HA 4AG3A 4IJUA 1KEPA 5TJHA 4CLOB 4BNGA 4ALNA 1GQYA 3W4KA 2UVDA 3FN4A 1LLDA 5L4LA 3DZBA 4EI2A 3R6DA 3OFSA 2VYNA 4MOWA 3X2EA 1G6KA 2HMUA 4OXNA 2E49A 4WKGA 3PQDA 1H2BA 4J4BA 3EYWA 4UAGA 4CLEA 1D1TA 4E12A 3ITDA 1O5IA 3C1TA 2I3AA 3DZJA 3C8MA 4I9NA 4ND4A 2DM6A 4R3WA 2GSDA 2VRCD 4BNUA 2HMTA 4BMVA 4CV1A 5JAZA 1IL0A 1Z45A 1GADO 3ENNA 1HDXA 1ZK0A 4PFJA 4PZDA 4TRNA 2PWZA 1EE9A 3H65A 1Y5RA 4E2WA 2FP4A 3RFTA 3G1UA 5JY6A 1PQWA 2NQ8A 5G0TA 1PS0A 2BLLA 4AJ4A 4FD3A 1KEVA 4IXWA 3RC2A 1NTOA 4LVUA 2NWQA 4H16A 1ZVMA 1H6BA 3BYZA 1X0XA 4ONEA 3QWAA 4GQAA 1E1MA 5AXAA 1YOVA 3ZU4A 3ZDFA 5CG2A 3ADOA 1DXYA 3UXYA 3GUCA 2OBNA 4IDDA 2EEZA 3GDFA 1Z7BA 2HRBA 1GQQA 1HLPA 1JDJA 1LJ8A 1R0SA 4MIEA 5CDYA 1PZGA 4R3NA 1A4IA 2CDCA 3U5TA 1DC6A 1UP7A 4PLZA 3MJSA 3DAFA 3LF2A 4E2YA 1Y8RA 3OF2A 1PWXA 4IQ8A 4YB8A 2NUAA 3E1KA 5KJEA 4MVJM 2FPIA 2YV1A 4AJEA 2QZZA 3GF4A 3WXBA 2ZIZA 1E3EA 4HV4A 5AVOA 4E30A 3ZW8A 4DPLA 1GU7A 2P4QA 2EKLA 2WE8A 1GCOA 4IS3A 1IUKA 5TSDA 1E1NA 2C54A 3VKVA 5DOZA 4L74A 2NVUA 3V1UA 2AG8A 2DBRA 2HAEA 1B26A 1R4NB 3KV3O 2VZ8A 5JC1A 3GN1A 4AJKA 2CMDA 5L7YA 4DUPA 3KZVA 3KB6A 4BGVA 3AI2A 2HK7A 4D0SA 2FPGA 1B16A 1ML3A 4O59O 1E92A 1LUAA 4ALJA 3K30A 3PGXA 2QZ9A 2O7SA 1ZXLA 1XWFA 3ULKA 5IFLA 1P1HA 3NGXA 4XGKA 2UV8A 4ZD6A 3CZMA 3ZV6A 1JW9B 3HHPA 5TX7A 4JK3A 1ISFA 1B0AA 1CDOA 1MG5A 4P38A 4DQUA 3JYNA 1RYEA 4OIMA 3OA0A 1B8PA 3DDNA 5DBFA 4JLWA 5A5EA 3JQ6A 4PIVA 3TZ6A 2FZEA 4MVJG 3TJRA 1KVUA 4BV9A 1QV7A 1U8FO 1ORRA 3I9OA 1TT7A 3L4SO 1EVIA 3LC7O 3HFSA 1W4ZA 3QLJA 1MV8A 2H5LA 3WQRA 2JKVA 3RC9A 1YXMA 3PZBA 1BDMA 3ANNA 1X15A 3GDOA 3AUUA 4E2XA 3ZWYA 3AWDA 2TMDA 3WMWA 4BNXA 1K6XA 3GVXA 2JCYA 1GCUA 5F5NA 1Z82A 4M8SA 4WOKA 3PHLA 1P45A 1W8DA 1XKQA 3GR6A 3WS7A 1DHRA 2E4AA 1GQ2A 3D3EA 3MZ0A 2W2LD 2G5CA 1X7HA 3D4NA 1I3MA 5DOVA 1R15A 4HNHA 4L73A 2Y1CA 3FCOA 4Z9FA 5JYAA 4XR4A 4L4XA 1H9BA 4A10A 4UUNA 4BO8A 4WLNA 1NWHA 1V6AA 4WOJA 1TT5A 3NT4A 1GR0A 2JFFA 3F4BA 4IZIA 4B4UA 4D41A 1CJCA 1GPDG 3PWSA 4KUEA 4CQMB 4YJGB 4CV0A 2DVMA 1ZFNA 5JAQA 4E5PA 3MJTA 3Q3CA 3IJRA 2BD0A 1DRWA 1Q1NA 3LT2A 3NTQA 3RSHA 4PG6A 4Q3BA 2LDXA 3GOHA 3NTOA 5JLAA 4BNZA 3E18A 2D4AA 2DBQA 3CKYA 4IINA 4TRMA 1X7DA 2Q22A 3A4VA 4R51A 2POQX 4QFDA 3GFBA 4MKRA 4Z0PA 4BB5A 4HBGA 3PQEA 3JQ9C 1H93A 4F46A 4WNIA 1RM4A 5ES3A 1PEDA 2NTVA 4Q3AA 5H83A 2Q1SA 5A02A 1E7MA 1EFLA 4I5DA 3AI3A 4EDFA 4PG4A 3A06A 4UUPA 5AOVA 2O3QA 2W2KB 5ENDA 3ZZNA 4D45A 4U6SA 3IMFA 3WSWA 2CNBA 3OICA 4MO2A 4CQMD 3GGPA 5CAEA 3I3OA 1QRRA 3NDRA 1XCBA 2Z1NA 4H3VA 1DOHA 1OC4A 3W1VA 1B7GO 4XQ9A 3JD4A 1VRWA 4WLOA 3EC7A 4K9DA 3D64A 4BVAA 4D3DA 2FR1A 2X7HA 1CETA 4ROSA 1ENZA 4Z9XA 4Z3DA 1WWKA 3L9XA 2A94A 2ZTMA 5A3JA 1TB4A 2EKPA 4DTIA 3K5PA 1KETA 4G2NA 4ND2A 4M1QA 2OZPA 2Q2QA 5G0WA 1JKIA 2I66A 3AUSA 1KC1A 5AYVA 5T67A 3KUXA 4E13A 3JQGB 4R69A 5A05A 3LZ6A 4RL6A 2C7VA 1I10A 3RCBA 4ALLA 3LC1O 2BF7A 3H4VA 3SJ7A 1QORA 4DYDA 1ENPA 4IGEA 3R0IA 2D5CA 5EERA 4X54A 3ZU2A 3KLMX 3LC2O 1C0LA 4S1VA 1ZH8A 3LVFO 2Q2WA 1DRVA 3M1LA 3HSKA 5KVQA 1JN0A 4YQYA 9LDTA 4DIOA 4RDIA 3ZNOA 1U3TA 1GUZA 1VKOA 5A04A 1LA2A 2OO5A 4YVFA 1F0YA 4YJFA 3WGTA 3WLEA 3EVTA 3RBXA 2OUIA 4Y8VA 5A9SB 2PGLA 3PHJA 4N5LA 3U4HA 1MG0A 3SLKA 2BKAA 5DBIA 1ZW1A 3OECA 3AY7A 1IULA 3F1LA 4YRBA 2HUNA 2WD8A 1A5ZA 4W7IA 4HP8A 4BO6A 1HDZA 2DU8A 4QSMA 3A14A 2GYYA 4OQYA 3JQ9A 3OBBA 1YDWA 2VNSA 3PJGA 1C1XA 3DMTC 3QSGA 2X22A 2EHDA 1P1FA 3BHMA 3ZNPA 1I24A 1CRWG 3HWRA 2PKQP 3MOIA 3NDJA 4AL4A 3H9GA 1HE2A 3UKOA 5B4UA 4XDZA 1ENOA 4Q3EA 3F46A 3BTUA 4IQ0A 1WVGA 1NX6A 2ZK7A 3ZWPA 5TC4A 3DBHB 3H2SA 3H9UA 2Q50A 4CUKA 4D44A 3VOSA 4JX8A 4NK4A 4RORA 1U28A 1NVGA 4FGSA 5MGBA 2UUOA 4JGBA 4R1TA 2UAGA 2NU6A 2WYUA 4B3HA 1XDWA 3R3SA 2I6TA 4TKLA 4CQLA 1C0IA 4M54A 3AJRA 2CSUA 4BNFA 3GG2A 1TA4A 3QW2A 3H3JA 4H15A 1K3TA 3GGOA 4H7PA 1WZEA 2C29D 4M87A 1Y9EA 4PLPA 3ZI0A 4HADA 2C20A 3TZQA 4M89A 4P4GA 1UDBA 4DLLA 7ADHA 3ICCA 2G1UA 2IXAA 4KQXA 1PU2A 1KBZA 4E5NA 5F21A 3BIOA 1HF3A 2HU2A 3KYDA 4R1SA 5ADHA 2RBEA 2PH5A 2O3RA 1FDSA 4K1LA 3AFMA 5TNXA 3ZHZA 3OMLA 2ZTLA 3PPIA 4O1MA 3ROKA 1QYCA 3MTJA 2YDXA 5K6AC 4FPXA 3GN2A 4TKMA 2YY7A 2C2XA 2WMDA 1DLIA 1ONNA 5G0UA 1JLLA 1JVBA 4BGUA 4RVGA 4A26A 5L53A 4DC0A 1L7DA 4D3FA 1S6YA 5COAA 3CUKA 3U3XA 2O7QA 1BXGB 2WE7A 5T57A 1EUCA 1L1FA 2P4HX 3E82A 3L77A 1FDVA 4M55A 4LVCA 3DMTA 4NNJA 2P5YA 3E6AA 3PYLA 3GY0A 2EF1A 1LSUA 1BG6A 5BNIA 4K6CA 3ZNQA 5FI3A 4RZHA 5DCWA 1MB4A 2OORA 5K9ZA 2H6EA 3ROQA 4R68A 3T7EA 4U8GA 5EQFA 5BSFA 4UUOA 3RASA 2Q4BA 3KXDA 4J4TA 3V1YA 3ZWAA 4W82A 5TT1A 1I33A 5EJ2A 3EK2A 2DLDA 1CIVA 5CEJA 2NLOA 1UZLA 5B37A 1NQAO 2RHRA 1ARZA 1RYDA 1NASA 2QX7A 5LC1A 5F1OA 2ZTVA 2FR8A 3AUTA 1B14A 5I7FA 4HFMA 2BRUA 2GN9A 3G1TA 4CMBA 3D5QA 3H8VA 1DSSG 1HDRA 1N92A 4ILKA 4NQZA 4WLFA 1NAIA 2OGUA 3LDHA 1QSGA 2C82A 1I2CA 3WBFA 4PLTA 3VVCA 2O3JA 3KSUA 3WQQA 2I65A 4LSWA 1LSJA 1LXCA 1LRKA 1EEHA 4P22A 5L3ZA 1XQ1A 3OJEA 1IYZA 5JS6A 3OJ0A 3D3WA 4PG7A 3JYOA 3KLPX 1E3SA 3AOGA 4B7CA 3FSRA 5BSHA 2IZ0A 3U0BA 4HFRA 3U9LA 4OKIA 1MFPA 5EQDA 5K6AA 4WUVA 3WGZA 5TS3A 4CM7A 1Y1PA 2VQ3A 2Q1UA 3VVBA 1CYDA 5BT9A 2AE1A 3VPGA 4O0LA 5IF3A 1RPNA 3JCZA 2OP0A 4W6ZA 4BO3A 4GBJA 3TL2A 2ZTUA 4A5OA 3C1OA 5LDHA 5MDHA 2IODA 1SEVA 3DBLA 4CL3A 3BTOA 3WBBA 2CF6A 2D2IA 1GY8A 3HB5X 1EMDA 2W2LA 3INTA 2PZMA 4WLVA 4JXKA 4NHEA 1ZUD1 5CHEA 3RC1A 2FPPA 1DIAA 4CLRB 1J6UA 4IMPA 1P1RA 3KTDA 2VYVD 2G17A 3QWBA 4FC7A 5DULA 4HXYA 3ON5A 2VOJA 3K96A 4BMNA 1GZ4A 4CLHA 3N74A 1JA9A 5IDXA 5DCYA 5L45A 2PZJA 1VJTA 3FD8A 4QTZA 5KVSA 3D0OA 1ADFA 5DF1A 4ZJUA 2HQ1A 1QYXA 5JCJA 3W8FA 1ZXBA 2QYSA 1GDHA 3JD2A 4FBGA 1H6CA 4N54A 2ZYGA 3EDMA 2BFAA 2PY6A 4ZQFA 2HJSA 4MVJP 2JAHA 1LDNA 2J8ZA 2WD7A 2FR0A 3PDUA 4W9NC 4ZQGA 1MC4A 3VZPA 4YXFA 3TZHA 2NM0A 2PNFA 1TVEA 1LU9A 2ZATA 5FWNA 5DNAA 4R4JA 3WQSB 4DA9A 4IDGA 2O4UX 2P9GA 1E7RA 3RKUA 4F6CA 1OC2A 3RROA 3K9QO 4LN1A 1U5AA 5HBRA 1MA0A 1E3WB 3WGGA 1QYDA 3AY6A 1H9AA 3VAZA 2Q1TA 2X23A 4R54A 1CEQA 2X58A 1HDGO 2RH8A 3PI7A 3WSVA 5L51A 1WNTA 2X8LA 2EKQA 4I5GA 5GMOA 8ADHA 1H2HA 4RQUA 1DDOA 3UCFA 3NV9A 2G0TA 1A7KA 1NFFA 3GEMA 4A73A 3FR8A 2J6IA 4E0BA 3PIIA 1I8TA 1NM5A 3GC6A 3ZV4A 3WGYA 1EVZA 4DMLA 4FJ1A 1BDBA 4CV3A 4XKJA 4ESOA 1HZZA 3G0OA 4RF3A 2DQ4A 4NBRA 5A03A 3CE6A 4CMJA 3Q0EA 1PJQA 3GZNA 5HA5A 1K0UA 3DL2A 4KTVE 3NT5A 1DHTA 1PL6A 4ZU3A 3KHUA 1O0SA 4GVLA 4NI5A 4XWYA 2Y93A 4FFMA 4CMAA 1YB1A 1BW9A 2O3UA 3WR5A 3I9MA 2EWMA 3W8EA 1V8BA 3NRCA 4KWHA 1GTMA 3GHYA 1Y5MA 4MP6A 1RJWA 3GA0A 4BNMA 3CINA 2DPGA 1QYWA 3BMOA 1A71A 3DZHA 4NFYA 1Y8QB 3QWIA 3HFGA 1HETA 1P77A 4W9NA 3OHSX 4E2ZA 1KVQA 1XSEA 3HN2A 1V35A 2CVQA 1V9LA 3DOOA 1V3UA 4MP8A 3NTRA 1K6IA 1EE2A 4J49A 4A7PA 4EGFA 1IPFA 4YDRA 3MJVA 1Y9AA 3PTZA 4Q39A 3ASVA 1V0JA 5A9TA 5JCXA 4XEHA 2AA3A 1B3RA 1M2WA 2NTJA 5L7WA 1M75A 2GZ3A 4A2CA 3UN1A 3GPDG 1Q7BA 4TZTA 1R66A 5ITVA 3DB2A 3ZHXA 2YJZA 4LGVA 5CPBA 3K8ZA 1YDEA 4L76A 3CPSA 4DYVA 3UCXA 3PFWO 4RVDA 1JWAB 5J9GA 2D0IA 1PSDA 4RGBA 5T73A 4NBUA 3VZRA 1P3DA 2FMUA 4UUMA 3UOGA 5B1YA 1JAXA 2O4CA 5TLSA 4B4VA 1BTOA 1LQUA 1U7TA 3PQFA 2CD9A 2X9GA 2Y05A 1UP6A 4FFOA 3GNSA 2HCTA 3RUAA 4BHTA 4GGOA 1Q0QA 3JQFC 1RWBA 3O8QB 3UAGA 1QG6A 4EEZA 2AQKA 4JJFA 1BSVA 4OM8A 3LYLA 3ZWVA 1E0DA 3MOGA 3MEQA 4NFHA 3AU9A 2DC1A 4WK6A 3CH6A 1PJ2A 2PZLA 1FK8A 5GZ3A 2IE0A 2V65A 3P19A 1V3VA 3SLGA 3ZU5A 2GRAA 2X4GA 4LMRA 5I7VA 4YJHA 5KCZA 4J2HA 3SC6A 2YW9A 3PHIA 3RI3A 3GVPA 5LDGA 3ABIA 2OOSA 1LSOA 3JQAB 1HYEA 1T4DA 3ZWXA 1EQUA 4WEOA 4C4OA 5B4TA 4TMFA 5T64A 1U4SA 1Y7TA 4DBVO 4D0RA 5IZCC 4B4WA 1T2CA 3VPHA 1EZ4A 2Q3EA 2VWHA 4FFLA 4PLCA 1JKJA 1KVSA 2PD3A 1HSOA 2Y1FA 4MPDA 4D43A 4D46A 5L4SA 4GSLA 4XCVA 1AXGA 2X0JA 3JQ7A 3K92A 1VJ0A 1YQGA 3A9WA 3LT1A 3WICA 2HK9A 3BMCA 1GYQA 3PP8A 4F45A 1ZKMA 1ZK4A 5U4QA 1M6WA 1PJCA 1F8GA 4RO0A 4CM8A 5BNTA 1B8VA 4EEXA 1UDAA 1WMBA 3FPCA 2NU7A 3JQAD 4DIFA 3IDSA 1ZMOA 3WX0A 1IY8A 2X0IA 1C1DB 2IEBA 1E5QA 2QHXA 3WIDA 1CWUA 4OYRA 3GAZA 2C5AA 3I6IA 4J4HA 1TI7A 2AE2A 4FGWA 3MWDB 3UFXA 3ZWWA 1QMGA 2HKIA 3L9WA 4NU6A 2HMSA 1GZ3A 2B35A 1GPJA 3WWYA 1K2WA 1KVTA 3ZGYA 2VCYA 2PH3A 3JQFA 4HY3A 4DQXA 4WE3A 1XU7A 3PJFA 2VOEA 1WW8A 4RF4A 4BO7A 4BNWA 3KBOA 4PVDA 1NAHA 3QVXA 1LI4A 3S2FA 1DLJA 3B20A 1OBFO 3LT0A 2Y99A 1EBFA 4ALIA 3GPIA 2FSVA 4WCFC 3DOCA 3KRTA 4PLGA 3TPCA 5T8KC 4MINA 3TQHA 1LDGA 4QO8A 1P0CA 3KYCB 4MVJI 4PG5A 1P1JA 1WAMA 4JNKA 4BUCA 4Q3CA 3WLFA 3RUCA 1V3TA 1C0PA 5G4KB 5ITWA 2J3HA 4EUHA 4CMIA 1R6DA 1ZSVA 5DBGA 3ICPA 2XPCA 1VI2A 5IZCA 3SXPA 4ALMA 4Q3DA 3SEFA 3RUDA 1AE1A 1ONPA 1BVRA 1LDBA 4II3A 1F06A 3S2EA 4A0SA 3U4CA 3INGA 2CF5A 2HK8A 2RHCA 3DTTA 5JC8A 2D8AA 2J3IA 1YWGO 1Z73A 1IZ9A 1U3UA 2BFOA 3ONFA 4URFA 1G0NA 2VRBA 2AEFA 2VT3A 2VZ0A 3LQFA 4PLHA 5JDIC 1KEUA 4RF2A 4XA8A 2Y1DA 3I9NA 4E5YA 1BMDA 4W99A 2JFGA 1OOEA 3R3JA 2JAPA 4XYEA 2VYVA 3KETA 1L7EA 1WZIA 4BKOA 1N9GB 4FFRA 3HDYA 3RKRA 1VPDA 1AXEA 5ER9A 3TNLA 4YWJA 3HN7A 4BO1A 4BO2A 1Y6JA 4DRYA 1D7OA 4GLLA 2CVOA 4YAKA 1VM6A 5TIIA 3D5TA 3W4JA 4DC1A 2Q4EA 4ND3A 1J49A 1HL3A 3FTPA 4DVJA 1I3LA 1XEAA 2P9EA 3QP9A 1P0FA 5CDSA 5CDTA 3R1IA 1UR5A 3FNFA 4J3FA 4WLUA 1X1EA 4Q9NA 1J0XO 3KYBA 4JP2A 1FF9A 3IP3A 2PA3A 1YONA 3JQBC 4CMGA 3MJEA 3DWFA 3UW3A 4CR8A 3RBVA 2OMEA 4LK3A 4RZIA 3V2UA 2YHIA 3GEDA 4YEDA 1NVMB 1PS8A 3PHHA 1HDOA 2X0NA 4I9HA 4XJTA 4WLEA 3DZGA 1Q7CA 4WCFA 1UZMA 1DC4A 2X6TA 3ONDA 5T8KA 3WTBA 2AW5A 1E7SA 2GUGA 2NVBA 1U7HA 3CSDA 3V2HA 3OEYA 4B7UA 4CUJA 4EW6A 3H7AA 3FRJA 1YBVA 4LCJA 3BA1A 4NJMB 3JD3A 3WWZA 5ILGA 5G0SA 2V6GA 2A92A 2HDHA 3BXXA 3VH3A 4HWKA 1KIFA 3DAGA 1T2EA 1O8CA 1GL3A 1JWBB 1PGPA 2OP1A 4EJ6A 4XB2A 2R2GA 1EDZA 3T4XA 4TZKA 1U9JA 2NTNA 4XDYA 4UEKA 2DBZA 3ORFA 4ZGWA 4J9UE 4PRKA 3KOUA 5JDIA 3VC7A 1YQXA 3BMNB 3DZIA 3S1LA 4RPHA 2CFCA 5TRTA 3GDGA 3ITKA 2I99A 2JD1A 3BZUA 4CM1A 1KY5A 2Y1GA 1DAPA 3BAZA 3MCVA 1VJ1A 2DKNA 1Z75A 3KSZO 4YA6A 4P8RA 5C7IO 3C3XA 3O03A 2AQHA 2EJVA 3HQ4O 2YFQA 4INAA 3JQ8A 1AN9A 4KDEA 2G76A 4Y9DA 2EP5A 5THQA 3DBRB 2Q49A 4ID9A 4PN3A 2FN7A 4CMHA 4KDFA 5G4LA 3I9JA 4OHUA 2EV9A 5FYDA 3JQBA 2ZJ1A 4FW8A 1XYGA 3GAFA 3M2PA 1NVTA 4E21A 4CM4B 4BO5A 1OFGA 2PD6A 4N5NA 4D79A 5HRUA 4HUJA 4GMFA 2JD2A 5EPOA 1RKXA 2C2YA 3B70A 3DHNA 3QA9A 4CODB 4K26A 3G3EA 4DXHA 5U9CA 3HDJA 3ZNNA 4IIUA 3TN7A 4W4TA 5AXCA 3K31A 1RM5A 5IZ4A 4UEJA 2XAAA 4FB5A 3W8DA 4ITUA 3PYXA 4NMHA 4Y98A 3DONA 5JYEA 1KVRA 3L4BA 5JAIA 1ZSNA 5I8WA 3NJ4A 1N7GA 2WEKA 1H94A 4DMMA 2AG5A 1SZJG 1G0OA 2Q99A 4IDEA 2I5PO 1A9ZA 1NHGA 4BO0A 4Y6RA 1IOLA 4XIYA 1HTBA 3DBVO 2EG9A 3FHLA 4BKRA 4BNJA 4IBOA 1NR1A 1AHIA 2PD4A 2Z1MA 5IAAA 1VKNA 2YDYA 1YVEI 4XQGA 4NPCA 5IDWA 3LT4A 1D8AA 1UH5A 2WM3A 1ISMA 1VL0A 5HWSA 4AJLA
chains in the Genus database with same CATH superfamily
3THYB 4PLYA 3FCEA 5FUMA 4OJQA 4M1EA 4LAFA 3B13B 3SXJA 4YLGA 4M1SA 1PJBA 5JASA 4LG1A 1LTQA 1XZGA 3I42A 3LWZA 3PT9A 2F8TA 2Q9AA 5IARA 4YGXB 3LYUA 2DULA 2YV5A 4BJ6A 2CDBA 4TTAA 5EUQB 2H48A 4B48A 4ZQHA 1TA9A 1ZNXA 2P5UA 2QVYX 5M2QA 3OKPA 5JJLA 2Y27A 2C3OA 4FDMA 1ZOLA 1NQOA 4H1WA 3Q3VA 1GTRA 1W0KD 2FPXA 5KWEA 3VR5D 2REBA 1RABA 3KU1A 4C03A 3WGOA 1K5DA 3BQ9A 1XEWX 1OD6A 3ELBA 1UJ5A 5C7LO 2FGJA 2NO4A 2WT8A 3HEBA 1G21A 2NUAB 5IS2A 3DG9A 4DG8A 4TWAA 2W2TA 3H1BA 4GI2A 2DUWA 2YZ7A 4LW8A 3OBIA 3STXA 4QPPA 1GTZA 4JB2A 3OTIA 5JFTA 4EX7A 1KF0A 3S29A 5BSWA 3FROA 2HCBA 2AOXA 2VHVA 1L5MA 1LSSA 2W6OA 3JARA 1N8KA 4U5QA 4QJ3A 5FNVB 2CDRA 4QUKA 4EKIA 5FWXB 2QRKA 3VPXA 1ZHOA 1N9ZA 2VA9A 3VC2A 1ECPA 4UNNA 2XB9A 3IWDB 2Z2JA 3A1WA 3HUFA 2O3SA 3W3AA 4LJKA 1YBHA 1W34A 4N7JA 2GJKA 3FDFA 2FRDA 4UD2A 2W37A 1IFXA 5JOQA 1I94B 3WWOA 1BE8A 5CVCA 3L46A 2PH1A 3UJBA 1GG9A 1MFZA 4WASA 2BTOA 5BW4A 1ZHFA 3TFQA 2G9UA 4QJBA 1UDWA 1GAEO 3V1TC 5C8DA 7MDHA 5JVDA 2PUDA 3F3MA 1AG9A 4XGIA 1OYVA 1R8QA 5A0VA 1LRJA 1JH9A 1RYBA 1NPDA 1KSHA 1NJSA 2G9VA 2XSZA 4MYSA 4PYRA 1WHSA 2FFJA 4LZPA 3HDVA 1MX9A 4B44A 1LNQA 4MDYA 4PC3A 4F21A 1QVWA 1ZYUA 2C7GA 3X1XA 4BXOA 2PS9A 3DE4X 2ZETA 4RA6A 3B9RA 2XADA 1V26A 3E2MA 5F51A 2NYUA 4CL0A 2RGCA 3IBTA 4IIGA 5EJFA 5IXSA 1QIFA 1D6NA 3LK7A 4RAOA 3PKZA 4EQ6A 1ZZEA 3E23A 3FNHA 2AIRA 2WU1A 4DCSA 3AFNA 2OAGA 1DEAA 2A0UA 1K4YA 3K4HA 3WGIA 1DIRA 3ME5A 1GNVA 1OCEA 3FTDA 4OK5A 2GSWA 2GCPA 2PGOA 5AKLA 2CEAA 5U1PA 3WO0A 1KMMA 1N1EA 1ZW6A 1T4MA 4P83A 5EXEA 3I2KA 2GFIA 5E2BA 2ZUWA 4RHXA 2A5GA 5HOQA 1CQIA 1ZN9A 4NV0A 4DDVA 5JPIA 1YC5A 2VDRB 3A9SA 2P9YA 3BE4A 3D1VA 5AJXA 3U60B 3HG7A 3PFFA 1F1BA 4UOEA 1X86B 3G0IA 2FI1A 2H08A 4OLHA 1I0ZA 4TROA 3FDZB 3T12A 3VO8A 3ESBA 2R8EA 3A4LA 3BB3A 3SZLA 1R4NA 1XUOA 4XB6B 2GX6A 3VYSB 2JA1A 4QXOA 4B3IA 3P2OA 1XHLA 5EIOA 3C3KA 4ZO9A 2JLVA 3ETLA 3ZXSA 4AKGA 3NAQA 5FTWA 5JBIA 1VE9A 3L02A 3UANA 5EZQA 2Q8NA 1D0VA 2KMLA 1X14A 2JARA 3ANYB 3C1AA 1XDUA 5D6NA 4LPKA 4NENA 3UJCA 2PE5A 4X7PA 3L6UA 2G40A 4CG3A 1H8ED 4KMMA 2B94A 4QECA 4IJVA 1A69A 2JKYA 1L8OA 3LVBA 4O4JB 5HCIA 4Q7QA 1A9YA 3FFBA 1WB5A 1TCCA 3VMFA 3MXOA 1TVKA 4YP0A 4HR7A 3V7YA 3PNOA 3WMRA 1DIOB 4A03A 5CK5A 1NQVA 1P60A 1FRNA 1SD5A 2MSDB 2X9VA 4MUXA 3RK1A 4YX9A 3M3PA 3RC3A 2G0NA 2D0PB 3RS3A 4M99A 1NQWA 1VYHA 2ZIXA 5ALKA 2BFNA 5F4BA 2WSIA 4AY5A 1UPBA 1Q7GA 4IWYA 3DDHA 2P41A 4NE7A 4QXMA 2PGIA 4DADA 2PUTA 2V5AA 4GL2A 3OIWA 3GUYA 2RHGB 1PJ3A 2WWRA 4MR8A 5CDGA 2IP1A 4CR6A 1FLNA 4WJLA 1PI3A 4TL9A 2IYVA 5FH9A 2G7ZA 3PS9A 3HSSA 3MBIA 2JD0A 1E6UA 5HYVA 1SA0B 1CUDA 5EP2A 3FAKA 2GKGA 3FVTA 3GVIA 4G0MA 4EI7A 4Q4CA 3MT9A 1FSSA 1XDDA 2W4MA 3R41A 4AM8A 4LOAA 5JS8A 1VQ1A 1KGSA 1PWEA 4I1IA 2I3GA 2G9NA 4Y6PA 5DE3A 1SAYA 1XQYA 1JDBC 1H1LB 4CE6A 1E9VA 4OU4A 2I6GA 3VZBA 4IY1A 4C05A 4GH5A 3A58B 4KI0A 3WDSA 4IRMA 4OUDB 3S2SA 3Q8KA 1E18A 5DB4A 1UKZA 3P9SA 1PV4A 1CW2B 4EY5A 1IC6A 1OFTA 1XKLA 2IU3A 3IQDB 3UC9A 4MUIA 3ICEA 3OLYA 4A2PA 2VK1A 821PA 3VO1A 3H9JA 4XQEA 4AY6A 2VHTA 3R7SA 4D42A 3MUOA 3GP5A 1RRKA 3EY4A 4COOA 4O2BF 2R5FA 3BRWA 3BH6A 1C4WA 2PN1A 3FCCA 1H05A 3D4PA 3QPUA 1O6ZA 4HNQA 2HA7A 3EXHB 4N5MA 1DE0A 3BMXA 3BORA 3ZLBA 4XGNA 4RKFA 1T9BA 5F7ZA 1KAEA 4ZVTA 5C8ZA 2DY0A 2R1VA 1TMGE 2VUUA 3UK1A 2YV3A 3G59A 1J00A 2GT1A 4MGEA 2G7MC 3G8YA 1KZGB 5BVHB 5AR1A 4F2DA 4F3RA 4FYWA 1RYFA 4OXRA 1YQWA 1T1SA 1UDXA 2VAPA 3IVAA 5H5JA 3TRJA 2XDAA 3WJ1A 3LFHA 1ZHHA 2JGAA 2XODA 1U1IA 3JRWA 4L6CA 4D0LB 1SBTA 1S2IA 4KX5A 4L8LA 3RNOA 2W6JD 4RTOA 1QOPB 2R6JA 3THXA 4RESA 3K6SB 4RVCA 4S04A 4BGIA 1QO0D 3CZPA 4AMYA 4IPTA 5HZMA 2RIRA 1S1CA 2X1MA 4E4YA 3PWKA 1HE3A 1G64A 1LBTA 1OJLA 4P4SA 5C3MA 1T2DA 1Z2CA 4PGHA 2XKBA 4U7WA 3O8DA 5AM0A 4GNRA 3CCFA 3PUKA 2XUIA 1SHLA 4I50B 4ZAWA 3RIHA 4UM9B 1UBTS 3QMPA 2W2KA 4GVXA 3TIXB 1JSRA 1W1WA 3RR2A 1RWVA 3K35A 2DMRA 3L8ZA 3WNDA 1G1AA 1PZMA 3CF4A 3DLAA 1II8B 1US8A 1Y1TA 3M49A 5G0VA 3RIEA 2E5LB 4HAWA 2FXIA 2O2CA 3FG9A 3DL7A 2WV7A 3EGCA 4JC0A 4TKZA 5FJIA 3RJMA 5D6OA 1E4YA 5DTQA 1U1EA 5KNDH 1JZSA 3KX2A 3LLSA 2C07A 5CW2A 5AHXA 4B3SB 4HEJA 5B7PA 1R16A 4W7SA 4P98A 1AC5A 3V33A 2HSZA 2V6MA 2E6KA 3H9EO 3CXRA 1FQJA 1Y63A 5ICEA 2Q4DA 4GPTA 5LQKA 5I7UA 4BLRA 2E48A 3HNPA 4HPJB 5ALQA 3PT5A 2FSGA 4INJA 5TEVA 4F56A 4QRDA 3SE7A 2WA2A 3GVHA 1DAEA 4RIFA 4WVLA 1GGMA 1UPCA 2BELA 3JQGA 2JK0A 3K1JA 5AJTA 4C88A 2UZ4A 1XTIA 5LCXA 1MOSA 1S1MA 4HZGA 4BBJA 4ND7A 4N47A 1PVOA 1YBMA 1SNYA 4OHMA 3LUHA 4YJ3B 5FI5A 3USCS 2WUEA 4JELA 1J97A 2YZKA 2IGBA 4KQFA 4B3JA 4XWGA 1XQXA 2VDQB 1CZRA 1SBYA 3U80A 5HOEA 4RSMA 4JROA 1IHYA 2NU6B 3ACDA 2OC9A 4J6FA 4BLSA 4GPAA 3LW7A 4R2JA 3IAUA 3JD1A 3A6KA 5L6MB 2QE7A 4ND5A 5A7GA 1ZAYA 2ORYA 2F6RA 4LJLA 1MC8A 3U6KA 1EAYA 2H29A 4DJTA 2Z8YM 5KAPA 5A9SA 2GCOB 1G7SA 4DARA 5EN4A 2PRJA 1HR0B 1YZLA 3HUDA 3HHEA 2WPDD 1ODCA 5HF5A 2CLIB 2ABWA 2QAIA 2H1RA 3LF1A 2B98A 3RYHB 4L8VA 4BJ5A 2IHNA 3VX4A 1LPMA 2BEWB 4RADA 4RTRA 1TU3A 3KTAA 2CK3A 2BAGA 2GESA 4BO4A 1BFDA 3NHWA 2XD9A 2RBGA 2ZREA 2HU7A 5CBPA 1JE1A 4XQCA 3GMSA 5AVUA 3PD0A 1FSGA 3EW9A 3DTVD 2WG0A 4YAIA 1TC2A 4Y3UA 4ARVA 4R71A 4C76A 3VC1A 1NYQA 1QK3A 2WF7A 3DZ6B 3QENA 2Y0EA 1U98A 5EWMA 1BRMA 1BN7A 1E7QA 1KKMA 4CQNA 2C4VA 5CB4F 1R4ZA 1HT2E 2AOUA 2I2WA 4EJFA 5LOVF 1TM2A 1TQHA 2EX1A 1WUYA 1J2JA 3M6IA 4J0FA 3VH1A 4Z7JA 2PUFA 2RHWA 4B73A 2A84A 2OOKA 3DEJA 5ALYA 3N70A 4C0KA 1YF3A 1NATA 2F00A 3GWGA 3O0DA 3U9SA 3JS5A 3U1BA 2XKKA 1M5RA 4BV8A 3NVMB 3AINA 4ETMA 4XVRA 2P7IA 2W2OA 4DRXB 1FRFS 3BIWA 4Z6KA 1NBMD 4JAVC 4HTFB 2HJ9A 1Y3CE 1EUCB 1F0NA 1ZD5A 2ZRQA 3DCNA 1I4WA 3F9RA 5GM2A 4A0FA 1XXHA 3SHOA 1X1QA 4UJ5A 4YBZA 3LD9A 1QONA 5LZ2A 2BLNA 2WJ6A 3PQ4A 2YZNA 3OWXA 1DXHA 4NJOA 2ZAGA 2OAP1 5ILOA 1XLUA 1A4UA 5EIFA 2ZIAA 4JDPA 2CV1A 2A1TS 4G81A 3MCUA 1EU1A 4KXUA 4WKBA 1FDIA 1JGTA 3AHCA 3FPKA 4PC1A 2DAPA 1AVTA 4RY2A 1CY4A 1W4LA 1ZQ1A 3HZRA 3VHQA 4UE6A 2F1RA 1IPHA 4G0NA 4EZBA 2DWOA 1IBSA 2R6CA 3EUEA 1UXOA 3HJGA 3NB0A 3SIXA 1J90A 3F5QA 3RJZA 4E31A 3CTPA 3F6RA 2ZRGA 1IEQA 3PVZA 3GK3A 2IYQA 4CM3A 4PEVA 1RC0A 4D4HA 1WA5A 4CIXA 2F1OA 5CFPA 2PFGA 3QH4A 3Q41A 5K8CA 2JGNA 2DBYA 3HA2A 4KGXA 5EKXA 3UFBA 3P8ZA 3ET4A 1U8EA 3EF0A 4GX5A 5P8WA 3TE7A 1A50B 5IXYA 2P75A 3NRBA 1GNRA 4IDHA 4RHYA 5TGTA 1QQBA 5E6RA 3T5DA 4H59A 2ODTX 1Z0DA 4H4DA 2V7PA 2H2FA 1CRLA 4GRAA 4B47A 1XQ6A 1YZTA 3P52A 3QKTA 2J5XA 3LQ1A 3WJ7A 5I7WA 4KR3A 2XXAB 4R41A 2H63A 2FZWA 1V41E 2W71A 1RWPA 2YZ2A 4FFPA 4WT7A 1N75A 2QY9A 2IBTA 1BXGA 2WWYA 4YRIA 1SK8A 5FNVA 4D9EA 4FMBB 3C87A 1NRIA 2OO3A 4BL5A 3DFUA 6AT1A 2O20A 4CDMA 4E51A 4G5GA 2JH9A 3NDIA 1OXTA 3DE7X 3R3XA 4OKSA 1ULHA 5FAKA 2ZGVA 1FSZA 2JAXA 1BVUA 3H0WB 3BMQB 3FCYA 2VPTA 3ZQJA 4Q12A 1YS2X 4FCCA 4Y1EA 3SX0A 4TLCA 4GZ6A 2QTCA 1Q19A 5FDFA 4DKXA 2BJWA 3LXXA 4HGOA 5J2UF 2QUBA 4PPFA 3F2VA 1T1RA 4GX2A 3EC1A 3LKVA 4XB1A 3PB3A 4GKKB 3GEPA 5JFGA 1ITZA 1DI0A 1KGDA 3DBLB 3HR8A 1QPBA 1R8SA 1CDEA 4OJKA 2CJWA 3DE3X 2B9VA 3IQEA 3S28A 3LY5A 2G77B 1UJNA 5LM3A 3ORSA 4J0EA 1OMOA 5DTJA 5BN1A 1PNRA 2WKQA 6LDHA 1EP9A 3ADKA 1UXIA 2AK3A 5JFOA 5KYKA 1P8JA 3RHSA 3G0HA 2UXBB 5G02A 1ZA1A 1VDZA 2FPPB 2VR1A 2ECKA 2F1KA 1AQ6A 2IYYA 5E0KB 1C7IA 4X20A 3TIFA 4BVBA 2QG6A 1V16B 1YCHA 3GJ8A 1P0MA 2FPOA 3O8NA 3DZFA 2HF2A 3DFZA 4UTZA 1JI0A 3LRTA 2HBYA 2PX6A 3NDPA 3VGPA 1KIMA 3LBAA 3CNEA 3ZVRA 1WG8A 3FE2A 5M04A 3F3KA 3GHHA 3FA2A 3ZCTA 1YRYE 4PX3A 3OTHA 4AURA 4KR9A 1TM5E 1EGQA 2OZVA 4RMJA 4ZPXA 1F51E 4IGIA 1JR3D 1P1BA 2B36A 2JGEA 4LXXA 4AVYA 3JRNA 1T4GA 4AY4A 5DN9A 2G1AA 4PAWA 2W0SA 4ISBA 3H2JA 3VKUA 1CR2A 1FRVA 4GPBA 4OQQA 1MBZA 2EZ4A 4GLFA 1P9LA 1IY9A 4J9VA 4AUEA 4KN9S 5EQJB 4BE9A 1XVVA 4XM0A 5EXSA 3AM4A 3IKTA 2O57A 3AKCA 4CETA 3OQ6A 4NV1A 3SEAA 2IELA 2C78A 3GMDA 5IJAA 3O8CA 1Z6ZA 5F9MA 3VNSA 5K3FA 2R85A 3K15A 1QKIA 1GZHB 4I5FA 4KE9A 4HPWA 2PKQO 2YQ5A 1KAMA 2WVHA 3NUGA 4TS1A 4YECA 3OJWA 4BNLA 3H1EA 1SO8A 4CF6A 1DRKA 3VHXA 3JASB 2GEKA 3GA5A 1VKHA 4A27A 2O2ZA 5A06A 3W2EA 1P2FA 2JASA 1RYHA 4K9QA 4BC0A 4HGYA 5JCJD 1LPOA 2F8MA 1ZK2A 4OOEA 3ST7A 2C4HA 3BB1A 2IZOA 2ATIA 2J3KA 3I05A 1RM3A 3ZWDA 1CE8B 1C4OA 4I6JA 1DXQA 3WKBA 5CA0F 2C0QA 4HNRA 2GF0A 1P74A 4H27A 1WMEA 3BIFA 3E4CA 5M6DA 3OC0A 1UIRA 5FORA 3TI9A 4JA0A 1V5GA 3ZQ4A 4M6WB 3AF0A 4GX0A 3TZKA 1XTUA 5INTA 5JH7F 3N7TA 4QBFA 2FWNA 3C16C 1JNYA 1THTA 3L07A 1L4MA 1RVDA 1WMSA 3PV0A 2GD1O 4N5DA 4PXAA 5EZ6B 3VYWA 4TS3A 1G1MA 3HPQA 2PYDA 4UNPA 1P33A 3UYKA 1KNXA 1SA0A 3OT4A 2CEKA 4RANA 4NMXB 3FH0A 5A7HA 1KI3A 2X0FA 1DTWA 1FUEA 2ZBRA 4AJHA 2CLKB 4GWGA 4L9SA 2FPRA 3WB9A 1Y48E 4BPBA 2VNHA 3K9WA 2YIJA 3FLBA 1IQRA 4HSGA 1SPXA 4MIKA 1FTGA 1LPNA 4WKOA 3QPDA 3JVIA 4HEA6 2UYYA 4CUZA 2P40A 1GSOA 3VDMA 1JHZA 1SXHA 2V6JA 5KHLB 4E3WA 1RXUA 1G8FA 4IXDA 4J16C 1R0YA 4DF3A 5GIOE 1IZYA 3BMOB 4LCEA 3QTLA 4TWBA 1HYHA 3WYBA 2ZIGA 3L8GA 2DTDA 1UBRS 3BBLA 4G0YA 3FZGA 2OL4A 1ST2A 2GN2A 2JJ1D 2XMDA 4DC9A 4U0JA 2VLIA 3L49A 1NYTA 1OW3B 2MSCB 1RRPA 4HN9A 1X1SA 5JSUA 2BZ0A 4MTLA 2Y0CA 1FVOA 3OJFA 5I8ZA 5KNLA 1RRVA 5T7BA 3RHZA 4P7JA 5KMGA 1RAFA 1E0KA 4ZCPA 3I8SA 3FOZA 5B5SA 2IITA 3ZZUA 2B1JA 4UM8B 2ZSEA 4V38A 1RSZA 1U2RA 5JTUA 1DELA 5E9QA 2GTIA 4DSZA 4D2IA 3I1IA 1PNOA 3OIGA 1XZMA 3CZAA 1NMEA 4N49A 4UCXA 3VX3A 5BUZA 621PA 1RI2A 5JNVA 1HQDA 4JLPA 4DIUA 2ONCA 3MERA 1GZUA 4E11A 2FLWA 1JJIA 3UVEA 3WK6A 5CCEA 1ZGCA 4GUAA 2XCRB 3NCTA 3A1EA 4EJSC 4QZVA 2E4XA 3ZK8A 2GPNA 3CMMA 2AFIB 3O3MB 4O2LA 4REMA 4BRZA 3PJRA 1X7WB 2VXCA 4K88A 4ZI7F 1TUGA 5K1ZA 2OHGA 3R3ZA 4I1UA 2QT0A 1CF2O 4FXPA 5CDUA 4KUHA 2HQOA 1WOYA 4OX9B 4G8DA 2XYVA 4IDBA 2FF5A 1VI6A 5IN5A 2OV2A 3EISA 3ZCPA 4E7OA 4Q9LA 3VR1A 3SJZA 4EPVA 2AT1A 2AKYA 1EK5A 2VJYA 3DPSA 1P1CA 4NZZA 4TQGA 3IXMA 4UQPA 1LD3A 1SUBA 5BV0A 3OT1A 4YJ2B 1E2UA 5IC4A 4LE2A 3TIGA 4ZHQF 1PHPA 2WKSA 4XR9A 1J4AA 3VR6A 1NNUA 4FN4A 3GUUA 1CUIA 1KOLA 2YVAA 4EGJA 4R8SA 1ZBQA 3OE5A 1GV1A 3QVWA 1XEFA 2QTBA 2ZI9A 4G5HA 5ANRB 3BGDA 2RHLA 2VUTA 4BN5A 1CXZA 4Q1BA 3CV3A 2BEJA 3NAGA 2R11A 5GY7A 5KTYA 1FL9A 3GJ5A 3HDHA 5E6UA 2D1YA 3Q6NA 3ZY5A 2Y67A 1KRWA 3ZCQA 1PQPA 4G1MB 3A9UA 3V4PB 1MXFA 1TIBA 4KQWA 2OBYA 4YAGA 2COUA 4J16A 4ZODA 3X1MA 5K0GA 5D00A 1H0RA 3Q11A 1Q77A 3K9GA 3QLVC 4HEQA 4JWKA 5H3CA 2JIRA 1KL7A 4DMGA 1X8LA 2XUFA 3RBZA 3AR9A 5A3SA 1GGEA 1JG2A 3M2TA 1AQNA 1GU0A 2G83A 1VL8A 4IIEA 4NU8X 3T0GA 3MTEA 5BR8B 2X2PA 4PCUA 1QX4A 3QVLA 2ZYRA 2A1UB 5CX1B 3RRZA 3SR3A 3NBMA 2VJCA 4PQFA 1CP2A 1GFIA 5A5FA 4NOMA 3ZEAA 1JFFB 1TM1E 2UKDA 3AETB 2PGDA 3LKBA 2VG8A 4GOJA 2GO1A 3E5HA 4MRVA 1UAYA 2GCOA 3SSAA 2NV2B 4ATNA 1RMTA 5IHPA 1FJGB 1EK0A 4OQNA 3A6GA 2X9NA 4C14A 5DT2A 1AM4D 4FJ0A 4AAYA 4ZARA 1U8UA 1JJFA 1C2YA 2AQ8A 4YMIA 1YE3A 3L7NA 4OSPA 1GGFA 1Z2PX 2ZPUA 1REQA 5IDVA 4CM8B 1GUFA 3RSZA 4OQZA 2LNDA 4EJSA 2NSDA 5BV8A 2IV3A 2OBFA 2FW8A 3TAXA 4IDCA 5ESWA 3NPMA 1M2GA 1UDCA 2UZAA 3GJ4A 2QGNA 3WLQA 4B6GA 1MJ5A 2CHFA 5KSYA 1W0JA 5BQFA 4PV7A 3RAGA 3L0DA 5H8WA 4Z9YA 3EH2A 3QSYA 2I8LA 2AYZA 3BFJA 1SKQA 4KCGA 5HKLA 3TEJA 4KQ2A 4NE9A 1H5QA 1DXOA 4FOSA 4LHYA 5BYJA 1Z6PA 1DAOA 1P81A 1P5JA 4HMQA 2MJLA 2PU7A 4O2AA 3KFXA 4W7HA 2B61A 2CKDA 3UB4A 1UIMA 3TEFA 3C7CB 1GWNA 1G55A 5JYDA 4L4UA 1LB1B 5I6DA 3ZUGA 1WCIB 2M6LA 4E1BA 4EFKA 3H2ZA 1VG8A 2HT6A 3U3ZA 1JIQA 1QHSA 3F1KA 2Q0SA 2ZSAA 3TW8A 4EELA 5BYAA 2E18A 5KO2A 1E2PA 2A3RA 5JJKA 2FMHA 3DL0A 4IXTA 4ON9A 4P82A 3EPPA 4Q1CA 3SVLA 4FHFA 1OREA 1YUBA 2QRJA 3DAYA 4UD6A 3DS8A 4EITA 3GIWA 3K2QA 1OKKA 2HGSA 3B89A 1J7KA 2H0RA 3V3KA 1SY7A 3QLVA 5B1HA 3WADA 1OROA 4BLQA 2WHXA 2VF2A 2V0GA 3R5HA 1U5CA 4N7BA 3DHEA 1WF3A 4AF8A 2VZLA 3ZLTA 2PPVA 3IEIA 5A3VA 2COKA 3OTWA 2VL7A 3THSA 6ADHA 1NJ5A 1ZUIA 3IKVA 1G63A 4Y0VA 3T9BA 1R0KA 4RMIA 3E8XA 4AMBA 1UXGA 4UULA 4JNCA 1PG0A 3HJHA 2LXNA 3LJKA 1CZHA 3Q9NA 1C1DA 2X76A 2H31A 4I99A 1B43A 1H22A 3A3NA 5K8UA 4NK5A 4R8RA 3HADA 1GU1A 3NBUA 3SC4A 2PLRA 5SV2A 3MWDA 5E9WA 1M7GA 1QH1A 1RLOA 2AZ4A 3QIVA 3T7EA 3TOZA 2YN0A 2W2XA 4OJNA 3R3WA 4MUAA 1A27A 4QO7A 5DXJA 2O8CA 5HG0A 4L50A 2QTAA 4PTYA 2ZRMA 4IIJB 1NQTA 2BBTA 3AOEC 1SCAA 2G6TA 2RGUA 1RBYA 3EODA 3GPBA 4G8BA 4AJOA 1UAGA 3SVTA 4DLWA 3U7JA 5JDCC 4YS6A 2IHBA 1D4FA 2QL5A 3EVFA 1RLJA 2IYTA 3UJ3X 5DNUA 1Y81A 2ZRKA 1JPVA 3KTOA 3VDRA 1HMYA 4Q6WA 2UZ1B 4ZOCA 2WHYA 1WXDA 3CUTA 5EYPB 1TT5B 5HDQA 2HJRA 3COPA 4X3OA 4BP1A 3MT8A 3BMQA 5BWMA 5EFOA 1WPXA 3TQQA 4D5GA 3QFRA 2X8BA 2NACA 3FVRA 5FUXA 1UJMA 3CUVA 3JYQA 2QSYA 3OETA 5F5LA 4L5YA 3SF8A 4EI8A 2VK2A 5JMWA 1QP7A 2BWJA 4C3OB 5E7IA 3B7WA 4FYKA 2C9CA 2P67A 1EVYA 4KQIA 2Y66A 3T61A 1ECLA 1X87A 3IAS6 5E3HA 1PD0A 4WNYA 3RS4A 3E9CA 4ETNA 2JLYA 4AZVA 1NNLA 2ASVA 2OHXA 4HSEA 1OZAA 2Q45A 4AJJA 4F04A 5B6IA 4CG1A 1LDYA 1CU1A 3ACCA 4J94A 2R0QC 1GYPA 1GIAA 2ZEJA 1AKVA 1XT6A 1Z3CA 2V4MA 2JHPA 3TZBA 1XVAA 4TRRA 1U3VA 3UAWA 16PKA 1PWHA 3OOHA 4YAOA 2PV7A 2XNCA 3UF0A 4WNAA 2IPXA 2BV3A 2YHIB 3ONVA 3UGKA 2RGYA 5JHHB 2E9SA 4YRRA 5K8JB 4HVCA 2PO7A 3HXKA 1LF5A 2RGDA 3MMXA 3G5TA 1EIWA 3FYUC 4KC0A 1GXSB 3CGGA 4HNAB 5KJ6A 1CUEA 2P3LA 1PHRA 2VJKA 4HUQA 4YREA 1SEPA 2BSXA 2IYSA 3LT5A 2VHWA 2H7CA 1G20E 5CLGA 4S1WA 5ISMA 2QJWA 2WSLA 3WQHA 1HOTA 1EFVB 4QDUA 5J5VA 2GN4A 3IPXA 1SUPA 4FQ8A 1KWGA 1GOTA 3KOWA 1LW7A 4C4OA 1KOJA 2PWYA 4MPPA 4ZI5A 1EFKA 1O2DA 1OAAA 4LQDA 4CIVA 3G85A 4E5KA 4F2WA 5JNWA 1P2SA 2D7JA 3CWQA 3QKWA 1Z29A 4WECA 1X74A 1NIPA 1FC0A 5I7EA 2XRYA 5DYYA 2ROQA 4MVJH 3IR5A 4P3OA 5CVEA 4J43A 4TRJA 1IUNA 4OA5A 5JXJA 4UVEA 4JMLA 2AZXA 2GHRA 3AY3A 4X8OA 4W8GA 1PUIA 1SQSA 1VE5A 2KSQA 2AD5A 1F8YA 2O1XA 1QF7A 4MR9B 3WYAA 4B83A 4AF7A 4EVIA 3VU9B 1GG5A 3AOEA 3OEHD 1Z0IA 4YALA 1WY7A 1JFSA 2WM8A 2W22A 1T8YA 2D59A 2ST1A 4MWGA 5JDCA 1N0IA 1JU9A 4X44A 3OU7A 2G3YA 3IVXA 4FKBA 4R9RA 1QGED 4KE7A 2IPNA 1V7PC 3B6JA 3QEMB 4L02A 2FJ0A 4KYIB 4E33A 4BLPA 2JHCA 1ZD4A 4UM5A 3ETCA 5B4VA 2J3EA 1I4OA 2J48A 2XOKD 4Q4LA 2ZUSA 2YOFA 1ECJA 1E6MA 2XDYA 4HF7A 4OYHA 4PXYA 2W98A 3C5VA 4ZGBA 1OLSA 2FPSA 3MSXA 2XRMA 1MJNA 2CXSA 1C80A 3JQ8B 1X1CA 1JEOA 1E8DA 1B0PA 1UK9A 3CX7A 4YJFB 2AMLA 2X1VA 4P5DA 5FTNA 3V1LA 1N2SA 1NU6A 1T9DA 3E9NA 3OX4A 2JLRA 2YNMC 3MJRA 1YRHA 2I76A 3Q6IA 4P3XA 1QLHA 3FLEA 3KKPA 1MABA 1SIOA 3NYIA 1G3UA 3OO0A 4K6KA 5CVUA 5J2TB 3IL2A 3IAFA 2VF5X 2L82A 3H87A 2YWFA 1ZCFA 4RSHA 3VR2D 4J1SA 1XPJA 4OXKA 3VR3D 2WU0A 5AJVB 1NSTA 2E21A 1DRJA 4BQRA 1RHUA 3P9KA 3TLKA 1YZHA 2QTMA 2C3PA 5GIPE 3EVEA 2ENUA 1MVLA 2PRYA 4GZMA 1YQEA 4IRUB 1RXVA 4FLFA 1LC3A 4D81A 1GPWB 3QG5A 1PJ8A 3QMWA 2IPMA 3TDMA 3WYEA 2XLCA 4Q4JB 4DR5B 3CIFA 1FNSA 4ZDWA 3CG4A 5AW3A 2NUTB 3QY9A 4AL4A 5JSZA 1D6MA 1CQPA 1W49A 3ZCVA 4K9OA 4LXUA 2CGEA 1QP0A 3QRWA 4DA4A 2PGAA 1YHNA 2YC4C 3Q1LA 2C96A 5HSGA 4PC2A 4OTZA 2JFXA 2P6OA 2LDBA 1TKAA 3HDQA 3QE2A 5LBIA 2YJ6A 1HT0A 3K09C 3NYWA 3O4VA 4IDFA 1K8RA 2W6MA 2FZVA 1E77A 1UBNA 1ZC3A 3D2CA 3IAAA 1V2HE 4HDSB 4HFJA 5BV7A 3R7BA 1C9EA 1YE8A 2DWQA 2VJNA 4E32A 2B78A 4EYSA 5HVNA 2WAOA 4ZV7A 1PS9A 3GLFB 2BFMA 1XA0A 1RLIA 3C7KA 4X8LA 3DZ5B 4AP9A 4YUVA 4PVCA 1QDLB 1WW2A 3UXMA 4DMRA 2FQYA 3C7AA 1B15A 5E6SB 3PGLA 4JOQA 1XTKA 5B55A 4U7HA 5DM60 4DSTA 3TFOA 3OD1A 2B69A 1DQRA 2FLKA 1YZYA 3RDPA 1MRNA 3MTBA 3PPYA 1XPRA 4N5IX 4OGKA 3EP9B 5FBWB 1OI2A 2CFSA 3JY6A 4BZQA 3JTMA 5A3QA 5E9AA 3DEKA 3MF4A 3KXIA 2Z4TA 4IWNA 3TAHA 2IZ6A 4CM4A 3BZBA 4DQDA 4AG3A 5TJHA 1TJ4A 1HE1C 4MRMB 4BNGA 4INZA 4IH1A 3W4KA 2FRVA 5FBKA 1LLDA 2B7CA 3TGLA 1A8QA 3C8HA 2OPHA 2BGIA 4EKYA 1LS6A 3IBFA 5AM5A 1PUXA 5E1BA 3AM1A 2H1WA 1TZBA 3R7LA 3MMSA 4UPEA 3EIUA 4MZXA 1EINA 1RJ9A 3IDZA 3D8TA 1X39A 4FOPA 4Q5IA 2HO4A 1XFAA 2YNMA 3NBKA 2YW2A 4IGAA 5REQB 2WY2D 3ZLUA 1OH8A 1GHTA 3U4MA 4OXNA 4UOQA 2ZVQX 5IW8A 4YJ2A 3VRHA 1XCOA 1PZNA 4J4BA 4Q3LA 4XX0B 3EYWA 4UAGA 2I7VA 4BB0A 4ZALA 2JJQA 2WHQA 3C1TA 1H0HA 2MSKA 3PX3A 2LUOA 4QT4A 2C7RA 3H5LA 4AYWA 2BOVA 2GSDA 3B5IA 3KIPA 3GUZA 3V8RA 4PC6A 2C61A 1Z45A 2ZBPA 5BSTA 4CV1A 3RVRA 3ENNA 2JLAA 2WWVD 4TSFA 2OKCA 3GX1A 4PFJA 1VSQA 4PZDA 4TRNA 1H3EA 5U4XA 4BB9A 4ZCTA 4E2WA 5C18A 3RFTA 2HPAA 2ODBA 4RDCA 3FUVA 3N9IA 1WB9A 1RKVA 3CX6A 2DSNA 2O1WA 4P58A 1Y4UA 5F4ZA 3DE5X 2HRDA 3RV4A 1NTOA 1XA3A 2JEOA 4NPAA 5HTKA 5A71A 1D8TA 3LZCA 4C0LA 1QK5A 2NWQA 5K3SA 3TM5A 2GUWA 1NULA 2FZKA 2GKSA 5AOBA 3BCHA 1E1MA 3K09A 3NLLA 3ZU4A 5AM2A 4NNOA 1A98A 4KNWA 1XNGA 3ILXA 3GUCA 5EMJA 5LLDA 1OZGA 4IDDA 3GDFA 4NS4A 5GTDA 3AHFA 2FWPA 3ENWA 1MHMB 1P0PA 1R0SA 4MIEA 3U5TA 1W87A 1NU8A 2V1UA 1A7JA 4CFYA 4E2YA 2FFAA 3B52X 5EJAA 2FW9A 4TMKA 1Y8RA 2DJIA 1N2GA 1PWXA 2QVZX 1W5BA 3EG5A 3A2LA 4MS3A 4H1TA 3VYTB 4BAUA 3H99A 3UA3A 1DKNA 2YV1A 1Q14A 1FCJA 1RZVA 1POXA 2PJUA 3WXBA 3RYFB 3R4VA 2ODEA 3T41A 2OAEA 3DGFC 5B3AA 2NU9B 3FDJA 1BXRA 3PF9A 3W7AA 5KU7A 1UWCA 1E61A 3ZJ4A 1GU7A 2P4QA 4QPCA 2EKLA 2RKOA 5CW1A 4IOLA 2V3WA 3VKVA 2PWBA 4L74A 5DOZA 2RHOA 1G8PA 2IKQA 2YINC 4XVUA 2NW6A 3HK2A 2HAEA 5EE5B 5JH7B 4N5HX 3KV3O 1YS7A 3HA5A 3O1JC 4YRCA 2GEDA 1T3GA 4K05A 1HT3A 3KZVA 3OE4A 1CULC 1SWWA 1SIWA 1K66A 2BKEA 1UBKS 3WGLA 4D0SA 3TUXA 1BEEA 2B6NA 3UOWA 3DCJA 4NEQA 1M1XB 3LXMA 3DFFA 2B1GA 4ANFA 4JQSA 4JC8A 4WZBB 3FWKA 4UKDA 4ALJA 2OLKA 2PAAA 3K30A 3S99A 4UBOA 5KSOA 3L1HA 2EKDA 1Q95A 2QZSA 1A4RA 3CZ5A 4NMWA 3L2OB 2K6GA 2X5XA 4KFUA 3ZHOA 1XWFA 3ISVA 5IWAB 2D0OB 5IFLA 4QLAA 1J8QA 1T1JA 1P1HA 1T3SA 1WCIA 2UV8A 3GZJA 3NGXA 5KWIA 4Q24A 5DSXA 4QTYA 1A5TA 4P5EA 2PBLA 4IGKA 3P0RA 2XCOA 2NXEA 1ZIXA 4JK3A 1MG5A 1B0AA 4LVOA 1VE3A 1A77A 2VDNB 1FXUA 3BJRA 3D54D 4FFWA 5EMKA 3WBKA 1OF1A 4DQUA 3P9IA 1J07A 3JYNA 1NX9A 4HG2A 2B1RA 4HRYA 3RSQA 1RYEA 2IV7A 4MVYA 2XQGA 1YZUA 4TUYF 4YLEA 1ZQ9A 4DUGA 5A62A 3DDNA 3LCRA 2TMKA 5G3ZA 5HGJA 5LQUA 2XCSB 3KJEA 4QYIB 4DHEA 3S1AB 3C45A 1Y6FA 5JECA 2PL9A 1KVUA 1QV7A 2HDWA 2AUMA 1TT7A 3ELDA 3EXEA 4RULA 2HEGA 5L3SB 2XQFA 3LC7O 3LGSA 2XYRA 1QAQA 4AT1A 3BJIC 4OI0A 4K2HA 1S8OA 1DO0A 1M2KA 1YXMA 2CHUA 2OGTA 4G4GA 2WNIA 2IOFA 3D0QA 5TARA 5HUHA 2IH5A 2GRJA 3OZSA 1O96A 4C2TA 1J06A 4M1KA 5EKUA 1JIJA 4E2XA 3AWDA 5KQPA 1S7GA 3WMWA 2XOEA 2PVPA 3ZS8A 3LOUA 4BNXA 1PW7A 3QK7A 4GECA 5DKFA 4E88A 1MO2A 4MS1A 4WY8A 3GR6A 2JHAA 4QNMA 5IMBA 5K5EA 3O1HB 2W2LD 4IIFA 4GP9A 3F2IA 1Z06A 3T7RA 1ZPDA 4IIJA 3HP7A 3LPNA 2WIJA 2IPAB 2NO1A 4TMYA 1IOWA 1NQUA 1GA1A 2E1PA 5DOVA 5LP6C 4L73A 3QHPA 3UMBA 2Z6QA 3TQSA 3GL9A 2GBPA 2ZJ3A 5HX7A 4Z9FA 2PX8A 5JYAA 1C81A 1P0IA 1X92A 2EDAA 3R5FA 1K9VF 1DG1G 4WLNA 1V6AA 1TT5A 1DAIA 3NT4A 2QSZA 3IIMA 1GR0A 2JFFA 2WNHA 4B4UA 3M6XA 3AVUA 5GV8A 5IF9A 1YJAA 5EVJA 4DR7B 3PWSA 3ZW7A 4CQMB 4YJGB 3Q7PA 3QG1A 3SOZA 4CV0A 5DNWA 5GONF 3WGUA 5JAQA 4N7MA 1XTTA 4EKGA 3Q3CA 5B6PA 2G8LA 2QN7A 1GFWA 3LT2A 4I1YA 3WRYC 3LHKA 5GOTA 2ZT7A 3BZWA 1SXJD 4RHFA 4JA2A 1JLMA 1R5BA 4ZVOA 1Z5OA 3L3BA 3QBJA 5DHRA 2LDXA 2QU8A 1B1CA 2V7XA 4IINA 1LH0A 4GSYA 4XOIA 4HYTA 2Q22A 3A4VA 4O2BB 2ORED 1UBEA 2POQX 2NT4A 3BL6A 5DFAA 1F2TB 1ZZGA 4A8HA 4HBGA 4Q47A 3PQEA 3WGKA 2Z2IA 3LQRA 1PG2A 2G71A 4WNIA 1RM4A 1FUIA 3ZHTA 3UPTA 1QQTA 1KOGA 2NTVA 4NF2A 4UM7A 2DG2A 2OR3A 2WKPA 3BFVA 3BSWA 3KYIB 5A02A 3AI3A 2ALJA 4EDFA 4NNPA 4F97A 1N5IA 2KQUA 2QM7A 3A06A 2HLDA 3BRWD 1I13A 3IMFA 4KQGA 3PQ5A 1WPRA 4I4CA 5EJ4A 1OIXA 1UBLS 2NT3A 4RXTA 2YZGA 3GGPA 3I3OA 1DKMA 4D3XA 3VV2A 1C4KA 3A10A 5K05A 1OC4A 2AKAB 1KO1A 2XUGA 4KPUB 2WW8A 1IY2A 1QBKC 2EAUA 4POAA 4WBXC 5CJJA 2QSJA 2WT4A 2GBLC 3NIFB 4WLOA 4BJ3A 4K9DA 4AO8A 3QM1A 4BVAA 3FGZA 4ROSA 4Z3DA 1CETA 4QDJA 5IUNC 3KSRA 3L9XA 3FZEA 2LZ0A 2ZTMA 1F0PA 4F86A 5A3JA 3KQLA 1ZNWA 4LHVA 1TB4A 5DGXA 1YFJA 3H13A 4F91B 2HV9A 2V8OA 4Q4HA 4AW9A 4M1QA 1TA0A 1TQ4A 4YV7A 2J0QA 1P2VA 2B8TA