1H6BA

Reduced precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
381
structure length
381
Chain Sequence
b'ATLPAGASQVPTTPAGRPMPYAIRPMPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
publication title Crystal Structures of the Precursor Form of Glucose-Fructose Oxidoreductase from Zymomonas Mobilis and its Complexes with Bound Ligands
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Protein translocation
total genus 126
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2001-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h6bA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h6bA01
4O6VA 2JFFA 5AXDA 1Q1NA 2GERA 2Y1GA 4DIOA 2NLOA 2DU8A 8ADHA 1VRWA 2Y0DA 4NU5A 3TZCA 3ANLA 2CD9A 2VHZA 3TZQA 3E9MA 1PWZA 1Y5MA 1EFLA 3ETGA 4P4NA 4NG5A 1A4IA 1ONPA 2PZKA 2YV3A 4UUNA 3A28A 3ZCXA 1H5QA 5DULA 1GPJA 2P5YA 2GZ3A 4IIUA 4B4UA 4CMAA 4GX0A 3WNVA 3JYOA 4AJHA 1V9LA 4WECA 5I9NA 3RC7A 3WQSB 3IMFA 3TN7A 1R12A 4IMRA 4QEDA 3LT4A 2NM0A 4B4OA 1HE4A 3ZWWA 1Q0QA 3PTZA 1Q7GA 4LVUA 3ZI0A 1DIRA 2AG5A 4QXMA 3V2HA 1ISMA 2DBRA 3C85A 1U8XX 4WCFC 3IUSA 1OI7A 3ICCA 5C7LO 2OBNA 3GLQA 4DBVO 4WASA 3TRIA 4I9NA 5I8WA 4MDHA 4D43A 4WOJA 3TQHA 3QLJA 1OZAA 4JBGA 4XJTA 2B35A 5HS6A 4YACA 4TZTA 4PLCA 4D3FA 3NTOA 3ZH2A 4XIJA 3JQFC 3RC2A 1HYHA 3OIFA 3GMSA 1BSVA 1XEAA 2Q1WA 3GDFA 3UCEA 1MGOA 4L73A 5ILOA 3MJEA 3KB6A 4OL9A 4QO8A 2VYNA 2YQ4A 3H5NA 3GY0A 4UEKA 1HYEA 1NQOA 2CFCA 3ZNPA 2O3TA 1DIGA 1ZSNA 4ZHSA 1O94A 1B8UA 4U5QA 3PDJA 3F9IA 3JCZA 3WBBA 1UXKA 1NWHA 2D3TA 2I5PO 2DFDA 2Y1OA 4HKTA 4A73A 4CLOB 1B14A 4OM8A 5JW6A 3LYLA 3K30A 1X0XA 1E7MA 4H3VA 3RQSA 4IBOA 1EVYA 4IDAA 3UFXA 5JAMA 1G1AA 4XYMA 1PGQA 4F3YA 2J3JA 2WM3A 5IJZA 5FI3A 4Y6SA 3HWRA 4BV8A 2G1UA 5TIIA 4FOSA 4Y6PA 4I8XA 1HT0A 3F6YA 2J5RA 2VWPA 4OKNA 2FN7A 5L40A 1Y5RA 2AG8A 3GGOA 1C3VA 4M89A 3JD3A 1DLJA 2YUTA 4FQ8A 1X14A 4J2OA 4R9SA 4EUHA 1PJ2A 5IN5A 3DAFA 1IZ9A 1T24A 3PDUA 2WSBA 2UDPA 1QP8A 4IJKA 3LC2O 4JJGA 1AXGA 2HLPA 4DIFA 1SOVA 1M6WA 2VHWA 3PXXA 2Q1UA 5J23A 4RPGA 3UGKA 4XWYA 4CM6A 4XGKA 1C0IA 1XR3A 2FPPA 2PTGA 3KHUA 3WBFA 1VPDA 1O5IA 5COQA 4BNIA 2OP0A 4JJFA 4WK6A 2QZ9A 1ZK2A 1ULUA 4ZRMA 3I83A 2BELA 3FI9A 3OEWA 2D1YA 3SJUA 4RF2A 4GBJA 3ZWBA 3WGGA 4CM8A 3CZRA 2J3HA 1H6BA 5G0UA 1NVTA 3VDRA 2EJWA 4AJNA 3JSAA 1EBFA 4ALJA 1YH3A 1UAYA 3RC9A 4URFA 3L6OO 1LDYA 1CQIA 4BV9A 1XGKA 3UW3A 3OJ0A 3G3EA 1EVIA 3ADPA 4J16A 5IDXA 3WFJA 1ZK0A 5B4UA 4NPCA 1GL3A 3UXYA 3CZMA 2EGHA 4JN6B 3ZHYA 4O0LA 1K6IA 3ITDA 4J1SA 1BVUA 2HMVA 5CHEA 4UREA 4DTIA 2Y99A 2IZZA 1IL0A 2IZ1A 4GKVA 1O6ZA 3MJCA 1EE9A 1DB3A 3E5RA 1HDXA 4PCVA 5G0TA 1UZMA 4RORA 1J49A 5HM8A 4TSKA 3ZZNA 1GR0A 1BXZA 4JGBA 1LLDA 4PFJA 4IMPA 2P4QA 3GZ4A 5KVVA 1JW9B 3WIDA 3NYWA 1RPNA 1C1DB 4H16A 1Y9EA 4CM7A 3WSWA 4MO2A 2UAGA 1QR6A 2OHXA 4PLGA 3HNPA 5KKCA 3PLNA 2DKNA 2YY7A 4WKGA 2R2GA 2Y1DA 3JQEA 5EPOA 1JTVA 4GMFA 2UYYA 3EHEA 4RLHA 4BKOA 1E5QA 4GSLA 2ZKLA 4I5EA 5CPFA 1HZJA 1VM6A 1TLTA 1U5AA 1B3RA 3ZDFA 1QYVA 1X7GA 1ZFNA 1E1KA 3EVTA 3QP9A 5EQFA 3S2EA 2Q49A 3L6DA 4B7XA 1YJQA 2VYVD 1BWSA 1N92A 1KVUA 2Q2QA 3ITKA 4J9UE 4MKXA 3JD0A 6LDHA 3C24A 3VAZA 1I5RA 3GUCA 4ZQHA 1MV8A 2PGDA 3IDSA 1T1RA 1HF3A 1XKQA 4NQZA 2YV1A 4E6PA 5AVOA 2NWQA 2O7SA 1E6EA 3QV1A 3IOYA 1B26A 2B5VA 2WYVA 3GFBA 5JC8A 2EEZA 3V1YA 4J0EA 1D4FA 4RDIA 5IFLA 2AQHA 4RQUA 1Y8QA 1T2DA 3B1JA 3GHHA 2AA3A 3WYEA 3FBTA 2B0JA 2C2XA 1ZXBA 1LDNA 4CLEA 3ZV3A 1U7HA 4ZQEA 4J3FA 4OIMA 4NHEA 4L8VA 3VPGA 1LDBA 1B2LA 4D0SA 1CDOA 5JYAA 2BRUA 3KXDA 4A03A 4L4XA 4RCVA 1YDWA 3DR3A 5G0VA 1PS8A 1NVMB 2Z5LA 4HX5A 2I76A 4BNVA 3I23A 1E6UA 1YB5A 2FSSA 3S8MA 3W4KA 1XA0A 3KLPX 5I9MA 3B20A 1DRVA 4B79A 3WGZA 1GYRA 4YA6A 4J1TA 4KDFA 3F5QA 4BMVA 3C1AA 4RF4A 3AI1A 3L9WA 2VHVA 3T4XA 1MC4A 2X22A 2B4TO 2ZB8A 5JC1A 3JQAB 4Q39A 4DLLA 2V6GA 1LNQA 3V5NA 1JKFA 1BGVA 5G4KB 1UP6A 3NEPX 5BSHA 1X0VA 4KTVE 4CQMB 4HUJA 5TX7A 4ALMA 4ONEA 5T64A 2P4HX 4QFDA 3C1OA 3DBLA 3RROA 4PLPA 3OA2A 1QMGA 2GN6A 2OP1A 5A05A 1O0SA 4HFRA 1UZNA 1M67A 2DAPA 1HEUA 2OL4A 3ENNA 4EDFA 5H82A 3IJRA 4PLHA 1GPDG 3ORFA 4U0KA 5L3ZA 4Q9NA 5JCJA 4BNXA 1EEHA 3W6ZA 3UVEA 2ZIZA 1A5ZA 4MVJD 1UXJA 1TEHA 3CE6A 3GRKA 4BB5A 3NGLA 2GD1O 1NR1A 2X8LA 4TVBA 1LRLA 3RKRA 2PGJA 4J2HA 3IS3A 1IHYA 4PLZA 4UVGA 3RJ5A 2RH8A 1EMDA 5L4NA 4P4LA 2VUSA 4NMHA 2I65A 3V2GA 3C7DB 4DWVA 4J7CA 2IXBA 5IDYA 4YT8A 4NDNE 1U9JA 1Y8RA 4DPMA 1LDMA 2G0TA 2PZMA 2PD3A 4M54A 4A26A 3HJAA 3OSUA 5G0WA 4Q3EA 4B3HA 4BGEA 3QVXA 3O9ZA 2ILTA 3DHNA 4FFRA 3PPIA 3VPFA 1Z74A 5ITWA 1YOVB 3UICA 5B4TA 4Z0HO 1WWKA 5GZ3A 2DVMA 2PZLA 2X58A 2ZYAA 4E5KA 3ZWCA 4CJXA 1MUUA 3LDHA 2NTVA 4B7CA 4YXFA 3U0BA 2B4RO 3AUAA 3DZFA 3HDJA 2WD8A 3KEOA 4GX2A 4BIIA 4CL8A 3MTGA 2HK7A 4FIZA 2GF2A 2AQ8A 3PHJA 5ENVA 3R3JA 2JD0A 2JD2A 2X0IA 5IXYA 3F1KA 1CERA 1GU7A 5A9RA 5KWEA 2Z1NA 1I32A 3PIIA 1ENPA 4J4TA 4ILKA 4OQYA 2GGSA 1CEQA 4CL3A 2YZ7A 4YB8A 2HO5A 5DBIA 5KIAA 3NT5A 4B3IA 2GCGA 5DOZA 2I67A 2X23A 4O63O 1K3TA 5L53A 5I7FA 2IDZA 4BO4A 2WD7B 4II2A 1AUPA 1E1MA 1SNYA 2Q4BA 2XOXA 4HNGA 2E49A 2J6IA 3RU9A 3WX0A 1HSOA 2CZCA 3TZHA 4Y6RA 2HUNA 2QYSA 3K92A 3JD2A 3DBHA 3HB5X 4TRJA 5K0ZA 1VC2A 5IZCA 1KEPA 1IHXA 3H5AA 1NNUA 3JQ6A 4HP8A 1KERA 4BO0A 3BMNB 4CMKA 3B1KA 4GGPA 3GNSA 3IIEA 1VSVA 3EUWA 1O9BA 3O8QB 4DUPA 4HV4A 2NV6A 2VYND 4EI2A 4X54A 3DB2A 2X9VA 1WZEA 1PSDA 4FFMA 4BO3A 1I2CA 5JLAA 3G79A 3BAZA 4TROA 4M1QA 4AVYA 2C59A 1QORA 5J9GA 1I3LA 3PHHA 1E92A 3COSA 3KVOA 3PJGA 3R0IA 1YXMA 4C4OA 1B8VA 5EN4A 1LC0A 1TT5A 2CVOA 2QW8A 5M6DA 1ZVMA 1CQJA 3I9NA 5GZ6A 2RAFA 4EEZA 2HMTA 3I9OA 4I1IA 2D0IA 1P1IA 4XRRA 4PG4A 2JHFA 1D3AA 3NDRA 3EK2A 4XYLA 1JDJA 4BGVA 1FDWA 1I33A 1ADBA 3BMQB 3DTTA 4F6LA 2PH3A 3MOGA 2C5EA 1CWUA 4BNUA 4ALLA 1LX6A 1ISFA 3D3WB 4BKPA 1HL3A 1U7TA 4OSOA 4FGWA 3U3XA 3DEYX 1JWBB 3QA9A 2DLDA 3WYCA 3ZN2A 4DMLA 2AEFA 2VRBA 4JQCA 1ZKMA 1ENOA 1I8TA 3Q2IA 1VJ1A 4IDEA 4XR4A 4YR9A 4PGFA 3D64A 1P0CA 1O8CA 2G5CA 2FOIA 4YQZA 3INGA 2PD4A 2NTNA 3TSCA 4YRAA 4OXYA 1JKIA 1CYDA 5A9SB 4E5PA 4XRGA 5KJCA 7MDHA 1HXHA 2VWHA 3ZU3A 5K6AA 1EK6A 2H6EA 4FS3A 2JL1A 1N9GA 2RBEA 4PG5A 3TL3A 4XB1A 4Y9DA 3WGHA 2GZ1A 2JAPA 2GO1A 3QSGA 1I24A 2QZZA 1NFFA 4ID9A 4QSMA 4BNLA 4CLRB 3Q9UA 5F5LA 3QE3A 5IZ4A 1YGYA 4B8WA 4DQUA 2W2KB 2P91A 2X9GA 3QVWA 3RAJA 3M1AA 2WE8A 2QRKA 3VZRA 2Y0EA 4PLWA 3F46A 4LRTB 3IP1A 2FSVA 5GZ1A 1ENYA 4L76A 5I7VA 1UJMA 1SZJG 3HDYA 1OAAA 2NQ8A 1EE2A 4FN4A 1H9BA 4DLBA 3STHA 1V3UA 4J49A 5F1OA 4D0RA 2ZB3A 4FFPA 4DXHA 4CM9A 4YT2A 5IZCC 1O89A 4TVOA 2JFGA 2PR2A 5JY6A 4R16A 4BNWA 1N1EA 4MINA 3ZWVA 2WYWA 4RVHA 3TZ6A 3DFUA 1QG6A 1ZUD1 3P2YA 1FF9A 3EVNA 3AW9A 4CM5A 1HSZA 3VPHA 4RF3A 1Z75A 4CMCA 3WGTA 3E18A 4MKZA 4AG3A 5BSFA 1JU9A 1PZFA 3B70A 3HQ4O 3O26A 4QFCA 3K2EA 2W2LA 5T8KA 4E0BA 4LVCA 4QO7A 3RIHA 4OH1A 2AE2A 4MVJG 3C8MA 3SX2A 5AOVA 1R66A 5IDWA 1CETA 5KCZA 2VHYA 4IJWA 4NR0A 2BGKA 2Z1MA 4FGSA 4R69A 3U49A 3DOJA 1D1SA 1DO8A 1T25A 1PGJA 3HZZA 4H7PA 4CM4B 4WEOA 1XQ6A 4XYEA 1Z7BA 4EZBA 5L4SA 3VH3A 4OKIA 1ML3A 3GN2A 1LI4A 3X2EA 4ZGWA 3A1NA 1ZIDA 3OM9A 5CDSA 2D2IA 2X4GA 3NX4A 1NVGA 2B83A 2PY6A 3PQDA 1WZIA 5L7YA 2HMSA 2BFPA 3AY6A 3ZV4A 3F4LA 2NU6A 4MVJE 5TF4A 1SEPA 3OA0A 4AJOA 4IM7A 3GZNB 4FCCA 1PGOA 1LLUA 2ZCUA 4W99A 3DHYA 3L9XA 4GH5A 4DC0A 1EFKA 5BR7A 5T73A 5JXWA 3CPSA 2ZATA 2YFHA 1A4UA 2UUPA 3BHMA 5MDHA 4PZDA 1A71A 1GUZA 2YFQA 3WQRA 5JDCA 3F47A 1ADGA 3DQPA 3GK3A 5TC4A 1RYEA 3GG9A 4FJ2A 3JQ8B 1PGNA 4KDEA 1ZH8A 4I5DA 4IZHA 1I10A 4UVEA 4JCOA 3QWFA 2C7VA 3HE3A 1DEHA 2RIRA 3GC6A 1UDBA 3PHIA 1X1TA 2GUGA 4JROA 3TOXA 1IZ0A 1NPDA 4CPDA 1NR7A 3RBZA 4ZU3A 1FDVA 5TJHA 3X2FA 3L4BC 3DBRB 1DJNA 3FNEA 2AEJA 3MEQA 3AM4A 1UH5A 1GQQA 1ZCJA 5TSDA 3SJ7A 3PJDA 1HDOA 1PR9A 5TGDA 3VKVA 3GA0A 2IZ0A 1IE3A 1AGNA 1ZEMA 4PG6A 3S2FA 4D44A 7ADHA 3H9JA 3PEFA 4J7UA 3QVSA 4BS9A 4NU6A 4LN1A 4BUCA 3TFQA 2EGGA 3IL2A 3OJOA 4K26A 4CMEA 4IXWA 5JYEA 4H15A 3H2ZA 1DPGA 4R5HA 1G0OA 4MOWA 2EERA 2EXXA 1I3MA 1C1XB 4U0JA 1GZ6A 3KYBA 3ROQA 5A5FA 1HE3A 4WEQA 5JCJD 2O4CA 3FWZA 3OFSA 3AU9A 2J3KA 5A5EA 2YW9A 4MP3A 3RFTA 1LC3A 5AXBA 3DC2A 1P1FA 4BQRA 1S7CA 1TA4A 2BFOA 2VOJA 4TKLA 4YJGB 4E32A 4NFSA 1R4MA 4W7IA 4YVFA 2VNAA 2C29D 3CIFA 4L4RA 2GNAA 4A5OA 4ZRNA 1X7HA 1RJWA 4R1SA 1PJ3A 1H6DA 4BGIA 2BKAA 1HE5A 3H9GA 3KYCA 4BNGA 1T1SA 4QUKA 3I4FA 4MVJI 1C0LA 3ABIA 1RM3A 1QV6A 4PLTA 2Q22A 3D4OA 3SXPA 5FI5A 3HDQA 3CXRA 4JP2A 3BMCA 3GEGA 1R4NA 4R5MA 1PJQA 3C7CB 5T67A 1MA0A 1GEGA 1T26A 2D59A 2WWRA 1UUFA 2QG4A 1ORRA 5A03A 1GQ2A 2W98A 3JQGB 5T57A 1UP4A 5L51A 3ONDA 3Q3CA 1AN9A 4D3DA 4J4HA 5DP2A 5L9AA 5FFFA 5GMOA 4CMGA 3NJ4A 4D46A 3DZHA 4M55A 1LEHA 4XIYA 4JIGA 1P3DA 2V6BA 2Q3EA 3V8BA 4YJFB 1PJBA 2H5LA 1I3NA 4P22A 3U5TA 3JQ9C 1WNTA 3MJ4A 4RJTA 1T4BA 4GLOA 3VKUA 3WGQA 4B3JA 4C7JA 3BMOA 5L95A 1V6AA 1EQ2A 1PL8A 1K5HA 1LTHR 2YDYA 1Q7CA 2UUOA 4ND5A 4FFNA 1U3WA 1HETA 3ON5A 4Z0TA 3PYMA 4ZQFA 4II3A 3BTSA 2NU8A 3IJPA 4PVCA 3G1UA 3G49A 2JCYA 4HWKA 3FNFA 5JDCC 4BNNA 2C0CA 5KVCA 2HJSA 3T7CA 3H2SA 5TT1A 1B3BA 3OICA 3M1LA 1ONNA 3N58A 1NWCA 3NUGA 1YQDA 3GPDG 3W8DA 4CMIA 3PI7A 2OMEA 1UDAA 1TB4A 4PRKA 3JTMA 2A94A 5B1YA 1LSOA 2PA3A 4N5LA 1BTOA 3Q11A 4W82A 5CG1A 1P74A 3FD8A 1YRLA 5DF1A 5H81A 1GCOA 3GEDA 4ZQBA 4NJMA 3VPXA 4WNIA 1EDZA 1SAYA 4B4WA 1ISJA 1YB4A 4GVLA 3JD4A 4ZD6A 1K6XA 3D0OA 2EF1A 3G17A 1C0KA 3I6IA 1PL7A 2Y66A 1MB4A 1ISIA 5JAZA 4J1QA 3ZWPA 3OQBA 1HKUA 2Y67A 1I2BA 3T7EA 3U4DA 2O7QA 3NTRA 4D41A 1A7AA 3PWKA 4FJ0A 4XB2A 1CIVA 2YV2A 3AI3A 1WDMA 3RKUA 4Z0PA 1NASA 2D8AA 1E5LA 4RPLA 4FC6A 3AOGA 2FMUA 1H0KA 1U3VA 4YAEA 5EINA 2ZJ0A 3I6QA 5A9TA 1MFPA 1FXSA 4IDCA 4XA8A 4NBWA 5I7EA 1QYWA 3ZWMA 1ADFA 3K6JA 3PWSA 4UUOA 4AL4A 2PNFA 2WMDA 4MVJF 2Q1SA 4WPGA 3D5TA 2DQ4A 1D7OA 1E7RA 2FPIA 3RFVA 4YJDA 4NJOA 4YRBA 2GN8A 5KNLA 3ZNOA 1U2GA 4CLHA 1YL7A 4FB5A 4IJVA 1MX3A 3FCOA 3NDJA 2D4AA 4WOKA 4YEDA 3NT4A 2FPGA 3MWDB 2J5KA 3GT0A 4IDFA 3QWAA 1XDWA 3GVXA 3GR6A 4JNKA 1G6KA 2HMWA 1I36A 3HFSA 1JQBA 1A9ZA 1ZJZA 4XD2A 1E3SA 2QRLA 5JS6A 3EAGA 2R00A 1YKFA 4LSMA 1HDRA 1N2SA 3AM5A 4RZHA 4BOYA 3MJSA 3RU7A 3BA1A 4B4VA 3VPSA 1VSUA 5IAAA 2BGMA 2EP7A 3GQVA 3H4VA 4NFYA 2QX7A 1H2HA 4EYEA 5L7TA 1J6UA 1DHTA 3WWZA 2CF6A 3DL2A 4JBIA 1R0KA 4RL6A 2CDCA 2OXIA 1EUDA 3NAQA 2XF8A 5DZSA 2JKVA 1L1FA 4QQRA 1PGPA 1YBMA 4BL5A 4E31A 4EJ6A 5A3VA 1A7KA 1GTMA 4YTEA 3E1KA 5JAQA 2FZEA 2ZQZA 1DC3A 4J0FA 4E4YA 4CLOA 3KZVA 4OQZA 2BMAA 3AM3A 1TT7A 4RZIA 5L4LA 3CMCO 4E2ZA 3GAFA 4DL9A 1PQPA 1YJ8A 4D3SA 3U4IA 4DMMA 1HLDA 4CM9D 5CEEA 4TQGA 3SLKA 5JDIA 3RUIA 3QVOA 4JJIA 2P9EA 5EIOA 1EDOA 3DMTA 3LC7O 5F5NA 3QHAA 2G76A 2Y0CA 1J0XO 3GOHA 4E12A 5HBRA 2DFVA 4EITA 3S2IA 5JY1A 4Y98A 1E3WB 4CR7A 3DOCA 3I52A 1LBEA 4PVDA 3HB4X 2W2LD 3M2TA 4G81A 3E9QA 3GMDA 4GPD1 3AUUA 5DCWA 2O4UX 2BI8A 4JXKA 1G0NA 3JQ7B 4Z9XA 1YE3A 3O03A 5KKAA 5BQFA 1PIWA 2Q46A 4P4GA 5DCYA 5KVQA 4U7WA 5ADHA 4A7PA 4IQGA 3M6IA 1XELA 1KEVA 3DO5A 3KYDA 5DN9A 2IE0A 3K8ZA 2G82A 1DSSG 3OMLA 4BKRA 3EYWA 4HNHA 1GFSA 1JWAB 4K9DA 5A04A 1YQGA 4LCJA 4PLFA 3WJ7A 3BHIA 1BW9B 4JBHA 2G17A 1WDKA 3H5RA 3V1TC 4R01A 1KBZA 2FR8A 4GX5A 2X6TA 3BXXA 1NBOA 2PV7A 3JQDA 2DUUA 1P9LA 4BO6A 5IF3A 3NTQA 3JV7A 3L77A 2NU7A 2HMUA 2X86A 5TS3A 3TJRA 4RPJA 5IXSA 2SCUA 4L75A 4K6CA 2UV8A 1P31A 3WIEA 2NADA 2H63A 3ENKA 4J91A 1GCUA 4LRSB 4RPKA 3KRTA 1MG5A 1ZEJA 4YT4A 4FFLA 4TRRA 2DTDA 2C5AA 2FRDA 1ISGA 4XDYA 1BXKA 1I2ZA 1Y7TA 4BKUA 1C1DA 1I3KA 5U9CA 4B8ZA 4PG7A 3UF0A 2HRBA 3P2OA 3CEAA 1UXIA 2HAEA 2PFGA 1DFHA 4XZ3A 4K28A 2VT2A 3RBVA 1GY8A 3U9LA 2AW5A 4J7XA 1ID1A 1O95A 3INTA 2V6FA 1HTBA 3VH2A 1YL6A 1S6YA 2ZTMA 4XQ9A 2AMFA 2QHXA 1QYDA 4YAIA 1BG6A 1SOWA 5TJ9A 1W4ZA 1CJCA 3ZWOA 2NQTA 1PQUA 3P19A 1GD1O 1SEVA 2J8ZA 2EP5A 1ENZA 2YDXA 4OSPA 3UH1A 3WNQA 1DC4A 4ESOA 4D7AA 5DT9A 2O23A 2R6JA 2NVUB 4WLVA 1VJ0A 2P9GA 4W9NA 1PJLA 2X0NA 5JDIC 4RO0A 2GLXA 1IPFA 1LA2A 1N1GA 1VE9A 1IY8A 1XWFA 4Z3KA 1KY5A 1R15A 1NAIA 3ROPA 4HFNA 3ZV6A 5CEFA 2CUKA 4IQ8A 5F1KA 3ZGYA 4AJIA 4KWHA 3ZWXA 1ZZEA 3Q2KA 3K73O 1JVBA 4L0QA 4YT5A 3PLRA 1BXGB 4CQLB 3LQFA 2I66A 3KSZO 4TKMA 2I9PA 4U8GA 4UVIA 2IYOA 1RM5A 3U62A 3SVTA 1AXEA 3AY7A 3DZJA 2AQIA 4GWGA 3WMXA 1K89A 4YJHB 1ARZA 2PLAA 3FBGA 4IPTA 3H9EO 3RUDA 1R16A 4M87A 5ER6A 1B0AA 3BHJA 2W8ZA 2I3GA 3WYBA 1XSEA 4GL4A 1FDSA 4YRDA 3FNGA 1B7GO 5KOIA 4WCFB 5CP8A 3L4SO 2XAAA 4R1TA 3FR7A 3GUYA 3ICPA 3QWBA 4L4SA 4DYDA 1ULSA 4UAGA 1TXGA 3WTCA 4F6CA 3R3SA 4JLWA 2WE7A 3WB9A 3LF1A 1OMOA 2WYUA 3W8FA 3JYPA 2NSDA 5G0SA 4S3MA 3GPIA 2P5UA 2EKQA 1UXHA 1YQXA 4YAJA 4CM1A 4ND2A 3AFNA 3PGJA 2B36A 2Q45A 2VT3A 1HDCA 4RF5A 4D45A 1H2BA 3JQAA 3WLFA 3LU1A 4ZN6A 1QLHA 3PIDA 2FP4A 1ISHA 1U4OA 2YYYA 3AI2A 3B6ZA 3C3XA 3PHGA 5G4KA 2HKIA 4CQMA 2OUIA 4R1UA 5LC1A 3W4IA 3VTZA 1U28A 3ONEA 1ZO8A 1I01A 4PLVA 1QYCA 1SC6A 2VCYA 1M2WA 4YWJA 1YONA 1E1NA 3VTFA 4E33A 4L9RA 1P77A 3FSRA 1PJSA 4P38A 5DOVA 4YYZA 5DP1A 2IEBA 4E2XA 4R3WA 1W0CA 4BNFA 3LF2A 4GGOA 4E30A 3F5SA 2F1KA 4UVHA 5COBA 3ZHBA 1VKOA 3GRPA 3WICA 1B16A 4OO3A 3VZPA 1PTJA 2PKQO 1U5CA 3LLVA 4A10A 1F8FA 4K6FA 2JHGA 3HSKA 3UAGA 2YHIB 1KC3A 1Y9AA 1T2CA 2W90A 3WG9A 1UXGA 2O2YA 4R9RA 5KJFA 4BNHA 4W9NC 4GSKA 3PRJA 2EWMA 1HYGA 5AXAA 3WGYA 3WWYA 1T2FA 1P33A 4I5GA 4U6QA 4DREA 5B4VA 1KOLA 4RV9A 3FHLA 5F1PA 4RGBA 1YOVA 5AQ1A 1PJ4A 1SMKA 1Y1PA 4RDHA 2WTBA 3E48A 1HE2A 2D5AA 3MWEB 3OH8A 4YPOA 4BB6A 5CG2A 3G0OA 4BNKA 1E7YA 5KJEA 1JN0A 2AXQA 2GDZA 4AJ1A 3CTMA 4I9HA 4MIYA 1HDZA 4AJLA 4Z9YA 1KVTA 3RUAA 1W73A 1BRMA 2ZTVA 2ZTUA 1SB9A 3LVFO 2PKRA 3UCFA 3TNLA 2Y93A 1H6AA 1M75A 1PQWA 2VUUA 3WR5A 2ZYDA 4IQ0A 1E0DA 1XCBA 1YBAA 4UEJA 4R1NA 1DFGA 1E7QA 4IDGA 5JYDA 1LSSA 1ZSVA 3KLMX 1DXYA 3CMMA 2F00A 4ITUA 2O3UA 1DAOA 1P1RA 5A1TA 3I9KA 1LRKA 2WD7A 3O4RA 3VVBA 2PH5A 4Z6KA 1VJTA 4R41A 1UAGA 2BF7A 2RHCA 1H93A 5B12A 5C3MA 1ZK4A 3ETDA 3SEFA 2PK3A 2GPTA 2BFAA 4C7KA 4PLYA 3SC6A 4MVJH 2CDBA 3WSVA 1NYTA 5T6BA 3ZWYA 4CLDA 3QVTA 2P68A 2CF5A 4QT0A 3ZHXA 2VUTA 1LUAA 1T2EA 2Y05A 3BMNA 3OJEA 3P7MA 2CNBA 3O8QA 4G2NA 1Q0HA 3OEYA 3OP4A 2B37A 2BI7A 3LT0A 1LJ8A 2B69A 4WLOA 3TOZA 6ADHA 3L07A 3FNHA 3KUXA 2VWGA 3PGXA 1JVSA 3GGPA 3K5PA 4KUHA 5JO9A 2O48X 4BNZA 1SPXA 2WDZA 3JQCA 4W4TA 1KEWA 3EY4A 4LISA 1LQUA 1RM4A 4CLXA 3I9LA 1V35A 2GR9A 4CM3A 2DBQA 1X15A 1LSJA 3TL2A 5CEJA 1GV0A 4DYVA 3D4NA 2A4KA 2OBYA 1LLCA 3FF4A 4E13A 1YWGO 3VH4A 5K6AC 1NPYA 3BMQA 3WMWA 3LSYA 1N7HA 3C7AA 4OOEA 3Q9NA 4BO5A 1Q0LA 2Y1CA 1GZ3A 1NTOA 2GSDA 4BNMA 3JD1A 3EGOA 5I7SA 1R0LA 3OF2A 4CUZA 2EKLA 1QXSA 4F46A 3KEQA 3VZQA 2XPCA 3D3WA 2LDXA 4Q3NA 4Y67A 4ZJUA 3ZW9A 2JFHA 1PU2A 4FJ1A 3MCVA 4WE3A 2VTDA 3ZU5A 4CM8B 4FW8A 4JP3A 1HWYA 4IDBA 4NBVA 5JNLA 1LLQA 1GYPA 1OFGA 3GNTA 2ET6A 2QRJA 3LC1O 4EW6A 5A9SA 1PWXA 4OXNA 4Y8VA 3DDNA 2GN4A 3HADA 2IEDA 2A9FA 2Q99A 3QW2A 5JE8A 3F1LA 4OJNA 3VVCA 3NDIA 4G5HA 1NHWA 3DZKA 4XCVA 4XQCA 3E03A 3FN4A 4CLRA 1GYQA 3PZBA 1DIAA 2IODA 2W2KA 4J90A 4FC7A 4AJKA 3PJEA 2O3SA 3VC7A 2X0JA 3ZHZA 5G4LA 4NH4A 3O38A 4IIVA 4XJSA 3M2PA 1DAPA 1X1EA 1XLTA 2PZJA 1V8BA 4S1VA 4DIBA 4FPXA 4Q3AA 3RFXA 4EBFA 4IS2A 2JCXA 1UDCA 1C0PA 4CUJA 5TLSA 3H8VA 3RUCA 3WXBA 4OAQA 3OIDA 5T8KC 1YB1A 4W7HA 4CV1A 1R6DA 1IUKA 3QQPA 4BNJA 3H7AA 2HQ1A 2JD1A 5DBGA 5ILGA 4AJEA 1FDTA 1X13A 1ZNQO 5CFZA 3OQ6A 3EZYA 5BNIA 4NK4A 4WGGA 5HS4A 4NZ9A 1KVQA 1MP0A 4BO7A 1JA9A 3OIGA 1Y81A 2X9NA 2HRZA 2BHLA 2RHRA 1E3JA 3WLEA 2PWZA 4TMFA 2I99A 1PEDA 1KVRA 1EVJA 5JMPA 5JO0A 2DTEA 3FR8A 2ZB7A 4NFHA 2FR1A 2WJPA 1XIVA 3K31A 3WTBA 1EVZA 1WDLA 2C7GA 4OYRA 1WW8A 4E5YA 3EMKA 4FDAA 3ETEA 2EW8A 3DOOA 5TNXA 1RKXA 2W4QA 3AFMA 3ZU2A 1XHLA 1VL0A 2B4QA 2NVBA 3TFOA 4MP8A 4LK3A 2X5OA 1OC2A 5K9ZA 1XQ1A 3QJ5A 3RI3A 3GGGA 1D1TA 4CM4A 1QYXA 4HXYA 4KWIA 4CV2A 3DAGA 1D8AA 2PGLA 4XDZA 2NNLD 1Y8QB 3S1LA 3ZWAA 3HHPA 3GFGA 3BTUA 4Z3DA 4DA9A 3GHYA 2UVDA 1BHSA 3R6DA 1E7SA 4NNJA 5FYDA 4GQAA 3VHRA 4NBRA 4DVJA 5F3RA 1Z73A 5C7OO 4CMBA 5B37A 3N74A 2BH9A 4GLLA 2XXBA 1ADCA 2VZ8A 3DZGA 5EL0A 3D4PA 3GZNA 1PL6A 1J4AA 3JYLA 2EJVA 3ZV5A 4IS3A 1KETA 3LZ6A 3HFGA 3IP3A 3TWOA 3W6UA 3KO8A 1DC5A 4MPDA 4R68A 3HN2A 1LU9A 4WLNA 2QIOA 3I1JA 3MJTA 4ND4A 3JQ8A 4CMEC 2C2YA 2GZ2A 4RLSA 1IYZA 3AU8A 4G65A 9LDTA 1U3UA 3CSDA 3H65A 3KYDB 4JX8A 4N54A 1K6JA 2ZYGA 1XG5A 4BMSA 2CVQA 3DBRA 1F14A 5EMHA 4DRYA 1EK5A 2J3IA 3DBLB 3T4EA 3JQAD 3QIVA 5GY7A 2FHSA 5BNFA 3PZRA 1QRRA 1Y6JA 3NRCA 4FOOA 4J9VA 4CQMD 1PJTA 5MGBA 1YS4A 2DUWA 2HU2A 1W8DA 1KYQA 3P5SA 4GAEA 4LSWA 4BMNA 3PHLA 4LGVA 4EJ0A 2CMDA 3RC1A 5G2OA 3CUKA 3ANNA 4JK3A 2RCYA 3MTJA 1T4DA 1GEEA 1PR3A 1C1XA 5FF9A 2EW2A 1RYDA 3NGXA 1FJHA 4DGSA 3DONA 5C37A 2BFMA 3KSDO 3E82A 4CV3A 1Y8RB 3E9NA 4CMHA 3DFZA 4UEOA 4YJGA 3TF5A 1ZK3A 3I9JA 3WJAA 1NFRA 1DLIA 5DNAA 4OHUA 3ULKA 3VDQA 1WPQA 3LT1A 4CR8A 4FD3A 2IYPA 4R51A 4ALKA 1P1KA 3VH1A 1HZZA 3VOSA 3PVZA 4TRNA 5A02A 1P0FA 4CV0A 4PN3A 1DFIA 5BSEA 4WLEA 1N7GA 2VNSA 3PQEA 4E2WA 2DBVO 3INRA 4KQXA 1AHIA 1FMCA 2H9IA 2TMDA 3D7LA 4I5FA 1DJQA 4MJLA 3WFIA 2OORA 1DDOA 3WOHA 5BT9A 5U1PA 3JQGA 4I9UA 4ND3A 1R0SA 1M76A 1PZEA 1NPTO 4IINA 1GADO 1F06A 1V0JA 4BO1A 2AHRA 1U2DA 1EZ4A 5KVSA 1PX0A 4J1NA 2P2SA 4E2YA 4TRMA 3GF4A 4YJFA 3HDHA 2E48A 3OQ1A 3RUHA 4N5MA 3LT2A 1GAEO 1SO8A 1IULA 3TZKA 3VZSA 1V3VA 4AJ2A 5L7WA 4RVUA 4E21A 1P45A 1WVGA 4E5NA 3H3FA 5ES3A 4W6ZA 5CDYA 4QX6A 1E3IA 2OO5A 4PRLA 5A06A 4O5OA 3IC5A 2DC1A 4R4JA 3OJFA 4LMPA 3FTNA 4BQPA 1E3EA 1P1HA 4PIVA 5TRTA 2C54A 1DIBA 1GQYA 2FZWA 4BNTA 1GUFA 1MG0A 3WGOA 3SLGA 3DMYA 1OC4A 3ZNNA 1GUYA 3UUWA 3A9WA 2Q4EA 4KUGA 3DBHB 2Q50A 3WDSA 3KSUA 4DC1A 1LSUA 4Q3BA 3IAHA 2CDAA 3RASA 1H94A 1VKNA 3WQQA 4KTTE 4D79A 5I9LA 3IQDB 3EC7A 3N7UA 4AFNA 2AE1A 2ZCVA 2QQ5A 3JYQA 3ROMA 4J43A 3D3EA 5T5QA 1ZW1A 2Q1TA 4EGFA 4CODB 4AJ4A 3I5MA 4IZIA 2E82A 1KY4A 3BIOA 1CRWG 3NT2A 1ZK1A 2NTJA 2ZQYA 1NFQA 2NUAA 3PP8A 4ROSA 5IDQA 5THQA 2EHDA 4NBTA 4YAGA 5CDGA 4RPHA 1EUZA 5IN4A 3CINA 1KIFA 1KEUA 3FTPA 1IOLA 2IXAA 1U1IA 3I9MA 3Q0EA 5ICMA 1RM0A 2VN8A 1TT5B 3IKVA 1VI2A 1BMDA 3HN7A 3NKLA 4KQWA 1N8KA 3GNQA 4NBUA 5CPBA 3UHAA 5HTOA 2TMGA 2VZ9A 2I6TA 2PD6A 1E1LA 1LXCA 1WLYA 1LRJA 1U4SA 3U4CA 4R54A 1EQUA 1JKJA 3MOIA 4BGUA 4IJUA 3KOUA 3MJVA 3RSHA 3H6KA 5FEUA 5DBFA 3GVPA 4AJJA 4EJMA 1W6UA 3S2GA 2V7PA 3RVDA 2NACA 4Z9FA 1MC5A 1IPEA 2CVZA 1TVEA 4O1MA 4WLUA 1EUCA 4LCEA 4YCAA 3IKTA 2HJRA 2V6MA 4UUPA 3BTOA 2R00C 4XYBA 3AUSA 2C82A 4NI5A 1FK8A 2VRCD 4MIEA 3FPCA 4NK5A 4BO8A 1WP4A 1BVRA 1E7WA 4J4BA 4P8RA 3V1UA 3ZNQA 5EJ2A 4O59O 2H1SA 2OZPA 4K1LA 1DOHA 2C20A 1XYGA 3AJRA 5HWSA 3QWIA 4KUEA 1WXDA 1RWBA 1Z7EA 1Z6ZA 4ZQGA 1JAYA 1DC6A 1Z82A 5A3JA 4M8SA 3GG2A 3I4CA 3FRJA 1B15A 3RCBA 2DPHA 1A72A 3JQBA 2X7HA 5ICSA 3UKOA 5JSFA 3I3OA 2NVWA 1N9GB 5ENDA 1YBVA 5KTKA 4U6SA 5JBIA 2VQ3A 1ZJYA 5I8ZA 1PZHA 3GVHA 1CF2O 2GYYA 2ZK7A 5EERA 8LDHA 3KV3O 2Y68A 2DT5A 3GN1A 5EQDA 5A4DA 1NQAO 2I3AA 2HK8A 1PZGA 3S55A 4RVGA 4HY3A 5ER9A 3QWHA 2DPGA 4INAA 2VOEA 4AJPA 3G1TA 1JAXA 4IUYA 5FWNA 3DMTC 3PFWO 2VTEA 4WUVA 1MXHA 1M6HA 4GX1A 1EBUA 1NXQA 1QKIA 2XXJA 3ASVA 5AXCA 2E37A 5JYFA 1ZSYA 4L74A 2FR0A 3H9QA 1Q2XA 4QTZA 5JPIA 4BNYA 1YO6A 2P9CA 2X0RA 2Q2VA 1JLLA 5THKA 4EUFA 3U4HA 4TWRA 4LMRA 3AY3A 4GWKA 4UUMA 4DLAA 4MKRA 2HCTA 3UCXA 5HA5A 2HSDA 2YJZA 1NM5A 4BO2A 4BHTA 1SB8A 4M86A 2AEMA 4XR9A 3RJ9A 2AQKA 4FSHA 1AHHA 1BDMA 4WCDA 3K96A 2PKQP 3F3SA 4OMUA 2YQ5A 2OOSA 1SBYA 2EKPA 4N18A 4Q3DA 3L0DA 1PS9A 3ONFA 4RVSA 5CAEA 4MVJP 3RUFA 4F45A 1PS0A 2CY0A 5LDHA 1HDYA 1E3WA 1ZMOA 5LDGA 3GVCA 5HRUA 5KJ1A 5C7IO 1B8PA 1QV7A 1NP3A 1MXFA 3ASUA 1XU9A 3BZUA 1GDHA 3JQ7A 2O3QA 3GEMA 5F21A 1K2WA 1VL8A 4OXKA 1F17A 5C5IA 3JYNA 2WEKA 1YDEA 3RWBA 1Z45A 1UR5A 4XX0A 1DRUA 1WMAA 3W1VA 5H83A 5L45A 3L6EA 4YAKA 4IGEA 3E6AA 2Q2WA 4DQXA 1E77A 3ADOA 5ITVA 2YHUA 2VWQA 4MVJM 1BW9A 2B5WA 4GMGA 2HDHA 1OBFO 1NQTA 2Z95A 4I08A 3PWZA 4LW8A 4XGNA 1SCUA 4KZPA 3GH3A 2DBZA 2HK9A 2NU9A 3PYLA 4RVDA 4D42A 4E3ZA 1AE1A 1GZ4A 3FWNA 5BNTA 5TT0A 3HG7A 1NAHA 3JQBC 3ZW8A 3EW7A 5CDTA 4XYGA 3AOEA 3OHSX 3ROKA 2BLLA 3U09A 3PYXA 2ZJ1A 4R3NA 4A27A 1F12A 4YBZA 4CR6A 4DPKA 3LK7A 1L7DA 4EUEA 5CDUA 2EG9A 3DZIA 5JAIA 3EDMA 3UOGA 2C07A 1NHGA 4UULA 3PFFA 3F4BA 4ND1A 4PZEA 3GDOA 4UVDA 1MFZA 1OOEA 1UZLA 1A27A 3H9UA 3PQFA 1LQTA 3OJLA 3PJFA 4KMSA 4YDRA 2ZTLA 4DPLA 3D1LA 4WJZA 4MP6A 3SC4A 2D5CA 3WS7A 1ONOA 3B1FA 1F8GA 1DRWA 4PZCA 4J6FA 5TQVA 3E5MA 1IB6A 5EESA 3DXFA 2O3JA 4XQEA 1K0UA 2VYVA 5DDIP 2E4AA 1NX6A 1HLPA 2VHXA 3BYZA 2BGLA 5JCXA 3NJ8A 4ALIA 3CH6A 5DCUA 4GI2A 1N5DA 4DQVA 4NIMA 4IDDA 4HBGA 4RQTA 1P1JA 3AUTA 3KETA 5IG2A 3DTYA 3HUDA 2BD0A 3ST7A 2NVUA 1UP7A 4A0SA 2JAHA 1A9YA 2POQX 3LLSA 2X5JO 1QLJA 1Q7BA 3K9QO 4HFMA 2Y1FA 2GRAA 3L4BA 4FFOA 5AYVA 5LCXA 1C14A 4M49A 1R4MB 1HDGO 1KVSA 1YL5A 2LDBA 1FDUA 4XKJA 1XU7A 4HADA 4N5NA 4N7RA 4XEHA 1DBVO 3KYCB 3R1IA 1BXGA 2QYTA 4CQLA 3TDKA 5COAA 4BVAA 1L7EA 1V3TA 2ZB4A 4OGWA 3DHEA 1U3TA 1KS9A 2JJYA 3DZBA 2V65A 4TZKA 1M66A 2OFPA 3RD5A 3OBBA 3BMCB 2O2SA 1I0ZA 1R4NB 2RH4A 5KJ6A 1WAMA 1NQ5A 4YJHA 4A2CA 5JMWA 3BTVA 2DM6A 4MIOA 1E3LA 3ANMA 4IXTA 4FR5A 3ZWNA 1PJCA 1P44A 3RBXA 1GV1A 2X1HA 1VLLA 2FY8A 2JCVA 3QRWA 4WCFA 3ZU4A 1H6CA 3W8EA 2X5KO 4RVFA 1DIHA 1X7DA 3NV9A 3FPLA 3EZLA 1VL6A 2A35A 3GVIA 3OETA 1T2AA 4CUKA 4IY1A 3RUEA 4IGFA 3E8XA 3BMOB 2DTXA 4WLFA 1QSGA 4ZVVA 4HFJA 3Q6IA 9LDBA 3WGIA 3JQFA 2O3RA 2E6UX 4WNCA 4ZICA 1MLDA 4QECA 3CKYA 3AK4A 4GKBA 3PK0A 4BKQA 2GASA 5BSGA 3A14A 3KBOA 3IUPA 3MZ0A 2FWMX 3GDGA 4OOFA 4KP7A 4AICA 3A4VA 3AOEC 4B7UA 3D5QA 3SBOA 1KC1A 3OECA 3W4JA 1R37A 2VRCA 1BDBA 1F0YA 1I30A 1HRDA 3QY9A 1ZMTA 2IRWA 1YVEI 4CMIB 2GN9A 3JQ9A 2VZ0A 4DBZA 1LDGA 3V2UA 3GAZA 4E5MA 4BO9A 2OGUA 4MVJA 3A06A 3KM0A 4YQYA 4GVXA 5JFOA 4Q3CA 4CMJA 4KOAA 4EEXA 2A92A 1ZXLA 2O50A 2EIHA 4ZA2A 1J5PA 1H9AA 4XQGA 1DHRA 4XGIA 4PG8A 3KTDA 1U8FO 1ZBQA 2Y1EA 3AWDA 1WMBA 4ALNA 1E6WA 4NJMB 2J5QA 3DWFA 2EV9A 1LDEA 3C1TA 3K2BA 5U4QA 4FBGA 1TI7A 3DBVO 3H3JA 3TPCA 3UN1A 3Q1LA 2CSUA 2YHIA 3DAPA
chains in the Genus database with same CATH superfamily
3HCBA 1UL1X 2B5OA 4O6VA 1LK5A 4OI2A 1NBMD 4MS1B 5CB8A 2DU8A 2REBA 3UJBA 5HOQA 2H2GA 1KYZA 1L7VC 4YRGA 3UKJA 1XZPA 2CD9A 1L5OA 3CO5A 5REQA 4RZ3A 4YV1A 2VK4A 3CISA 3B8EA 2PPLA 2FVXA 2VP2A 4YP5A 4MVWA 3PXBA 2Q41A 3INYA 1BH2A 1SVNA 2C7QA 4IG9A 4RE6A 2AOTB 1RBZA 3BD6A 4TUYA 3AB7A 3KU4A 4QKQA 4NG5A 3A6LA 1A4IA 2WTXA 3C8DA 2PUBA 1DKLA 1O08A 4AQDA 4NCXA 2ECQA 4O4JA 1H5QA 4H9GA 1GPJA 1T2VA 1WSWA 2PA0A 3GO4A 4JASB 3BGSA 4NCNA 2HV9A 2JBAA 4ZOLB 1V9LA 1U0TA 1ULBA 2J0UA 5HMMA 2HGSA 1RBMA 5D84A 4IVPA 1DCFA 3MCZA 4B2LA 3ZR4B 2BGGA 2QTHA 2V58A 3ROTA 3NWOA 3AF1A 1F8UA 1I3CA 4KQJA 4MGYR 1GTG1 4NENB 1OLOA 2NM0A 4UDYX 1ODJA 1ESEA 4KYIB 4B4OA 4NESA 2CBZA 4CFYA 3M9XA 3PTZA 1Q7GA 4TVSA 1KOJA 1WE2A 3ZI0A 1IATA 1P4HA 3NALA 3NWBA 1DIRA 3B9QA 3ZUGA 3BK7A 2PUVA 4HPXB 4X95A 3V2HA 2HY7A 2BEKA 3TLEA 3LUGA 1N2IA 1RQPA 4EFNA 1D1PA 4I9FA 1A0OA 8ABPA 1Z16A 1QRUA 4LHZA 4WASA 4DBVO 1WHSA 3L3BA 4M1EA 3ZLTA 1ZR4A 1MRNA 3OC0A 2ODQA 3WMGA 5I8WA 4IJMA 4BP8A 4LC1A 4MV0A 3QLJA 4ENRA 4XJTA 1KDYA 1LVHA 4HBZA 2HBZA 1Q1GA 3NTOA 1S96A 2IITA 4YUVA 3ZH2A 1CNFA 2W0SA 3G0DA 3OPQA 1HYHA 4KKXB 5AKYA 3RYFB 2B6HA 3BB4A 3MW8A 4IP0A 2IOYA 1JQAA 2Q1WA 4HDNB 2JGDA 2DUMA 3G0CA 4PNEA 3UCEA 1MGOA 4GPBA 4EUSA 3KB6A 4MV8A 1TO2E 4OL9A 1QOPB 1SXPA 1EUDB 4UEKA 4B81A 3KPYA 1IQPA 2O3TA 1T0PA 4Z7OB 1HORA 1ZSNA 2VP3A 1CSEE 1EA7A 3H75A 3MBKA 4BRWA 5EVJA 3WBBA 2AWOA 1UXKA 5LZ8A 4GDMA 2O0JA 2D3TA 2I5PO 3PSHA 3GJXC 4KQ2A 4Y30A 4V02A 1B14A 5SV2A 2WINI 3FMOB 3IBTA 3HUFA 2VQSA 2I03A 3GBSA 4OTZA 5AUNB 1X0XA 4H3VA 3U9SA 5JSKA 4W8GA 4PHCA 1EVYA 5E8JA 3LT5A 4PO9A 1G1AA 1G5TA 2XGMA 2IYLD 1YHNA 4OVKA 3AGQA 5AQEA 5F33A 5FI3A 2Q4RA 3BDVA 2CLMB 3E5NA 2O8EB 4Y6SA 2LCIA 3HWRA 5D7BA 1JIKA 4IHJA 5TIIA 5CIQA 4XAQA 4UU7A 1XTSA 5K3FA 4I8XA 1HT0A 3AF2A 3ZYZA 2J5RA 3H0WB 4L3OA 1WULS 2FN7A 2FZ4A 4LGYA 3L05A 4P7FA 3PDIB 1UBFA 2E4UA 2JFZA 2PJZA 3JD3A 4GG1A 3CCFA 4J7AA 4QYXA 4ZCQA 5FH9A 5INTA 2ID4A 1EK2A 1S8FA 3TW8B 4EUHA 1MHTA 1PJ2A 4TTIA 4WFIA 4URWR 4QREA 1OLXA 3M6FA 2YY6A 1QP8A 3AGPA 3LC2O 3TGPA 1QP0A 3ECAA 4FYPA 5A3QA 3UJDA 2KQUA 2OD2A 2XB4A 3FVTA 2C4TA 3UGKA 2EP8A 1L1EA 2J4DA 2P2DA 5CYOA 2FPPA 4LJ9A 3KZ1E 2ORIA 1VLZA 1O5IA 3EGDB 2ZXFA 1ZHHA 2KBEA 5COQA 4BBZA 2H18A 3U7IA 3V7WA 1G38A 1CPYA 1ULUA 3L0BA 1SXJD 2CL6X 2XI4A 2BELA 3H83A 4LY9A 1OI2A 5ECWA 2BM9A 4CM8A 5ES4B 5CLLA 2ATEA 1UJ4A 1PDOA 3D0KA 1OWNA 4B45A 3KVYA 1K63A 3JSAA 1G9TA 1GVNB 1LJUA 3B7PA 3OQIB 5F51A 1XVLA 4QBKA 1UAYA 5DWVA 1GTL1 2FLWA 1AXRA 1LDYA 1CQIA 3UW3A 2PBLA 3ETNA 1W88A 5K45A 4ER0A 3AEUA 3EGCA 3VM6A 5EXXA 5B4UA 3ZQ6A 1GL3A 1AKMA 2H59A 1XP5A 2ODNA 3T54A 1MQ8B 3ZHYA 1Y7HA 4O0LA 4TV8A 2IOFK 2LIVA 4IX1A 5AI5A 5KDDA 1M1YA 2VYFA 3ITDA 3S1AB 1PNRA 2CJWA 1Z26A 2IYSA 3UV7A 1FZQA 1XWWA 3ONWA 4R9UC 3CVVA 3WLNA 1HMYA 3R3HA 1EE9A 1DB3A 4D26A 4PCVA 1HDXA 4W1PA 1XTZA 1XU4A 2FUG6 1J49A 3RVLA 2AXPA 4TSKA 1Z4NA 1M7GA 2HRRA 4IMPA 2RHOA 4KQHA 5JJBA 3MINA 3UPUA 1EZZA 3NYWA 1USWA 1KZ1A 3E2PA 3EXHA 1EJ2A 3FHJA 3I04A 1GVHA 2JIPA 2XMRA 3P0RA 1SCIA 2Y76A 5DLQC 2UAGA 2WQ7A 4IWXA 4PLGA 5AM1A 3KL2A 2DKNA 2CVPA 3OX4A 3W05A 4HO1X 3UHJA 3UWDA 2R2GA 2Y1DA 4UAVA 2IX9A 2RHLA 1K9VF 3Q3VA 3CUVA 1L5RA 5I6DA 1UC9A 1GNRA 2QTBA 3V8PA 3OPYA 1YZQA 2FPSA 2L82A 4MHSA 4J2TA 4JOCA 3V8RA 4DZTA 5JAOA 4YY3B 5CPFA 2BFEB 1U5AA 4M7WA 3O3NB 4OCZA 5E1MA 3QH4A 5C8YA 2V98A 5H4HA 3EVTA 3GLIE 3QP9A 5KHOC 4ZDWA 3KT3A 4EZEA 4KPEC 4R8RA 3H5VA 1KVUA 2Q2QA 4J9UE 3K09C 2REQA 4WFKA 1QFJA 3RS7A 3W6PA 2Z5VA 3IDSA 1DKMA 1T1RA 4TTQA 1XKQA 2GEFA 4L2IA 4MQBA 5DBHX 5EYPA 1O2DA 3BWBA 1PNQA 3HYNA 4I6GA 1LZLA 5BN4B 1A8IA 3CF6R 1VI5A 1USVA 3DMHA 3QVVA 2NWQA 1CLEA 3NIGB 3MQFA 4JT4A 2OQVA 3ZHQA 2HBQA 1RHRA 3RS3A 1I1HA 3QV1A 1UC8A 2HJHA 4HAOA 3VHLB 1J2RA 2WYVA 1MABB 3O5AA 5TQJA 2M32A 3RO7A 3HKBB 2C8VA 3MLAA 1CYEA 3KNZA 3FTCA 1Z39A 3KLNA 1AX9A 4EJ2A 5LXTA 5IT9A 1DKPA 1RJDA 2QU8A 2E4VA 1L4MA 3TTSA 1VTKA 2MMGA 4PZ0A 1PT9A 2A59A 4Q12A 1LCIA 3UJ6A 5E6RB 2ZRFA 5FTWA 4C3VA 5L3SB 4RQUA 4LZJA 2AOVA 3GHHA 3AFHA 3OFND 2WWHA 4BP9A 4AZ0B 1P61B 3WE7A 1GQSA 2P9QA 3D7NA 4C7MA 2B0JA 4CKBA 4EVIA 5I4KA 4M6WA 2JJ8A 1C80A 4OHCA 1CP3A 3KTAA 1CDEA 4BB0A 1D6NA 4HEA1 1B1AA 4NHEA 2Y0BA 5BSVA 3AM1A 2I2WA 1FQJA 1CDOA 5JYAA 3HUTA 5FNZA 1JHZA 2O59A 3QOWA 3DEKA 4L4XA 1WBJB 3OCZA 4RCVA 1YDWA 3OLXA 2CCJA 1NP6A 5G0VA 2DR2A 2P90A 3GFFA 1D8TA 2ZRBA 4W6QA 4A8JB 1MC1A 4YI5A 1QRSA 4BNVA 1UIRA 4QXQA 1C2YA 1GQRA 1IIBA 1ITZA 4P4SA 3L7BA 2PGOA 3I23A 4U3JA 2IEZA 4DUZB 4IH4A 2JIDA 5I9MA 4B79A 1RNLA 2F43A 5DGDA 1KNQA 1J39A 1GYRA 1P9NA 2W2TA 4KZKA 2B8TA 2XUHA 1KKUA 4BLOA 4UCFA 3RSLA 2IH2A 3C1AA 4JUBA 3OKAA 4RF4A 1T6XA 2ZIVB 4MYDA 3K9CA 3RS2A 3R5JA 4N8SA 1U0RA 2PLRA 2PKWA 3Q3JB 5KDOA 2CBXA 3JQAB 2EZ9A 4DLLA 3W9YA 3UMMA 3B2QA 1VMKA 5ALFA 1T15A 1LNQA 2FP4B 3V5NA 5G4KB 3NEPX 3IO3A 4KTVE 2M6LA 4YQFA 4HUJA 4C22A 5TX7A 1L9KA 4ALMA 3WWPA 4V24A 2P4HX 1ZVKA 2GB4A 2KHZA 3C1OA 4CF3A 2O8CB 3BORA 4L8WB 1N5RA 3RROA 2GXAA 1YRQA 1JLSA 2GN6A 1Q22A 5K3DA 5A05A 5CT9A 4ZCMA 1VYHA 4H3KB 2OL4A 3ENNA 1HEUA 3FPJA 1FJ2A 1NGSA 4FOTA 4WUTA 2B7LA 2CFTA 2FG5A 5EE1A 5H82A 3ZJ4A 5MN4A 1TYBE 3CEJA 4JNCA 3I92A 2QLNA 5LB4A 5ECGC 5K3CA 2ZIZA 3IJ5A 1UXJA 1TEHA 2NSJA 3W6NA 4D9MA 4WK2B 3L8MA 4TVBA 4H0FA 2NO7A 4FUQA 1SRRA 3U7QB 1M8KA 3CRVA 1E2FA 4PLZA 1ZUNB 3M1YA 1EMDA 1WZUA 5EFOA 4TYNA 2GJ9A 4JI6B 3T5TA 4M9CA 3C7DB 4DWVA 2IOHA 3JZFA 1GPH1 3BKXA 1O58A 1LDMA 1Y8RA 1ZJWA 2G0TA 4G89A 2PZMA 4GBED 1XTIA 2V7QA 5K7SA 4UARA 1QTQA 3WIVA 3HJAA 4I55A 3SQDA 1MJFA 2BMFA 2GJSA 2ILTA 4FFRA 4G01B 4GRIA 1Z74A 1JDNA 4IDPA 5HF9A 5AW4A 3UICA 3T7KA 1H2YA 2ORVA 4Q47A 5ALVA 4Z0HO 2V74B 3HA7A 4JVOA 2IYQA 1MTOA 4LJ6A 5A3SA 3U37A 5KWIA 2DVMA 5J2TF 4MR8A 3VR2D 2ETVA 2P3QA 4ZZ1A 1DT3A 1SBZA 221PA 2QYOA 3VSBA 2QWXA 1AGPA 1Z17A 4HRAA 2NTVA 5JXJA 5J2UF 1UBOS 2QXUA 4LUCA 2HWXA 3NMUF 3KKZA 2IXFA 4M0MA 5B2ZA 4FIZA 1UJ6A 3I8SA 1E20A 3KQLA 1Y3BE 2JD0A 3D2LA 3R3JA 5IVPA 3RFCA 2Q6IA 4DLXA 2YYAA 1NLZA 4RADA 4W9MC 4NP6A 1JILA 2JD2A 2X0IA 3JQPA 5IXYA 3GNLA 2X76A 1GU7A 5A9RA 1ORTA 3FKSD 3SZOA 3L01A 3LY8A 2KM1A 3GD5A 4OQYA 4UHBA 2YTZA 5IAEA 1S3IA 3IWCB 4CL3A 2OECA 3MIZA 5M7EA 1KZ4A 2P2NA 4ETMA 3NT5A 1W34A 4B3IA 2BC9A 5DXFA 5IJ0A 2I67A 3CTPA 4AKHA 1D0IA 4RHXA 3G9XA 5AT1A 2IDZA 4BO4A 5ECYA 4FYJA 2WM9B 1AUPA 3KQYA 2C2GA 2XOXA 4GHWA 4UHJA 2DH6A 5K0FA 5CTJA 4HNGA 3K8QA 2J6IA 3RU9A 4PF1A 3VR6A 2FUCA 2MYNA 3OOEA 1LBIA 2XGGA 3P0IA 5HIKA 4Y6RA 2HUNA 2QYSA 3K92A 3V1KA 1WF3A 3AEKB 5K0ZA 2CKMA 1ZHOA 1TGVA 4M0DA 2Z8YM 1IHXA 2MYTA 2YASA 1KERA 1YS9A 1E3DA 3H04A 4MV3A 3F71A 5FULA 1XEFA 4BJ5A 1XTVA 2NTEA 4B48A 6ABPA 4HV4A 3S6JA 1ZOLA 3CX4A 4PZUA 5JVDF 3UPDA 2CLFB 3DB2A 3TTYA 4H4CA 4RX1A 3DB1A 2UVPB 4ZALA 1HR0B 3TW3A 1XRPA 1NMSA 2OAQ1 1UOOA 2VJCA 3L8YA 3E1GA 4XCXA 3AUXA 1O94D 3DMNA 3F9CA 3P2KA 1R0YA 2QQEA 4Z1MA 1RBQA 4DA8A 1FSSA 1SA0A 4BYMA 2Q2OA 5LR6A 5JRDS 3L8FA 4ER6A 1MJHA 2M9MA 3PHHA 4DLUA 2EAUA 2IEIA 4HLUA 4WKNA 3KKOA 3S7ZA 3VU1A 4F5YA 1LC0A 1KFBB 1TT5A 1HT2E 2O0LA 3TSYA 3MRXA 3HRKA 1CQJA 3M3HA 3I9NA 3Q10A 3EJWA 5GZ6A 1J0BA 2WJ6A 3FBWA 1NSYA 5K3SA 3AZQA 5YASA 4ARZA 4EBBA 3I9OA 1JFFB 3QNUA 4XB6B 1IUPA 5TPZA 3N86A 1XRLA 3LCJA 4PG4A 2JHFA 3NDRA 1CEEA 4YN3A 1RQRA 4JDPA 3C3JA 3B3QA 3PI6A 2PGXA 4BCBA 1FU7A 4Q9HA 2QBYA 1Q0PA 3UEOA 1NXTA 1JMVA 1EXMA 4FWBA 3HU2A 3DTTA 2I1WA 1P2SA 1YI8A 4MW6A 4P58A 4Y9TA 2IV2X 3QQ5A 4F6LA 3IESA 4V3BA 2MR6A 4G84A 4KDRA 1ETUA 2C5EA 1TRKA 2G9QA 3FCYA 4BNXA 2GA8A 3NBYC 3ETHA 4BNUA 2UUCB 1ETHA 4IILA 4NZPA 5T4EA 1LX6A 4URXR 4QGAA 5AUQA 4HDKB 5LLTA 4BKPA 1JXMA 1PWYE 2Q9CA 2XE8A 1XJCA 1FS6A 3T3OA 1JWBB 3FYTA 4Y2PA 4Y6LA 3ZN2A 3X1ZA 1QE5A 2B25A 1FVXA 2JARA 2A7XA 3AR6A 1ENOA 1I8TA 1LKZA 2X4IA 4GOXA 4AF6A 3V1NA 1L4UA 1PEYA 1QK5A 2XNCA 3WZMA 2G5CA 1MO4A 4OHRA 2DULA 1HGXA 2DLCX 1SUEA 1MT3A 2G88A 2VNIA 3LQ4A 4U5XA 3AVXA 1CYDA 2G80A 3PX7A 2VWHA 2B9VA 4H35A 3ZZNA 3R20A 2BMDA 3CPJB 4KGZA 2V9CA 1F4LA 3CJTA 4UAUA 5HOEA 2GZ1A 1MHMB 1LW7A 2JAPA 3L2OB 1N8NA 1I24A 3DE2X 1NFFA 4ID9A 2XCQA 3M82A 4BNLA 4GEGA 1UM9B 4XQ0A 4CGYA 3U7GA 4DQUA 4TS9A 3A1UA 4B8WA 4F3KA 1TYEB 2FWJA 1M0WA 2W2KB 4C2AA 2BUCA 2WJ4A 3ESBA 2RKBA 3N70A 1W5EA 5E3HA 1GRNA 2ZJ7A 4KQ1A 1RMTA 4AKEA 2GXSA 4B09A 1TJNA 4URUR 4C08A 4JGGA 2YWCA 2FSVA 3HB9A 5AK0A 2IGTA 3B9RA 3KLOA 3ZIDA 4YRPA 1TM2A 3ZXUB 2NQ8A 1GAQA 3PS9A 5BXYA 1H9BA 1X74A 1JS1X 1K9SA 4PAQA 1T5OA 1E3QA 1W87A 3QI7A 4FWTA 1V3UA 2O05A 3V80A 4BEJA 3GRAA 2HADA 4D0RA 2ZT5A 3ZG6A 3H2BA 1FIUA 4FFPA 4JQYA 2DQZA 3U17A 2YVAA 1O89A 4UBKA 2YJNA 1RI1A 1F7UA 3FYHA 2JFGA 4BNWA 5DSZA 1MT0A 4TLBA 4PAMA 4Y1RA 4Y9RA 4AULA 3SM3A 1Z2OX 4LYHA 2WYWA 1OBOA 1JSZA 2C2KA 2ZRCA 4JXJA 4HXEB 3T9CA 2BIFA 2Q6LA 4WXEA 1ZOIA 4QGFA 1ZONA 4JI5B 4M8LA 4BATA 4C4TA 5GADl 3O74A 1L7XA 4RF3A 3VPHA 4LEIA 4DCVA 4TTSA 4LRXA 1THZA 4WXPA 2MSEB 4LZLA 2XE4A 3K0AB 5KTNA 2D62A 2VHCA 4AG3A 3T8YA 1U5BB 4BWVA 2WAYA 3B70A 3O26A 3HQ4O 2CL0X 3A4LA 1TM3E 2JIBA 3GLHE 4QFCA 3OIYA 1TVKB 3Q6MA 1T36B 4XWAA 3H4TA 5CVEA 3T5GA 4OH1A 2AE2A 3FGPA 5FCDA 2A9RA 4QU5A 3C8MA 2LCQA 3VGPA 4EATA 4AYTA 1PUJA 1I6MA 2NUPB 4QPDA 4XJXA 5EXTA 1VDMA 4QXRA 4D98A 4RK4A 3IMKA 1DPFA 3HCOA 5LUBA 3VR0A 1DO8A 1SCQA 5FJIA 1PGJA 4QDJA 4WESB 3SAJA 2AXNA 1COWA 4H7PA 2X6QA 3UJNA 3TRHA 5E9JA 4HYEA 3IAXA 2BONA 2GYWA 5F7XA 4F91B 2VFAA 4BLTA 4KODA 4OFBA 5L4SA 5CW1A 4KNYA 5KYYA 3U0VA 4HPJB 4XSGA 3JS5A 2I78A 1RZ3A 1SH7A 5ADVA 1LI4A 3JZDA 1DKNA 1RFGE 2OHJA 2PGAA 3V8EA 1RMQA 2ECPA 4ZGWA 3X1YA 2VQFB 2ORED 1ZIDA 4MB0A 3JW8A 2D2IA 3VYTB 1GXSA 2QPLA 2VAXA 2ZBDA 5F2OA 3H9CA 2ACEA 3R6LA 4R8KA 2PUGA 1WZIA 3FZGA 4GMDA 4GSYA 1SIWA 4DV2B 3F4LA 1J9GA 2NU6A 5K4AA 5TF4A 4EPTA 1XTQA 3U1TA 5JD4A 3K32A 4D5EA 5SZKB 3N1UA 1TJ4A 3AC0A 4A3SA 1ORIA 1DQSA 1PSWA 2FG7C 4W5NA 4UHDA 4S1TA 1RJFA 1SD1A 1T3HA 8AT1A 2AEEA 5DX0A 1TO6A 3CPSA 1DAEA 1SKAA 2PL3A 4HCJA 4RIIA 4H7FA 1PZXA 2X13A 2H7XA 2AI3A 2VTBB 3EPLA 4GPAA 1A71A 1YMQA 2PMDA 4QOGA 1ADGA 4HLCA 1JTEA 5AHXA 3S70A 2HR1A 3L7AA 4FJ2A 4P08A 4RSGA 1XZAA 5HJ2A 4M7PA 1ZIXA 4KDEA 5DM2A 1ZH8A 1J70A 3A36A 3BSWA 4IZHA 1KOGA 2NTYC 1P5JA 2C7VA 2AC7A 2JFBA 3HE3A 4C76A 4JROA 3SDZA 1GPUA 3VHXA 2R1UA 1IZ0A 4MJXA 1W49A 3WB1A 1NU6A 4OXRA 4P7GA 3STYA 4A8TA 4A0FA 4CPDA 5KX5F 2JLXA 1FDVA 5TJHA 3SHVA 3L4BC 1MQAA 3ETJA 3DBRB 3FNEA 4D9FA 4KCGA 1J9EA 3AM4A 2R8ZA 5J2TB 4QUGA 1DCKA 1GQQA 3LBIA 4YGXB 5TSDA 4UTPA 4IEFB 2VNHA 1HDOA 1PR9A 3HCPA 1FMFA 5H3HA 1XD2A 3UT5A 4DCGA 5J2UB 1Q95A 5DM1A 4ZVRA 1YA4A 1ZEMA 4PG6A 2PZEA 3PEFA 3M70A 1NRJB 3GUZA 3TFQA 5BN5A 1XCJA 3M4NA 3Q7QA 1H8ED 4HRYA 4YQEA 5JYEA 1J2EA 1GTSA 1DS6A 3H2ZA 1NQWA 1G0OA 3I8XA 4FDUA 4MOWA 4V0MA 1R10A 3U3OA 2FH5B 1HQKA 1C1XB 1HC7A 4S2UA 3V4SA 4HDMB 2R96A 4EMUA 2WU8A 2CD7A 4IF4A 1II0A 4EA6A 2O4CA 2FFHA 3G8AA 1I6LA 2ZSDA 1UPXA 3X0DA 2YW9A 5F7OA 1AMOA 2X4DA 4FOLA 2R62A 4UMFA 4F2HA 3G0HA 3TTXA 5TEWA 2CVFA 4HYYA 1TA4A 1T4MA 4YHHB 3DV0A 1AK9A 2JGFA 4KH0A 3HKEA 4MUMA 5DV9A 4W7IA 4YVFA 4RKEA 4L4RA 2GNAA 1Z25A 3A1CA 3OQOA 1RJWA 1W0KD 2GZHA 4R1SA 1O54A 4PBSA 5A0FA 4BGIA 2BKAA 1P1CA 1RVDA 3H9GA 4I1OA 4EFMA 4BNGA 3EIOA 1QZ3A 3I4FA 4MVJI 1QTRA 1WIWA 1ZMBA 1RM3A 1QH8A 3N0VA 3CVUA 2CWDA 4L16A 4NZZA 5J1TB 3GGSA 5FI5A 3R9IA 5G53C 3HDQA 2P30A 3T7DA 4DLSA 1QKKA 2A1UA 3BMCA 3I5AA 3PICA 5MF6A 2MIIA 1T26A 2D59A 1G9SA 4LJRA 1SN7A 5A03A 3G7SA 4HSEA 4GMXA 4MJ7A 3VKFA 4LOHA 2RC5A 2YRXA 3EGXB 4Z4IA 1JEQB 3AP2A 1NV8A 4KV7A 4D3DA 2M2IA 2DWUA 5FFFA 5GMOA 2AN5A 3OOWA 5B6JA 3NJ4A 3TCXB 5LL6P 3GLIB 2GZDA 3T6KA 4G5QA 1Y4ZA 2V6BA 3A4MA 1AZWA 3ZVNA 4EHKA 3PC8A 5EJEA 1NW4A 3SC2B 3D7SA 1D04A 1JIXA 1M6YA 4FXPA 5H3CA 4B3JA 1ABEA 3M5CA 5A4FS 4CEHB 1AHNA 1EQ2A 3QBJA 3KALA 2IS2A 1LTHR 3DFFA 4U8HA 3U6BA 4FFNA 1H0HA 5FPYA 4FZ5A 2CNKA 3W5VA 4IO1A 3ON5A 1Y8AA 4UCWA 3AG5A 3NM4A 1AQUA 3TV1A 1IG3A 1OLSB 2C9DA 2QSUA 4FEGA 1XJQA 2ZBEA 4L22A 3C14C 2BFFB 2QD5A 3O90A 4PVCA 2NZXA 1UWCA 3P26A 2JCYA 1UMBB 4G1CA 5DGHA 3QEKA 1F38A 5EUCA 1T1JA 3T7CA 1OYVA 4MSUA 1MPXA 3D2AA 3ZXYA 2FQ1A 1NBAA 3LWDA 3M1LA 3AL2A 4JHXA 3GAAA 4KFUA 4QOJA 2GEKA 2XW6A 2FZVA 3FNBA 2OCDA 4KW7A 3GPDG 3LSTA 2QVLA 1Z5GA 3H2IA 1Y34E 4PWZA 3UJ9A 3V7YA 2IPLA 2IPMA 1QGYA 2GKGA 1UDAA 3JPYA 2LBPA 1E2GA 1OWPA 1UKAA 5KPDA 2NT3A 5AM2A 5FJJA 2F3TA 2HZBA 2PA3A 2PZ8A 3G2NA 3Q88A 1TGYA 2QUKA 1SHZA 3WRXC 1FFSA 4EF6A 1WMEA 3FE2A 4W82A 3T9FA 3VPBA 5CG1A 3FD8A 1V1MA 1M2VA 5JSYA 5H81A 1OX4A 4D9NA 2XA9A 1NW9B 2B1GA 2TS1A 5EIFA 4X61A 4B4WA 3QU5A 2PMCA 1ESCA 1TKAA 3V8MA 3VDXA 4ZD6A 1NVVQ 1NJSA 2VNJA 2W6IA 4ROTA 3LYAA 4BX9A 1RYMA 3UC5A 3G17A 1DZ3A 5BWOA 1QAOA 1BEEA 1C0KA 1XMSA 4PPYA 2BKXA 1MB4A 1IOWA 2JLQA 4B6JA 3RHZA 5JAZA 3ZWPA 3OQBA 4MS4A 1VSBA 1HKUA 5DLDA 2JIMA 1KRWA 1G5PA 2Y67A 3AINA 3LE8A 3T7EA 4Z86A 3ZGVA 2AUTA 3T9AA 1M1YE 2GETA 3BZWA 4OFWA 3VYRB 4B31A 3HLYA 3FB4A 1MO3A 5HUJA 2VT7A 3LJKA 4XGRA 1N33B 4LSZA 4FJ0A 1JTFA 3MIIA 2BEUA 2MYUA 1E2QA 2ON6A 3ITEA 3EPHA 5LWHA 1CRZA 1U1GA 2QI9C 3WAGA 4FC6A 2PIAA 2FMUA 3AOGA 4YAEA 3RW9A 5EINA 3EMBA 1MFPA 1FXSA 3D8TA 4IDCA 4XFDA 3LPAA 4PR0A 4NBWA 2AN3A 3NWPA 2AS0A 4GYWA 2XOKA 1FYDA 2ZQ5A 3C6XA 4YREA 3PWSA 4RKQA 3KCNA 3AP1A 5LA6B 3HWWA 4G09A 1TUEA 1YI1A 4EG4A 3HU5A 4QULA 5KSPA 3QMPA 2OCLA 4BMDA 2YN2A 2W6CX 2X5NA 4KNWA 1D7OA 2FPIA 2AKYA 4NJEB 2BFBB 4YJDA 4C0KA 2Z9CA 2ZBVA 4UNRA 3BRSA 4IJVA 4X6LA 1MX3A 4JENA 3EZGA 3T35A 5F4ZA 1BEZA 3K9BA 2P2YA 2D4AA 2YRFA 2Z9DA 1BQEA 1Q5PA 1YIAA 2ZUVA 3D8UA 3P9CA 4HGRA 2ZSHA 4LA4A 4YEDA 4CG2A 9ATCA 1NNI1 1BCSA 4H6XA 4I4LA 1EGVB 2GD0A 4BDSA 4KO8A 3S8EA 1RRCA 2ECOA 1I36A 1QU2A 1WU8A 4R2KA 3JATB 4NCIA 1EG7A 1E3SA 2JJ2D 4H0CA 4HDCA 1YKFA 2V6JA 1HPLA 4LSMA 1WQ4A 1KEZA 5A7FA 1OHHD 4RZHA 1KJWA 4BOYA 2EF0A 1UWLA 4M8NE 2QRGA 3LY5A 1VSUA 3M7IA 5IAAA 2BCEA 2BGMA 4EQ6B 2BTOA 2DYKA 4JQOA 2I6XA 5A6SA 3TXAA 3WWZA 3DL2A 1O96B 4H7JA 3VSDA 1RJ9A 1ZU4A 2JI9A 5CIWA 4QBGB 4X8LA 4BNDB 1JAHA 3B5JA 4ZT5A 1PGPA 4E31A 5M5BA 4B7ZA 1JDBC 3QE0A 1A7KA 3IAS6 3DL4A 1GTMA 2LE0A 4YTEA 2PS1A 4YP0A 1PI3A 3B51X 3TEMA 3BQMB 3W5IA 2FZEA 4J0FA 4E4YA 1VXRA 1YR7A 2DFPA 2D1SA 1Q6ZA 4CLOA 1TJ3A 3S27A 1K7FB 1Q0TA 1NLMA 4IVNA 5C34B 1TT7A 3MVEA 4YUYA 4LDQA 4YRTA 2QROA 4JSRA 4ZAYA 3RC3A 5A4MS 2DQSA 4CKCB 1ZC3A 2IP1A 4DMMA 1KY2A 2V7VA 1PV1A 3DEFA 4IEEA 4CM9D 3SLKA 1EFVA 1P7CA 1NVDA 1PEKE 3QVOA 3RUIA 3N28A 3ZTWA 2B1QA 2ODWA 4RD6A 5F3DA 1R0RE 2P9EA 1CZOA 4N49A 3UMJA 5DW3A 4JJ6A 3LVRE 5EIOA 1EDOA 1JKXA 1XXLA 1RTTA 4WJLA 5F5NA 5A2GA 4EA8A 2B61A 3QHAA 1VA5A 1VRVA 1J0XO 2OZVA 4Z4HA 1NUHA 2ONZA 4ZHQB 1KMHB 5K09A 4N6OA 1YZNA 2LTAA 2Y1WA 3AVVA 1J2TA 3P9YA 2RC6A 4OP1A 4WAUA 3UMRA 3WO0A 3MCAA 4NFLA 3OTWA 3RVNA 4YRZA 4YUZA 3NHYA 5JY1A 5CCBA 3HK2A 1H23A 4LXUA 3Q2OA 2WB2A 3PB3A 3DOCA 5ALGA 4RSRA 4B17A 3I52A 1LBEA 4A15A 3VKGA 3I45A 2OQ2A 3HB4X 4LPKA 3LQQA 4OEHA 1V6CA 3M2TA 1NDUA 2R9VA 3GMDA 4CBVA 5DCWA 2O4UX 2BI8A 2E5LB 2Z2YA 4JXKA 1H85A 2KE5A 2WDPA 3ONVA 4PWYA 1UMCA 4Z9XA 1YE3A 3QJGA 5BQFA 4C7OA 2Q46A 3KD2A 4N40A 4P4GA 1JENB 3ZDQA 4EIWA 5KVQA 3CZAA 3FPAA 3L82B 4QLAA 4GMKA 4U7WA 3TLGB 1A7JA 4A7PA 5BYBA 4WBNB 4MO9A 2GA9A 5FP0A 1OH8A 3DO5A 4O8ZA 4WCVA 1XZQA 1YOBA 3U44A 3DLCA 1ZD3A 4TOIA 4V2UA 1NXSA 3DTNA 2FPOA 2G1JA 3E0XA 2IKQA 3OMLA 2JCSA 3V32A 3WJ2A 1KZ6A 5EIWA 2GVZC 4XFJA 1YQGA 4JYMA 3WRVA 4YMHA 5HRAA 2P3LA 1TTTA 1WDKA 2VXBA 4U00A 1R5JA 1SCUB 2B2NA 1TZMA 3C3CA 4GX5A 3WMFA 2X6TA 4RK0A 3KSAC 1SXGA 3JQDA 2DUUA 1V7ZA 4FVTA 1VHDA 4YASA 3B53X 1QDLB 5AKKA 2NU9B 5IF3A 3IEPA 3CPHA 3N8IA 2FUEA 1G5HA 2NU7A 4NU0A 2X86A 1EK1A 4P5DA 4ZEVA 4JUCA 2PJUA 3ET5A 5TS3A 4BQQA 3IUQA 5B64A 3BD8A 4LKRA 3VR4D 3K6SB 2FFRA 2SCUA 1YA8A 2WTEA 2QZJA 3GXOA 4MAAA 3SYTA 3WIEA 1HLFA 2H4XA 2H63A 2I2XB 2QTWB 1VG8A 3I76A 1RQLA 2HWKA 4J91A 1BGXT 3BRQA 3ELWA 1U2TA 4RPKA 4AIIA 4FFLA 3N75A 3RVKA 3A0RB 4TRRA 4JCCA 2CZGA 4RCZA 3U3KA 4JI2B 2XVXA 3RTDA 3E05A 3SS8A 1RLOA 5KNDD 1O9HA 3I0MA 5KREA 1A9RA 3LGSA 5HW0A 3TI7A 3KYIB 3ZJTA 1L5KA 4G0NA 1YK0A 4BKUA 1C1DA 1I3KA 2YWBA 1FEZA 3QJYA 3WAJA 1M2HA 5F78A 1JA0A 3HKCB 2QB5A 1UXIA 2HAEA 2RK3A 1UYJA 1EJBA 4XZ3A 4Y2SA 4MW4A 1K5GA 2XZOA 2IW3A 2YY5A 4G4IA 4D5GA 3DLBA 2BMWA 3OJCA 1QIEA 2FG6C 2WIKA 3ND8A 4RM2A 5GONF 1MAUA 2ZTMA 4XQ9A 3X1KA 2QHXA 1Q44A 1QYDA 1BG6A 3SHQA 1TUBA 3I1FA 3AEYA 2UZ3A 2COUA 2QMHA 2NQTA 3EOBI 4W9RA 1NI4B 2APJA 5AHRA 5KPJA 4OSPA 5FUWA 5CA0A 3ND9A 3Q3EA 3UH1A 3W78A 2OFWA 3ZU6A 4D80A 3H7IA 3AILA 3LM8A 5CJJA 3EP8B 4YJ2A 1K88A 3FVRA 2QSYA 4TV8F 2P9GA 1EHYA 1IPFA 1FU4A 1XWFA 1YE8A 3FROA 3A1WA 5LMZA 3OURA 2IC5A 3TD9A 3LRTA 1SKQA 1NAIA 2AK3A 4XVCA 4MRNA 3ZV6A 1OB5A 4P4UA 5B7NA 1UF9A 4UNSA 5DYWA 2WWYA 1K8RA 2OBMA 2PXCA 2WJWA 2XVYA 4L28A 4B74A 3U60B 3ZWXA 1N3BA 3W8RA 2Z4RA 4RTQA 3FCAA 2O5VA 3D1VA 4WJKB 1YZYA 4CCSA 4L0QA 5CX1B 1NF2A 3PLRA 1W48A 3NONA 1BROA 1XTBA 2IOQA 4B7AA 3R6TA 3NVMB 4XCQA 2MINA 2PTHA 2BEVB 4WOCA 2HHLA 1SKMA 2IYOA 3DOIA 2IY8A 3KXIA 1NSTA 2OBLA 4M8IA 5AP9A 4GI7A 5EKUA 1AXEA 4FB4A 2G6BA 2BP7A 2FFJA 2RIPA 3DZJA 3SVTA 2VK2A 1B6TA 1K89A 1XQWA 4B82A 1EXNA 3D6MA 4LFBB 3HH8A 2GBPA 3H9EO 3FWHA 1UQUA 2Q5EA 3BX1A 4M87A 4C5BA 5U4XA 1FY2A 2FDCA 2W8ZA 1Q1QA 1XSEA 4GL4A 5BVGB 1FDSA 5FWDA 1B23P 1W85B 3RRNA 4LF6B 4CTKA 3Q0IA 4QU0A 1B7GO 1I4EB 1BHJA 1P4GA 2QPTA 3I2HA 3L4SO 1IUNA 1V41E 2XAAA 3PQ4A 3AVOA 3GUYA 3QWBA 2WSSA 3TFWA 1T4GA 1U4NA 3AP3A 1TU4A 1TXGA 1IBSA 5AK6A 1XRSB 3NHPA 3VC1A 4PAOA 1Q2UA 2JAOA 3GLHB 3R3SA 1FVHA 2IW1A 3E70C 3R7FA 4JLWA 4LYYA 1R5OA 4BRZA 4IG4A 4MUHA 4DUGA 3OCVA 2VLBA 3JYPA 2IX3A 4MH0R 3MMZA 1NW6A 1L6RA 4PZYA 2VO1A 4AUKA 2NYAA 4S3MA 1GPAA 3D6VA 3GPIA 4KGXA 3WA6A 3VNVA 2PU7A 4JBYA 2EKQA 3HJCA 3LBYA 4TS3A 2ZOSA 5FHQA 4PTYA 1LFDB 4IIFA 5LWQA 1IHUA 1RQ2A 3PGJA 1CE8A 1ZAKA 3T99A 2GNOA 1RI4A 1W4CA 4DR4B 2IUTA 2WIAA 2RAUA 3WLFA 4ZN6A 2V7XA 4AZ3A 4ZCPA 4O2AA 2VPTA 3PIDA 1ISHA 1ECLA 1O97C 1ZUIA 2WIBA 3C3XA 4PYMA 5ALDA 2H7VA 3P2IA 5FXMA 4CQMA 4EWLA 1B8NA 2C2MA 4A0HA 1RRPA 3UB2A 4ABYA 1QGUB 1LLFA 3VTZA 3QZUA 4IFTA 4JS0A 1AUOA 1LB1B 2FRDC 1J0AA 2FFQA 2G8LA 3G5MA 4PLVA 5E4FA 1JDTA 1M2WA 2BWJA 4TLLB 4YWJA 1R9NA 2WG1A 4C5AA 3VTFA 3BFJA 5CRIA 5DHAA 2MCFA 3BRWD 4CL2A 1T4CA 3C5HA 3OLVA 5DP1A 2W2OA 5IW8A 1CULC 2TRSB 4GR9A 5HX7A 1K4YA 4OATA 2GTHA 4WKBA 2WIFA 5SYNA 3QTLA 1O95C 3OZGA 4LX0A 4MQLA 2YC2C 5JHGB 4UVHA 4BEBA 1NV9A 3B6JA 4RGQA 3GRPA 4OO3A 3PR3A 2CFOA 5EJAA 3M0EA 2XGOA 4M7RA 2WTUA 3SIXA 1X1RA 2JHGA 3FYUB 3HSKA 5ITZB 1EIWA 1B73A 1PJ8A 4Q7LA 2RGXA 2WFZA 5FTLA 1BVHA 1JDUA 1QPGA 4EB8A 2GKOA 1H1LA 2B8JA 1QQBA 2DERA 1GNLA 3RS4A 5KAMA 1ICIA 3VUEA 5KJFA 4BNHA 1N2XA 4GSKA 4B40A 4KXLA 1EM8A 3DE1X 4WA8A 5DE3A 3IERA 5REQB 1T2FA 3AH8A 1H5NA 1BX3A 5BY2A 1CVLA 1U80A 3HJHA 1TX4B 5FUYA 3DWGA 1Q74A 4WVLA 3MPUA 2XWPA 4TUYB 4ZT2A 1KOLA 5F1PA 3ONNA 3AFOA 4P5EA 1W1UA 1Y1PA 3O2QB 3ZV7A 2XH8A 4O4JB 1M8PA 2D5AA 2N46A 1QH0A 2JBAB 2OHIA 2J0UB 3DJFA 4S1PA 3G7UA 1FPMA 1P2TA 1W2GA 4YJ3A 5KJEA 1JN0A 4AJ1A 2IHTA 4I9HA 4AY2A 4CIYA 3IR5A 4HB2A 4X62B 1OAOA 3RUAA 1W73A 2P7HA 1IZYA 2VA9A 2ZTVA 2ZTUA 1U2QA 2CEKA 3LVFO 2D7CA 3I6YA 1NRXA 4KIUA 3VJKA 2AFIA 4BE7B 1M6VA 3G2OA 4ZMSA 1FB5A 1H6AA 1M75A 2HFKA 3ELUA 1RAGA 1NX9A 2VUUA 4IQ0A 2XQFA 3OLWA 4UMDA 3WR5A 4Z49A 5JYBA 4O33A 5EPUA 1XO1A 1YBAA 1XJ5A 3D6AA 1F3LA 3LXXA 4R1NA 5BP7A 3DFIA 3D3KA 4OQFA 1WCXA 1WHSB 1V9CA 4IDGA 2W83A 1PUIA 4KR0A 3ROEA 3O93A 3WBJA 1MX1A 3KLMX 2F00A 1TMYA 4ITUA 4A8PA 5JBQA 4TYYA 4A8JC 1K27A 5B58T 2FWNA 5KYWA 2HTFA 5A1TA 3ZVKA 4L0DA 4ML3A 3GLFA 1LRKA 1TNDA 5EMNA 4YRKA 1PLLA 2E1RA 2PH5A 3IOEA 1DQZA 2ZWPA 2XWJI 2QTGA 3TH5A