1H6CA

Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with succinate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
381
structure length
381
Chain Sequence
ATLPAGASQVPTTPAGRPMPYAIRPMPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Precursor Form of Glucose-Fructose Oxidoreductase from Zymomonas Mobilis and its Complexes with Bound Ligands
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Protein translocation
molecule keywords PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
total genus 126
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2001-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h6cA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h6cA01
4ALMA 5ENVA 3RKRA 2EXXA 1M2WA 4WUVA 3MJ4A 4EW6A 4Q3EA 2YYYA 4YCAA 3ZU4A 1WVGA 1AN9A 5JLAA 3WGZA 1Q0QA 1SB9A 4BV9A 5IXSA 3H9UA 3LQFA 4OO3A 4G2NA 3UFXA 2I3AA 2NU9A 2X23A 2GLXA 1DDOA 4BNVA 1C1XB 3BXXA 3DHNA 1X0VA 1ZH8A 1TA4A 4W7IA 3VH3A 5I7FA 3GR6A 2J5QA 4GX2A 2D59A 3JQ6A 3V8BA 2WD7B 1NQ5A 1CRWG 1EK5A 2JCYA 1KETA 5G4KA 1HXHA 1G1AA 1NTOA 1JLLA 4EEXA 1QV6A 1NXQA 1V3TA 2AXQA 1JU9A 3T7CA 3JYOA 4UEJA 1MB4A 1AGNA 4ALIA 2XXJA 2Q2QA 3QP9A 3PLRA 4PCVA 1FK8A 5GZ3A 5GZ1A 4FR5A 2A92A 3ZWAA 3CZMA 1Z74A 5CDYA 1H9BA 1EQ2A 2EW2A 5DNAA 2O23A 2O7QA 5IZ4A 4CM1A 3Q1LA 3QY9A 1QYWA 2B4TO 2J3HA 3C8MA 1UJMA 1DFIA 1QKIA 5L3ZA 2FP4A 3AM3A 4MVJA 2DFVA 3JYPA 1MA0A 5G0VA 1DBVO 3GVHA 1HL3A 4XWYA 1A71A 4FN4A 1U2DA 4YEDA 3VKVA 3P2OA 3PRJA 5JO0A 4XJTA 2NQ8A 1ONOA 2O3JA 5F1OA 4JQCA 1E3JA 5C7LO 5CDUA 2HRZA 4GVLA 2HJSA 4IPTA 1JDJA 4YT5A 1UR5A 2C7VA 2X0RA 5JBIA 1GL3A 3KETA 4E6PA 4PLTA 1WDMA 3T7EA 1A7AA 3VPFA 2W2KB 1E7YA 4LSMA 3E5MA 1PQPA 4IS3A 2ZKLA 2HJRA 5KKCA 3WG9A 4I9NA 4PLZA 3JD0A 4IY1A 4RCVA 1YDEA 3RC7A 1SOVA 3WLEA 4E3ZA 4RGBA 3GNTA 3RUEA 5FFFA 3DBHA 2UVDA 3K6JA 3I9OA 2ZQZA 2JD1A 3C85A 3I9MA 3P19A 4B3HA 5K9ZA 3TZ6A 5CDSA 4KUHA 2ZTLA 3TN7A 3DBLA 1IB6A 4RPJA 1MP0A 1TI7A 4BNTA 3PIDA 2YDYA 1GUZA 3H3JA 1K6JA 3K8ZA 1A4IA 3PIIA 1BMDA 4D41A 3D64A 1GZ4A 3GMDA 1UXJA 3LK7A 2V6MA 1XG5A 1JVBA 3CPSA 4RVSA 5JYDA 4G65A 3QE3A 4BL5A 1X7GA 4DL9A 1L1FA 3SVTA 4M8SA 3RUAA 4NH4A 3PHJA 3V2HA 2O3TA 4IGEA 3TZHA 1VSVA 1A5ZA 1B8VA 2VZ0A 3KEOA 1GYQA 3BHMA 1W8DA 2PGLA 2GZ2A 1MXFA 1B3BA 1S7CA 4DIFA 1LSUA 1D3AA 1JA9A 3ANLA 2VHVA 1V9LA 1MUUA 2V6BA 3UN1A 2UDPA 4DTIA 2WE7A 1B14A 5JDIC 1NVMB 3OIDA 3MOGA 4GLLA 4CQMB 1BXKA 1ONPA 3KLPX 4MVJF 2V65A 2H5LA 1Y5RA 1F8GA 1H2HA 2D0IA 4D0SA 4E2WA 4GKBA 4A7PA 3CTMA 2Q99A 1FJHA 4EYEA 5CAEA 5HBRA 3VZQA 3WQQA 4TRMA 4N5NA 2DLDA 1HETA 3I3OA 1C3VA 3DZIA 3WMXA 4J4BA 4PZCA 4MP3A 1YONA 4DPMA 1XA0A 1HE5A 4CR7A 2GYYA 1SC6A 5KJFA 1E5QA 2DFDA 2VHWA 5KJEA 4CV2A 4YT4A 3NT2A 3K96A 3ZHBA 1PJ3A 1IZ9A 3ENNA 1VI2A 4NBVA 4TVBA 1O5IA 4NJMA 2OXIA 4B7CA 4PRLA 3JD1A 1IUKA 1I2ZA 1F0YA 1LC0A 1T1RA 2A9FA 2VRCA 2FZWA 3D7LA 4WLVA 1LLDA 1KBZA 2QX7A 1ISHA 1ZMTA 4FC7A 4K1LA 1HYHA 1H5QA 4E32A 2GRAA 1DIBA 4DA9A 1E77A 2HSDA 2PZJA 2BRUA 4WNIA 3D3EA 3IL2A 4PFJA 3KHUA 3GPIA 1YJQA 3MJCA 3SXPA 2D5AA 5J9GA 4XGNA 4YRBA 3DAFA 3I9NA 2JD0A 1WXDA 4RQUA 1R16A 1A72A 4FOOA 3BMOA 1KVTA 4DIOA 4XGKA 1FDWA 5CPFA 3L4BC 4FFMA 2EIHA 1K3TA 3PHIA 3KEQA 3TNLA 5JW6A 2DKNA 5DP2A 4BUCA 1J49A 4EUFA 1P1FA 2Y1GA 3PTZA 4KTVE 4YRAA 5G4KB 3DBHB 1R37A 3G3EA 5ER6A 4E2YA 1KY4A 2NTVA 1P1HA 4WOKA 4J7XA 3CMMA 5DOZA 4PLWA 2ZATA 1KOLA 4PG4A 1ZNQO 1IY8A 1V3VA 4YJHB 3C7AA 4BO9A 2FHSA 4CODB 3RD5A 4J43A 2HAEA 2DBVO 3WGYA 4RVHA 4KUEA 3V2GA 5EN4A 4BO6A 5JAMA 1I3NA 3AM4A 4A10A 3AY3A 3GFGA 4NG5A 4DMLA 4LISA 1NP3A 4JCOA 3DTTA 2X0IA 1X0XA 5KJCA 2NADA 1UXHA 1OAAA 2O4CA 2HMWA 3TL2A 3F6YA 3L07A 4TROA 1UP4A 3QSGA 3FR8A 1I24A 1VL0A 4BNHA 2ZIZA 3UVEA 1N7HA 1NAIA 2Z95A 1VJ0A 1DLIA 2CDAA 5TT0A 1U5CA 1LLUA 2Z1NA 3C1TA 2FSSA 3KOUA 3OMLA 3GRPA 4FSHA 4NBWA 5G4LA 4CL8A 1ML3A 3PDJA 2C0CA 2YW9A 3IMFA 3VZPA 2HU2A 4J9VA 5A3VA 2Y0EA 1DFGA 2YHUA 3FNEA 4HV4A 3NDJA 4R68A 1PJ2A 2W2KA 3ZHXA 3LT1A 5T8KC 1IHXA 2EERA 4Z9XA 4AJKA 2C54A 1QLJA 4IQ0A 1EUCA 2EKQA 3GRKA 4H16A 2D8AA 2ZB3A 2YQ5A 2NVUA 3BZUA 2DTXA 1P74A 4Y6RA 4CMBA 1M6WA 2I65A 1GUFA 4PLPA 4IGFA 3K30A 4BNJA 2PH5A 1E3WB 2QYSA 1P77A 2VOEA 2QYTA 1GPDG 2CF6A 2GNAA 1D4FA 5A5EA 4L74A 1MX3A 3AWDA 5T67A 4EJMA 1QLHA 2AEFA 1UXIA 1NWHA 4WKGA 5C7OO 4FFOA 3AUSA 3W8DA 1YBMA 1VC2A 2X0NA 3SBOA 5TRTA 5JCXA 1HTBA 4JN6B 2VYND 1P3DA 2DM6A 3PQFA 4BMSA 6LDHA 3KRTA 3BMNA 5DOVA 1MFZA 1YGYA 3NEPX 2P5YA 1RM5A 4CV1A 2CY0A 1ZJZA 1EE9A 3WDSA 3QHAA 1PS0A 4NQZA 4M1QA 4II3A 1XEAA 4TZKA 3NT4A 2GN8A 2ZYDA 4CR6A 3DZKA 1LTHR 1WZIA 4WJZA 4H15A 2JD2A 1B8UA 4JIGA 1ADBA 3CMCO 5JYFA 2Y67A 4NDNE 1UP6A 3BMNB 2ZYGA 3DO5A 1JKIA 3L0DA 1HZZA 2BGKA 3DFUA 3WBBA 1R0SA 4DVJA 3NUGA 1IPFA 2Y1CA 3KO8A 1PJBA 3ROQA 3DONA 1BRMA 2ZJ0A 1X13A 3JQFC 4I5EA 3WTCA 5TT1A 2BF7A 1E6WA 5F21A 5G0TA 4U8GA 3ZU2A 1B26A 1T2EA 4R3NA 3UICA 5T64A 3ITKA 1RJWA 2GF2A 2R00A 3H7AA 4M55A 4D43A 4B7XA 3PHLA 3ENKA 1ADFA 5JNLA 1FDSA 2I3GA 8LDHA 2DT5A 3QQPA 2VRBA 5KVSA 2C2XA 5K0ZA 3QA9A 3R1IA 5HM8A 2J3JA 1JKJA 4B3JA 4E13A 1HDRA 4GX5A 4ZD6A 3I4CA 1MFPA 1HYGA 1YB1A 3RC1A 5L7TA 1J0XO 1D1TA 1IE3A 4WEQA 4BS9A 1RKXA 2BFPA 3KYCA 4FD3A 4IJUA 5G0UA 1MC5A 2BD0A 4HFNA 1NPTO 3D4NA 1AHHA 3OEWA 4MVJP 3DMYA 3S55A 2DBQA 1KY5A 3FPLA 4K28A 4RORA 3HADA 5A9TA 3ZI0A 1Q7CA 1C0LA 4FFPA 4QXMA 3U49A 4E0BA 1XWFA 3VC7A 1DFHA 3GH3A 1ID1A 4CM9A 2CD9A 4AJLA 1GCUA 2VOJA 2H1SA 2VTDA 4GMGA 3FRJA 1TT5B 4MPDA 3UH1A 4UVDA 3ZWXA 3X2EA 4HXYA 3D5QA 3K2EA 4WLUA 3FWZA 4L9RA 1YXMA 4XYMA 4QX6A 1QXSA 5G0SA 4NBUA 2P9CA 1VLLA 2Q4BA 1N7GA 3JQ9C 3RJ5A 1H9AA 3RUCA 5DZSA 1GV1A 3OH8A 4IDDA 1VKNA 4QO8A 3ST7A 4E12A 2E82A 1PJCA 3GDFA 3W6UA 1ISJA 4MVJE 2Y1DA 4LSWA 1JW9B 2VNSA 1OZAA 2CFCA 3GFBA 3UHAA 1EFLA 4HY3A 5KKAA 3IUPA 5A03A 3HN2A 3S1LA 1SB8A 3M6IA 3OBBA 3QV1A 1QSGA 1MLDA 4ZVVA 1CF2O 4MIOA 4KWIA 4ALLA 3GDGA 1DIRA 3EZYA 1KVSA 1OC2A 1KVUA 2IYPA 5KTKA 2WSBA 3AI3A 4XIJA 3JQGB 1T1SA 4TRJA 4YQZA 5KWEA 4FJ1A 4XDZA 4N5MA 4QECA 4CMJA 3QWBA 3Q0EA 1ZCJA 2Y0DA 3LU1A 3C1OA 2FPPA 2BGLA 4ZA2A 3UXYA 2OZPA 2Y0CA 2ZK7A 3TSCA 4CLOB 1ULSA 4UAGA 1P0CA 2JKVA 4QQRA 2LDXA 3WIDA 4E2ZA 4Z9YA 4ND4A 4CM6A 3GG9A 3PLNA 5DP1A 3B1JA 1ZK2A 2BH9A 1JTVA 5DULA 3OQBA 3UF0A 4W99A 3ROPA 2I5PO 3KVOA 3GK3A 4IXTA 1YOVA 3CINA 2I99A 2QZZA 3P7MA 5COQA 4RVGA 4A27A 3ZV3A 1SPXA 4OSOA 2B5WA 2R6JA 4CLEA 5L7WA 4CMCA 1LNQA 3ZHZA 4PVDA 3UKOA 3E6AA 4Y9DA 3T4XA 4BMVA 3VH4A 4WNCA 3BTSA 3O8QB 5AVOA 1LXCA 1NQOA 2QIOA 2Y99A 4D79A 4BNFA 1KC1A 5EINA 5U9CA 3WSWA 1MXHA 4WCFA 3IJPA 3AOGA 1YS4A 1GR0A 3T4EA 3GNSA 4BO5A 2PZKA 4ND5A 3ZWOA 1WZEA 5C3MA 5A04A 4ALNA 2P91A 3U4DA 4ZQFA 3QJ5A 3LLSA 2WE8A 2C7GA 1SCUA 1Z6ZA 2GN9A 4DUPA 5C7IO 5AXDA 1XLTA 3BHIA 3WFIA 1UDAA 1WDLA 4CL3A 5CDTA 4IDBA 1MG5A 3OM9A 3RFVA 3I23A 5AXCA 2GZ3A 4R41A 5B1YA 1YWGO 2Q1UA 4I1IA 4I5GA 1N1EA 2H6EA 4OL9A 2F1KA 1YOVB 2ZB7A 3B6ZA 2C5AA 1HWYA 4CMKA 1R4MB 4L76A 3PHGA 2X6TA 1I3KA 1B2LA 5JSFA 1HE3A 1Y1PA 3H2ZA 3ZH2A 2PH3A 1W6UA 5C5IA 2E4AA 5TGDA 4XYEA 1F17A 3H9EO 1T2FA 3INRA 1P0FA 3ONDA 3STHA 3ZWWA 3WIEA 1H93A 2W2LD 2IXBA 2TMDA 4MKZA 4R5MA 4GVXA 2RBEA 4NJOA 4UUMA 4WASA 5F5LA 4AJHA 4BVAA 1EEHA 4EUEA 3ZNOA 3MZ0A 4YYZA 5TSDA 3ETEA 1CQJA 1JAXA 1I36A 3GPDG 4NU6A 1P31A 2IZZA 3HB4X 1PU2A 4BMNA 1U3UA 5IDQA 3DMTA 1X7DA 2I67A 3ZWYA 4YJGA 1I01A 2G0TA 5A3JA 3JQFA 3F4LA 4BNZA 3PFWO 1UH5A 3PI7A 4XR9A 2DUWA 3DOOA 2PTGA 3RI3A 2A94A 3U4HA 2AA3A 5U1PA 4J1NA 1RM0A 3VZSA 2B4RO 1BDBA 3KXDA 5A9SB 3CKYA 3MEQA 4RZIA 1NQAO 3NGXA 4U6QA 2HDHA 4BB5A 3BA1A 1YE3A 1V35A 3ORFA 1Y5MA 2PLAA 4IDAA 4J6FA 1E6UA 3GVCA 2J8ZA 4CM7A 4DBVO 3ZWVA 3TFOA 3GGOA 3IS3A 3HJAA 2YY7A 4B8WA 2FOIA 4WLFA 5IZCA 4CV3A 2ZCUA 3H9JA 2I9PA 5U4QA 4BKOA 1LQTA 4QFCA 1C1DA 3EUWA 4MVJH 1M76A 1U4SA 3U3XA 2IDZA 1H94A 5CP8A 3Q11A 1YQXA 1CERA 2VHXA 3PEFA 4NBRA 1DAOA 3A28A 2JHFA 3H5RA 1CWUA 3NRCA 1U8XX 1W4ZA 4BV8A 1YH3A 3P5SA 2X22A 4L75A 5B4UA 1DJNA 3B1KA 1NBOA 3I5MA 3I1JA 4BO3A 1F06A 3C1AA 1G0OA 2WDZA 3N74A 4GGOA 4OH1A 4TKLA 4YRDA 3QW2A 1X15A 2OUIA 2Y1FA 1Y8QB 5COBA 1KIFA 2GZ1A 4U0JA 1MGOA 1UP7A 4JP2A 5T6BA 3TZQA 4XB1A 1DJQA 1LDBA 3DHEA 3UOGA 1U7HA 1XCBA 3PQDA 5T8KA 3FN4A 3A14A 3VTZA 4MVJD 4GI2A 3WNQA 2FR8A 3LSYA 2FR0A 2XXBA 5JS6A 2R2GA 3VH2A 3BHJA 5K6AC 3RKUA 3PQEA 4OJNA 4TMFA 3QVOA 5TJ9A 3JTMA 4OKNA 4Z3KA 4KP7A 3HUDA 1I5RA 4FGSA 1Q7GA 5J23A 3BMQA 1NYTA 3AU9A 4DQXA 2RH8A 4Y8VA 2IZ1A 1PJSA 3GT0A 4AJ2A 2UUOA 1FDTA 2Y05A 3V2UA 3JYLA 1E5LA 5CEJA 4XB2A 1U4OA 4YAGA 4HP8A 3WJ7A 4F6LA 4UVIA 3O26A 4OHUA 1XIVA 5L53A 3MJSA 3O4RA 2G1UA 3A4VA 3PDUA 4OGWA 4BGVA 1LQUA 2EWMA 2GGSA 4J4HA 5KJ6A 4UVEA 3V1YA 3ZU5A 4WCDA 4C7JA 2HMTA 2VHYA 1EE2A 3F3SA 4AJOA 3FR7A 1WMBA 3K5PA 3EVTA 1LDYA 3H2SA 1LEHA 4BNIA 4GX1A 2VWHA 1TEHA 3NJ4A 2WMDA 1HDCA 1BXGA 3JV7A 1TVEA 2HMSA 1K6XA 9LDBA 2JCVA 4ZQBA 1XR3A 4GWKA 4Z0HO 1E92A 3AUUA 1EVJA 1YL5A 3KSDO 1X7HA 3FNGA 3L6DA 5FWNA 1B16A 1HEUA 3QWIA 4TQGA 5BT9A 2QRJA 2WYWA 3RASA 1ISMA 1W73A 3U5TA 3AU8A 3GGPA 4JNKA 1WPQA 1G6KA 4LVCA 1ISGA 4R1UA 2IXAA 3GLQA 3PWZA 3QRWA 4B79A 3AK4A 4BNGA 4EUHA 4EJ6A 1EUZA 5EESA 3R3JA 3OJFA 3I6QA 2YQ4A 4XKJA 3HWRA 4BNUA 3RIHA 3I9LA 2XPCA 1VSUA 4CM9D 5JAZA 2AW5A 1SOWA 3AY6A 1NFFA 4K26A 1NFRA 1QG6A 1QV7A 4J4TA 3RC2A 5THQA 4UREA 3GY0A 1DB3A 3GVPA 3D0OA 4LRSB 1X1TA 3C24A 3CXRA 5ER9A 4D3SA 1B8PA 1DLJA 1ULUA 3EVNA 1CETA 1NR1A 1IPEA 2EGGA 1HYEA 1LLQA 1TT5A 2X0JA 3BMCB 4BO2A 1NASA 3WXBA 3D4OA 1ZZEA 1NPDA 3VPHA 3LT2A 1RM3A 5KVQA 3WBFA 1DC3A 3F9IA 4CM3A 1BVRA 2FY8A 1GUYA 4IM7A 4EITA 1HZJA 4MIEA 4Q39A 3LC2O 4XGIA 2JFGA 3MJVA 2RH4A 1ENYA 4XDYA 4CM8B 4I08A 1U9JA 1GEEA 4ESOA 3GVXA 4IDCA 3HDYA 1Z82A 4CM4B 4WLEA 1P9LA 3ZW8A 3E82A 2OFPA 2GN4A 1ZUD1 3DAPA 4FBGA 5H81A 2YUTA 3S2EA 4ZQEA 3UW3A 4Z3DA 5KNLA 3GEGA 1O0SA 1BW9A 3DXFA 4ZQHA 2VYVA 4HX5A 1QRRA 2X4GA 4GX0A 2JAHA 3GNQA 5TLSA 5TF4A 3OICA 2DBZA 2E49A 3AW9A 3UAGA 1DC4A 2PFGA 1PQUA 3E18A 3RFXA 3IP3A 3WYCA 1NHWA 2CVQA 5B37A 3GN1A 5B4VA 2Q4EA 4HUJA 1Z7EA 4S3MA 1E1LA 1K5HA 3U62A 2FR1A 2Y66A 5BSEA 1JQBA 5I7EA 3O8QA 1EBFA 5COAA 2B35A 4IXWA 3TDKA 1LSSA 1XU7A 4FPXA 1ZK0A 2O3QA 3NTQA 3IP1A 1Z7BA 5LC1A 4IMRA 4CQLB 1N2SA 5EL0A 5DBFA 3ZNQA 2UV8A 5T73A 3JYQA 4XQ9A 1UZNA 3VPSA 4A0SA 4DWVA 3ZN2A 1A4UA 4PVCA 3ETDA 4D0RA 1HE4A 4KDFA 2Y1EA 1VPDA 1WWKA 2Y68A 4YJDA 2D3TA 3GVIA 4KUGA 1N9GB 3TL3A 4NFSA 3BMOB 4XA8A 1GQQA 4FFLA 1PL8A 3VKUA 4YPOA 4F6CA 3KTDA 3HDJA 4WE3A 1CQIA 3RUFA 2VUSA 4Q3BA 3CEAA 2Q2WA 3QVXA 2PD6A 4URFA 4YXFA 1NM5A 3L6OO 1GZ3A 4ND2A 3PYMA 4YJFA 1KEUA 1PGQA 2PR2A 4YTEA 5FYDA 3EMKA 1WW8A 4WCFB 4FS3A 3KYDB 4ONEA 5A5FA 3H65A 4ILKA 1TXGA 2AQHA 2FPIA 1F14A 2D4AA 2WWRA 5DCYA 1GCOA 5IG2A 3JCZA 4JX8A 4L4SA 4HADA 1PSDA 4F45A 5FI5A 2UUPA 3ROKA 4D7AA 1GD1O 1Q2XA 1ZVMA 1ONNA 2EP5A 1I3MA 3OJOA 1V0JA 1JKFA 1AHIA 2BELA 4XEHA 5IZCC 2ZYAA 1ZK1A 1EQUA 3MTJA 1F12A 1HT0A 2HO5A 3A06A 1KS9A 3G1TA 4ND3A 3ZDFA 4BB6A 5JFOA 1YBVA 3NYWA 1D1SA 2VUTA 4PG7A 3OJEA 5HS6A 1RM4A 4IS2A 4YT8A 2H9IA 5EJ2A 1H6AA 2HCTA 3I52A 4IJKA 4ALKA 5I8WA 5F5NA 3PWKA 3EK2A 3EW7A 3RCBA 5JXWA 1PWZA 3QLJA 4LN1A 4YACA 4JJFA 3IDSA 1EVIA 4BO1A 1P1IA 3E9NA 4RPHA 1G0NA 2Q49A 1NNUA 1Q1NA 2J3KA 2ZJ1A 3DL2A 5F1KA 3WB9A 2DAPA 3NJ8A 1N5DA 4LK3A 2QRLA 4NJMB 2YFHA 2O2SA 1WNTA 1MV8A 2CVOA 3RVDA 2VN8A 2EG9A 3U4IA 4DGSA 3TJRA 1XQ6A 2DC1A 3L77A 2JL1A 2O50A 3FTPA 4RQTA 4BNMA 4KOAA 3HNPA 2WD7A 1NPYA 5HWSA 3UUWA 3OFSA 5IDWA 3QIVA 3ICCA 4HFMA 3TZCA 3WOHA 4DPKA 1ZK4A 5AXBA 3KB6A 4Z6KA 3Q2IA 1E7WA 2AG8A 4PZDA 4TSKA 3JYNA 4P4GA 3L4SO 3CZRA 4UUOA 2HK8A 3GZ4A 1BVUA 3WICA 4FB5A 1GPJA 3RUIA 3DR3A 1O95A 4YAKA 2NU7A 3FSRA 5JDCA 4O6VA 1UZLA 2BI8A 3GA0A 4AL4A 1BW9B 2C29D 1Y6JA 1B3RA 2O48X 5HS4A 1CJCA 4DXHA 4NK4A 4ZN6A 6ADHA 1E7QA 2X7HA 1R4MA 5DDIP 1R15A 1L7DA 1N9GA 5TNXA 2HLPA 2X1HA 1OOEA 3DHYA 3ICPA 1GEGA 3NV9A 1U3VA 2OMEA 4GMFA 1DIGA 2GN6A 4N54A 5I9MA 3C7DB 2W98A 4QTZA 1NVTA 1AXGA 4E5YA 1N1GA 4OQZA 1PEDA 4LMPA 4PLFA 1J5PA 2YV3A 3GZNA 4EJ0A 1IYZA 1O89A 4KZPA 4NPCA 4TRNA 5DBIA 4J90A 3Q2KA 3W4JA 3VOSA 1IHYA 1EUDA 1XQ1A 4ND1A 1ZBQA 3VHRA 1T2AA 5CFZA 1PR3A 1HRDA 1XELA 4J7CA 1LDMA 3NDIA 4FJ0A 1VL6A 1DC5A 2CNBA 3EAGA 3OIFA 1DOHA 5DBGA 1DEHA 2CUKA 2GD1O 4NZ9A 5CEFA 3VPGA 2PWZA 3GQVA 2E6UX 4C7KA 4LRTB 3ON5A 4RL6A 4RDIA 1GTMA 4HWKA 5F3RA 2O3RA 3WTBA 4IINA 4OKIA 2PKQO 3PJFA 5DN9A 4OAQA 4E21A 5TQVA 5L9AA 4KQWA 3H3FA 5IJZA 5I7VA 1YB4A 2PV7A 3GDOA 5L4NA 1LRJA 4JP3A 4IQ8A 3PPIA 4CM5A 2JHGA 1BG6A 1E0DA 4Y6PA 3WLFA 4BO0A 1NWCA 2FMUA 3R0IA 4PLCA 4ALJA 5CPBA 3IC5A 2O4UX 4WCFC 2GR9A 3VPXA 1I30A 3ITDA 4BOYA 4CMGA 5TX7A 3IKVA 4FGWA 3RUHA 2GO1A 5AXAA 2OP0A 2J5RA 3WGQA 3AUAA 5JMWA 4DREA 2EJWA 1IULA 2Q46A 4Z0TA 2DPHA 4AJJA 3MWEB 1J6UA 1R12A 4BNYA 3OSUA 2P9GA 4QUKA 3NX4A 5JO9A 2BKAA 1ADCA 3HSKA 2FPGA 2XAAA 1DXYA 3ADOA 1K6IA 3PFFA 1P44A 1NFQA 3JQGA 1Y81A 3BMCA 5ILOA 5JC8A 2G82A 1Y8QA 1LRKA 2GSDA 2V6FA 1QORA 4CUZA 1QP8A 1VE9A 4FFNA 1DPGA 5HTOA 3A1NA 5M6DA 3HDQA 3LF2A 1I33A 2B37A 4JGBA 1DSSG 1QMGA 2NNLD 2A4KA 1LI4A 4OXNA 3DAGA 5H83A 2ILTA 4N18A 1PZGA 2Q3EA 1D7OA 2EP7A 1Y9EA 2AG5A 1C1XA 2Y1OA 4RF4A 1UAGA 3AFMA 4BO7A 5IF3A 5LDGA 4W6ZA 3IQDB 2W90A 1E3SA 2VYVD 1LC3A 4QSMA 3WYEA 4AJ4A 1ZKMA 4UUPA 4BNKA 5A4DA 4E33A 3WFJA 5TC4A 1PWXA 3PXXA 2OO5A 3OA0A 4R9RA 2A35A 1I2BA 1PGJA 3H4VA 4BNLA 3KYDA 2AE1A 4R3WA 2C2YA 3HG7A 3WS7A 1T26A 2NWQA 2EGHA 4BIIA 5G2OA 4BQPA 5BSGA 2GUGA 4G5HA 4MDHA 2X5KO 1U2GA 4O1MA 4D3FA 2IODA 3C3XA 5I7SA 4ZRNA 3SC4A 4GSLA 1CYDA 2NU8A 3PJDA 3WMWA 1P1KA 3K73O 4IUYA 1BXZA 4DBZA 4DYVA 5C37A 4NK5A 1PZFA 5K6AA 1DC6A 4LMRA 4TKMA 5BR7A 2J5KA 4CLRA 4P8RA 1C0IA 1T25A 1AXEA 4RLHA 3WJAA 5JYAA 1BXGB 1PL6A 5IXYA 3M2TA 3LC7O 1X14A 2Q22A 4Z0PA 4W82A 3R6DA 3AI2A 4U0KA 4UVHA 1A27A 4BGIA 1H0KA 1RPNA 3GZNB 1MG0A 5ICSA 4XQEA 1N92A 4IDEA 4D46A 3MOIA 2FWMX 3R3SA 2PD3A 1ZXLA 1HKUA 2P4HX 4F3YA 3JD2A 4FQ8A 1P1RA 4J1QA 4O0LA 4B8ZA 3DQPA 1YDWA 3D3WA 4H7PA 1KC3A 2D2IA 4XR4A 1RYDA 4U6SA 2AQIA 1ZIDA 1EVYA 3RJ9A 1KERA 1VM6A 4ZRMA 1Z73A 1HDOA 1CDOA 1YVEI 3BMQB 3JQDA 3N7UA 1O6ZA 4RF2A 4J7UA 2UYYA 2HMVA 2NVUB 1LUAA 7ADHA 5IN4A 2W2LA 1U28A 2GPTA 4NBTA 4EI2A 3X2FA 1E1NA 1E6EA 2YFQA 3G49A 3PK0A 3B20A 4BO8A 4ITUA 4JJGA 3BTVA 2XF8A 5HA5A 1TB4A 3ROMA 3EC7A 3RAJA 2NV6A 1GQYA 4QFDA 4CM8A 3ZZNA 2ZB4A 2Q1WA 3DZJA 4JBIA 2HUNA 4PGFA 2OP1A 5BNIA 3FBTA 1LDGA 3SX2A 4PG5A 4IBOA 2ET6A 2BFOA 1F8FA 4IIVA 3OQ1A 2OBYA 1R4NA 2OGUA 5TS3A 3ZCXA 2Q50A 3WGHA 1AE1A 5AYVA 3RBZA 1PX0A 3JSAA 3NTRA 5L4SA 5ITVA 4D44A 4B4WA 4MP8A 1XU9A 4OMUA 1HDXA 3BTUA 1ZXBA 3VTFA 1BHSA 3UCXA 1V3UA 3MCVA 2ZTUA 4L73A 2EJVA 4UUNA 3D4PA 3DZFA 3VVCA 4EGFA 2DTEA 1DRVA 5B12A 4XJSA 2VWPA 1HDZA 4AFNA 4IMPA 4R1SA 1CEQA 5JC1A 3ZNPA 5HRUA 3AI1A 1E3IA 1PIWA 2OHXA 1H6DA 1W0CA 2B36A 4R01A 4E31A 3PGXA 3L9WA 2DUUA 1T2DA 3V1TC 1LDNA 2CSUA 7MDHA 1PQWA 3TFQA 4OXKA 3CIFA 2O2YA 4TZTA 5BNFA 1ZMOA 3GF4A 1KEVA 3OETA 2NSDA 2V7PA 3U4CA 2HQ1A 2WD8A 2X58A 1A7KA 1TT7A 3E9QA 4GLOA 4UULA 1LBEA 5IDYA 3Q3CA 1Z75A 5ITWA 4O59O 4AVYA 2I66A 2QHXA 3KSZO 1OI7A 3FNHA 3IOYA 4DQUA 2WYVA 2E48A 2RIRA 4RVFA 1YL6A 4MJLA 3BIOA 1KYQA 4B4VA 4LW8A 4CMHA 2O7SA 2X9NA 1Z45A 3GGGA 4FDAA 4DLAA 3ZV4A 4PLGA 4YVFA 2JFHA 2GDZA 4XRRA 3WGTA 3L6EA 3TZKA 5L4LA 1I0ZA 1M67A 2EV9A 3DBLB 2XOXA 4EBFA 5IDXA 1OFGA 4G81A 1GFSA 3VH1A 2AMFA 3FPCA 3A9WA 5L45A 1PS8A 4JBHA 1E3EA 2B5VA 5CEEA 3RQSA 1ZSNA 3EZLA 2WJPA 4W9NC 1VKOA 2C82A 3U9LA 2VTEA 1DIHA 1ZEJA 5A9SA 3JQ7B 4CMIB 1JAYA 1O94A 4IIUA 3ONEA 2W4QA 4MO2A 4FCCA 2VHZA 4II2A 3EYWA 2NACA 4E4YA 1FDUA 4YAIA 2C5EA 3QWAA 3S8MA 2OORA 5THKA 2GASA 2LDBA 2CZCA 3HQ4O 2YJZA 1YQDA 3INTA 4Q3DA 4Z9FA 3ZWMA 2D5CA 5EMHA 1M6HA 1HLDA 3TOZA 5DF1A 4HKTA 2UAGA 1YRLA 1V8BA 5EQFA 1HDGO 5LCXA 4BQRA 4PLVA 4AJEA 4UEKA 1SZJG 3KUXA 2Z1MA 4LVUA 3AJRA 4ZU3A 3WX0A 1KEPA 1NX6A 4BKUA 5KVCA 1TLTA 1QYVA 4EEZA 2FRDA 3OEYA 1R66A 1YL7A 3U09A 4IDFA 1ZFNA 3RFTA 5AQ1A 4ROSA 4XZ3A 1GYPA 3E5RA 1YKFA 4PG8A 3GHYA 3HFGA 4Q9NA 4RPKA 5CG2A 3GC6A 4N7RA 2EF1A 2RHCA 2F00A 4CR8A 1CIVA 4OOEA 4UVGA 4CQLA 3W8EA 1PJTA 4ZGWA 4ZJUA 3RC9A 4YAEA 2NVWA 3PWSA 5I9LA 3IJRA 4D3DA 1LX6A 3GN2A 3KM0A 5MGBA 5TIIA 1VL8A 4IJWA 1PJQA 1O9BA 1ZO8A 4RPGA 1ZJYA 2Q45A 4D42A 2VNAA 3IAHA 1UAYA 3WSVA 1BDMA 3B1FA 3G0OA 3TRIA 2VZ8A 5I9NA 4P38A 3FHLA 1R6DA 3KYCB 2BGMA 4A73A 4TVOA 3V1UA 1GADO 2CDBA 4U5QA 4JBGA 1BSVA 1PJ4A 4J91A 3LZ6A 3ABIA 8ADHA 4CQMA 1SO8A 2CF5A 3PZRA 4J0FA 4MOWA 3ASVA 2ZCVA 4P22A 2PKQP 1WP4A 2TMGA 4A26A 3TF5A 5L51A 1KVQA 3OJLA 5DCWA 4B7UA 3ZV6A 4RF3A 2AHRA 3DC2A 4KMSA 3ZU3A 2V6GA 3B70A 1DRUA 3AOEA 4I5FA 4M49A 4BO4A 2PD4A 4HNGA 4FC6A 2HMUA 4ZHSA 4IQGA 1C0PA 1PGPA 3F1LA 4DPLA 3H9GA 2PA3A 1SMKA 1ZK3A 2DU8A 3WGOA 3PP8A 4H3VA 2B83A 3ZWPA 2PY6A 4BNXA 1HE2A 1QYCA 3WQRA 3ZGYA 4RPLA 1E7RA 4E5NA 3DBVO 4M89A 3ETGA 3CE6A 2WYUA 3F1KA 4K6FA 3FBGA 5ENDA 1GZ6A 2PK3A 4ID9A 3PZBA 1PGNA 1K2WA 3ANMA 3U0BA 4LCEA 4O63O 4CJXA 4MVJG 4Q3CA 5JY1A 4B4UA 1IOLA 1KEWA 3E1KA 4DIBA 2G17A 1HLPA 3G17A 4IZIA 1ORRA 1U1IA 4NNJA 5JDCC 3SEFA 2IZ0A 2VT2A 3F4BA 2NM0A 2JCXA 4BGUA 1P1JA 3RROA 1U8FO 2O3UA 2PGJA 1LLCA 2PZMA 2DPGA 3DZGA 3GMSA 4OQYA 1GQ2A 5JDIA 4TRRA 4CMAA 3DB2A 2BLLA 2IEBA 3LYLA 4YJFB 4YQYA 5ES3A 2PNFA 3PHHA 3H5AA 2BI7A 1DO8A 1PTJA 3H8VA 1LU9A 3MWDB 4XCVA 3GUCA 3RBXA 1L7EA 1Q0LA 5KOIA 3AOEC 1R4NB 3EDMA 3ULKA 5DCUA 2POQX 3JQAD 4GKVA 1EZ4A 3KBOA 4JROA 4YJHA 1HDYA 4AJIA 2AQ8A 1PGOA 1QR6A 1JN0A 2HRBA 2VUUA 4JK3A 4YWJA 1WLYA 1ARZA 3FD8A 4OM8A 3S2IA 3PGJA 3W6ZA 1UDCA 1ZSYA 2O3SA 3FI9A 4CM4A 2IE0A 2OBNA 3IKTA 5JYEA 1XKQA 2ZQYA 3F47A 3WNVA 4QO7A 4ZICA 4NI5A 1E7SA 1SNYA 2IEDA 3O38A 2NUAA 3TWOA 4P4LA 3C7CB 4WGGA 3SJ7A 1PL7A 2DQ4A 4CV0A 2D1YA 4M87A 4XIYA 2FN7A 2CVZA 1UXGA 1C0KA 1C1DB 1VJTA 5GZ6A 4S1VA 1DAPA 1BTOA 1R0LA 3IIEA 1DRWA 3HFSA 4PLYA 3EY4A 2AEMA 4R4JA 2ZTVA 1UDBA 1FDVA 1NR7A 4KQXA 4DLLA 4CLDA 1WAMA 2QRKA 2Q1SA 4JLWA 4OYRA 4PLHA 5JCJA 2G76A 3RSHA 3TQHA 2WEKA 4I5DA 3DWFA 3KSUA 4K6CA 5JCJD 3UCFA 2NQTA 3WQSB 2ZTMA 5JAIA 1V6AA 4R51A 1E3LA 3JD4A 2B69A 3NAQA 4RV9A 3DDNA 4XRGA 3VVBA 2HKIA 3LVFO 4BKPA 3KLMX 4GGPA 3V5NA 1ENPA 1GY8A 2OL4A 1GYRA 2NLOA 3DZHA 4GH5A 2OOSA 1ISIA 4YB8A 3E9MA 3Q9UA 3DFZA 2I76A 4FJ2A 4J0EA 4ZQGA 3QWFA 1E7MA 2CMDA 1LJ8A 2QW8A 1WMAA 4J3FA 3RWBA 5CG1A 4J16A 2B4QA 4Q3AA 2BMAA 3BAZA 3GG2A 5IAAA 1ZW1A 2WTBA 1Y8RB 1N8KA 1PZHA 4O5OA 4GAEA 4CLXA 2Y93A 1I3LA 1LSJA 4JJIA 4GWGA 4D45A 2QZ9A 3JQ8A 5IFLA 1XHLA 3F5QA 1I8TA 3RU7A 5FF9A 4L4RA 1T2CA 2G5CA 4XQGA 4B4OA 3WR5A 4CMEA 3Q6IA 1I10A 4J1SA 4NIMA 5F1PA 3G1UA 2I6TA 4A03A 1GAEO 1ENOA 5BNTA 1GV0A 3EHEA 3DBRB 4YJGB 3G79A 1A9YA 2Z5LA 3LF1A 3L4BA 4EZBA 3M1LA 2QQ5A 4XX0A 2WM3A 2EEZA 2JFFA 3E48A 3F5SA 4RZHA 2BFAA 2NVBA 4R5HA 3TOXA 4XQCA 2W8ZA 4K9DA 3GEMA 2AE2A 3P2YA 1T4BA 3LT0A 1U7TA 3WYBA 2JJYA 3E8XA 3NGLA 1ADGA 1LSOA 4E5MA 1NQTA 2RCYA 4P4NA 4J49A 1EVZA 4E30A 3OA2A 5G0WA 2C20A 1NAHA 5FEUA 3TPCA 3ZW9A 2VWGA 3D1LA 5A02A 3JQ7A 4CMIA 3HN7A 2YHIB 3HDHA 3JQAB 2NU6A 2NTJA 3GHHA 4Y98A 5FI3A 4YDRA 4XYBA 4PRKA 2H63A 1BGVA 3HZZA 4YBZA 1X1EA 3NKLA 3ASUA 3K31A 4WLNA 4XYGA 3KYBA 2VZ9A 4IJVA 4AICA 3JQBA 3VZRA 3GUYA 4YR9A 3FTNA 1U5AA 1SEPA 1K0UA 2P4QA 3I83A 4J1TA 4NFYA 3DBRA 3IUSA 4AJ1A 4W7HA 3W4KA 3D5TA 3OP4A 1PR9A 2FZEA 3RU9A 9LDTA 4R54A 3PYXA 2EW8A 2RAFA 2DTDA 3PYLA 1IZ0A 3DOJA 4FIZA 1A9ZA 4FW8A 1SBYA 3ZWNA 3OIGA 4KWHA 5GY7A 3OECA 3AFNA 5BQFA 4EDFA 3FNFA 4W9NA 1B0AA 2C59A 1GU7A 1K89A 3AY7A 1ZEMA 4J2OA 1I2CA 1YJ8A 3KZVA 4KDEA 3EGOA 4BKQA 3HB5X 1XYGA 3N58A 4CLOA 5BSHA 3I4FA 2P9EA 3SJUA 2DVMA 4Q3NA 1NHGA 4GQAA 1B7GO 1E1MA 2VT3A 3JQAA 4XYLA 5MDHA 3QWHA 2C07A 4MKRA 1EK6A 4NFHA 2RHRA 1FXSA 1JVSA 1E3WA 3BTOA 3W4IA 3DOCA 1RYEA 2YHIA 4GL4A 1T24A 4I8XA 4A2CA 2CDCA 3H5NA 2YV1A 3BYZA 3DEYX 3SLGA 3JQ9A 4R1NA 4R1TA 3M1AA 4E2XA 4JXKA 3AM5A 3K92A 3MTGA 2HK9A 4L4XA 4NMHA 4RVUA 1E1KA 4AG3A 3GEDA 4NHEA 3I9JA 1Q0HA 3WWYA 2PKRA 3MJEA 2P2SA 3LLVA 5TJHA 4J2HA 4NU5A 4RO0A 3LT4A 4PG6A 2EKLA 3D3WB 1EDOA 5BSFA 2BFMA 3Q9NA 3O03A 4L0QA 3DZBA 4E5KA 5CHEA 4CLHA 5CDGA 3QVWA 3QVSA 1H6CA 4W4TA 1LA2A 4PZEA 4RF5A 4DLBA 2E37A 3H6KA 5JMPA 2GERA 4M54A 1DIAA 3FCOA 4J9UE 5A9RA 3LC1O 4WPGA 2VQ3A 3ADPA 5LDHA 1Y9AA 1SAYA 1WDKA 1J4AA 4RLSA 4E5PA 4R9SA 3WWZA 5I8ZA 1M66A 1U3WA 3L9XA 3FF4A 2EKPA 1UUFA 1LDEA 1I32A 2VWQA 4WLOA 3JQEA 1VJ1A 5EERA 4DQVA 1B15A 1Y8RA 2DBRA 4B3IA 3HHPA 5B4TA 3O9ZA 4CUKA 5KIAA 5JAQA 4QEDA 5EIOA 2VYNA 3OHSX 4PIVA 1C14A 4INAA 1YB5A 4CLRB 1HSZA 2B0JA 1NVGA 2VCYA 2J6IA 2VRCD 4MP6A 4RVDA 2R00C 1OMOA 2P5UA 4R16A 4TWRA 1FF9A 4AJPA 1YQGA 3E03A 3VDRA 4MKXA 3NTOA 3SLKA 4YT2A 3ZNNA 1GDHA 2PZLA 4M86A 3KV3O 4QT0A 4Y67A 5JPIA 1DHTA 4RDHA 5ICMA 3HE3A 4HFJA 3OF2A 5T57A 3GAFA 3I6IA 2P68A 4OOFA 2Q1TA 3JQCA 3JD3A 3K2BA 4OIMA 1UZMA 3JQBC 4DRYA 3ONFA 4CUJA 5L40A 1R0KA 3MJTA 3WGIA 4R69A 5A1TA 1M75A 3FWNA 4MVJI 3PJGA 1ZSVA 4WEOA 1EBUA 2PGDA 2NTNA 1ENZA 2X8LA 3K9QO 1PZEA 2AEJA 2JAPA 3GAZA 3W8FA 4N5LA 3INGA 1T4DA 5KVVA 4IDGA 5JY6A 3OQ6A 4MVJM 1ISFA 4U7WA 4HNHA 5T5QA 2J3IA 5AOVA 1EFKA 1S6YA 3NT5A 2GCGA 3UGKA 1EDZA 4A5OA 5JE8A 4FOSA 4Y6SA 3VAZA 5A06A 1LRLA 3JQ8B 4WOJA 4WECA 4NR0A 2IYOA 3F46A 4DMMA 1YBAA 2EHDA 3CSDA 4HFRA 3ANNA 4OSPA 1MC4A 3S2FA 4IZHA 5EQDA 3ZWBA 4C4OA 4GSKA 3WGGA 4BHTA 4HBGA 1KVRA 2IRWA 3CUKA 4FFRA 4UEOA 1EMDA 2X9GA 5DT9A 4RJTA 1D8AA 1AUPA 1QYDA 2X86A 3OJ0A 4CMEC 3SC6A 2BHLA 5KJ1A 5L95A 3DMTC 5ADHA 3GOHA 5H82A 5ILGA 4BKRA 4LCJA 5A05A 3PJEA 4BNWA 3COSA 4MIYA 1Q7BA 4GBJA 3QVTA 4WK6A 4I9UA 4CQMD 5IN5A 3NDRA 3M2PA 1OBFO 5L7YA 4F46A 3RUDA 3LDHA 4OXYA 4MINA 1PS9A 3I9KA 4DC1A 2ZB8A 1PJLA 1H6BA 3DTYA 5KCZA 3PVZA 1VRWA 1JWBB 4YA6A 1Y7TA 4LGVA 1DHRA 5EPOA 1RWBA 1SEVA 1XSEA 4BNNA 3ZWCA 4I9HA 3RBVA 1HF3A 1H2BA 1XDWA 2X5OA 3UCEA 1IL0A 1UXKA 3ZHYA 3ZV5A 2YDXA 4DC0A 4KTTE 3CH6A 3W1VA 1HSOA 1O8CA 2FSVA 4PN3A 2X5JO 1P45A 1U3TA 4BGEA 1YO6A 2AQKA 2SCUA 3S2GA 1JWAB 5GMOA 4L8VA 4YAJA 4DYDA 1OC4A 1FMCA 3H9QA 1XGKA 1QYXA 2HK7A 4AJNA 2YZ7A 2YV2A 1P33A 4X54A 3VDQA 2Q2VA 3AUTA 4XD2A 4CPDA 2QG4A 4GPD1 1BWSA 2X9VA
chains in the Genus database with same CATH superfamily
4ALMA 4DDTA 4DNFA 4PYNA 4JLAA 3G1WA 4WUVA 4EO7A 2QTCA 3OZBA 1AN9A 5EZSA 5JLAA 3TR6A 4BZPA 2VA9A 1V39A 3WGZA 1ZINA 4DN6A 1LPAB 3CZCA 4X6YA 3F97A 1YKSA 4JUAA 5H16A 3FPGA 3P0EA 3UFXA 1SKYB 2GLXA 1VHJA 1C1XB 3PNBA 3U7IA 1JHZA 3QYJA 3WGJA 4W7IA 2FN9A 3JVUA 3O8RA 1J5XA 3FW1A 3G2NA 4JHXA 3DCNA 4YRQA 3WYFA 5IC4A 3AIKA 1I2DA 4KNWA 3HJRA 2HA5A 5KVAA 1T0IA 1KETA 3F6PA 3D6UA 1NTOA 4EQ6B 2PE5A 1QV6A 3OOJA 4ZU1X 2AXQA 1S4QA 1JU9A 3SHFA 3PC6A 4KHZA 3JYOA 1PG0A 3ABZA 4PC7A 2QLNA 5JNWA 1AGNA 3AESA 4ALIA 2Q2QA 4G0UA 4RHXA 4OI2A 3TIVA 3KQNA 4PCVA 1FK8A 4PTYA 5GZ3A 5HZGA 3V4RA 5GZ1A 3OEEA 4FR5A 2CNOA 4D9KA 1CR2A 4UM9B 3CZMA 2C5GA 2L69A 3RABA 3GZTB 3KWJA 3VPCA 2CYBA 3MAJA 1H9BA 1A9XA 5T3YA 2P90A 4MRAA 4ZO4A 1L8QA 2EW2A 2XD9A 5JD3A 3DC7A 1N0HA 4ZPXA 4K46A 4MDEA 3LYHA 2J3HA 1GTG1 4NZZA 2WV9A 4ENPA 2ZJOA 1FS6A 2B0CA 4TKVB 2FP4A 3AM3A 2IXDA 3U0VA 2WMNB 3JYPA 1JA1A 4RZSA 3WGKA 1CZOA 1N75A 4MW7A 4CEHB 1YF3A 5ALQA 3R9WA 4G9EA 1QIJA 2I8AA 3FDFA 3PNVA 4K6HA 4DEYA 2H18A 2CK3D 4DDKA 4GVPA 1U2EA 3IKMB 3IPRA 5CMLA 1XJQA 1AURA 2NQ8A 3TQCA 3EASA 4OXQA 4LKRA 3FKQA 1H05A 1QAQA 2W11A 2QTMA 3HY6A 3TNYA 1W25A 2BDEA 4ZVMA 4XLLA 3K4QA 1FL9A 3YASA 3NDBB 4GHWA 3UWDA 1HTWA 4BMPB 4BVEA 4YT5A 4C87A 2QT9A 1P2TA 3E9ZA 3DKKA 1TM4E 3G23A 4OK6A 1GL3A 2WAMA 3DT9A 3V33A 3KZKA 4E6PA 3L1KA 3ZWQA 2QGFA 1LBHA 2I4LA 5AK3A 3KETA 2FLWA 2RKBA 3CVOA 1M7HA 3QLUC 1L5KA 4E07A 2EW1A 1L5YA 2FFAA 3D8TA 3E5MA 3FPFA 2ZKLA 1K8ZB 2ADOA 5KKCA 3JD0A 4IY1A 5KWJA 4E3ZA 3B3AA 2WSIA 5L3QB 2IF0A 2ZRCA 4KJXA 1YR1A 2OHOA 3ORHA 1HC7A 1OXSC 2GRUA 2YIJA 1G4UR 4N47A 5KYNA 4YMTA 5LQSA 3KXIA 2REOA 3D0KA 3KQWA 3C85A 2JD1A 3L79A 4Q9IA 4A0QA 3FUUA 3TZ6A 4AT1A 2AOWA 2EL9A 2FEAA 1SFRA 1J0EA 1W2WB 2OG1A 3DBLA 4HF7A 3OHMA 2XCTB 4RPJA 3ZHCA 2V97A 4LQLA 3O8DA 4WD3A 1UBCA 1DZIA 1WSAA 3HI4A 3PIDA 1GUZA 1QCZA 4IP0A 4J2TA 4BNTA 1G2OA 1K6JA 4CNQA 1F60A 3EA5A 3K8ZA 2PJUA 3PIIA 4ML3A 4ZDIA 3H18A 4FN5A 4D41A 2MSEB 3TUXA 3GMDA 2V6MA 4IFTA 4N9WA 1XG5A 3WRXA 3REQB 5FV4A 3CLTC 1Q44A 4IH1A 1EX1A 4G65A 4M60A 3QE3A 4JITA 1QO0D 5CA0B 5H1YA 4HOYA 3SVTA 4PY2A 3WLPA 3LBAA 4PR3A 4ZZ1A 2F4VB 1N78A 3V2HA 1QGUB 5FADA 3ILXA 1IXSB 3TZHA 5AK6A 4UBMA 5CM2Z 3BHMA 2Q2OA 2W71A 3C6KA 2O1XA 4KAXA 4OB8A 1S8FA 3QBDA 2GZ2A 1SVKA 4ZREA 4ARVA 4B9AA 5LP6F 1B3BA 4EKGA 1OWOA 1QH0A 2JBHA 1D3AA 1JA9A 3ANLA 3OX2A 4W9MC 3UMVA 1V9LA 1KE1A 4Z4IA 2V6BA 2AFHA 3PGKA 2GM9A 4DTIA 2VBGA 1H2WA 5B55A 3WGLA 2FW6A 4IOJA 3UMGA 1ONPA 4ZODA 4RW0A 2H5LA 2OHVA 3EQ9A 1B73A 1SRRA 3CISA 2XZDA 3Q3HA 2D0IA 3WQBA 4D0SA 3KQKA 3FETA 1CTQA 4A7PA 3CTMA 1PFQA 2Q99A 3F6EX 3LKZA 2V1UA 4MGZR 4EYEA 3RGWS 2W2NA 5IBCA 3WQQA 4DLKA 1Z38A 2DLDA 4BTVA 4YRGA 3I9V6 2I03A 3WMXA 3NHJA 3IA7A 1CW2B 4YGXB 1V9SA 4DPMA 2WU0A 4XARA 2B99A 1HE5A 4C30A 2FPIB 1T8WA 5JQGB 4TS4A 4MI3A 5KJEA 2PUGA 3V4SA 4ZO8A 4U4AA 3NT2A 2CE2X 1NE2A 1IZ9A 3MQ4A 3X1XA 1W7AA 3COJA 2EX1A 2BP7A 3LVBA 4NBVA 4KRFA 3C3PA 2HWXA 4QATA 4ZO6A 3S29A 4B7CA 3D6MA 3S8EA 3ZD7A 521PA 3DQQA 3ENZA 4LF4B 1IVYA 1F0YA 5F78A 1T1RA 2FZWA 3D7LA 4KR9A 1TM7E 3I1IA 4LNUB 1YOBA 4A0RA 1Z39A 1ZMTA 5IH3A 4G8CA 1XAJA 1KQGA 1HYHA 3FHJA 1HX7A 2GRAA 1DIBA 1XXHA 3NWBA 3I2GA 2FWAA 2Q7XA 2PUBA 3G5UA 1E77A 4MEBA 2BRUA 4WNIA 3KDSE 4CZ2A 4PFJA 1P4GA 2HF7A 2FF5A 3KX2A 3LXMA 3SXPA 2PSFA 4XGNA 1J8DA 1K4YA 3I9NA 2JD0A 1JGTA 4WACA 4XQ0A 4AMUA 2V58A 1WXDA 2JZNA 2D1SA 5SY4A 2D3WA 1U3GA 2HLDD 1KVTA 1G8KA 1S8AA 1X7ZA 2IYUA 3NASA 1FDWA 1GKUB 2VQDA 2V0CA 3MB5A 4NAVA 4RIGA 1TK9A 2V03A 3OF3A 1KU0A 1SCIA 3IPCA 2NV2B 5LOVA 5C8ZA 4TTPA 4MS1B 2DKNA 5DP2A 4BUCA 5A2GA 1JHAA 2EQBA 2YN0A 1IJKA 3RIMA 1O5OA 2Y1GA 2RC5A 2BGTA 3DBHB 1R37A 4I1SA 2K87A 1W1IA 3MGAA 2PR7A 2GFQA 3LC0A 5E4JA 2QRQA 4HGRA 4E2YA 5JATA 5E6UA 1KMHA 2W37A 5B58T 4C4YA 5LVAA 1QWSA 2XUQA 3LA6A 3QNWA 1OIVA 1CR0A 4K3VA 4PLWA 4YJHB 3SZMA 3ZJYA 3C7AA 3W5AA 3RD5A 2GBIA 3ZZMA 1ZVVA 3BD6A 1MZVA 4MS4B 2Z4SA 1T3HA 2FI1A 4QU5A 4RVHA 1L3CA 1N2OA 2HF9A 3H5OA 2XMDA 2P67A 2J59A 4QEKA 1I3NA 4BO6A 3P0HA 5CFPA 2OB2A 4N3NA 4DMLA 2X0EA 4B43A 3DTTA 5CJPA 1YRYE 5KNCA 1ZCBA 2ZUUA 1L5RA 2QTRA 1E4YA 3S8YA 3UQYS 2A1TS 1WSWA 1UFOA 4Q19A 4L8GA 2FX2A 4Q9JA 4QUEA 5EXEA 2XKAA 2HHCA 3VKGA 1KJIA 3F6YA 1UBGA 1FFSA 4RY8A 3L07A 4TROA 1UP4A 5I4IA 1UBHS 1Z4MA 4CI9A 1P81A 1ADYA 1VL0A 3OPNA 1D1QA 4U3JA 5TT0A 2CT8A 2BKEA 3K94A 4MV3A 3JZFA 2JJ2D 3Q7IA 2H3HA 3FOFC 1OWNA 2DKFA 3PGA1 3PDJA 4HB3A 3HVUA 3K71B 2ATEA 3IMFA 4XPIB 4UNNA 3VZPA 2BFFB 4BE7B 2R96A 4NRDA 1YT5A 1Z2DA 5DHAA 3WLOA 3UBTA 1CHNA 3NDJA 4URXR 2W2KA 2BE7A 3CG4A 1GZHB 2FP4B 9MHTA 4AN1A 5JISA 2YMMA 1QLJA 2LV8A 4GECA 3GRKA 4H16A 1OIXA 1W88A 2HA6A 2PX5A 3SDSA 2ZB3A 5HQTA 3REGA 2I2WA 3E84A 4AS3A 1H42A 2BEVB 1Q1QA 3BZUA 1JIKA 4WESA 1NZJA 1T4CB 1KJ9A 1W2HA 2EC5A 2YRXA 2ZUCA 3N9IA 4PLPA 2A1UA 2JFXA 4GKAA 1XD8A 1Z12A 4L5BA 5FWAA 1WMFA 3IBTA 1Q0TA 2PMBA 4WOCA 1E3WB 1COWA 4K87A 3K2QA 2QYSA 3KL4A 5EWLA 2QUAA 4FD2A 1JAIA 5EPEA 1NWHA 4TLDA 3U3OA 4ANFA 1YBMA 2R0QC 2NO6A 4EZIA 3GLFA 3SIRA 5D84A 1Y4UA 4CXMA 2RGCA 4B1FA 5JSUA 4JN6B 3SLRA 2BDTA 1T5HX 3KRTA 2YH2A 3NEPX 2KMLA 2QSUA 3P9YA 2P5YA 3B1XA 5DI3B 1RPJA 2GN2A 2CY0A 3HEMA 5DW3A 1EE9A 1STOA 5AT1A 3ZD9A 3G9QA 4JVLA 5GV7A 3STXA 3TTYA 4M1QA 1NI5A 1XEAA 1QQTA 3A2NA 4II3A 4RKEA 1YCGA 5GGXA 4U2FA 3DZKA 4CR6A 4YUVA 4WJZA 2EBWA 3W04A 4ZVOA 1B8UA 4JIGA 1O3YA 4D9HA 1VZ3A 2Q4DA 3UTCA 2JFBA 5IM4A 5BUCA 4F2DA 1AO3A 4B0PA 4D8XA 4R6XA 2R6CA 5F4ZA 5C8YA 2J9FA 3ECAA 1CB0A 1TMGE 4OYHA 2Y67A 5P8WA 2BW0A 4CCYA 9ABPA 1XVIA 4NDNE 4OQEA 5ITSA 4JVOA 4JT4A 3CBGA 3BK1A 4NZYA 1JKIA 1PDVA 2BGKA 4BXOB 2FMHA 2WHXA 4MUEA 3I53A 3M8KA 4QREA 4W1SA 4BMXA 4EG3A 1IPFA 4TL9A 2Y1CA 4MPTA 2AN1A 3ROQA 4CKXA 1BRMA 3K6KA 4HLUC 4LYDA 4MUXA 4S0XA 4U8GA 1TYDE 3HVIA 4IIHA 2OORC 1T2EA 3FCXA 2R6HA 4R3NA 3ZEAA 4NABA 1P0MA 3VJMA 4FLFA 2RG7A 2AX3A 5K8UA 3HXLA 2FKAA 3TLKA 5CFQA 2XD4A 4GMKA 5JNLA 5KQLA 1DQYA 1RXYA 5BY2A 3QU2A 8LDHA 3QQPA 1KSJA 2VRBA 3CUTA 3H2JA 2C2XA 2KX7A 1RQ7A 2WUVA 5G3YA 3RLIA 2FXVA 3IEPA 3QA9A 5HILA 5HM8A 1QVAA 4GLBA 2G9RA 4YROA 3TCKA 4CTNA 1D6NA 1NUPA 1BEEA 5LM3A 2VS1A 3QOYA 4C3VA 1Z4PX 4GX5A 4K9LA 3B36A 2CLIB 3TLXA 1MFPA 3EEYA 1YB1A 4UNQA 5L7TA 2ECQA 3IUBA 2R6GA 1CUWA 1IE3A 2C8JA 3BULA 4UCFA 2V0GA 1RKXA 3KOZA 4RGYA 3KYCA 3NBMA 1W94A 4FD3A 3EVFA 3O82A 4EAQA 1MC5A 2ATIA 1L5HB 4MR9B 1DTSA 3ISJA 4HFNA 1NPTO 4J0DA 5KDDA 1PD1A 5GJCA 1E4EA 4WY2A 5HUHA 1EHIA 1KY5A 1EX7A 2J9FB 2PUHA 1OH8A 4M4SA 5SZKB 2PCJA 3ZI0A 1R0CA 1C0LA 5LN1A 2OPBA 4G2TA 4TYPA 4O4LA 3U49A 2B4YA 3LW8A 5KAMA 3VC7A 1M6VA 1VJCA 4OCZA 1YS1X 3ECCA 1ID1A 4P81A 3TKYA 3ZE0B 4LGMA 1NN0A 3A6DA 3E15A 2VTDA 3FRJA 3UH1A 5C52B 1AZLA 2HA7A 3X2EA 5FL3A 1GPNA 4HXYA 1YB2A 4Y1EA 4KIJA 3FWZA 2GTIA 2QVZX 4ZI7B 1YQ9A 1JQKA 1W76A 2VYFA 1S9HA 1NLUA 2IEAA 3A0UA 3BIXA 4O8CA 4GYKA 4JBWA 1MOZA 2P9CA 1UMDA 5GQSA 2JI6A 5JWHA 3SJZA 2CL0X 4C0WA 4EATA 2FSUA 1B23P 3DDUA 3JQ9C 3RJ5A 5SY6A 1GRVA 4C0QC 1GV1A 3OH8A 2W43A 1OXMA 2R97A 3LX4A 4ENVA 5TVKA 1VKNA 1POWA 3F8WA 3B6KA 1IATA 4OA8A 2UZ1A 4OKSA 2WWVD 4E12A 4HHEA 3VR0A 1OZGA 1FLDA 1JW9B 3RHZA 3H5IA 4IG4A 4HAUA 1NXOA 2IIBA 1SKUA 1KAQA 2QRNA 2TYSB 2VZEA 3LHDA 4OGKA 5DM0A 3DZ7B 1ZGJA 1G38A 2JVJA 3S1LA 5KDOA 2C2GA 2YS7A 3M6IA 3PB3A 3BBLA 5F1YA 4EYSA 4AZVA 1M5TA 3GBVA 2QBYB 3IVRA 4ZVVA 1CF2O 1CUEA 1YIAA 2PBLA 3LPMA 4I6EA 4TT8A 1DMSA 3E3MA 1V7CA 5K3DA 1U0EA 2GH1A 1Z22A 2XUHA 2QTGA 2WSBA 3AI3A 1CPYA 3T5CA 4WMLA 4JVNA 3JQGB 4DQDA 5JQGA 3LLUA 5KYGA 3IEMA 1Y6GA 2A9VA 2E89A 3LOQA 5EP1A 5KWEA 4TYNA 3CB2A 2XUFA 3Q0EA 2IE8A 4DG9A 2I8CA 5J4YA 4BC1A 3E7WA 3QKUA 3WRXC 3ZZUA 1XCOA 1R9NA 3JY6A 2Q9BA 2ZK7A 3MLBA 4CLOB 1V7PC 2OBMA 1Z13A 4HUQB 4DR7B 4EX6A 2PBRA 4FFDA 4NZNA 5DBEX 5I45A 3SVLA 4D0LB 5HIKA 4QQRA 1Q11A 1U2RA 2J67A 2LDXA 3WIDA 4NTZA 5FR2A 3HC7A 2AG0A 5SZIA 3KSBC 1UJ6A 4ND4A 3E2IA 4EYQA 3WISA 1T6XA 5I47A 2GM3A 3PLNA 1MB9A 2BH9A 2H2IA 1CNFA 3GUVA 3UHFA 1Q15A 1WV1A 3EMBA 3GK3A 3AHCA 4L85A 1U2TA 2BSAA 3P7MA 4ZAWA 1KI6B 3PSAA 4FFWA 2EWWA 4N8SA 4MRVA 3C7KA 4Y3UA 4GPBA 3CZAA 4KXNA 4OI1A 1MO5A 1SPXA 2WFLA 2B5WA 1CSEE 2H4FA 3EWNA 5E9QA 3LZDA 1LNQA 3DD5A 1KY3A 4PVDA 1XAGA 2XVAA 3ZHZA 4C6RA 3LX8A 3ZJTA 1RWXA 1Y80A 3DV2A 1S3FA 1XFAA 1RACA 3NO4A 3OEED 5L6MB 1E8DA 1TTPB 2G9VA 1E8NA 4O4HB 4OTZA 1NQOA 2QIOA 1AG9A 4KYVA 4BNFA 1IWPB 5KO2A 4INJA 4CVNA 5JUWA 1RBZA 1CYEA 5EINA 2OD9A 3RT9A 3IEVA 3WSWA 2IT1A 3IJPA 4NCJA 1GG2A 3U6KA 3T4EA 3TVDA 4F2WA 1QCYA 4ND5A 2G88A 2EX0A 4ZVSA 3K0FA 1Y7IA 3ZWOA 4EUSA 2P91A 2EQAA 4NPHA 1ZS9A 1LS6A 2ENWA 5JZSA 3W05A 3LLSA 1UMBA 1M5UA 4DY6A 4MWGA 2P6RA 2ASEA 3WSTA 1M8PA 4LJ6A 2PBZA 5IYZF 2ORIA 4HDMB 4C6HA 1SELA 2FWNA 4Y1RB 1AQJA 4NU0A 5AHOA 4CL3A 1A77A 2R1VA 5CDTA 2H59A 4G5OA 2OXCA 3IAM6 3QNUA 3R2JA 4EJFA 5AXCA 2FLKA 2YCBA 4R41A 2SKCA 3C3BA 4QLOA 3E61A 5B1YA 5L3SB 2R8XA 3EIXA 3G2OA 4OF4A 4ZCRA 2N75A 4CEHA 4MUGA 1WUKS 4MLDA 1XKXA 1GSOA 5IH7A 1CF4A 4NEHB 3BDVA 3B6ZA 1HWYA 4UM8B 3PHGA 1WZNA 2J9GA 3HR7A 3W9UA 1XNJA 4QYWA 1AXRA 1BC5A 1J9EA 4MWTA 3ZH2A 2EKDA 3SIPA 1YR9A 2E4AA 2GYVA 4OUDA 3UT5B 1GVNB 1EFCA 2CZQA 3DMRA 3O4IA 3H9EO 2IPMA 2LD4A 3SVZA 5IRCD 3STHA 3ZWWA 2VAVA 5IJ9B 1TKAA 3IQHX 1H93A 2IXBA 1TM2A 1TYCA 4AJHA 3CC8A 3OQVA 4A2PA 3ZNOA 1CJMA 3KWMA 1Z0KA 1I36A 4HS9A 1PU2A 1ZI6A 1ZA1A 4P4SB 4AXBA 1FW6A 4N7JA 4QUIA 5DYGA 2JFYA 1I01A 1I51A 3H11B 3JQFA 3M81A 3OU6A 4XWWA 2ODTX 2ZSDA 3PFWO 4LBZA 2XTNA 3U61B 2PTGA 1GNPA 2ZRIA 2FPOA 3C3MA 3LDGA 3F78A 4XCXA 4EKEA 3UA3A 1I5OA 4TLCA 4P3PA 5JZ9A 2B2NA 1RM0A 2XODA 3LP8A 1HMYA 1A9SA 1VPLA 4X00A 5HCNA 3GFSA 2NUTA 4FT4A 4DV3B 3VDNB 3D02A 4BVHA 5A9SB 3A4NA 4RZIA 4DRZA 2PUEA 3MD9A 5E7IA 3MVEA 3L3BA 2EFEB 1E1YA 4AO7A 4ZI7F 3UHAA 1DWOA 3LM8A 1AU9A 4HRXA 3UMRA 1QIHA 1Y5MA 1YDFA 2QDXA 4ENSA 5BXYA 3V7WA 1WCXA 4U7TB 1EGHA 2N42A 5JNVA 4JFRA 3GGOA 2M6RA 2WWXA 2D5LA 4B8WA 5B57C 2ID7A 2VJOA 2FOIA 3UFXB 1Q57A 2IH4A 2IXEA 2WQZA 3CRRA 3I2KA 3N39C 4WZAA 4D9MA 4QTYA 2VDPB 4JQZA 2XQGA 4QFCA 1EESA 1E98A 4DCJA 3DE6X 4B73A 5BN4B 1KF0A 3U3XA 1K06A 5J5AA 2JAUA 3Q11A 2EFYA 2HBZA 3PEFA 4KQ9A 1DAOA 2ZZMA 5EXXA 2QSJA 4US1R 3A28A 4B3BA 4IHQA 3R9XB 5C31A 3PRYA 3NVMB 2RC6A 1YS7A 1CWUA 3O2SB 5EKDA 2A84A 3OUZA 2X22A 3G0CA 1ZUHA 3I34X 4YQFA 3B1KA 1XZEA 4BO3A 4YYEA 1JV2B 1XNHA 1Y5IA 3C1AA 3UJDA 1XDSA 1E0SA 4I2VA 5CGQB 1D2MA 2GD0A 2FV8A 1O08A 2OUIA 2ZRNA 2HLNA 3A37A 3O95A 4CT0A 3L4JA 1SUIA 4Q12A 1UMCB 1ZJ4A 3OD5A 1IMOA 3BD9A 4S1TA 3A6PC 1MGOA 1T4GA 4C01A 1AMOA 3MPUA 3TZQA 1BN7A 5F2NA 4YJ3A 3HR8A 4XB1A 2C61A 1DAEA 4RELA 3T3NA 2DX7A 2HYIC 1FTQA 4LE1A 1EDDA 4R98A 1XCBA 2FW9A 3FFAA 1F2TA 1W6RA 1VG9B 3INYA 3JAKB 3A14A 4ZK2A 2XYHA 1OAKA 4IIDA 4L5JA 3CF2A 5A5VA 1T5TA 3I42A 4E88A 4F71A 1FLNA 4PWYA 4MV0A 4LA4A 1RRMA 3NIBA 1LGYA 4AO8A 1AKYA 1KY2A 2R2GA 3WGVA 2CHEA 2B5OA 3TW3A 3BHJA 1CZUA 1V1RB 3RKUA 4DLTA 1H4SA 4TMFA 2WTEA 1ILEA 1AQUA 3J81A 3WDKA 4Z3KA 4KP7A 3HUDA 1MNQA 3H7IA 4MDYA 3VYTB 1GA1A 3S1AB 4EUKA 5J23A 1F7VA 4N5DA 4Y8VA 1UIRA 1EHCA 1PJSA 3GT0A 4TV8B 4IDHA 2M1XA 4GT1A 2ZJAA 5E4FA 4AJ2A 3V2UA 2RKWA 1Z5OA 4HP8A 3SJCA 4OQPA 3GX1A 3WJ7A 1JI0A 5K0SA 2N1MA 1XTJA 3KJXA 2XZLA 4OU5A 4RZXA 4OHUA 3P97A 4M0PA 4D81A 2FFBA 5FBLB 2WK1A 1HNWB 4FT2A 3W3AD 2CNLA 4J4HA 2QPLA 3HJHA 2NW6A 3AP1A 4OGFA 1G2IA 1E5VA 5FFMA 1W36B 4WCDA 2RBKA 2V7VA 4G5GA 5KQMA 2CV1A 1KMQA 1T9HA 3EVTA 4I4TB 1K88A 4X3OA 4Z1MD 3BS4A 1V4NA 4Z7NB 5DLYA 2R751 2EZ8A 2PZ8A 1BXGA 1GU0A 1K6XA 5LZ5A 5JZVA 3QYPA 4YRTA 4GWKA 5KKNB 3R7AA 1JHRA 1NJ6A 3WLLA 3L6DA 3KKKA 1QHIA 5A3QA 2C4KA 2YWXA 1EH5A 3IP5A 2MINB 3IEXA 3FZEA 1PO7A 4G85A 5B3AA 2IXAA 2OWEA 3A9RA 3QRWA 4L15A 3AK4A 1GAQA 3D6JA 4WWHA 4OFXA 4B79A 3L06A 1VCNA 3PUYA 4IX1A 5TMBA 2ACEA 1XF1A 3R3JA 2WW8A 2NT3A 4MUFA 3VZDA 2J33A 1PFUA 1R10A 1T5IA 2IY9A 3I2FA 1PQ4A 2CB9A 4UATA 3ZPXA 4BNUA 4X66B 4JUFA 1SXPA 2PKXA 3T9BA 3NFRA 4S24A 1S5PA 1NFFA 2PGOA 1ISSA 1Y3DE 3QU4A 4K6OA 4LVNA 2DQKA 2FOXA 2GLTA 5H8WA 1KJWA 4A4DA 3CURA 3GB9A 4RLFA 5J40A 1DO0A 3V9AA 1B8PA 1DLJA 1X7WA 4LZAA 4QG7A 4ETIA 2J3DA 4LBWA 4X0EA 2VKQA 2BAGA 1GQRA 3K9NA 3M4NA 1NR1A 2YZMA 2D8MA 3WXBA 1Z5PA 3KJGA 5KX5F 2ZRDA 3I04A 3DZ4B 4W5RA 1J25A 4XAQA 1JG6A 3LT2A 3WBFA 3GIDA 3NHKA 3F9IA 4CM3A 2DHQA 3HJBA 1FB5A 1GUYA 4PHGA 4ZCMA 1QJCA 2XVMA 5FAKA 4AX4A 4IFBA 4QE3A 4MIEA 2ZRBA 4MWBA 2RH4A 1SULA 3HYNA 4TMVA 2V5AA 3FWYA 4Q1VA 5CB0A 4ZYYA 1QIGA 2H4HA 1GEEA 4ESOA 3GVXA 4Q18A 1ZCAA 1D1PA 3B53X 3I61A 3ZQJA 1DOAA 2A58A 1RAAA 1V5EA 2HD4A 1JHPA 4GR4A 4BQSA 4R2MA 3AX6A 4N6OA 4WJLA 3DEIA 2JFVA 3DAPA 1JUDA 1U0RA 3S6JA 3SX4A 1L5FA 2CMHA 1BCRB 4UHDA 2Y9PB 1QKKA 3UW3A 1W4AA 3I4LA 4HATA 1T9GR 4RA9A 5KNLA 5JT1A 2Z9DA 1BW9A 2GXQA 2QMEA 3G5MA 4Q82A 2BH2A 1WVMA 4ZQHA 1L8XA 3PKJA 3EG9A 2VYVA 2HUPA 4ZI3A 1JPUA 3K16A 4BQOA 4RTSA 3QF4B 2GFIA 1J42A 2HXSA 4ASUD 4CCAA 3FROA 3GNQA 5TLSA 1CULC 3OICA 2AIRA 4LXIA 3WK7A 2XNSA 4UU8A 2PFGA 3E18A 1C4WA 4ND8B 1UBNA 4DDVA 3GEIA 2VT6A 1NHWA 1YHZA 4PHHA 1HNNA 5B4VA 3SEZA 5K3OA 1PWHA 2G71A 1U1GA 3FDIA 4S3MA 1OY1A 3AT1A 4EA8A 2FR1A 4NZMA 5JCOA 2ZUFA 2IBMA 3BSSA 4HAZA 1GKLA 5COAA 5JJLA 4D0NA 1WM1A 2B35A 4IXWA 1D03A 3EFOB 5HX7A 5C80A 4C6SA 1EHYA 2DHDA 2O3QA 3R20A 4OHBA 1Z7BA 2PLWA 4DNOA 2VXYA 3L0SA 4ES6A 2I1LA 1Q0UA 2YIMA 4OHPA 4BFXA 5T73A 4XQ9A 1UZNA 4J0CA 4EMTA 3O21A 3ETDA 2XTJA 3Q9LA 2O5VA 5EWJB 1HE4A 2BEWB 3SFTA 2GN0A 4C0JA 2QD3A 4KDFA 1NG9A 2J3EA 1VPDA 2AFIB 2GXSA 2XDQA 2GK7A 2Y68A 4HGZA 4LOJA 2XB8A 3GDHA 4DCVA 1K2VN 1USGA 1CR6A 1V8PA 3BXPA 1RLOA 3CH4B 3VO1A 4XA8A 3NNDA 1TAQA 3V00A 4F38A 5FUMA 3CRZA 3VKUA 1GNRA 1C4KA 4M1MA 5FBZA 4B71A 3UAZA 3VHQA 5BSVA 8ABPA 3FGNA 2WKSA 1XQVA 1EWVA 2J9YB 4HYTA 4Q3BA 2Q2WA 3HMKA 4YJ3F 2PYZA 2PD6A 1ZG3A 1NM5A 4M1OA 4MWZA 3WWPA 3L6OO 4EY3A 2QQGA 5KYTA 1KEUA 1F4PA 1PGQA 1RWMA 3L7BA 2PR2A 4PO9A 4RJJA 5D85A 3O8LA 1JHXA 3SQOA 1JECA 4UAUA 1QF9A 1J99A 2BCGY 4TKUA 1N2JA 3KYDB 4RLQA 4IDNA 1XZNA 4G8DA 3H65A 4KQ1A 5PGMA 3BOSA 5FOWA 2PS9A 1TXGA 3HXKA 2XUGA 3WGNA 3M34A 3VNVA 4Z4CA 3DTVA 4C4SA 3C8ZA 4HADA 5IBRA 4C7BA 4F45A 3I6MA 4PHCA 4D7AA 4EB6A 3U4MA 3CIOA 1DINA 1KO8A 2DG2A 1I3MA 3OJOA 3AJ8A 1V0JA 2YMLA 3W2FA 1DTEA 3RIGA 3JW8A 2QN3A 1JKFA 1AHIA 2KQUA 2A5JA 1OSNA 2YBEA 3BGWA 3BX1A 2ZVJA 3LWZA 4HTAA 4KB5A 3RIXA 1EQUA 3HA5A 5F9FA 2HMYB 3E5HA 5AHRA 5DX1A 2HO5A 3G1TA 1KS9A 2Y1XA 3IAFA 4ND3A 1YJBA 4QNMA 1JPNA 4WESB 5DCLA 5TGZA 4RMHA 2V4UA 1D1SA 1G9TA 2NYAA 2OCKA 3BIJA 3DG9A 3MXTA 3BGOS 3OJEA 1T5SA 4IS2A 5HS6A 4YT8A 1H6AA 1E79A 1L7MA 5HYVA 5EIXA 2C2HA 3AZQA 3UGJA 3EB9A 2Q5HA 3ABRB 1S2LA 4EL0A 5KOJA 3PWKA 3K4PA 1LX7A 1NT4A 1WABA 1RJGA 2I6XA 1HH4A 5ILQA 2HZBA 5FD8A 2J0SA 3IX7A 1UEXC 1ORDA 3CRMA 1G0NA 5TQJA 2ZJ1A 4WFQA 4YN3A 2IOHA 4FMDF 2W22A 2QRLA 3CNQS 1ZU5A 1Z28A 3LCMA 1D8TA 5JQGF 4DR1B 2O2SA 2B8TA 3KZXA 1JYEA 2IITA 3AXSA 3SP1A 1MV8A 2KPOA 5J43A 1KAEA 3SG0A 1ZIXA 1QOPB 1QHYA 3BWXA 4R40A 5JG7A 1ECLA 2EG9A 3U4IA 3T9CA 1KAHA 3TJRA 1CRLA 1SXJE 1V5IA 3OO0A 3QG5A 4Y2QA 2H52A 2FTKE 2I2FA 3F73A 1H4VB 4UZSA 5JADA 3O1IC 4KOAA 3HNPA 2P4SA 3DKRA 2QLMA 4QRIA 1DJPA 3OFSA 5I8PA 5DGCA 5TEVA 2O8EB 4HFMA 3TZCA 4DPKA 3A32A 4AZWA 4COKA 1ZK4A 1NRJB 3BB1A 5J9FA 4RVNA 5P21A 3URMA 3Q2IA 1XLTC 1L5SA 2VZLA 3I2IA 3JYNA 4MW9A 3H1PA 1RZRD 3L4SO 3CZRA 2HK8A 4FB5A 1RR6A 4MWOA 2WWWA 1V1MB 1Z6GA 3TQSA 2Y8EA 3FMGA 3C48A 4EFLA 1VLMA 2G4CA 4O6VA 4KH1A 1L4HA 1WB6A 1N2XA 1F38A 1K63A 3EUFA 4IRUB 3H04A 1CBUA 3D8NA 5HS4A 5JJCA 1XTQA 1F6WA 1VL1A 4DXHA 2X8AA 3N2NA 3P9KA 2ZM5A 1L1QA 1Y3CE 3MAAC 3NPMA 1DAFA 5DDIP 4LQ4A 3VKFA 3NCTA 1BWPA 4X1KA 5LKAA 3HGTA 2ZRPA 4DLZA 1P29A 1MAWA 2E4YA 2X1HA 3ICPA 3R6WA 1QH9A 4UXIA 3ZTYA 1GEGA 3R7NA 4KXMA 2OMEA 4GMFA 2GN6A 3SYTA 4F56A 5I9MA 2MYUA 3ELWA 3PXDA 1GAJA 3VOTA 1M2EA 1AXGA 3KYJB 3R0XA 1P2VA 4RFLA 4YP5A 3C4QA 2NX2A 1J5PA 4EJ0A 1VGQA 4QBIA 1M6YA 2JAQA 3NC1C 3M9LA 4NPCA 1IK6A 1K6MA 2C5SA 3VAAA 3W4JA 1WY5A 2LCFA 1VXOA 2D5BA 2WIBA 2YWFA 1ZRMA 4ND1A 5ECDA 2P2NA 5ALDA 1T2AA 2SNIE 2B1RA 3PA6A 3PPWA 2H9AA 4PZLA 1UADA 5CFZA 1PR3A 2NQ2C 2I4OA 3NDIA 4YPVA 1VL6A 2VC2B 3EAGA 5DBGA 3D4LA 3NJRA 3OKAA 1XZFA 2MTBA 4EHIA 2GD1O 1X7YB 4KDRA 5CEFA 5SYMA 2EF0A 3GQVA 2R1ZA 2FEPA 2P65A 5F3RA 2QVGA 3GDWA 4B6PA 3P0RA 5EGNA 4KHPB 4DADA 4D9CA 1OLXB 3TRHA 3PFGA 4G84A 4OAQA 1IM2A 1MTOA 2A0YA 4KQWA 3NEAA 5IJXA 3PUIA 1FLAA 3WNCA 1D0VA 3P1JA 2HA2A 4LWZA 4MA0A 5I7VA 2PV7A 1CUYA 2H1CA 2Z0MA 3G8BA 1JLLB 1RAEA 2A3NA 3G13A 4TUYB 3FWHA 2G08A 1LRJA 3U7QB 4PX2A 4CM5A 4EG8A 4UPEA 3LBIA 5K01A 1EP2B 3CO5A 1T1GA 2YZ2A 2EWVA 1P5RA 3SQLA 3W5CA 3NWPA 2FMUA 3FFBA 2X0DA 4LVOA 3KC2A 3JWHA 3R0IA 5AVYA 3UIEA 3MBIA 3IC5A 2HQRA 4DV5B 3PXEA 1SHJA 2GR9A 5JCOC 3ITDA 1T9AA 1U3DA 1I14A 1X1BA 1AKUA 5DWDA 3L8DA 3Q72A 3T3IA 2NPOA 3CUEF 4RXUA 1C7IA 5DJ5A 1H85A 1AC5A 3IKVA 2YV4A 3HCDA 4FGWA 4QDOA 2X5XA 1ZVKA 3LD9A 3WGQA 1QZXA 5IU6A 3ET4A 2J0EA 4FWBA 4PYKA 3X3HA 5DLEA 4RNCA 4FHGA 1NBME 1YAJA 3MHTA 3PI6A 4BWGA 2AEEA 1KI2A 2VXOA 5FI0B 1J6UA 4UCWA 3E7PA 2AKYA 3ET5A 1U31A 1E4OA 4BNYA 1UPAA 2P9GA 5EGSA 2ODNA 4QUKA 1L3BA 3NX4A 3MUEA 2BMDA 2XUKA 4UUAA 5FTJA 2ZWIA 4OFWA 1CG6A 4OXIA 3RS4A 1P44A 1LY1A 1L7PA 2FDRA 1PFWA 1Y81A 4C3ZA 2I91A 3HS3A 5JC8A 5ILOA 4UBOA 1Z0DA 3VSCA 1YRAA 2V6FA 2EBHX 1FNNA 4GOOD 4CN8A 5JEDA 5KS2A 2AR7A 5B5SA 4QQFA 5HTOA 1AK9A 3LF2A 3T95A 3EPLA 2NPFA 2Q0XA 1I33A 1W35A 3BSFA 1K9VF 4IVQA 4LHXA 1FFBA 3Q7TA 2NNLD 3G2KA 4JLKA 1OI2A 1LI4A 4OXNA 3DAGA 1U0BB 2ILTA 1ES9A 2WZQA 2JLUA 2PMFA 4R8LA 2Y1OA 2BUBA 3GEPA 5IF3A 4W6ZA 1AV6A 2UYGA 2W90A 1I6WA 3KUDA 2WVGA 4HTFA 4X8LA 4ZEWA 5J2UA 2O19A 4BE9A 1V6CA 5G40A 4BNKA 1EIZA 3COZA 4ZDJA 3BL8A 2JLCA 5EFZA 4RDXA 1PGJA 2H7YA 4YCSA 3BGSA 3H4VA 4GOMD 2NTYC 2PANA 3N5CA 1BOOA 1Z16A 4UNSA 2O8BB 1ATZA 5DNDA 3KYDA 1BEUB 2ON6A 1Y1RA 3CLHA 5CDFE 3HG7A 4A15A 2HW8A 3RYCA 1T26A 2NWQA 4I4TF 4NNPA 1AB6A 2EGHA 3EJWA 4TSFD 1C7FA 5G2OA 3RVSA 4BIIA 3K9GA 2IU0A 4F06A 3W7VA 5KNDD 4MR7A 2Z30A 3SM9A 3GFPA 1F1JA 2GUGA 4BN4A 4G5HA 2VYCA 3EF0A 3L0PA 1TUEA 4Q48A 1ZIOA 1KI4A 4JUCA 4TXMA 1TTQB 2W6JA 3AKYA 4D3FA 5JJIA 1G5QA 2XNKA 5BPHA 2LRHA 5CU7A 4GSLA 1BKDR 3FYCA 3JWPA 5FDFA 3K73O 2W6JD 4IUYA 4W1RA 4HWTA 1V8FA 5C37A 3E81A 1M6NA 1J70A 4NK5A 1BFDA 1WHSA 1PZFA 1J1IA 5K6AA 1DC6A 1RW4A 1LBIA 4KKXB 5BR7A 5E4YA 1B0PA 3DUWA 3L7DA 4B09A 4P8RA 4K2AA 1KZ9A 3WJAA 1VB3A 4CDMA 5HIMA 5IXYA 3LZCA 1UDWA 4P5DA 4RTRA 2J85A 2Q22A 2WG1A 4NMLA 4Z0PA 3T5PA 3A2LA 1RFLA 5CIWA 4DGQA 4LY3A 3AI2A 1MT0A 1VP3A 2P9YA 4U0KA 1A27A 2ATXA 4KVAA 2F8LA 2NT4A 4YV1A 5ICSA 1USUA 3LPCA 1D6JA 1JQJC 3N0VA 5EZ5A 3STYA 3TMKA 3SOZA 3C6YA 4M88A 4L6CA 4XDHA 1ZXLA 4FQ8A 1I80A 2HH9A 2PAAA 2X4DA 3N2LA 3MA0A 1EJBA 4BP3A 4EKIA 2D2IA 4YMUA 1E62A 1DQSA 5IT9A 1FTYA 1O5TA 1U3CA 2HMAA 4QGAA 5KX5B 1WZ2A 1UFVA 4PO3X 4PYLA 4QXOA 4RUKA 3EC2A 3BXOA 3ER6A 3LQ4A 4G4SO 4JYAB 2FG5A 4K6KA 1VM6A 3OM0A 3QYFA 5HJ7A 1A96A 5IM4F 4BU0A 4BKMA 1Z73A 1G7CA 2PKYX 2QAGA 1HDOA 3L40A 1W2GA 3S1AA 4ESHA 3JQDA 2JJQA 3N7UA 1MOSA 2Z2KA 4J7UA 4CF6A 5HZMA 1JXOA 1WEHA 2H4XA 5ALUA 5KDLA 5K09A 4J6EA 2NVUB 1ORWA 2CW5A 2DUMA 4BNDA 3UWPA 1YA4A 2W2LA 4NBTA 4QTTB 2BONA 4EY8A 2JRCA 2IEGA 3WWEA 3X2FA 3G49A 1HO3A 3U5ZB 1ZH6A 4HK4A 2REXB 1XVVA 2JB9A 2XF8A 3CX6A 1TB4A 1L2TA 3HJNA 3Q1KA 3RF7A 4RM2A 2Q3CA 4N8DA 1R9JA 6PFKA 1K7XB 2XLBA 1AGRA 2ONYA 2HTEA 5HF6A 4JBIA 2HUNA 4O4IF 4RABA 3K9WA 2C3MA 3FBTA 4Q4HB 1LDGA 3UANA 3SX2A 4TKZA 3TTXA 4YJ2A 2XDYA 4ZIRB 1JHQA 4IBOA 1R3DA 3U31A 2BFOA 2ZIAA 3FYTA 3ITEA 2OBYA 3PXAA 4HWPA 3VSBA 5BQ3A 4BJ6A 1JPJA 1FX0B 2Q50A 4DSOA 3UJNA 2ZP1A 1YULA 3NIFB 5DYIA