1H6DA

Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
383
structure length
383
Chain Sequence
b'QAATLPAGASQVPTTPAGRPMPYAIRPMPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
publication title Crystal Structures of the Precursor Form of Glucose-Fructose Oxidoreductase from Zymomonas Mobilis and its Complexes with Bound Ligands
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Protein translocation
total genus 126
structure length 383
sequence length 383
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2001-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h6dA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h6dA01
2X5KO 4FFNA 4TZKA 1V6AA 3BZUA 2X0JA 5IDXA 2X86A 5JS6A 1Z82A 4CL8A 3PLNA 4MINA 2NNLD 1DLIA 4BKPA 4JQCA 5DZSA 3W8DA 2PZMA 1WNTA 4ALJA 4PZEA 3LYLA 5JW6A 1VJ1A 3G49A 2HJSA 4G65A 2AQHA 1MB4A 5G0TA 2WE8A 1G0OA 2FSVA 4KOAA 2QRJA 3HE3A 4LRTB 4FB5A 1Y81A 4RPHA 2GASA 3HG7A 2YFHA 2IEDA 1Y1PA 4H7PA 2Q2WA 4RJTA 2BKAA 1E77A 1K5HA 3GNSA 3KRTA 1JKFA 3F1KA 1PZEA 1BSVA 1HLDA 5I7VA 3QVXA 2NTJA 3VVBA 3FTPA 1IZ0A 3ETGA 3FR8A 3JQ7B 1X1EA 5G4KB 3RJ5A 3KHUA 3BYZA 4Q39A 5LCXA 1LDGA 3GNQA 2DVMA 1DRVA 1QG6A 4IBOA 2H1SA 1YJ8A 4Z9XA 4BGEA 3EHEA 4DXHA 4K9DA 2Q1UA 3PK0A 3F4BA 4B4VA 4OQYA 2AEJA 1GR0A 2PR2A 3NRCA 5JLAA 1TLTA 3GMDA 1IB6A 3W4KA 2PFGA 3OIFA 3T7EA 3PIIA 1E7QA 1EK5A 1FK8A 4Q3NA 3RD5A 1OI7A 3PQFA 4E3ZA 5BR7A 1A4UA 1Y7TA 3AM3A 1KIFA 1OBFO 1YS4A 5JC8A 2AA3A 2JFGA 3DBLB 1B3RA 4JK3A 5JAMA 4IJWA 5IDYA 4CLOB 4NFHA 1PJQA 1ZO8A 2OMEA 3AM5A 1U1IA 2AMFA 3A9WA 3VOSA 4RORA 3EGOA 1JAXA 3MWEB 3GVXA 1YBMA 4XEHA 1PJ2A 2O3QA 3GVIA 3I83A 4HFJA 4IJKA 1RJWA 3CTMA 5L51A 1B2LA 1LDEA 3R3SA 3U5TA 5F5NA 7MDHA 4YJHA 1LXCA 3ZN2A 1K6XA 3TL2A 2H6EA 2PD3A 4Q3DA 1YOVB 3T4EA 3OJLA 1C0KA 4BNIA 4F46A 1LBEA 4L4XA 2NM0A 3OP4A 5AYVA 4II2A 3K31A 4FQ8A 1SOWA 1K2WA 1NNUA 1LRJA 4RZIA 4J49A 1R16A 3ZWOA 4E32A 2DTEA 1ONOA 2B5WA 3ASVA 1YB5A 4YWJA 2YV2A 4E5PA 1EVIA 3DAGA 1NFRA 3AUUA 4B4UA 2ZQYA 3DAPA 4R5MA 2VNAA 2VZ8A 1H6BA 3BMNA 4J4BA 3WBBA 2RHRA 3KBOA 1P9LA 1NR7A 1ML3A 2WSBA 1F14A 3I5MA 3WSWA 4EI2A 2IDZA 1PGQA 4IXWA 3VPSA 1Z75A 3ZDFA 3H8VA 1GYPA 4HWKA 2WM3A 1GADO 3ZI0A 3DBRA 1NYTA 1T24A 3F1LA 3C1AA 1HWYA 4M86A 5A04A 3OQBA 4YEDA 2WYVA 4WCFC 3FNGA 4M8SA 3V2UA 1ZCJA 3N58A 4JXKA 1Q1NA 1DOHA 5TSDA 3ZWBA 4HFNA 2NVUA 2O3TA 3PGXA 1EMDA 1EBFA 3DZBA 4O59O 4RO0A 5ENVA 2Q99A 2O2SA 1HF3A 2IE0A 1Z7EA 3AUTA 2X1HA 1ZMTA 1H5QA 1MX3A 4BNXA 1U7TA 2WWRA 3CZMA 2Y1CA 4OKIA 3S8MA 1PTJA 1BDBA 1GUZA 4WJZA 4BNMA 2D8AA 5FYDA 4ZQFA 5B37A 3WGGA 5G0WA 1ARZA 2JFHA 3IMFA 2B0JA 5A5FA 4PZCA 3GC6A 3JQFA 1QYCA 3I9MA 3RI3A 3KUXA 1U4SA 1EFKA 1LLDA 1NTOA 3WDSA 2OO5A 1YRLA 3K5PA 4EEZA 5L4SA 2WMDA 1JTVA 2JD2A 1XG5A 2D1YA 3A1NA 1DAOA 4YRDA 4A26A 4PZDA 1D7OA 1JLLA 4EYEA 2QX7A 3B1KA 2JD1A 1AN9A 3IUPA 1IHXA 3KLMX 1H9AA 2VN8A 2QZZA 3PTZA 4NNJA 5JE8A 3FI9A 4CM6A 3KYCA 1H6DA 4BB5A 1TI7A 2JHGA 4XDYA 4AJNA 1V35A 3U4CA 3WMXA 3OA0A 4EITA 3BMOB 3EZLA 4MOWA 1B8VA 4BVAA 2WEKA 1HETA 4B4OA 1N5DA 3U4IA 4FBGA 5G0SA 3I23A 1P0CA 1X7GA 4HX5A 3DMTC 4E21A 4Y98A 5HS6A 3PJGA 1WAMA 1XELA 3I6IA 4HUJA 1Y8QA 3DQPA 1ISFA 3I9OA 1DXYA 2C2YA 1AUPA 4BO0A 4HFRA 4HNGA 4UULA 1N8KA 4L4SA 3H9UA 1Y9AA 1S6YA 2CF5A 4BNJA 4BNYA 5COAA 1GQYA 2UAGA 3JV7A 5JXWA 4CODB 1LLUA 2PZLA 2G76A 3C7AA 5ENDA 1AE1A 1G1AA 3DEYX 4NIMA 4AG3A 2VWPA 5HBRA 1BW9A 4CM9A 1UP4A 3VPXA 1TT5A 3PJEA 5JYAA 3PZRA 1B8UA 3WFIA 5T67A 3ADOA 4GKBA 1ZK3A 4OAQA 3RU7A 2AE2A 4EDFA 5IF3A 2YFQA 3E9QA 2P9EA 3JQ9A 3LVFO 4GX1A 3FN4A 2AG5A 2VT2A 4YJGA 1C0PA 3ZW9A 5JDCA 3H65A 3R3JA 4UUNA 2BELA 5K0ZA 1C0IA 3HZZA 4MVJA 3NEPX 1V8BA 3GEDA 1DC5A 4XQEA 4L76A 1MA0A 4CM3A 1KVQA 2JL1A 2QHXA 3HB5X 3SC4A 3RU9A 1BRMA 1E3SA 5A9SB 2AQ8A 3CUKA 4FC7A 3ANMA 4A03A 4EJ6A 1NX6A 1AHHA 4RV9A 2VTDA 3SLGA 3GH3A 3LLSA 1AXEA 1C1XB 1ZH8A 4F6CA 1TB4A 3EC7A 4TWRA 2ZTLA 5AXCA 1U8XX 4J2HA 3WQRA 4A5OA 5JPIA 1SBYA 1P1JA 4E30A 2FR1A 5G0VA 1LDNA 3QVTA 3AK4A 4OXYA 4CMGA 4EW6A 3H5RA 2NLOA 4R41A 1ISHA 5TRTA 3RFVA 3TPCA 3ZU2A 4XD2A 4URFA 4XWYA 4A2CA 4CR7A 3MJCA 3FNFA 2P4QA 3WLEA 4J6FA 4YA6A 4NFYA 2VHVA 4ZQBA 4ZN6A 5CEJA 1ZBQA 1ZKMA 1ZJZA 5KWEA 2O48X 2DLDA 1N7GA 4IJVA 1P1HA 1KS9A 3FPCA 3TFQA 4D43A 3F46A 3PZBA 3OEYA 2DUWA 4WEOA 4R69A 5F5LA 5AXBA 2JKVA 5COBA 3HHPA 1A72A 4CQLA 2YQ4A 3BMQB 4FJ2A 2POQX 3AM4A 2CVQA 4CUJA 4DIOA 4YT2A 4LCJA 4QECA 4B3HA 3JQGB 4YAJA 2Z1MA 4IMPA 3H6KA 4TVBA 2Q3EA 4ZRMA 3KV3O 4R3NA 1EDZA 4WLEA 1T2EA 3IP1A 2X0IA 3GVCA 3C7CB 4UREA 2VTEA 5L53A 4Q3CA 4LGVA 2CDAA 3OJOA 3GHHA 4RF5A 3ROKA 1ZEMA 4WOKA 1NHGA 4PLZA 3DHNA 3FWNA 3ZNQA 2BFOA 3PFFA 3ST7A 2C7GA 3FWZA 4DA9A 2NQTA 5EJ2A 1MFZA 4UEKA 4CLRB 3Q11A 4BNLA 2EG9A 3LU1A 5IXYA 4OQZA 4U6QA 4BGUA 1A7KA 3S2IA 3F5QA 1XU7A 4A0SA 3JQAB 3WG9A 1Q7GA 1UUFA 4IY1A 4E6PA 1EDOA 2Q1TA 3HWRA 3IKVA 5DULA 4ZVVA 1LJ8A 4IQ0A 3MJSA 2GN4A 2P9GA 2W98A 3KTDA 1RM4A 4XRGA 3NDJA 3U62A 1DC6A 4U0JA 3IDSA 3KM0A 1LC0A 3ZWYA 4YAGA 3N74A 3ZNOA 1GD1O 3JCZA 5JY1A 4DQUA 1ZZEA 4QUKA 3ZCXA 5KVQA 5B4TA 4IXTA 4RQUA 1EEHA 5A3VA 5JYDA 4BL5A 3NTQA 1V9LA 3S2EA 1H2HA 4WCDA 3OMLA 1UXJA 3Q6IA 3O4RA 4YR9A 2XF8A 3ZWPA 4ZA2A 1I8TA 1M6HA 3KSZO 4GVLA 3GK3A 1WW8A 4ZQEA 2WTBA 3GQVA 2D0IA 4I9NA 2RH4A 2WYUA 1KY4A 1GQQA 1PJTA 4A7PA 2W90A 4MVJM 2PD4A 4KZPA 3FNHA 5I9MA 1ISGA 3O26A 3VHRA 3VDQA 3F4LA 1PS0A 4MVJP 4J9VA 1GTMA 3VKUA 3BHMA 3WMWA 3GR6A 1FDWA 1PJCA 3QWIA 3GT0A 4I1IA 4IS3A 5ILGA 3HQ4O 1A9YA 4YJFA 5DN9A 3UUWA 3PWZA 4FFLA 3HB4X 1VKNA 3UCXA 3OICA 1X15A 2R00C 4KDFA 4NBWA 5BNTA 2I67A 2Q4BA 4OGWA 3RAJA 1LDMA 3SVTA 2FMUA 2GZ2A 3VKVA 4DBVO 4ALIA 4DQXA 3WGHA 4GLOA 1VJTA 4WKGA 4DGSA 3DOOA 5ADHA 1NQ5A 1B16A 1QYXA 5KNLA 4DPMA 3WICA 1VLLA 2IZ0A 5KVCA 3OM9A 4TRNA 3U4HA 4BKRA 3I9KA 4XZ3A 3ANNA 3RBZA 5GZ6A 1C1DA 4IM7A 2A9FA 1L1FA 1X1TA 3GUCA 1I3LA 3H7AA 3PHHA 4OXNA 3GN2A 1BXZA 4CMKA 1T2CA 4UUMA 3O8QA 4R1NA 4Q9NA 2X5OA 1Y8RB 2VWQA 2NTVA 1KBZA 4BO9A 2VHWA 1DIBA 1TVEA 4LSMA 1ISMA 4XYBA 3IKTA 3S2FA 1E3WA 5B4UA 1Y9EA 5A03A 1RM5A 3E82A 2FHSA 2Q1SA 1YWGO 4HNHA 4P4NA 3WSVA 7ADHA 3AW9A 4Q3AA 2F00A 4CMIA 1LSOA 2YDXA 3NGLA 3ZV4A 5G2OA 1NQOA 1UDBA 2PZKA 3LK7A 1I3NA 1DFIA 1LRKA 2BI8A 4P22A 2HRBA 4AJPA 4C7JA 3DZFA 4BO5A 3LZ6A 5A9TA 4OM8A 3GVPA 1X7HA 3E5RA 4JBHA 1V3TA 4LK3A 3SJ7A 4TZTA 3DBHA 4CUKA 2VYNA 1UP7A 4EBFA 2R2GA 1VM6A 1E7YA 2YHUA 1FJHA 2DFVA 1XU9A 1DIAA 4IDEA 5HRUA 2PWZA 1PJBA 1NFFA 3OA2A 3HDQA 4JROA 3ZV3A 2J5QA 3QA9A 5TJ9A 1F0YA 3ZH2A 1O0SA 2BI7A 4XYMA 2X9VA 5FF9A 5IN4A 4WNIA 1G0NA 1C0LA 1ONPA 3R0IA 4QSMA 2B83A 4GGOA 1DIRA 4YB8A 1OFGA 3TFOA 1K6JA 5CHEA 1EBUA 3OIGA 4XR9A 1DRUA 3QLJA 3C85A 1Z7BA 3SXPA 5IZ4A 2VRBA 2I6TA 2EIHA 1Y5RA 3OIDA 2NADA 3ICCA 5TNXA 4FS3A 2P5UA 1PS8A 3WYCA 1ZK2A 2D59A 3ITDA 3L77A 5JYFA 4M87A 2CD9A 1ULUA 5JO9A 4DVJA 3X2FA 3ADPA 1NVMB 3ENKA 3H5NA 4IIUA 3DFUA 5L40A 4ID9A 1XGKA 3KXDA 3NDRA 4J4TA 4WPGA 3B6ZA 3PDJA 2ZATA 1NPDA 1ZSYA 3W4IA 2Y1OA 3C24A 4BNTA 3AFNA 3HDYA 3TL3A 4BV8A 1UH5A 4CPDA 2X4GA 4PLTA 3DMYA 1R0LA 3ZWVA 2OL4A 2E6UX 1EVJA 1UDAA 3E8XA 4FSHA 3RFTA 4PRLA 3JTMA 3GDFA 4RPGA 4IPTA 4R68A 3UCEA 5CG1A 1CQIA 3MOGA 4J0FA 4ZD6A 4R51A 3DZKA 3I1JA 2V7PA 2QRKA 2CY0A 3RQSA 4RF4A 1A71A 3UKOA 4GMGA 5LC1A 2AXQA 3JD3A 2PY6A 2R6JA 3KO8A 5JYEA 5L4LA 4O6VA 3G1UA 2DTXA 1OOEA 4K1LA 2QW8A 4U7WA 4D0RA 2FR8A 4IQ8A 3BAZA 2H9IA 1QXSA 1KVUA 5L9AA 4YAKA 4BO6A 1ADCA 4KDEA 3LC7O 4RDIA 1K6IA 4MVJD 3KOUA 1T1RA 1LTHR 4I5EA 4KP7A 4BQPA 1WMAA 2GYYA 4WCFA 1HYHA 4E5MA 3GVHA 1PSDA 3TZCA 2G17A 1BWSA 1XWFA 4R1SA 4XB1A 3DL2A 3WGTA 4I9UA 1YQDA 2EXXA 5GY7A 2FRDA 2EP5A 3CINA 5JNLA 5A05A 2BD0A 2GGSA 1LEHA 1J4AA 1BTOA 1L7EA 1ZXBA 1VL0A 3BA1A 4JBGA 4KTVE 3QW2A 3PIDA 2CUKA 3GZNA 1PZGA 1SCUA 1T25A 1YH3A 3OETA 4NK5A 5EQDA 3E9MA 1T2AA 2OP0A 1B26A 2TMGA 4CMEA 2RHCA 3WYBA 1ENOA 2QRLA 1JN0A 1KC1A 4JJFA 4NH4A 1XSEA 2Y93A 1HDCA 1SZJG 1YB4A 5U9CA 3BTUA 2OGUA 3EDMA 5L7YA 4YAEA 4CMAA 4CM4A 1OMOA 4ND2A 4BMSA 2EERA 1QV6A 5AXDA 2GNAA 4OO3A 4W7IA 1BMDA 4MVJG 3MTGA 1F8GA 1P1FA 4MP8A 4XX0A 2C5EA 1YL5A 4JCOA 2RCYA 2YY7A 3AOEA 4FIZA 4BKQA 1BVRA 1GY8A 3ETDA 4TROA 3DHEA 5KJ6A 1IUKA 3PPIA 3GRKA 3COSA 1U28A 2Z95A 4FOSA 1HTBA 2HJRA 4IINA 1XIVA 4KQWA 1PWXA 1HE3A 4NR0A 1R6DA 4MKZA 3RUEA 2RAFA 2BH9A 4GWKA 2B4TO 2O4UX 1XR3A 4YPOA 3DAFA 4J90A 5JAIA 2YZ7A 1IYZA 3ZU5A 1HT0A 2P2SA 5JMWA 1UAYA 3DMTA 3I9NA 5FI3A 1OC4A 4PG6A 3ITKA 1N9GA 2Y1EA 4LSWA 3WJ7A 1CDOA 9LDTA 3KEQA 4M89A 3QWBA 3PFWO 1M66A 3VZQA 3WFJA 3OQ1A 2ZJ0A 3ICPA 4L9RA 2EV9A 3RROA 3OF2A 2GN8A 4Z0PA 1NP3A 3ZWNA 4PLVA 2DBRA 4CM8A 4BO2A 4GL4A 3Q0EA 3JD0A 1P3DA 3CMCO 4YT5A 3JQ8B 3L6EA 4GAEA 4FN4A 2HMTA 4L0QA 5DCWA 3ROQA 3TSCA 5DBIA 3ZGYA 1HEUA 3F47A 4IGFA 4AL4A 1CQJA 5BSFA 4AJKA 4MKXA 4A10A 4MP3A 1U3VA 3U4DA 1A9ZA 2FSSA 1XQ6A 3ULKA 1RM3A 1O9BA 3ZW8A 3KEOA 1U5AA 1DSSG 2GN9A 5GZ1A 2EJWA 5GMOA 3IQDB 3NUGA 3TZHA 1EUCA 3ASUA 4BUCA 4QT0A 4DTIA 3BMOA 5DT9A 1IPEA 1JU9A 5A5EA 1BXKA 2EW8A 3FD8A 3D5QA 4UAGA 4GVXA 2O3UA 2OFPA 3BMCB 4PG7A 3DZIA 3RKUA 2O7SA 4FFPA 4IQGA 5T64A 4R54A 1NAIA 3JQBC 3FPLA 1F06A 4KUHA 4ZICA 4MDHA 4XA8A 4OYRA 3AY6A 2UYYA 4NI5A 1ZJYA 1ZUD1 2HSDA 3N7UA 4DMLA 3KVOA 4D0SA 1P45A 3K73O 1J0XO 1QLJA 3TZQA 1GDHA 1U3WA 2DC1A 2VRCA 4N5LA 4ZRNA 1KOLA 3RBVA 3U49A 4EEXA 4C4OA 5TJHA 2Q22A 1QMGA 2Q1WA 4JLWA 4EUHA 4L74A 2CVOA 3B70A 2C54A 3K8ZA 3C3XA 1WDMA 2PKQP 2VHXA 1UP6A 3T7CA 4CLEA 1B0AA 3AI1A 3AU8A 5HM8A 2NU7A 4PIVA 1CEQA 2LDBA 2CMDA 3I9LA 4QO7A 3V2GA 3MWDB 3V1TC 4E2WA 2IXBA 2HMWA 2J5KA 1NASA 1PQUA 1PWZA 3AI3A 1UR5A 4IDAA 4RGBA 3V2HA 3W6ZA 5DBGA 1IY8A 2DTDA 1R12A 1RPNA 4PVDA 4YRBA 5L3ZA 1BGVA 2Y1DA 4RDHA 1C1XA 3PQEA 1DHTA 1PQWA 3KYDB 5JDIC 2WJPA 4ND5A 5I7SA 1JWAB 1W8DA 3TQHA 2IYOA 1EZ4A 2P68A 4J7CA 3LF1A 3DDNA 4CMEC 4BO1A 4RL6A 3K2BA 2CSUA 2NV6A 2PTGA 3PVZA 2YQ5A 4JBIA 4Y6RA 3VC7A 1E6WA 2D5CA 3GAZA 1XYGA 1I32A 3JQ6A 3NT4A 3GGGA 3IL2A 3O9ZA 3BHJA 3ZHYA 3WWZA 2HU2A 1H94A 2ZJ1A 1PJ4A 4Y67A 1ZMOA 1PL6A 4ZQGA 4ALNA 4BNUA 5TLSA 3RJ9A 3PHIA 3RFXA 4YT8A 3H2SA 3BMQA 1LDBA 3GGPA 5AOVA 1ISJA 5AVOA 4WGGA 1CYDA 3AOEC 3JQGA 1M67A 3D64A 4J16A 2CFCA 4WLUA 3GEGA 3QSGA 4OIMA 5J9GA 4CQMA 3OECA 2X5JO 3WQSB 4ND4A 3PEFA 4PLYA 4AJHA 3A28A 2CZCA 2E49A 4GWGA 1EVZA 1MFPA 5KOIA 4XIYA 4MVJF 4RVUA 1YO6A 5L95A 1XLTA 1YDEA 3HFSA 1P0FA 1A4IA 5U1PA 2G0TA 1FF9A 1NPTO 1P74A 1F17A 4PCVA 2GZ1A 2X7HA 1DRWA 3CZRA 1D4FA 1VRWA 3RUAA 3W8EA 2Q49A 5FWNA 3HN2A 2J3IA 2WD7B 4ILKA 2OBNA 2IZZA 2O3SA 1DJQA 4QFDA 2OZPA 3VVCA 3MZ0A 2RH8A 3QRWA 4JJIA 1PL8A 5JCJA 1E3EA 5F21A 2VOJA 4U0KA 3JQAA 1I01A 5JMPA 4NBRA 1LQUA 1YXMA 4INAA 5M6DA 2W2KB 3WX0A 4WLOA 3VPGA 2EKPA 3GUYA 1KC3A 5THKA 2RBEA 1QP8A 5GZ3A 2I99A 2QQ5A 1VKOA 2GERA 2FPGA 2OOSA 4MIYA 4CMCA 4FW8A 1R15A 5FFFA 4D41A 3PXXA 4BKOA 2R00A 1BDMA 4QEDA 2XAAA 2ZB7A 3G79A 4JNKA 3JD2A 3MCVA 4GX2A 5IG2A 1MC4A 4BOYA 3ENNA 2EKQA 3DBVO 3WJAA 4D42A 4IZIA 1MXHA 1H0KA 4PG8A 5A02A 1E1NA 4NU5A 3LDHA 3PWKA 5THQA 4DQVA 4DYDA 4ZJUA 1E1LA 3FBGA 2I65A 4RZHA 5KJCA 4FR5A 3KLPX 3DTTA 3DTYA 4Z3DA 4KTTE 4GX0A 3WOHA 4DLAA 2Y99A 5C5IA 1JDJA 2FZWA 4HBGA 1IPFA 2XOXA 1NXQA 5B12A 4NQZA 2NVUB 3K96A 2PH5A 2JJYA 3NGXA 4AJEA 4NDNE 4B7CA 4EUFA 1UXKA 4GMFA 4BV9A 5ICMA 2CDBA 3P2OA 3KSUA 4XGIA 3MJ4A 4YTEA 3P2YA 3ZHXA 3HDJA 4XR4A 1CIVA 2W4QA 4Z9YA 3D1LA 3E03A 2VWHA 3UVEA 5ER6A 1HRDA 1ZK0A 3U0BA 3TNLA 2AW5A 3JYPA 3NJ8A 1IHYA 1H9BA 1M76A 1DIHA 4MVJH 1N7HA 2P4HX 3PJFA 3DHYA 1NVTA 3A4VA 1E0DA 1XHLA 1JWBB 4RVGA 3D3EA 1H6AA 3P19A 1MC5A 4UVIA 1I2ZA 4LW8A 3F9IA 2V6GA 4O0LA 5C7IO 3QVOA 3ZWWA 4DIBA 1K3TA 4BHTA 1DO8A 1T26A 1NHWA 3E9NA 5I8WA 3OSUA 1MUUA 3P7MA 3H4VA 3CPSA 3K2EA 4J2OA 2BLLA 4PVCA 1GZ6A 1QYVA 4UUPA 5IJZA 3VPFA 3BTSA 2FP4A 2WD8A 3L0DA 1Q2XA 3GPIA 3KYCB 3CIFA 1ORRA 2ZCVA 3L6DA 4MPDA 3VPHA 4JIGA 1CJCA 1JQBA 3VH3A 5H82A 4D79A 1DC4A 2UVDA 2BHLA 4OHUA 4P4GA 3RUIA 2NU6A 3PJDA 4D45A 3PDUA 1DLJA 3O03A 2O23A 4BGVA 1FDTA 3JD1A 2Y1FA 1N92A 2Y0EA 4FFOA 4PLWA 4WLFA 4KWIA 4XKJA 3H9GA 1N1EA 1QYWA 3LT2A 4XCVA 4BNWA 3ABIA 4R5HA 5DCUA 1DB3A 3UF0A 4W99A 1YONA 5H81A 5T8KA 5JO0A 1VI2A 1P44A 3G3EA 3LQFA 3S2GA 3RVDA 2C59A 5TX7A 4LVCA 4YDRA 3B1FA 1WP4A 1E1MA 1GU7A 2UDPA 3TF5A 1SO8A 4NHEA 3Q2IA 1OZAA 2GO1A 1TT5B 1VSVA 3EY4A 3U3XA 2HK7A 1QYDA 1GAEO 5CP8A 3Q9UA 1IZ9A 4W6ZA 4IMRA 3WB9A 1E7RA 4DMMA 1HDRA 4W82A 1E3JA 5DF1A 3V1YA 4IS2A 2IYPA 4YJGB 4G5HA 1MLDA 2QIOA 2O50A 5HWSA 1Z45A 2DBVO 1E7WA 2DPGA 1KETA 3AU9A 3FBTA 1ZNQO 1HDYA 1I0ZA 2W2LA 4RPLA 3H2ZA 1N2SA 5G4LA 3MOIA 1DC3A 4W9NC 1SEVA 4XB2A 4CLXA 4II3A 3G17A 3CE6A 4K6FA 1U2DA 1ADFA 1Y6JA 5CG2A 4J1SA 1GUFA 4D3SA 1R4NA 4R1UA 4A73A 2FN7A 5ICSA 1U8FO 3QY9A 4NPCA 3WBFA 2W8ZA 2VOEA 3BXXA 2X9NA 3JQDA 1HDZA 3EVTA 4WE3A 4Y6PA 3SLKA 1MP0A 5I8ZA 5CDUA 1SMKA 4TSKA 3BTVA 1VL8A 3W6UA 1S7CA 4RF2A 4XJSA 1LC3A 4N7RA 4YBZA 1WDKA 4ALKA 1ADGA 4XQGA 5ITVA 1EUZA 4RVSA 1R4MA 3ONFA 2VRCD 1L7DA 3JD4A 3EVNA 4W7HA 2FWMX 3VZSA 4NJOA 4S1VA 4EUEA 4TRJA 5HS4A 1BXGB 1CETA 2H63A 1HYGA 2ZYDA 4OMUA 2HRZA 4N54A 3AWDA 2ZB3A 1ZXLA 1LQTA 3S55A 3AJRA 4HADA 2IEBA 1YVEI 3EK2A 1GCUA 4E5YA 4DPLA 2DQ4A 2WE7A 2X9GA 4RLSA 5FI5A 4I5DA 1KERA 1P1RA 2C07A 3IS3A 1Z6ZA 1B15A 1TT7A 2HCTA 3STHA 1ZK1A 1EQ2A 3M2PA 5JAZA 3FTNA 2B4QA 1T2DA 1WZEA 3IAHA 3DONA 2GDZA 2V6BA 2D4AA 3WNQA 2YV1A 3GGOA 4PN3A 3DOCA 3P5SA 4PG5A 1KEWA 2I3AA 5A06A 4XYLA 3ZWAA 2NU9A 1WVGA 3FR7A 1YL7A 4OOFA 3MEQA 4Z3KA 4H15A 4YVFA 3CSDA 1XA0A 1O94A 2A94A 1I30A 2GUGA 3LF2A 4NZ9A 1HKUA 3DZJA 4BO8A 2Q50A 2OP1A 3Q9NA 4XRRA 4QXMA 3ONDA 1FMCA 4B3JA 1GYRA 4WUVA 2CF6A 2VUTA 3I52A 1P1KA 5BT9A 3E1KA 5DOVA 4F45A 2I5PO 5C7OO 1NQTA 3RUHA 1PGPA 1IE3A 1U4OA 5K6AC 1ONNA 5C3MA 4GH5A 4GQAA 2BRUA 4CQMD 1HSZA 1U5CA 1VSUA 4XYGA 5CEFA 3JQ7A 4BS9A 3HADA 5G4KA 1Z73A 3LT0A 5T57A 3QWAA 4BO4A 1F12A 5T8KC 4FGSA 2VYVA 3H9JA 4XYEA 3K9QO 4D3FA 2HAEA 1P1IA 1T4BA 4YYZA 1KEUA 3HSKA 3AOGA 3KZVA 3INTA 3WR5A 2UV8A 1J6UA 3V5NA 5MDHA 1RKXA 3HNPA 4RVFA 3VAZA 1E3IA 2EJVA 1NFQA 2PGJA 1BVUA 1R0SA 4FDAA 5CAEA 4C7KA 1WDLA 4DL9A 3OJ0A 3E18A 3JQBA 4H3VA 4MIEA 4M49A 4NG5A 3PHLA 3VZPA 4AJIA 4D7AA 2NWQA 1UZNA 2ZYGA 5TS3A 1HE4A 1U2GA 2G5CA 3WTCA 1WLYA 3NDIA 3DBLA 1B3BA 4CJXA 2J6IA 2OORA 3D4PA 3G1TA 5HTOA 2PK3A 4CM9D 1DPGA 4MVJE 3D3WB 3GMSA 3S1LA 4Y8VA 4CLOA 4ALMA 4AICA 1DBVO 3WWYA 3Q3CA 4YT4A 1CF2O 2QYTA 3ZU3A 1FXSA 5G0UA 2ZTMA 3GAFA 2C20A 4PLPA 3UGKA 4EGFA 1NBOA 4FOOA 1GFSA 5EL0A 3R6DA 1SC6A 2HQ1A 2GD1O 1ZVMA 1GCOA 3M6IA 1A5ZA 3V8BA 3M2TA 5F1PA 2ZB8A 2DT5A 4AJOA 3H3JA 2Q46A 4BMNA 1C1DB 3DR3A 1AXGA 1YOVA 4GI2A 3BMCA 3NYWA 5L7TA 3AFMA 4E33A 4CV1A 3ZV6A 4E5KA 5JC1A 4J1NA 3PYMA 1I5RA 4NBVA 2E48A 4DC1A 1E92A 3WS7A 3GFGA 5JDIA 2V6MA 1YBAA 3OQ6A 1X14A 3PI7A 5CDGA 4PG4A 2Q4EA 1JA9A 3JYOA 3LSYA 1LLCA 1KVRA 4CMJA 3ANLA 4DYVA 9LDBA 5B4VA 4JJGA 4UVHA 4K28A 3UOGA 4YRAA 4CMIB 1PR3A 2PLAA 2A35A 3VDRA 1PGJA 3BTOA 4A27A 2PKRA 3ROMA 3D7LA 1YBVA 3WTBA 3MJEA 4RVHA 3DBHB 1OAAA 2FY8A 5IDWA 3OBBA 5TF4A 1J5PA 1B8PA 1EQUA 4WLVA 5EN4A 3NAQA 2C2XA 1HYEA 3VH1A 3VH4A 4FPXA 5MGBA 2PA3A 3JQCA 5KCZA 3PYLA 4PLCA 3GEMA 1OC2A 3C7DB 4LN1A 4XJTA 4Z0TA 3R1IA 3K30A 3SBOA 1BG6A 5KVSA 2D3TA 3DFZA 2P5YA 3KYDA 1NWHA 4BIIA 4Z6KA 2J3HA 3E48A 3IJRA 2JFFA 3GNTA 3ZHZA 1O6ZA 2YUTA 1JW9B 1T1SA 5JFOA 3U09A 3W1VA 2BGMA 3U9LA 2VCYA 1EE2A 3C1TA 4E2YA 3HUDA 4R1TA 3RUCA 4P8RA 2GN6A 4YXFA 5AXAA 4NJMB 2C82A 4CLDA 1B14A 1PGNA 1X13A 4OXKA 1ZFNA 4LMRA 3B1JA 4JP3A 4U6SA 2G1UA 3UXYA 3CKYA 4GSLA 4BNFA 3KB6A 2BGLA 4X54A 3KSDO 3TRIA 5IN5A 4DBZA 1LU9A 3TZ6A 2HUNA 4UUOA 2HK9A 4CV3A 2X8LA 4RF3A 1YL6A 3JQEA 1W6UA 5I9NA 4B8ZA 2AEFA 2GR9A 5LDHA 2EGGA 2DUUA 1DAPA 2G82A 1LSUA 3PQDA 3SX2A 1PZFA 4J3FA 1WXDA 2VUUA 3RCBA 1M75A 1VJ0A 1LI4A 4BNNA 4CV0A 1E7SA 1GUYA 2EWMA 3FSRA 1YQXA 4XIJA 1HDXA 4PRKA 1SAYA 5F1KA 5TIIA 3PHJA 4KQXA 2JCXA 3BIOA 2OHXA 2JCYA 4IIVA 4J7XA 4CL3A 3VTFA 3L07A 2OBYA 3GF4A 3H3FA 3TOZA 1HZJA 2B5VA 2FPPA 1LDYA 5HA5A 2EP7A 3K6JA 2BF7A 3MJVA 1WMBA 1NPYA 1XQ1A 3WIEA 4B8WA 1N1GA 1R66A 2QG4A 1GQ2A 1VL6A 2ZB4A 3NKLA 2WD7A 3GG9A 3PRJA 3D0OA 3I9JA 4MVJI 1FDUA 4JP2A 4DLBA 4ALLA 2I76A 3GDGA 6LDHA 1NAHA 2WYWA 3Q2KA 3EZYA 2ZQZA 4HFMA 2OXIA 2W2LD 1GEGA 4TRRA 5JBIA 4WCFB 3RC2A 1XCBA 3DXFA 4J91A 2YHIB 1PU2A 2P9CA 1E3LA 1X0XA 5DCYA 1SB8A 2W2KA 4YAIA 3A14A 3QQPA 2AQIA 1I3KA 2NU8A 1ADBA 4BO7A 4CMBA 3RBXA 3CEAA 4TKMA 3PWSA 1I10A 4DLLA 4UVEA 4E31A 1DIGA 4OOEA 3ZWXA 1W4ZA 4YACA 2X0RA 3GZNB 4ND3A 3OEWA 1JAYA 4GKVA 3ZWCA 2Z1NA 4BNVA 4H16A 4DWVA 1MG5A 2NACA 3CXRA 1SB9A 3IP3A 1Q0LA 2B37A 2GSDA 4Z0HO 4HY3A 4MKRA 4AVYA 4TQGA 3VTZA 5CDSA 4TVOA 3DC2A 5A9SA 3QV1A 2AHRA 1DFHA 4FD3A 1HXHA 1AGNA 3DO5A 1SOVA 4KMSA 2JAHA 1C3VA 5CFZA 4AJLA 4DRYA 3L4BC 5IZCA 4FFMA 1RYDA 1GZ3A 1YJQA 4NFSA 4CM4B 4CMHA 3GRPA 3GFBA 3RASA 2E4AA 1CERA 3E5MA 3D4OA 5BNIA 2RIRA 3H5AA 2GZ3A 5KTKA 3ZWMA 1UXHA 5KJFA 1KYQA 3GHYA 2FZEA 3M1AA 2VQ3A 3SEFA 3QVWA 4NBTA 1LLQA 1MGOA 2J8ZA 3TZKA 1MV8A 3DOJA 2ZK7A 4NMHA 3I3OA 3O38A 1DFGA 4B7UA 3ON5A 4UVDA 5KVVA 1TA4A 4XGNA 5LDGA 2XXBA 1G6KA 1WZIA 3M1LA 2E82A 3W8FA 4IDFA 1E7MA 5IAAA 3WGZA 4XQ9A 1LNQA 4KUEA 4BO3A 1VE9A 1D1SA 1V3VA 5BQFA 4YJDA 1N9GB 2VYND 4O63O 4FGWA 1D8AA 4Z9FA 5CEEA 3ROPA 5A4DA 4EZBA 3DZGA 3GOHA 4FCCA 2B36A 1UDCA 5EINA 3D4NA 1NQAO 3RC7A 1ENZA 4E2XA 2C7VA 4CM8B 4S3MA 3AY7A 1ZSVA 1QORA 3V1UA 5A9RA 4E12A 2NVBA 1JKIA 2QZ9A 1W0CA 2Y0CA 3AY3A 3ZHBA 1Q0QA 4FC6A 2YV3A 2NQ8A 5CDYA 3INRA 1GL3A 1UXGA 4AJ4A 3PYXA 5KJEA 4M1QA 2D2IA 2PGDA 5F1OA 1QKIA 2IXAA 1JKJA 3OJEA 1LX6A 5EERA 4CLRA 4TKLA 1AHIA 4YJHB 2FOIA 4WK6A 1KY5A 4RPJA 1TXGA 1MXFA 5ILOA 4CR6A 2DBZA 4ZU3A 3NT2A 5KKCA 3MTJA 4W9NA 2BMAA 5EESA 1EUDA 2NSDA 1EE9A 5I7EA 2J5RA 1T4DA 2XPCA 2DU8A 2VYVD 3PLRA 5CPFA 5BSGA 3KETA 3NTRA 3TWOA 4BMVA 1IULA 2VZ0A 5KKAA 2VUSA 1D1TA 2GLXA 3PHGA 5F3RA 3UH1A 3JYQA 8LDHA 1GV1A 3UW3A 5ES3A 1R37A 4UVGA 3BMNB 3CH6A 1O89A 4FFRA 4YQZA 4E5NA 4J0EA 2Y05A 3NV9A 2VZ9A 4BNHA 3ZZNA 1IL0A 4HP8A 1B7GO 4ZGWA 2BFPA 1WWKA 4DIFA 3A06A 4J1QA 5L7WA 4E0BA 4BNKA 3OH8A 4BNGA 3DBRB 1MG0A 5C37A 4FJ1A 2PKQO 2HO5A 1P33A 4G81A 2PZJA 2EGHA 4HV4A 2Z5LA 3B20A 1DDOA 1EK6A 3HDHA 2H5LA 4AJ1A 3DWFA 2YW9A 1P31A 1QLHA 4E2ZA 5KJ1A 4IUYA 4EJMA 4MJLA 3F5SA 1D3AA 4F6LA 4I8XA 1UZLA 4NK4A 4W4TA 3RIHA 4QQRA 4Y6SA 4KWHA 4I5GA 1KVSA 1TEHA 4XQCA 1E6EA 4B3IA 3PGJA 4OH1A 1YGYA 2X23A 4ZHSA 4LVUA 2HMUA 5FEUA 1GV0A 4GGPA 3WQQA 2SCUA 2CVZA 4P4LA 1F8FA 4IDCA 1HE2A 5JCXA 1Q0HA 1PGOA 1LRLA 8ADHA 3UFXA 5AQ1A 4Q3EA 4BB6A 3NTOA 4FJ0A 1JVSA 4BQRA 1ZW1A 2AQKA 3LC1O 4RVDA 4BNZA 2X6TA 2DM6A 2DFDA 1ZIDA 4GSKA 5TT1A 1PS9A 3RUDA 1A7AA 5IZCC 2EKLA 5T5QA 3RKRA 3L4SO 1ZK4A 4BGIA 2OUIA 4N18A 1FDVA 1DEHA 1H6CA 2JAPA 3WGIA 2DBQA 4RLHA 4JGBA 1VC2A 1ENYA 3WIDA 1EVYA 1YDWA 1C14A 1HDOA 4IDGA 1Y8RA 4B79A 1HE5A 1BXGA 2LDXA 2V65A 3LT4A 4LCEA 4XGKA 4MIOA 4J4HA 4CQMB 5EMHA 4HXYA 2O3JA 4WEQA 2PV7A 5JSFA 2GPTA 3DB2A 1CWUA 4L75A 4R4JA 1I2BA 4AFNA 3F6YA 5H83A 2C5AA 3FNEA 2JD0A 6ADHA 1M2WA 2AG8A 2O2YA 1FDSA 4ONEA 3JQFC 2A4KA 2EHDA 5K6AA 2C29D 2BFAA 2DPHA 3T4XA 1YE3A 1Y8QB 2HMSA 3IJPA 1HSOA 4D3DA 3JYNA 2XXJA 3EYWA 3FCOA 4JX8A 2DAPA 1I33A 1NVGA 4CUZA 1XKQA 2P91A 3AI2A 4RPKA 3GN1A 3NJ4A 4DREA 5T6BA 3W4JA 1UJMA 4QX6A 2ZKLA 3GDOA 1BW9B 1HDGO 3I6QA 1QSGA 5TGDA 3LC2O 2Y1GA 2WDZA 4N5NA 4ESOA 3ETEA 3TN7A 1QR6A 3ZU4A 2ZTVA 1O5IA 3INGA 4E13A 5I7FA 3NT5A 5TC4A 2VHZA 2QYSA 1EFLA 5CPBA 2HKIA 2B69A 2ILTA 3ZV5A 4I9HA 4IZHA 1LSSA 5DP2A 2IZ1A 5BNFA 3RUFA 3RWBA 3SJUA 4RQTA 3QHAA 5ITWA 1JVBA 4CM7A 1K0UA 3I4CA 4O1MA 3TJRA 3SC6A 3Q1LA 4PGFA 3QJ5A 3AUAA 3GZ4A 3HFGA 1GZ4A 4ROSA 5J23A 4R3WA 2ZYAA 3WXBA 4J7UA 4AJ2A 1GEEA 1WPQA 4CM5A 5T73A 2UUPA 4NBUA 5DNAA 4HKTA 4E4YA 5K9ZA 5IXSA 3L9XA 3UN1A 3FRJA 4Q3BA 1YQGA 1XDWA 1GPDG 4M54A 2C0CA 5BSHA 3H9EO 1W73A 1V0JA 5DDIP 4PLGA 3FHLA 1LSJA 4TMFA 2ZTUA 4J9UE 5A3JA 1Q7BA 1T2FA 4XDZA 2JHFA 4CM1A 5EQFA 1H2BA 2I3GA 3JQ9C 1H93A 2PGLA 5JDCC 3H9QA 5EPOA 1O95A 2PNFA 3IOYA 4IDDA 1LUAA 2Y67A 4QTZA 2CDCA 4M55A 3WGQA 3D3WA 1ISIA 1HZZA 4CQLB 4LISA 1PJSA 1PEDA 1P77A 3FF4A 3AUSA 4YQYA 2Y0DA 4YCAA 1IOLA 4G2NA 2TMDA 4PLHA 3VZRA 5KIAA 1A27A 4Y9DA 1LA2A 4R9RA 2B4RO 4JN6B 3LT1A 3MJTA 3QWFA 5U4QA 2Y68A 1I36A 4OSPA 4P38A 4WASA 3DZHA 2ZIZA 2VT3A 5EIOA 3LLVA 3E6AA 4QO8A 2YDYA 3WLFA 2I9PA 2PD6A 1YKFA 1ENPA 1KVTA 3IIEA 3K92A 3QE3A 4IJUA 1PL7A 4OL9A 3QVSA 3KYBA 4AJJA 4B4WA 5L45A 4TRMA 3GLQA 3NX4A 5TT0A 4OKNA 4K26A 4R16A 3HN7A 4GX5A 4IGEA 1UXIA 3GPDG 5COQA 2VWGA 1KEVA 1E1KA 4N5MA 4OSOA 3JSAA 4LMPA 3WYEA 2IODA 1YB1A 1PZHA 4U5QA 5IDQA 2X0NA 1PX0A 4MO2A 3IC5A 4IDBA 3ZNPA 3RC9A 3WGOA 2D5AA 1DJNA 3G0OA 4GPD1 1NWCA 1U9JA 1X7DA 3GG2A 1O8CA 3ORFA 3GA0A 4DPKA 5C7LO 4L8VA 1ZSNA 3CMMA 1NR1A 5L4NA 3UCFA 4DC0A 3EAGA 4RCVA 5DOZA 2DKNA 3QIVA 1PIWA 1M6WA 3EW7A 2O3RA 4WOJA 2JCVA 2IRWA 1PJ3A 2AE1A 3D5TA 4NU6A 4UEJA 4CV2A 5CDTA 2J3JA 3JYLA 2YJZA 2ZCUA 1GPJA 3EUWA 3L6OO 4B7XA 2E37A 2NVWA 2Q45A 1RM0A 4U8GA 1J49A 2AEMA 3BHIA 4KUGA 1NM5A 3HJAA 3GY0A 2EEZA 4J1TA 2GCGA 5TQVA 4WECA 2VNSA 1E5QA 4NJMA 1SPXA 3UICA 5BSEA 2UUOA 3RSHA 3C8MA 1XEAA 3OJFA 4L4RA 4PFJA 1UAGA 1X0VA 1PJLA 2GF2A 1E6UA 2I66A 2Y66A 3F3SA 4R01A 2F1KA 4YJFB 3WNVA 2CNBA 1R4NB 5JCJD 3L9WA 1PR9A 1RWBA 2B35A 2GRAA 3OHSX 3JQAD 3QWHA 3JQ8A 1BHSA 4ND1A 4CLHA 3X2EA 1HLPA 4D44A 2O4CA 3VH2A 4EJ0A 4GLLA 1KEPA 4F3YA 2O7QA 3QP9A 4K6CA 4OJNA 2X58A 1I24A 1U7HA 2EF1A 3RC1A 3EMKA 4QFCA 5JY6A 1R0KA 1V3UA 5DP1A 3WGYA 3PP8A 2X22A 1SEPA 2Q2QA 2HDHA 4PLFA 5I9LA 4LRSB 1QRRA 1K89A 1R4MB 1GYQA 5B1YA 1HL3A 5JAQA 1I2CA 3O8QB 2NTNA 1ID1A 1PQPA 1SNYA 2A92A 1U3TA 1DHRA 3C1OA 4UEOA 2FPIA 2NUAA 1CRWG 1Z74A 2FR0A 2HMVA 1UZMA 4ITUA 4I5FA 4MP6A 3UAGA 1Y5MA 1E5LA 1VPDA 4J43A 5DBFA 4I08A 1E3WB 3TDKA 3L4BA 2J3KA 5ER9A 3ZNNA 4DUPA 1I3MA 2Q2VA 3ONEA 2V6FA 4WLNA 2EW2A 2VHYA 4WNCA 2YHIA 4D46A 2YYYA 4BKUA 3TOXA 4ZQHA 3UHAA 4GBJA 2BGKA 3IUSA 4CR8A 1U3UA 2HK8A 2HLPA 5A1TA 1ZEJA 5IFLA 1ULSA 4L73A 1QV7A 1Q7CA 4O5OA 2PH3A 2ET6A 2BFMA 3OFSA 1RYEA 4R9SA 3I4FA
chains in the Genus database with same CATH superfamily
2PXCA 2I4LA 1ODFA 1V6AA 1JKMA 3O7MA 5CHYA 5FLEX 3VHXB 1CDEA 2EZ8A 3REQB 1IXRC 1Z82A 4JVOA 2PANA 1BAPA 2QT1A 1DLIA 4TMYA 4JQCA 1QGYA 1P0QA 1TOAA 3BGSA 3ORYA 3N0XA 2YXPX 4DMRA 1KZYC 1XD2A 4JP8A 4RYDA 1Q50A 1UQUA 3KQWA 5BXQC 5JW6A 1VJ1A 3G49A 4UFNA 1DT3A 4K2AA 3QEBZ 3RF7A 3ME5A 1Y3AA 1CP2A 2IYVA 3RVOA 3B3FA 4ZV9A 1MVOA 2ONCA 2QRJA 4FB5A 4LWOA 1IJFA 4LC1A 2GASA 3LBNA 4JLSA 5JJLA 2E18A 3RVBA 3UAZA 1POXA 2Q2WA 2XCOA 5BSWA 4P32A 2ODWA 5ICCA 1J0DA 5KYTA 1NA5A 3K0FB 2CC2A 1K5HA 4K6MA 2CNDA 3WZLA 4FP9A 4DRXB 3THSA 5BPHA 2YJNA 1OASA 4O4IA 1TCVA 2NTJA 4QGGA 3IULA 2IW1A 3FTPA 3QBDA 1JFVA 4Q9HA 2JJ1D 3ETGA 3JQ7B 1I4WA 4LK2A 1X1EA 4MUAA 3A1UA 4CCWA 2K7FA 3BYZA 2OV1A 1P7VA 4Q1VA 3STUA 2FZLA 3BIWA 4AY2A 4M1MA 1QG6A 1YJ8A 4TV8B 4Z9XA 1Y82A 3EHEA 2I78A 4QGAA 3RRMA 4DXHA 3FWHA 3PK0A 2BN4A 3ICEA 3F4BA 3B6KA 3CVVA 3IHKA 1GLVA 1E2GA 1SIUA 1YHNA 4KMRA 3NRCA 4NARA 4E07A 2BFFA 3W4KA 2PFGA 4ZT3A 5FL7D 3T7EA 3AVWA 5IT4A 3V6LA 2ZEJA 4CN8A 2ZXEA 4Y9UA 3S8EA 2P6RA 1F4PA 1LPPA 3FLAA 5I9TA 3RD5A 1OI7A 3G6KA 4NENB 3ZIAD 4AP6A 1A4UA 1VHDA 1JGTA 1XO1A 1Y7TA 1NBME 2AZXA 1K2VN 3STVA 5HFAA 4XE5A 5K51A 3VSCA 4QOEA 1U7WA 4JK3A 4P81A 4BLTA 1Q1AA 4CLOB 4RTSA 1G20B 4ISCA 1SBZA 1PJQA 3IBCA 4L7VA 1RRFA 2P4SA 3D6NB 1C41A 2OMEA 3F6RA 4ZZIA 3M5DA 1X8XA 4GC9A 4NY1A 3SCZA 1E5DA 1U1IA 3AL2A 4JBXA 2ZI3A 4RORA 3QVJA 5JISA 1JAXA 2IITA 3CB2A 4XEHA 1QC5B 4L5BA 2ZFUA 3GVIA 4CU5A 3UHOA 4LSGA 5TR9A 1G8GA 1T3TA 3UK0A 4JLPA 5L51A 3K2IA 3U5TA 4EOGA 4Q01A 4ZEWA 3HZRA 1NMYA 5DE3A 4RZ2A 3T38A 1FUKA 3BORA 4WFIA 1BH2A 1LXCA 1K6XA 2JRLA 3BJMA 3TL2A 2PPLA 1FSZA 4LSZA 2VDRB 1YOVB 2C3PA 1C0KA 2RHDA 3E7WA 3OLQA 4RNCA 1B6RA 2WOJA 4ZXFA 3B6MA 1K2WA 1NNUA 1KY2A 4JR0A 3ZWOA 4O8JA 4RY9A 3VU0A 1NJFA 5J43A 1ONOA 1DG3A 1KJWA 1RRGA 1YB5A 5FP0A 4BMOB 4YWJA 2B1IA 4EF5A 4F3CA 1LS6A 5IVPA 3A4LA 3DAGA 1NFRA 1DINA 3L7MA 4P5EA 3DAPA 2DHQA 4R5MA 4QPDA 2GI4A 3F5DA 1JAZA 5SY4A 3BMNA 3FI0A 5FJIA 1ZLXA 2EX4A 4G4SP 1AN0A 2RHRA 4FQ7A 3PWTA 5FBHA 5H1YA 4YMGA 1ML3A 1HFKA 1JDVA 3FFBA 4TS4A 1F14A 4KG7A 4Z49A 3FVTA 4JQOA 2QI9F 4EI2A 4N9QA 1PGQA 3L6RA 4M1YA 2NSYA 1EI9A 1T0IA 1GADO 2QP3A 3ZI0A 5BSMA 1KARA 1U0OC 2AJDA 3C1AA 1HWYA 5AM3A 1E61A 3OQBA 1QMHA 3IIKA 3PNVA 3R8XA 2WW8A 3N87A 5AJHA 3T4PA 1DDGA 4MGZR 2A9KA 1MVNA 5D6NA 3OF5A 4WWHA 3R20A 5LP6C 2CXOA 4MI1A 4WCFC 3BB1A 3BWYA 3IOMA 2F59A 2QTBA 1BMQA 4JXKA 3KOOA 2ZUUA 4BQEA 4HFNA 2IUYA 1JZSA 1P2TA 1HO3A 3OT1B 1EBFA 2QVZX 1YDMA 2Q99A 4KQ1A 4D80A 3L7IA 1JJFA 2WLTA 1I6KA 2QD4A 1HF3A 3LUAA 4JA0A 4CKCA 3AUTA 1G60A 3NM5A 2RIPA 1ZMTA 4C4YA 3D0KA 1QZUA 1U7TA 1YZKA 1MB0A 3CZMA 2Y1CA 1JQEA 2QUKA 3DTNA 3E9EA 4NNOA 4OKIA 4EL0A 3ILSA 4HWRA 4JENA 4QJIA 4OHVA 1BDBA 5LVAA 3KJZA 4WJZA 4F96A 3TW8B 2PH1A 1JJ7A 3IB3A 2D8AA 3QKRB 4ZQFA 4PN7A 5C8YF 3OTIA 4P86A 3KXLA 1RQNA 3SZUA 3BG5A 2WU1A 5AHKA 2DECA 3ABSB 1F7VA 4U7TB 3JQFA 4S2UA 5ED0A 1QYCA 1RWNA 4P4TA 5JR3A 1EFKA 1LLDA 2C4WA 5KEIA 3KJEA 3WDSA 1NW8A 4LXYA 3K5PA 5DWVA 1VJCA 5JMTA 5G40A 1JTVA 2E5LB 4WOPA 4MYRA 4A8JC 1WDWB 3TRFA 3OTHA 3D5EA 2VDVE 3IJ5A 3L8CA 4A26A 5HKKA 4IWNA 4U2DA 1D7OA 4KXWA 4EYEA 2H29A 2QX7A 4MEAA 1V8DA 2A5FA 4UD6A 2UUCB 2IV2X 4JI3B 1W4RA 2XHZA 2CLSA 4X8HA 3IUPA 2C0PA 1UT8A 2CLDX 1OVMA 1QH8B 5IARA 3U7QA 2VN8A 1Q0RA 2QZZA 2HM7A 4NNJA 2GJ9A 2RAUA 1OLOA 3A1CA 2C8VA 2RJ3A 3KT0A 2F8SA 1G2PA 2YMQA 5CFPA 1R8YA 3SIWA 5EIXA 1J8FA 3DVLA 1TI7A 1U28C 1Z6AA 4XDYA 1T2VA 2EDAA 2VNJA 1PFWA 3U4CA 4AQDA 1ZAYA 1RXVA 1Z5UA 3CUYA 1ODTC 4CFSA 4EITA 1Y6RA 4RFSB 5E9WA 4YP0A 1T2NA 2HB6A 4X95A 1P80A 4GOND 3CLRD 1N3YA 2EJBA 4L5CA 1IXYA 1E2MA 2R47A 4YMSA 4TTIA 1PD1A 4UE2A 1JR6A 2FPPB 1E2EA 3I2YX 4Y98A 5IJXA 2YV4A 1KBQA 3HM2A 3N2GA 3I6IA 4MKFA 4WY2A 4MYHA 3VNAA 1EZZA 1Y8QA 3VXKA 4DQLA 3DQPA 3LPAA 3G0DA 1X74A 5JG7A 1VLZA 5DBEX 4L4SA 1HDIA 1TTQB 1MQ8B 3FROA 4LHEA 5E9JA 1Y9AA 3RARA 4BNJA 4DJJA 2VH2A 4E11A 1JHMA 2AJTA 2XCUA 3L79A 3RSGA 4CHTA 3B6EA 3DVQX 4GWLA 4D6PA 2WWGA 3C7AA 1R10A 3DEYX 4CQJA 1RCFA 2VWPA 3HBNA 1E0JA 2PKXA 5JFGA 1RJEA 3GLIE 4FZ3A 5DW0A 2NZUG 5FWAA 3PZRA 1B8UA 3IDAA 4EQZA 3BB4A 2HLDA 4XPIB 2ZSEA 5LUBA 5LMNB 1MNQA 5IF3A 2Q6OA 3O4IA 4FT4A 3DV2A 2P9EA 3LGAA 2EWVA 2V3VA 3GROA 3LVFO 1QHEA 4KPUB 3HV2A 3W5SA 2AG5A 4YJGA 5E3JA 1C0PA 1J1IA 4UUNA 1Z4PX 1OYOA 2JAWA 2VQSA 4H77A 5FXMA 5AHOA 4EGAA 5K0ZA 3R0VA 2DKOA 1ADJA 1AKUA 1MA3A 4LRUA 4P9NA 3S7TA 2XNJA 1DAFA 1F2DA 3SKXA 1TYCA 2JL1A 1J2TA 2WMOB 2DR3A 2JI8A 2IEIA 3HKEB 3RU9A 4ATNA 1LTQA 3JZIA 1EHIA 2XJ9A 3Q8MA 3ZDCA 5JBQA 1DWUA 3ABOB 3ANMA 4Q19A 2C4HA 1V16B 3QMPA 3LLSA 4BZPA 3B7PA 1QIGA 2FPWA 3IWCB 3EC7A 1N0WA 4TWRA 5AXCA 2IPNA 5HNKA 3PPWA 4UATA 1P1JA 2AZTA 1OXBB 2IE8A 4OV6B 2PL3A 5LDDC 1VL1A 1XNQB 2QLNA 1GG9A 2FR1A 2JH3A 3D8TA 3QVTA 1R0CA 1QHSA 3OZVA 4LC0A 3ZBQA 4EW6A 4YV2A 1OKKD 3RADC 4R41A 5TRTA 3NOVA 3CEPB 5EWMB 4XD2A 2I62A 4RMGA 4ZO8A 3TLEA 4URFA 3W04A 2FU5C 1JEJA 2ZW9A 2AF4C 2QTVB 4A2CA 2RGEA 4BZXA 2QAJA 1CB7A 3WLEA 4JGIA 3JAWB 4YA6A 1XVLA 2XD4A 4GPZA 4ZQBA 2CW5A 5E7JA 5KWEA 2IHKA 4BQSA 5HPYB 3A2MA 5LZ7A 1T1GA 5K0NA 1E6KA 1N7GA 2YBEA 2IUUA 3FPCA 3X2SA 3TFQA 4Q4HA 5D00A 4BQFA 5D01A 4OFXA 3PZBA 1CHNA 1E6LA 3UOWA 4WEOA 4L3OA 4R69A 5LB2A 3LUFA 1VB5A 2H4ZA 5DVZA 4B4KA 5L3QB 4HQ0A 3NBMA 3UT5A 1OZGA 1I0IA 2POQX 4LOKA 5FWXB 1FRVA 1EX9A 1WM1A 4KWCA 4BIMA 4OHYA 4B3HA 1XF1A 4KIGA 3OIYA 1V95A 4ZI7F 1IK6A 3KDSE 4IMPA 3CM0A 3H6KA 4NATA 2Q3EA 4K87A 1JHRA 3GPBA 3MT8A 3KL2A 4R3NA 4XVRA 2EQAA 3EFBA 3T0FA 1N8NA 1T2EA 3B3JA 4PYIA 2X0IA 3U44B 2JIOA 3GRUA 4UU0A 6REQA 4MAAA 1QAOA 3C7CB 2VTEA 4LJKA 4Q3CA 1QVZA 4HDKA 3VR0A 1L8QA 4DZRA 3L7CA 4QQ8A 4CDMA 3ROKA 3Q8LA 1VBFA 4OPMA 4WOKA 5A6SB 4R7TA 1NUQA 1FUEA 2QE7A 3NIGB 5AM2A 1YTLA 2OEPA 3EIXA 4OVKA 5SZJA 3PRYA 3UV7A 3VU8A 1ZXXA 3A1SA 4EVQA 2C1ZA 1KJIA 2A5YB 5EJ2A 2W2OA 3T1YB 5BQ5A 5CXUA 4N76A 4G3XA 4LI3X 4CLRB 2VZEA 5GP1A 2QRHA 4BNLA 1R6UA 2LBPA 1UPXA 2G1AA 2W6PA 4HATA 4OQZA 4UU1A 5IXYA 4LNAA 1A7KA 4XOIA 3BL6A 1JDPA 1QZZA 1GSIA 2QLMA 3S2IA 4WNYA 1OT3A 1RSZA 3V1NA 1QZ3A 4ZHQF 1T6XA 3U3ZA 4LF8B 2P35A 4IY1A 2HRQA 1VKZA 3FCXA 3WG9A 3UB3A 4ARSA 4HJXA 3IKVA 5DULA 4ZVVA 4QOJA 3MJSA 2W98A 2J0QA 4YMUA 5H9WA 1V71A 2H7XA 1EX6A 2PLNA 2R8RA 3I2IA 2HWXA 3NDJA 3U62A 4ZI5A 3KHSA 4ZAZA 3LSTA 3KM0A 3ZWYA 1CKEA 2F8TA 3ETHA 3AG6A 4HNAA 1NJ8A 2OCBA 3TDNA 3UXMA 2A9RA 5JY1A 3HV0A 2Z43A 4KV9A 5J4LA 2QM3A 4E5DA 4OBBA 4DXAA 1K8XB 5JS2A 1JDTA 4A82A 4BN0A 5B4TA 1YIOA 4RQUA 5KSYA 1H69A 4FYHA 2GESA 2IEZA 4B6QA 2BR5A 3GA7A 4G97A 1JPJA 3O3OB 4LMBA 4JOQA 1G19A 3F5FA 4QHSA 5D3MA 3S2EA 2AFIE 1T8UA 3LOQA 1OGIA 3L5KA 1EP9A 4EG5A 1I8TA 1K7CA 2JC3A 3NUZA 2NN3C 5JS8A 3UTDA 4Q5IA 2EZ4A 3GK3A 1WW8A 2C8JA 4HG2A 3VJMA 4DSNA 2D0IA 1CUYA 5BW4A 3G59A 1C8VB 1KY4A 1M34B 1V25A 2R85A 4IIHA 2FDCA 1Q0ZA 1KDYA 3E58A 3DB1A 3H11A 3OE4A 4LJ7A 2F64A 3MUNA 2PD4A 1JRLA 2BMDA 1EHYA 1ISGA 1GKUB 1LI5A 4E88A 1O5TA 2H11A 3OUUA 5I7UA 1PS0A 3VR5H 1GTMA 2ORVA 1REQB 1GHTA 1PJCA 3QWIA 5AUQA 1CUIA 3F6EX 3GYBA 3FCCA 3ZHRA 1NNSA 1OZ0A 4N4AA 3A6LA 3AERA 4QOGA 2WVJA 1ZOPA 5DN9A 3PWZA 4FFLA 3V8EA 5HZGA 4KNYA 4F4UA 5ITSA 3AYZB 1NJ2A 3MLAA 4KDFA 4NBWA 5BNTA 2I67A 1DUIA 2OV4A 3DQZA 2FEWB 1PV4A 3P5BA 2Y1WA 2HQBA 3ASZA 1OTYA 1WV1A 3I04M 5BORA 1MQAA 3FHOA 3GLHB 3VKVA 4YUZA 4DBVO 3RVQA 3ZE9A 4KXMA 4BE4A 3DNMA 1R0YA 3UGTA 4WKGA 3RNLA 1AF4A 4DGSA 1SD1A 2P9JA 3CZQA 3DOOA 1NQ5A 2JGEA 1QYXA 2Z3VA 3WICA 1JB9A 2IZ0A 3PA8A 4TRNA 5ANRB 3SLRA 1BCRB 3U4HA 2ODTX 4FKMA 2JKZA 3LQRA 1OTHA 1P73A 1VI6A 4REOA 2JCBA 1C9YA 1O87A 2BFNA 4L8GA 1Q21A 4MUFA 2A9FA 2LRHA 2WG0A 2CLMB 3MQFA 1I3LA 3BL8A 4OXNA 3RYFA 2YWJA 1BXZA 4CMKA 3OM1A 3D6HA 1EFVB 1GP2A 1TL7C 2BTQA 1H65A 2J33A 3EIQA 3SOZA 3EDRA 3SE7A 1DIBA 2VYCA 1GAJA 5ES4B 1RWVA 2OR3A 4LSMA 4KQEA 4XYBA 4LZAA 4D3XA 4FDVA 3CVUA 4AZVA 4UUQA 3VNQA 2X5XA 3WIBA 4BDSA 1RTKA 2PT6A 5A03A 1RZRA 4N8EA 4O5AA 3E82A 1P2SA 2FHSA 3VPDA 1PJAA 4RELA 5DI9A 3HO6A 1FMTA 1TQDA 1VYUA 4H35A 3V4PB 3NU1A 1XXHB 2PGIA 1S1CA 3AHCA 2Z5FA 4R68A 1I3NA 5BVHB 1FP4A 1FU8A 4P22A 3RVNA 5A9TA 3VNRA 1FMFA 4P58A 5SICE 1QK5A 1USIA 4CF3A 4LK3A 4LJ9A 1XHEA 1VOTA 3GAAA 4YRJA 3SJ7A 1SIOA 3KPVA 5HE8A 3EAFA 5J3JA 1UP7A 3FJOA 3MA0A 2AFHB 2J07A 4NMWA 3V4OA 1E1CB 3FHTA 1RMYA 1MRZA 4C6TA 3AB3A 3WGGA 3ZV3A 1RIFA 3QA9A 3H2GA 1I94B 4JI0B 1F0YA 1GIAA 4EA8A 4WNIA 1G0NA 3AEKB 5GOTA 3JWJA 1CE8B 4QSMA 3RS9A 1BFKA 3W5DA 1DIRA 1I7BB 4YB8A 4ER7A 3TFOA 4OMFG 3L7OA 3ROXA 1CUSA 3LY8A 3SXPA 5JMOA 5EZ5A 3ROEA 4FHCA 1SH7A 1RXUA 3EJWA 4MA4A 5HKKD 4XCQA 2XZPA 3QF7A 3W2TA 2X7JA 5CD9A 1NLZA 3Q3VA 3GFVA 1JH9A 4HDSB 1PS8A 3DEZA 1K5DA 1VPVA 4EPVA 2IPXA 3J7AC 2C2WA 1VI5A 4C30A 3SG0A 2CD9A 2CL0X 3EMVA 1Y63A 1ULUA 3S68A 4JI8B 3KUUA 3MN1A 1ITZA 4LY3A 1I7MB 1RD4A 2BLNA 2FDXA 3ADPA 3JR7A 4MLPA 5U4XA 1JL3A 1KAHA 5L40A 1Z4QA 4ID9A 2PRYA 4J4TA 2IVZA 5JFTA 1Y1LA 1JBEA 2ZATA 3HEAA 3T61A 1ZSYA 4B3GA 4AO6A 1YASA 1YI8A 2Y0BA 3E27A 1M7BA 3PGVA 5AM0A 2H16A 4N7MA 4ZKDA 4PFSA 1Q7TA 1C3OB 2Z4TA 4P53A 4BNDA 4KKXB 1JU3A 4DG9A 4DUGA 2QMOA 3KKZA 3F0TA 5B2FA 4EH1A 4EY8A 1GTRA 2P9HA 3FSGA 1UDAA 4FSHA 4PRLA 3G1WA 3JTMA 4RPGA 4IPTA 3HP4A 3UCEA 4F4DA 4MLDA 1TD1A 2IZ5A 3MOGA 5CG1A 4J0FA 4LTDA 4WVLA 2QRPA 1RQRA 1ZD9A 2GJSA 2JFQA 1Q44A 2WUDA 2ZJYA 4HDMB 3YASA 1FP2A 4RVNA 3ZZTA 3ENZA 3R8FA 2TRSB 5KPJA 1KH2A 2W6OA 4QOFA 3L5OA 3PDHA 5LC1A 4UTNA 4NCNA 2R6JA 2O2EA 1EWYA 4RDCA 3K15A 5BRNA 2IXEA 3T3OA 1MHPA 2NV0A 2DTXA 3AR3A 3G1UA 3TQSA 1W36C 3MJHA 3OCXA 1OOEA 3OKCA 4K1LA 3S40A 2FSGA 4MR7B 4U7WA 5SZKB 4AX4A 4D0RA 4IQ8A 4C5AA 1FQOA 1TUBA 2H9IA 2PX4A 2NO6A 2QMHA 4BO6A 3NBYC 1ADCA 3B2NA 5L3RA 1L1QA 4UDOA 1D03A 4B5LA 4ND6A 3GLFB 5FQOA 4D9HA 4RDIA 1K6IA 2FW6A 3MNFA 1G3RA 5FA5A 7AT1A 3ZXXA 2JHCA 2EBFX 1ZCZA 2G4LA 1WMAA 2C3YA 3KT3A 4C29A 5A5DA 5LP6A 1ZN8A 4L0DA 4WCFA 2IIQA 1PSDA 1V8PA 3TZCA 5FOQA 1U9CA 4UBIA 5D87A 1YQDA 2WIKA 1M1XB 1NNLA 2BEJA 3CINA 1R27A 4IRXA 4O8CA 2LR0A 2HXYA 2RHWA 2GGSA 1J4AA 1BTOA 1D2MA 2MSEB 4RD3A 4BQQA 1O58A 5CFLA 4JBGA 1XQWA 2HPZA 1DWPA 3QW2A 3PIDA 1PZGA 1A04A 1SCUA 3K8OE 1YVPA 1YH3A 1T9KA 1RXCA 3MJRA 1AKTA 5CGZA 3L05A 3A3OA 3E9MA 4WW0A 1YTUA 1F6DA 1WSWA 2L17A 2OP0A 3L8GA 3TI7A 3DEHA 4J0CA 2RHCA 1R64A 1ADYA 4QREA 5ALDA 5B1IA 5FH9A 2I91A 4MUEA 4JJFA 2H18A 2LVBA 4NH4A 1XSEA 4YQEA 4BAGA 1F9AA 2Y93A 1SXIA 2TYSB 2GEBA 4MIKA 1IDOA 3CLHA 3UJ8A 5JWHA 4MUIA 1UKCA 2JI7A 1U7DA 2P1ZA 2ZUCA 5L7YA 4YAEA 3K0EA 2ZETA 4LJRA 4A8JA 1N75A 2H54A 3O8OA 1OMOA 4FDMA 4WOBA 4BMSA 5JSKA 4W7IA 4IKPA 3MTGA 3S4YA 1F8GA 3NOOA 1K3UB 4GXTA 4ARIA 3TSAA 1AVTA 2JAUA 2RCYA 2BFCB 3BDAA 1GG2A 3GZJA 3IT2A 3W9SA 4DUYB 2D2EA 3K0AA 4L85A 3FOFC 4BKQA 1GY8A 4TROA 2ZWOA 3NATA 3DHEA 3PCXA 5EHGA 2GAOA 2JGLA 2ORIA 2PYIA 3NDPA 4FDLA 1IN5A 1GPMA 3PE4A 1YDGA 1U28A 5BYKA 2Z95A 3IAAA 4X1OA 1G2IA 2HJRA 2W2QA 1GZ7A 1JKXA 4IINA 3UJHA 3DYVA 4C87A 1PWXA 4TSFD 4DA9A 3QM1A 4EKIA 1HNNA 4MKZA 1KFJB 1GU0A 3VR2A 2RAFA 4KE7A 4R1OA 5HBGA 3SSMA 2O4UX 3KZCA 4J90A 3P0FA 4NAUA 2JCSA 4EFMA 1J97A 2H0RA 5ITZB 4GKKB 1UAYA 2CXXA 4OTZA 2PYDA 4PG6A 5EZ6B 4Z5XA 4CF5A 3VYSB 1HYBA 2O7RA 1CDOA 3HYNA 1M8GA 3AVPA 3A3YA 3N75A 4KQIA 5DHFA 3KEQA 4M89A 1OLUA 4WKNA 5IH3A 3AJ9A 3QFCA 2EX0A 3H2IA 1E18A 1KR2A 4B76A 3ZDEA 2FSPA 3CWQA 5F76A 5BWOA 5ISMA 3GLRA 3MOSA 3OHMA 3PDWA 1N2BA 4PNPA 3ZWNA 4M7OA 3PUVA 3LGSA 5EP2A 4MWSA 3Q0EA 2QLFA 3BWMA 3JD0A 4BATA 4DCMA 2UZ4A 2YL2A 1VIVA 4A16A 3S5UA 1HUQA 4FN4A 3VYVA 3SDBA 2V55B 4DSAA 3K9FC 2W00A 2JJMA 3T41A 4B6SA 5DBIA 1HEUA 1XE3A 2GBCA 1CZOA 4G1EB 4IGFA 2AKAB 1U3VA 5C4IA 1XQ6A 1ECJA 2J0VA 1U2PA 4Y1EA 2VDQB 2VAPA 5EXTA 4FB4A 3L1UA 1P5RA 2M6SA 5GZ1A 1OH6A 1OYYA 3I64A 4US0R 4O1IA 5GMOA 4II7A 1G5RA 1L4MA 1WOMA 3ASUA 3I9V1 1ANKA 1W48A 1IPEA 5DT9A 4HEA1 3C4QA 2WTNA 1MOSA 2EW8A 3D5QA 2HSJA 1RBZA 1XAIA 5AM5A 2E87A 4GVXA 3TFWA 4B3XA 1CCWA 3R0JA 2O20A 1ZI9A 3Q6NA 4INZA 4IQGA 3Q0TA 2Z5GA 3R4VA 3S2SA 4Z2AA 1NG1A 2P3SA 3PNYA 1T2UA 2CWWA 2NUAB 2D1QA 1L2TA 4FK8A 3T9CA 4ZICA 2VK8A 4E4RA 2X6QA 5DLYA 3PV0A 4OYRA 2BEWA 3AY6A 5JADA 4NI5A 4UZFA 5H4GA 5JNRA 4LHVA 2QS9A 3N7UA 5LQDA 4DMLA 3NKFA 3FWPA 4D0SA 2H8GA 1DO0A 1V43A 3IBSA 1UYJA 3L92A 1R9GA 4YDSA 2VAVA 2I22A 1NVAA 2AYXA 1CD5A 2IOFA 2DC1A 2VRCA 3TW6A 2WKSA 1TLLA 3KWFA 4JUDX 2FCRA 2BGTA 4EEXA 1T36A 4ER0A 4RC9A 5FBQB 5F7OA 2Q3FA 1D7AA 2CVOA 1RADA 3B70A 2C54A 3K8ZA 4CT5A 5AKJA 1WDMA 2PKQP 1A2BA 2ZI5A 4B6EA 1ZH4A 2B6NA 1ZGBA 2P3LA 3GFRA 4CLEA 1JIQA 3KZKA 2FE1A 3AI1A 3N76A 1V2HE 4F92B 1HNZB 2NU7A 3DSRA 4PIVA 4V0SA 3CW8X 1WUYA 3AV0B 4RGVA 4ZCIA 2IXBA 2QJTA 3NR2A 2J5KA 4DCCA 4GZ5A 5GPBA 4KNWA 1FVFA 5CYPA 3UAVA 5DBGA 4TV9A 2A57A 2XSZA 5EUMA 1RPNA 1P4RA 4DA0A 4YRBA 1LV7A 3N2EA 1BGVA 2O7VA 2Y1DA 4RDHA 1A95A 1T4CA 1VIDA 1WR8A 2WT4A 3G2HA 4FXPA 4JLBA 4Q15A 5JQGF 2F48A 3Q9LA 4EFDA 5LQAA 2ZRIA 1NIPA 4BWVA 5DPMA 4ND5A 3WAJA 3EQ9A 1JWAB 1W8DA 3DEIA 2AMLA 3AB8A 3UK7A 2W6NA 1JT2A 2IYOA 1F9EA 2OV8A 3VNBA 3FCYA 3UC9A 4DC9A 1EZ4A 1GPKA 1QGDA 3KFLA 1A7UA 4JB3A 3ID6C 1RWKA 3ENWA 3FY4A 5EHZA 1CS0A 3TEJA 4QUDA 1HFEL 5DTJA 3VPCA 1DBPA 1JZTA 4IZ6A 1U8TA 1UWVA 1RZ3A 3PVZA 2YQ5A 1WDTA 1KHTA 1JIVA 2AZ4A 3LH5A 4OJTA 4O4IB 1ULZA 4MQFA 1R6XA 1TNDA 1UFRA 2RDMA 3L02A 1RZRD 3FFXA 1JHAA 3AR8A 4GQIA 3IL2A 1JQJC 3MINB 3O9ZA 1UMBA 1N1DA 3QLEA 3V1LA 3WWZA 2CL5A 1UK8A 1H94A 2GETA 2HU2A 2OZLA 4AUNA 2B82A 4IJ6A 2Z2XA 1NUTA 1EX7A 2PG3A 4H3KB 3AETB 1Q95A 3RFXA 4Q1AA 5H59A 4YT8A 1H4QA 3BMQA 1X42A 1LDBA 1IEVA 1W30A 1TJ3A 1MIOA 3HMQA 1ISJA 2RBGA 1DKOA 3CWCA 3IPAA 3LDGA 4X61A 1TCBA 2OLJA 4RTOA 1Y4UA 1LGYA 1Y37A 3JQGA 1TJNA 2IT1A 1M67A 2JZOA 1DWQA 2CFCA 2WR8A 2QSJA 2Z8XA 3QSGA 4WKCA 3V9AA 4FHDA 2IXTA 2J6CA 3OECA 1TU0A 1Y6ZA 4FNMA 4ILEA 2XTAA 3UWPA 2VJCA 4PLYA 4UOEA 1XUOA 2VP9A 3A28A 1MORA 1UC5B 1EAYA 2X5NA 3HA2A 4EF6A 4XIYA 3SHFA 4RVUA 5HZMA 3BBLA 5IASA 2OFFA 1RYHA 1PJRA 1YDEA 2H0AA 3CISA 3IR5A 3HFSA 1P0FA 2VHJA 2XB4A 1NPTO 4BX8A 2RI1A 4PQYA 3L4EA 4EJSA 4Y2VA 3P2EA 2X7HA 3HBFA 1DRWA 2BMWA 2Y92A 1YS9A 2B3TA 3CZRA 4YUWA 5CD1A 4YRSA 3IDOA 2W0MA 4REQB 4MARA 3W8EA 5EXDA 4I3FA 2ZRKA 1KZ7B 3HN2A 2WD7B 3H2YA 3KCQA 4PZPA 5JZMA 4YUAA 4ILKA 2OBNA 4BJHB 4QFDA 4B6OA 3PNOA 2IHTA 3N2ZB 2FSIA 4AD8A 4A0RA 4JR2A 2X15A 3G2JA 4PSUA 2DFNA 1E3EA 3A25A 3HEMA 5F21A 5B7NA 3DO8A 4A6DA 1KHHA 1SCJA 1I01A 2ZRDA 4HDNA 3H97A 4NBRA 5CX4A 1TQ6A 1NBIA 1UBMS 2JJ2A 3MLEA 4WLOA 5EZYF 4QLAA 3SY8A 4Z7QB 4EUKA 1JI0A 2ZYWX 2AJBA 1QP8A 5GZ3A 2ES4A 5DM0A 2GK3A 2C2BA 3R5HA 2GERA 2IHBA 5EKTA 4F60A 4GOMD 3OCWA 4PX5A 1OIVA 3DMRA 1C7FA 4DUGD 5FFFA 3HB0A 4D41A 3PXXA 2QUJA 1GA6A 2QY9A 4G4SO 3AEZA 3RABA 4U39A 4BKOA 5LD2B 4QBHA 1CY1A 1FLAA 3EEYA 2UKDA 1CZUA 4QPCA 2XAAA 3G79A 4ZAWA 3UMFA 2JLXA 2PQ0A 2AMYA 4BOYA 1ULBA 3WGJA 4DLRA 5ALIA 1CUHA 1VA5A 1WUKS 4IZIA 1J33A 3WJAA 4CIYA 5LZ9A 3F6BX 3UEOA 3X1ZA 3HCOA 4RULA 5G1NA 3IE1A 1P29A 2C5FA 3ZCPA 4Z7OB 1EAMA 3NAZA 2ZJ2A 3B9BA 3CXUA 3LWZA 3OZUA 4RK7A 1T0BA 4B2LA 1HPLA 1TX4B 4DYDA 4RZHA 5KJCA 3AL0C 4ZVOA 3EXEA 3IAEA 3KLPX 3DTTA 5CVCA 4KTTE 5CCXA 4LF4B 1XKXA 3L46A 3Q88A 3OX3A 4DIKA 3T1OA 4DLAA 2J7PA 1JDJA 5FJJA 4QM6A 1IPFA 4HS4A 1AB6A 2HU5A 3UPDA 3QVGA 3WJ2A 4AIRA 2Q0SA 3OQPA 1EB9A 4TM7A 1PLJA 5TVOB 2HZBA 5KU7A 4B7CA 3HCAA 3EPKA 4N7BA 5CK4A 4MJXA 4BV9A 3BKXA 3P2OA 1H2RS 4XGIA 3L0SA 3MJ4A 2H3EA 4YTEA 3V7YA 3CNBA 1UT5A 3HDJA 4H17A 1CIVA 1EHCA 2HQOA 2W4QA 3PX3A 4Z9YA 2FLWA 3D1LA 2VWHA 3MFYA 5CJPA 1JPUA 5ER6A 1U0BB 1HRDA 1ZK0A 4OHRA 1Y4SA 3C8DA 2QGFA 1IHYA 3ZY4A 1K6MA 3K6SA 4TZ6A 1QOZA 2P4HX 3QPDA 2W2MA 3PJFA 4QYXA 4NQRA 2GXSA 4IUBS 4WHMA 3IXQA 1E0DA 4A2WA 3FFAA 3D81A 4MRMB 5TQJA 3O1JC 2AWNA 1QRAA 3MB5A 2OCXA 1MPXA 2Q4RA 4UVIA 1SU6A 5DKFA 3UWKA 2NZWA 2AI2A 2PO5A 3DDUA 4DILA 4F56A 1TAQA 4KPGA 4O0LA 1E2KA 4DAEA 5IWCA 2O2IA 4AAYA 3AVOA 4F0JA 5LKRA 5K3AA 3GJ7A 2AX4A 1S8FA 4O89A 3JWGA 4V0ME 2O19A 1W1WA 3NEAA 4WAUA 3K2EA 3D02A 3U7QB 5IJZA 2F3UA 2QRQA 5T41A 5AOAA 3BTSA 2FP4A 2V4MA 5J4YA 3ZS9A 1WABA 1RRCA 2JEOA 1Q2XA 3QH4A 1JLMA 3A1DA 5JZ9A 3PNLA 2IIVA 1MT0A 5GONA 2HA2A 1PBTA 2Y8EA 4FNOA 4RNDB 1CJCA 3VPHA 2J9GA 1PYDA 1H42A 4UBLA 5H82A 4HXGA 4CTMA 2UVDA 2BHLA 3W77A 4O4LF 4J75A 3AWIA 5C8YB 3PDUA 3JATA 1DBWA 3KD2A 4GYJA 4YJ3A 5E4JA 2X0EA 4LZJA 5DHAA 4OK3A 3OPYA 3D3NA 2IS4A 3VNVA 3UG7A 3KQPA 4IF6A 1VBKA 4I6JA 3IBGA 4NOJA 1DCMA 3QXCA 3MK31 5JZSA 4B3RB 1TTPB 4I36A 4PX9A 2F9LA 4NOLA 5T8KA 2XUZA 1P44A 3VR2D 3RVDA 2JIQA 1RCUA 1WHTA 2QORA 2OO3A 1XLTC 1WP4A 5IFKA 1E1MA 2BMJA 2ZSIA 4A0QA 3G7SA 2VPIA 5D2CA 1SO8A 3I28A 4I46A 3H16A 4M38A 3DT9A 2RGRA 1OZAA 1OXUA 2GO1A 3EY4A 1VSVA 3AEYA 1L5HB 2JFUA 1Q1ZA 1QIKA 1L9KA 5CP8A 4EK9A 3M6MD 3DE4X 4MVCA 3N2KA 2JGAA 1CTQA 1E3JA 2XGMA 2CT8A 1PG0A 2NXJA 4XEUA 4TYWA 1X77A 3C6XA 4G5RA 3V1YA 2GKOA 4YJGB 1UOPA 3UPTA 3PNPA 2W6MA 1Z45A 2DBVO 1FX1A 1E7WA 1KETA 1YI0A 5ELLA 5JD6A 4RHTA 3FBTA 4AMZA 1ZNQO 4GYWA 1P2BA 1WEHA 4BQIA 4DT1A 2W2LA 1IWBB 4RPLA 3IKJA 1N2SA 4WKPA 3VMMA 1DC3A 1WXQA 3ABRB 5TE9A 4R81A 4P2BA 5H16A 4XB2A 2YZ2A 3DCNA 4CLXA 5F73A 5IM4A 5CDFA 1DE0A 1HOXA 3FTCA 3SBDA 1NMXA 5SZIA 4TX1A 4EYGA 2B1RA 3F6SA 4LCBA 3O1IC 1PSWA 1Y6JA 3E5NA 2IYZA 2JIMA 4QAJA 1JIIA 2D00A 1EFPA 1H1DA 2FWNA 2Q8NA 4D3SA 1O0CA 3G9ZA 2DOKA 1UJ2A 3BFVA 3OCZA 4WXYB 3ZKWA 4A73A 2FN7A 4GXRA 4IOLA 1HLGA 4KYTA 1U8FO 5IANA 4ZYTA 1VLQA 2VOEA 1II8B 2X76A 1WNFA 3JQDA 3PXDA 5A71A 1HFWA 1MP0A 5I8ZA 3UWOA 4EW3A 1SVSA 4TSKA 2ONZA 4IHJF 1GKIA 2IPAB 1VL8A 4PC7A 4QBGB 3CVYA 1XP5A 2PZ8A 1SA0B 1XZAA 4JBYA 4NV1A 3ZCUA 1J5EB 3LCCA 1GL9B 3VR4H 4YBZA 2B8JA 1RAEA 2X4DA 4GPIB 4Q4HB 1AHPA 3CF4G 2DLNA 1AA9A 2BC9A 3EE6A 3M5CA 4XQGA 4HEQA 4EHNA 2ZPTX 1XVIA 2XAUA 3HCRA 3M6XA 2PMKA 1L7VC 3RHSA 4UBOA 2YJ5A 4PPYA 5J4KA 4M7PA 2VRCD 3NC0C 4ZDJA 4MB6A 1L7DA 3KFVA 4Y1RA 3UT5B 4DJFC 5L3VA 1IVSA 2ODBA 3PUXA 2XMRA 3NP7A 5K8TA 1HURA 1IQPA 3QKSA 3H0WB 4LOHA 3M6VA 5IN4A 1BXGB 1HYGA 3QHQA 1Y9JA 8AT1A 3WA7A 5A7FA 8ABPA 4BP9A 1DQRA 2ODEA 1Z35A 4N54A 1NI4A 2BM1A 4DQDA 2YWXA 3RUPA 2H85A 2R7NA 3AZOA 4HQFA 2R44A 1DEOA 5ETJA 5IKOA 2R25B 2JAXA 1QNFA 3IAS1 4Z9AA 5FORA 3U4MA 1L4EA 1NW9B 2X9GA 1QKKA 2FXIA 2XMGA 3LX4A 4UE6A 5EE0A 1V1JA 1P1RA 2L19A 1QH0A 1FVHA 1ORDA 1U81A 2HY7A 5BN4B 1EIZA 1U4NA 2IOFK 4X7BA 4DXDA 3EPJA 1M2GA 3U2QA 1CSEE 5D7NA 3RTBA 4XDGA 1I6MA 1WD7A 4LYYA 3A9CA 3M2PA 4F3KA 1X1DA 5JAZA 4JI2B 1WSBA 3MERA 4QUJA 3WL8A 3K6KA 2UYHA 3AUKA 3L1VA 1XDDA 3BXOA 3DG9A 3DW3X 1KJ8A 2GDZA 1Z29A 4J07A 2UZ0A 1ZINA 3JVDA 5CVVA 5FIUA 2YV1A 2XKJE 3DOCA 1T9ZA 4NX2A 5FPSA 3RSFA 1G41A 2PR7A 5IBCA 10MHA 2DJ5A 4ZYZA 2GRJA 5IKPA 1PD0A 2X2OA 4RPIA 3ZWAA 4Q18A 4HNTA 1WVGA 1YL7A 4OOFA 4B4DA 1C2TA 1EEXB 4M8IA 3MIZA 4Z3KA 3E5HA 2ZWAA 3NNDA 5ARDA 3U9SA 4D1YA 5HR5A 1SKUA 4BPBA 2A94A 3LF2A 3CUSA 3ML1A 1LB1B 1HKUA 3KXPA 4IFBA 4ZI7B 4C43A 1R88A 4B5KA 3R75A 3FOEC 3Q9NA 1XQ9A 1A98A 2IVFA 1WCV1 3CRZA 2Y77A 4QXMA 3BQMB 3ZE8A 1YCHA 4EFLA 1ISPA 4FGUA 2H7CA 1GYRA 4WUVA 2CF6A 2K5UA 5BT9A 4U2CA 4JHLA 4AG5A 4BLPA 1QF7A 2YOHA 3C8ZA 3GNLA 1F1JA 5C7OO 3L7KA 1PGPA 2H3HA 2FWAA 2GPSA 1QH1A 2IF0A 3VTAA 3HU1A 4B2YA 4EA9A 5C3MA 2BRUA 5KTRA 5L3SB 4X3CA 1SQFA 1VSUA 1GSOA 4PQRA 2Z4RA 4XSGA 5CEFA 5BWNA 2FJPA 2FUG1 4TKUA 2DWOA 4X85A 4E7OA 1F12A 2WKPA 4FGSA 2PO7A 4K0RA 4K6KA 2C88A 3TTYA 1KEUA 5KNBH 1VA4A 2QVBA 3H17A 3I3SR 1VKRA 2ZSDA 2V54A 1T5TA 3FF1A 3IIMA 3AO0B 3SSAA 1JEYB 5FYQA 1RKXA 4JZYA 3IRUA 4AP5A 3HNPA 3VC2A 4RVFA 3CC8A 4ZHQB 1UBFA 1UMDA 3ADKA 4LDZA 2PGJA 1BVUA 4QU0A 5CAEA 1MTOA 4I4TA 3E18A 1DQZA 2VDKB 3I34X 3NRJA 1TTTA 4MIEA 1MO5A 4M49A 1JH8A 1LF5A 1V47A 1K27A 1W8IA 3C0KA 3HZHA 3MGKA