1H6DA

Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
383
structure length
383
Chain Sequence
QAATLPAGASQVPTTPAGRPMPYAIRPMPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Precursor Form of Glucose-Fructose Oxidoreductase from Zymomonas Mobilis and its Complexes with Bound Ligands
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Protein translocation
molecule keywords PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
total genus 126
structure length 383
sequence length 383
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2001-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h6dA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h6dA01
1SAYA 3QHAA 2I9PA 1R16A 4KDEA 4IM7A 2NVBA 3GMDA 3PFFA 1U3VA 1ONNA 3LZ6A 1ZK1A 3LC7O 3QVWA 4IIVA 4JBHA 5DOZA 1SOVA 3K96A 5C7OO 2I66A 2R00C 4GWGA 4PLCA 4Y6SA 2YV1A 3IUPA 3OJLA 3JD1A 5G0VA 2AG8A 2Y68A 2V65A 1W8DA 4Q9NA 3LC1O 1QYDA 1DLIA 3TZ6A 1P33A 4IPTA 1PZGA 4EUEA 2DU8A 3I23A 4Y98A 3W4JA 5JCXA 1N1GA 4UUNA 4DBVO 1ID1A 3AY6A 4R69A 3GDGA 3GUCA 3L6OO 3IDSA 1LSOA 3WYBA 4OL9A 1C1DB 4WLUA 3PWSA 3ZWXA 5C5IA 3HDYA 1IOLA 4CLHA 2AW5A 1NVTA 2Q4EA 4YJGA 2DBRA 5THKA 3WQSB 5I7SA 4CMJA 2VYVD 3KETA 2VZ8A 1KS9A 1AHHA 3KLPX 4R1UA 4R01A 4YJGB 4YJDA 1ULSA 3SVTA 1GR0A 3UHAA 2BELA 3I9KA 1U4SA 1Z45A 5ITVA 3FNHA 1YQGA 3TN7A 3B6ZA 4HV4A 3TF5A 2NQ8A 4E13A 1MC4A 3ZNQA 2Z1MA 1NHWA 1VL0A 2G5CA 1LLUA 3I3OA 1I33A 1UZMA 3ETDA 2GN9A 5CDYA 4NU6A 1XU7A 1ADGA 3QWAA 3TPCA 1MFZA 3DEYX 1E1MA 4DC0A 1KETA 2Q50A 5EL0A 3VH2A 3ZI0A 5ILOA 4CM5A 4IDFA 4O1MA 3PTZA 3WGOA 1PJ2A 5JC8A 2IYOA 2FPIA 3CEAA 1C14A 1R66A 2J3KA 3PFWO 1HDCA 2VOJA 2AEFA 3DHEA 5DCYA 2PY6A 3RUCA 4B4UA 4RJTA 4INAA 5IFLA 1T2EA 4CL8A 1K6JA 3D4NA 3QP9A 3AW9A 3GF4A 2QRLA 4ZQFA 4ZHSA 2UAGA 2VUSA 3KVOA 3OIFA 4FSHA 1D7OA 3DBLB 1Q7BA 3JQ9C 3ZNPA 1NM5A 5AXAA 1GZ4A 3ASUA 4JBIA 4OQZA 4CMIA 4OOFA 4CQMA 4L76A 1ENZA 3JQAA 5G0UA 1MXHA 3SC4A 5KJ6A 3DZIA 4BGIA 4H7PA 4GSLA 1DHTA 4E32A 2FHSA 2DKNA 1KVUA 4ILKA 2P5YA 3I5MA 3ZWWA 1ARZA 4IQ0A 2DLDA 5KJFA 1E7RA 4ND5A 3RJ5A 2JFFA 2Q3EA 1SO8A 3ZNOA 4L9RA 1PZHA 4U7WA 2X5OA 3WR5A 2NTVA 2WJPA 1OOEA 1BWSA 3PHIA 4NZ9A 3BHIA 4AJKA 1U9JA 3QIVA 3OP4A 3WMWA 1R4MB 2YDYA 3PVZA 4XQEA 3RASA 3PK0A 2X4GA 4IXTA 3ANNA 1G1AA 1YDEA 1NXQA 2EW2A 1JKFA 1YXMA 4CM9A 5A9RA 2HK7A 3BXXA 2CUKA 4IBOA 4YAGA 1NQAO 1ZK0A 1T2CA 2QZZA 1LLCA 1BDMA 3JQ9A 4OJNA 4OYRA 3OECA 4IGEA 2GGSA 1GYPA 2GN8A 2G82A 4ALKA 4ND4A 4YQZA 3CH6A 1AXGA 3R0IA 1EBFA 4MINA 5T5QA 1ZZEA 2DTDA 2I6TA 3C1OA 5IXYA 4RQTA 5A3VA 4BO7A 1Y8QA 4B3JA 4RF2A 4YJHA 4YTEA 4DQVA 3SX2A 3PZRA 2OHXA 4Z9YA 4RZHA 3JCZA 1HKUA 3GPIA 2OL4A 5JO9A 5GZ3A 4JJFA 1NP3A 1Z7BA 3WWZA 4CMGA 1YQXA 2ZB4A 4A03A 5CDSA 4HBGA 2C2YA 5KJCA 1B26A 3UGKA 4D0RA 2C82A 4GMGA 2D1YA 1C0KA 4XGKA 1V6AA 2O7QA 3ROQA 2W8ZA 2EW8A 1ISHA 4DLAA 4MKZA 3KXDA 2VRCA 5AYVA 3O26A 4QO7A 3W8EA 5IJZA 3RC7A 1FDVA 3G1UA 5K9ZA 1VPDA 3EW7A 4MP6A 1AE1A 4TWRA 4I9NA 2X0RA 4U0JA 7MDHA 4WLVA 4G81A 1P1KA 2BFAA 4ALLA 1FF9A 4E31A 1K3TA 3F9IA 2C07A 4AICA 1P1IA 4MPDA 2O2YA 4DL9A 5CG2A 2YY7A 3PPIA 2Q46A 3DC2A 1EVZA 3DFZA 3SEFA 2OFPA 3HN2A 2DTXA 4GGOA 3JSAA 4ZQBA 3Q9NA 4BNWA 1U4OA 2WTBA 2X58A 1A5ZA 5DP1A 4EJMA 3ETGA 4FFPA 5DT9A 3U5TA 3NTOA 1F14A 2YJZA 2JKVA 5DNAA 4BNMA 3AUTA 3B1FA 4EEZA 3PIDA 4CM7A 3JYQA 5G0WA 2HMWA 2C20A 5F5LA 5DDIP 4YQYA 2Y1EA 2JCVA 5EERA 3MTJA 2B37A 2C2XA 3GQVA 2CZCA 1Y9EA 4J7XA 3HFSA 3I4FA 2HJRA 2AE2A 4R1TA 3IMFA 4OH1A 4WCFC 4BGVA 3JD0A 5A4DA 2B0JA 2PZLA 3B70A 3JQGB 2OBNA 4YBZA 4AG3A 4EUHA 3H3JA 4G5HA 4IDBA 4XRGA 1IPFA 3VDQA 4W6ZA 3CMCO 4I5FA 1K6XA 4D45A 1TT7A 3QWHA 4P8RA 1LSJA 3D4PA 4A5OA 4OSOA 5AQ1A 3DB2A 4GVXA 3LLVA 2CF5A 4IXWA 4CMKA 4AFNA 5DZSA 3WS7A 2ZK7A 3JD3A 3KLMX 1BVUA 4RVHA 4PLHA 2JFGA 3RCBA 2WD7B 5EMHA 4A7PA 1LDNA 2O23A 3PHHA 3ZU5A 3K2BA 4CR7A 2FZEA 3WGZA 2Y1DA 2PK3A 4IINA 4NFHA 3C1TA 3OFSA 1Z7EA 2BHLA 4GX1A 5DF1A 3PDUA 2VZ0A 3GRKA 3INTA 5JAMA 3OA2A 4A2CA 1UXJA 4KWHA 3PWKA 5FEUA 4BNZA 1HSZA 3U3XA 1TXGA 2PA3A 3V5NA 2TMGA 4FDAA 2BGMA 4BNFA 4BKUA 1YWGO 3SBOA 4XGIA 4E33A 1DBVO 2I99A 4E4YA 1MGOA 3D0OA 5TLSA 1P74A 3SJ7A 3JYPA 2TMDA 1LUAA 4S1VA 5ENVA 2E4AA 3QWFA 1HDXA 1E6UA 4RZIA 3K8ZA 3FSRA 5I9MA 4FFRA 3ANLA 3SC6A 4ZGWA 1JWBB 3DAPA 4R54A 3IC5A 3H9GA 4LSWA 3PYLA 1U28A 2BFOA 2B36A 3DZKA 4NJMB 3WICA 4RORA 1HZZA 4IJKA 1Z75A 1QYXA 2D2IA 3OJ0A 2UVDA 3Q6IA 1AXEA 1B3RA 4DVJA 2RCYA 1JWAB 4ESOA 4BNTA 3A14A 1VL8A 3QV1A 4M87A 1GYRA 3ZV5A 3I9NA 2VWGA 2HU2A 5F1PA 1FDUA 5L7TA 3DBHB 4GGPA 5HS6A 2I76A 2AXQA 3OQ6A 3JYOA 2JL1A 1R15A 1V3UA 2CVOA 4J91A 3DZGA 4NQZA 4OKIA 4MVJG 4J4TA 2IDZA 2NVUA 4QFCA 1GUFA 3V2UA 4G65A 5A3JA 3AJRA 4GKVA 1JAXA 3AFMA 1P1RA 1PS8A 4D79A 1DEHA 5JSFA 2BD0A 2EV9A 2F00A 1ZEMA 4PG5A 4LRTB 4IQ8A 1GDHA 1IL0A 4TVOA 3FHLA 1QYVA 4NBVA 3BTOA 5M6DA 2PKQO 2Y1GA 4KTVE 5EJ2A 5B4VA 1FK8A 3A9WA 1SOWA 4DPMA 2ZCVA 4YAKA 1LXCA 1VM6A 2E37A 3I9JA 3O03A 2PKQP 3C1AA 1HE5A 3WGGA 2PD4A 2QG4A 4AJHA 2IZ1A 5JNLA 3C7AA 4FCCA 2DTEA 5L7YA 1NWHA 1XIVA 3WJ7A 3UICA 1PS9A 2DUUA 4URFA 1R12A 4HXYA 1E3JA 4EBFA 1CWUA 2C5AA 4J3FA 3JQAD 4Y67A 4B79A 5IXSA 5JMWA 3K9QO 3QLJA 1KEUA 1S6YA 4QSMA 1O94A 5DBFA 1U3WA 1DRVA 1HDGO 1S7CA 1BTOA 2NU7A 1QV7A 4IDCA 2IODA 1LRJA 3TWOA 3INGA 3C3XA 2GPTA 3MCVA 1DIRA 1E3SA 4XQGA 4B8ZA 5JO0A 2X1HA 4NU5A 4BNGA 3QQPA 3AOGA 2HQ1A 2CDAA 1NPYA 2VHYA 2O3SA 3HZZA 1GQ2A 3P7MA 4GWKA 2PZMA 2Y93A 4GSKA 4GMFA 3NEPX 5T67A 3JQBC 2VCYA 1LX6A 4BQPA 2VYNA 3IS3A 4WNCA 5A5FA 4DPKA 2HDHA 3WSVA 4KQXA 3E03A 4XCVA 3NGLA 1Y6JA 4K28A 4O5OA 3Q3CA 4ZN6A 1LA2A 1I3NA 4Q3BA 4U6QA 1GUYA 4YJFA 3HHPA 4F45A 4NBWA 2QX7A 4DBZA 2JJYA 5CEJA 4LN1A 4R3WA 2WYVA 5FI5A 1EUZA 1XQ6A 1PGQA 3NKLA 4FW8A 1HYGA 4Z9XA 4MVJE 2ZB8A 4QECA 2VT3A 5HA5A 4YRAA 1UDBA 4R9RA 2HRBA 2ZB7A 4DREA 3D7LA 3PJEA 3WBBA 3V8BA 3HQ4O 4AJIA 5JYEA 4ZVVA 4IDEA 1PWZA 3QA9A 2ZJ1A 2C7GA 2ET6A 4E12A 3WLFA 3I1JA 1O95A 1QR6A 3SXPA 3CUKA 1EE9A 4ZA2A 3TRIA 4PIVA 5G4KB 2D0IA 2OUIA 4JN6B 1HE4A 4C7JA 4PG7A 1PL6A 1WXDA 4Q3EA 1W73A 3TSCA 4J49A 2JCYA 2D8AA 3W8DA 4CLOA 4JXKA 2HKIA 5I8ZA 3K2EA 3BHJA 3OICA 1E5QA 1DSSG 1YB5A 4BHTA 1P1FA 2GUGA 1QYWA 3JD2A 4J2OA 1YE3A 4M86A 4Z6KA 1JQBA 1I2CA 1XWFA 2J3JA 4DRYA 3QSGA 3GFGA 4EJ6A 3DHYA 3WIDA 4M8SA 5B4TA 5FYDA 4KTTE 4BO2A 2D4AA 3BZUA 3MTGA 2J3HA 4FIZA 5CDUA 3OSUA 1UXHA 2PGJA 3MJTA 1LU9A 4RGBA 4DIBA 2X7HA 3DOOA 3H2SA 2NLOA 4AVYA 1UH5A 1UP4A 4PRLA 4BMSA 2HK8A 1BDBA 4K6CA 1E3WB 4IJVA 1FXSA 1WDMA 3U4IA 3ABIA 4TKMA 3JQ6A 1DFHA 4GH5A 5B4UA 2OP0A 3LC2O 1O8CA 2GZ2A 3WWYA 4LMPA 1E7WA 3ON5A 4MKXA 3X2FA 1PR9A 1EBUA 5I7VA 3GEDA 8LDHA 3TFQA 3GZ4A 5CDTA 4PVCA 4A73A 1F8FA 4MVJI 2WE8A 1PEDA 2AG5A 2WWRA 3OIGA 2OXIA 3E18A 3I6QA 4U0KA 1B3BA 1W4ZA 4R41A 3GN1A 4F6LA 1N8KA 3OEWA 4CV2A 3JQCA 3NGXA 4HFMA 3E5MA 4UUMA 3HDJA 4FFLA 4D7AA 1RWBA 1DIHA 1ZEJA 2W2LD 4ROSA 3L0DA 2NU9A 1G0NA 4CMAA 2WD7A 1ZXBA 1GQQA 5HBRA 1ZXLA 4BB6A 3ZHZA 4CM3A 1PJTA 5IG2A 1HRDA 4WPGA 1UAGA 3VPSA 4WNIA 2JCXA 3DDNA 4XJTA 4RVUA 5CDGA 3L9WA 4AJNA 1H94A 4PVDA 4FGSA 3CXRA 3V2GA 4R3NA 2Y05A 3C7CB 4B4VA 2D5CA 4CV3A 4PN3A 2BI7A 1OBFO 3ST7A 3I9LA 4J9UE 4CLXA 4PLGA 3PYXA 3FNGA 3VVCA 4OOEA 3AK4A 3JTMA 1KVSA 1U7HA 3I4CA 3AOEA 3E82A 1PGOA 1KC3A 2UUPA 2ZCUA 4OMUA 2XF8A 3WQRA 3OM9A 4MP8A 2JAHA 3HE3A 5CPBA 1HEUA 2G17A 1E7YA 4HNGA 3DWFA 5JLAA 4JIGA 1XYGA 2XPCA 3KEQA 3PRJA 1EE2A 4Q3NA 3JQ7B 3E1KA 4DXHA 1UAYA 1U3UA 4BS9A 2AMFA 1LEHA 4PCVA 2Q22A 2GSDA 3D3WB 1LDYA 3BMCA 4B4WA 3BA1A 3EZYA 1U1IA 4WOJA 4EJ0A 1N92A 3UVEA 1WAMA 4E5MA 1DO8A 1R0LA 3OJEA 2CF6A 1XGKA 2POQX 4D3DA 2ZATA 4J7UA 4NPCA 3PIIA 1ZJZA 2GYYA 4WCDA 3MOGA 2ZQYA 4N5MA 4FS3A 2OZPA 4BV9A 1UP6A 3OEYA 3CMMA 4I9HA 1MX3A 3RUDA 3FTNA 1T2AA 1KY5A 3F46A 4RF3A 2QZ9A 3RKRA 4DUPA 3SJUA 1PQUA 3L07A 1ZW1A 3PQDA 3ZW9A 4BOYA 2VYND 1X15A 1YRLA 2VUTA 3VDRA 3GHHA 4XR9A 4BNVA 1PZEA 3EUWA 4WLOA 3S2FA 1ZUD1 4R1SA 1E3LA 2Y67A 5JDIC 3CINA 2ZQZA 2I3GA 1PU2A 3WFJA 2YHIB 4M1QA 5TF4A 2PZKA 3ZNNA 1VSVA 3F5QA 3PJDA 5I7EA 4CUJA 4ZD6A 4TSKA 2HJSA 3WB9A 1XLTA 5H82A 1Y5RA 4CMEA 2AQKA 4II2A 1KEWA 5T8KC 1P45A 4XB2A 4UREA 1PJSA 3S2IA 4ITUA 4YXFA 1Z6ZA 3WGIA 4BO9A 3FNFA 4M49A 3KOUA 5KVVA 1Y8RA 2OGUA 1LNQA 3GT0A 3UOGA 3CE6A 3F4LA 1HF3A 1JKIA 2HO5A 3E9NA 5KTKA 3DMTC 3OQ1A 4WE3A 1QG6A 1SC6A 1C1DA 3GGOA 5T6BA 3RUAA 1WW8A 3PGJA 4BNJA 3DFUA 1F06A 2X5JO 1EMDA 1SPXA 1T1SA 4BNHA 5GY7A 2PH5A 3K73O 1Y7TA 2B83A 1LRLA 1Y81A 3DBRB 4JQCA 3ROPA 8ADHA 1C0PA 2V6BA 5DP2A 4TMFA 3WOHA 2DM6A 3T4EA 2Y99A 4CM8B 2O3JA 1DRUA 1ZIDA 3S8MA 4UUPA 3E5RA 5CP8A 2R2GA 4CMEC 1LBEA 5EQDA 1HZJA 5T8KA 4BMNA 4CLEA 1VL6A 1XELA 4RDHA 4CMHA 3TZCA 2HMSA 1LC3A 1BXZA 1YL6A 1UUFA 4FJ0A 1TT5A 1NPTO 5HWSA 2CMDA 3VPHA 1Y5MA 5B1YA 3VVBA 2DC1A 3HG7A 3ZHBA 5ITWA 3IUSA 1C3VA 4BNYA 3GLQA 3UCXA 3DO5A 5BR7A 4KUHA 5BSEA 5T57A 2IEDA 2X5KO 2VQ3A 2J5QA 5EQFA 4XKJA 4D0SA 3GRPA 2EKQA 1WDKA 2WEKA 1DAOA 2LDBA 5CEEA 3A1NA 1JTVA 3ZW8A 2PGDA 3F5SA 3R3JA 3D3EA 2IYPA 3TFOA 3CSDA 1X7DA 3L4SO 3G1TA 5AOVA 1WLYA 5T64A 5L40A 4XGNA 1LQTA 1H9BA 1A72A 1ISMA 4LMRA 1BXKA 4OXYA 4R5HA 1EFLA 1IZ0A 1D1TA 3GNSA 2VZ9A 1H6CA 4FJ2A 3ZU4A 1P0CA 4CM9D 4J2HA 3AY7A 3V2HA 4D3FA 1ENPA 5BNIA 1EK6A 1B2LA 4U6SA 4BO5A 1UXIA 3ETEA 3O38A 4K1LA 1J0XO 3MZ0A 1PQPA 3EGOA 2WYWA 3ITDA 3STHA 2WD8A 4HUJA 3KSDO 4R4JA 4J0EA 1TT5B 4P4NA 4TKLA 3NTQA 2AE1A 3GVHA 3AY3A 1D4FA 4CM1A 4YB8A 1E92A 3A28A 2YHUA 1CJCA 4MVJA 5TIIA 4GLOA 3WTCA 4J0FA 2EGGA 4GPD1 1DJNA 3INRA 5KJEA 2P5UA 3DONA 3G17A 1GADO 3ZV3A 4BL5A 5AXCA 3IL2A 1GCOA 3VPFA 2IZ0A 3C85A 3KV3O 4N5LA 4O63O 3ORFA 5I7FA 1KVQA 2DBZA 3UUWA 3EHEA 3LT0A 4RCVA 2X8LA 3VHRA 1ONPA 3DAGA 1O89A 2A94A 1SB9A 4WUVA 2Q4BA 3DOCA 3JD4A 4KZPA 1H2HA 4NHEA 1VJ1A 3OQBA 3PHJA 1ISIA 3AI3A 1R0SA 5J23A 1WNTA 5TSDA 9LDBA 2E6UX 2P4QA 1Z73A 4WOKA 4WLNA 5A06A 3AI1A 1ZMTA 1B14A 4II3A 4AJOA 1MC5A 5MDHA 2HMTA 3GZNB 2HSDA 5A05A 2VWQA 1B0AA 4JP3A 2HMVA 4H3VA 4UVGA 2YW9A 4J7CA 2V6GA 4R5MA 3PQFA 4EGFA 4OO3A 2XXBA 5BNTA 4I1IA 2O3QA 4TZKA 4XEHA 4FOOA 3UFXA 2EF1A 3BTSA 5JW6A 3GVCA 4NDNE 1BVRA 1HL3A 4J1NA 2EG9A 1IPEA 2O7SA 4CV1A 3IJPA 1QYCA 3MJ4A 5C7LO 4QTZA 5L3ZA 1PIWA 3AUUA 1J6UA 4BNUA 1GPJA 5G2OA 1LTHR 1EVJA 1H9AA 4BIIA 1SEPA 2ZYAA 3MEQA 2Y0CA 5JCJA 4DQXA 3O8QA 1EQUA 3KM0A 4GLLA 3KYDB 4IUYA 4CMCA 1Y1PA 2ZTLA 1DC4A 3WDSA 1Y8RB 1JLLA 3C24A 5LDHA 4FR5A 5IF3A 1LJ8A 4I5EA 4NFYA 1CDOA 3ICPA 3MJSA 1PQWA 4ONEA 2PFGA 3WG9A 3FR7A 3K5PA 1E7MA 1WDLA 2OBYA 3M1LA 2V6MA 1T4DA 3A06A 1E1LA 3KSUA 2W90A 4RV9A 5U9CA 2DPGA 1E0DA 1GQYA 4GL4A 4F3YA 2YZ7A 3RFVA 5C3MA 1MG5A 1NAHA 2CNBA 4BUCA 4BNNA 5COAA 4UVDA 2NM0A 2W4QA 3GFBA 1LRKA 2JD2A 4J4BA 4RPHA 2IRWA 5L4LA 5F5NA 1GEEA 1NWCA 2GLXA 3GGGA 2H63A 4E6PA 4K9DA 3RBZA 4ND3A 4YWJA 1Q0HA 1YQDA 1ZJYA 1XQ1A 5ER9A 3H9QA 1SNYA 4N18A 6ADHA 1SCUA 3LT1A 4NBTA 4PGFA 3OBBA 3KHUA 3QWBA 5JY6A 1UZLA 4QFDA 2C7VA 2VHXA 4RPLA 4TRNA 5TX7A 1JW9B 2B4RO 3R3SA 3BMOB 3RVDA 3S2GA 5F1KA 4HKTA 1UDAA 1KVRA 1NQTA 5DULA 3MWEB 3BMOA 2B4QA 5KVQA 2ZIZA 3IKTA 1FDTA 3LDHA 4BO0A 2VWHA 3MJVA 4CLOB 1A71A 1AUPA 3I9MA 4NNJA 1Q1NA 4IDGA 2QQ5A 4YT4A 1EK5A 5FFFA 2YHIA 2G76A 3IAHA 3CZRA 2X6TA 4RO0A 1DDOA 4S3MA 1WZIA 5A02A 5L95A 1M76A 4LVUA 5ADHA 1BW9A 1PL8A 3WQQA 3VPXA 5B12A 5JBIA 2Q1TA 2ZYDA 4ZQHA 5BNFA 4LVCA 3P5SA 4PRKA 2ZB3A 3QE3A 4J4HA 1NVMB 3GR6A 1MFPA 3A4VA 5L4SA 3W4KA 1VI2A 4Y6PA 3CZMA 2EERA 3ZWVA 3ZWCA 5ICMA 5JAZA 1QRRA 1ULUA 3WNVA 1YO6A 5JY1A 4JK3A 1MLDA 1YB1A 4TZTA 1UP7A 3Q0EA 1K89A 4YPOA 1ZBQA 4CLRA 3LK7A 1SMKA 3OF2A 1TB4A 1TVEA 1NBOA 4BO8A 4N54A 1ZSNA 1PGPA 3LT2A 1PGJA 2GF2A 4FOSA 4Q3DA 4IS2A 5HRUA 1E1NA 1DIAA 1HWYA 1EDOA 1NR7A 4DPLA 3X2EA 4HADA 3BMQB 3S2EA 2RH4A 4H15A 4K26A 1LQUA 4AJ2A 4FGWA 3RJ9A 3I6IA 1YONA 4R1NA 1LDGA 3EMKA 3DBLA 2H5LA 3RQSA 1UDCA 2NNLD 3PWZA 3TL2A 1X7GA 2D3TA 4TQGA 3ENNA 5IDYA 3FPLA 2I5PO 3RKUA 4B7UA 1FDSA 1GV0A 2IE0A 4PFJA 1DFIA 5CFZA 3T7EA 1FJHA 1P77A 3BHMA 3T4XA 4N7RA 1I36A 4ND1A 3QVSA 4R68A 1NFRA 3PLNA 1ZCJA 9LDTA 4FPXA 2Y66A 4JGBA 4CQLB 3UCEA 3WX0A 4U5QA 1U2GA 5CPFA 3WYCA 5IZCA 2E48A 5AVOA 4CL3A 3IIEA 3GVIA 1P3DA 2VRBA 4I9UA 3LYLA 4YVFA 1UXGA 3HN7A 4P38A 3O9ZA 5A5EA 3AI2A 3G49A 1XEAA 1QLJA 4CQLA 1JDJA 2GCGA 1GFSA 3QVTA 4PLPA 1YOVA 3U4CA 4E2XA 6LDHA 3NT5A 4WCFA 3N58A 3O8QB 5JMPA 3KB6A 3KYCB 4L74A 2VOEA 4CM8A 4NFSA 1QMGA 1R4MA 2BFMA 3HFGA 4ALJA 5JDCA 1EVIA 2GO1A 1YKFA 3F1LA 1CF2O 1DPGA 5DBIA 3NDRA 1JAYA 3IP1A 7ADHA 1PJLA 3QW2A 1KC1A 4NJOA 1P1HA 5CG1A 1MB4A 5F1OA 1DXYA 4W99A 4OHUA 5IZCC 1QKIA 3LVFO 1ZSYA 3VTFA 1XHLA 1XSEA 4MDHA 5AXDA 3RROA 2B5WA 1RM3A 3OIDA 4L4XA 4OSPA 4ZJUA 1R4NB 3GG2A 4YT5A 3S55A 4E0BA 4QT0A 4AL4A 3LSYA 2VTEA 2AEMA 2E82A 1M6HA 1RM5A 2NVUB 4YAEA 4OIMA 5G4KA 5BSHA 5L45A 2CSUA 1CEQA 3PP8A 4EI2A 4MVJF 3GMSA 5AXBA 4XYBA 1EZ4A 1E3EA 1AN9A 1YBVA 3OJOA 3ONDA 4DC1A 1HT0A 5K0ZA 3WGTA 4K6FA 5TJ9A 4D46A 1NR1A 2P91A 4ALNA 2XXJA 3RC9A 1HDOA 1E3IA 1I01A 4IZHA 1NNUA 3EVNA 3ONFA 1BW9B 5U4QA 1LDMA 3PHGA 3IP3A 5F21A 4IQGA 1N7HA 3KEOA 1T24A 4JROA 4QXMA 3KBOA 3IOYA 4XJSA 1BGVA 5EPOA 1LI4A 4BNXA 1YJ8A 1Y8QB 3H5NA 3GG9A 2C59A 2BGKA 3LF1A 2O3TA 3D64A 1L7DA 3AU8A 3GC6A 3HB4X 4GAEA 2PNFA 2JHFA 1IY8A 3L77A 4GQAA 3CPSA 1D1SA 1XR3A 3Q1LA 1PGNA 3DZBA 1XU9A 2CDCA 3GNTA 3VC7A 2X0JA 3ADOA 3TDKA 3QRWA 3U09A 4W82A 3RI3A 4FD3A 4L4RA 5FF9A 4EZBA 3ZGYA 4GVLA 5G4LA 2O2SA 4EUFA 3GEGA 2Q2VA 4E3ZA 2Q2QA 1ENOA 1JVSA 4QQRA 1K5HA 3GUYA 3RUHA 3ZZNA 4DLLA 2P4HX 1XCBA 2BMAA 2H6EA 2Q45A 3BAZA 1NQOA 2LDXA 4BB5A 1LDBA 1XKQA 3DTTA 2EP5A 2X0IA 2SCUA 3WTBA 2NSDA 4XDYA 5THQA 1I3MA 1Z74A 2P9EA 3BYZA 1LC0A 1ZK3A 1ADFA 1ISJA 1TEHA 4PG4A 4UVIA 2W2LA 4D42A 3FD8A 4J16A 2AQHA 2VTDA 1M75A 3L9XA 1ISFA 2EXXA 2D59A 4BNLA 3AWDA 3JQ7A 4L4SA 3VKUA 3ZHYA 3HB5X 5ILGA 4YYZA 3QY9A 2BFPA 2C0CA 3RU9A 1PX0A 1GUZA 4FC6A 4IJWA 2QIOA 4BGEA 2WE7A 1A4IA 3JQ8A 1NFQA 4BKPA 4RF5A 2GASA 3RAJA 4MIOA 1VLLA 2DUWA 1VC2A 4N5NA 5KOIA 5KNLA 1ZH8A 3GVXA 2OO5A 4CR8A 1F8GA 2BRUA 1DRWA 5TT0A 4AJEA 5FWNA 2ZTMA 4OGWA 4PZCA 3ZN2A 3W6ZA 4L75A 2OORA 1XG5A 2OMEA 4EEXA 4LGVA 4LK3A 3JQ8B 3F4BA 3NYWA 5ES3A 1YGYA 2OP1A 4RF4A 5ICSA 3JQBA 4RDIA 3ROKA 3TJRA 4O0LA 4P22A 1WP4A 3LLSA 1L7EA 1HXHA 2DBVO 1OFGA 2YUTA 3NJ8A 3BIOA 3RC1A 4Q39A 3VH4A 4HFJA 3UH1A 2X9GA 3JQFC 4ZRMA 1PR3A 4PG8A 4KUGA 3ZWOA 4RL6A 1U7TA 4Z9FA 1LDEA 3FF4A 4JX8A 3ULKA 1R37A 3OJFA 1DLJA 3FN4A 1YOVB 3G3EA 2Y1CA 3WXBA 3FBGA 4DWVA 4WJZA 5IN5A 1DOHA 4G2NA 3TL3A 1A9ZA 1Z82A 2NTJA 4O6VA 1U8FO 2C29D 4HWKA 4YJHB 4DYVA 3F6YA 1C1XA 1RPNA 5TQVA 3S1LA 4MJLA 4A27A 4CM6A 1NPDA 4ALMA 2FY8A 1AGNA 1NVGA 3FCOA 3U0BA 2A4KA 2O50A 4DMLA 1HSOA 1E6EA 2J8ZA 1E7QA 1KERA 4E2YA 4WLFA 3MJCA 3OMLA 1PJCA 4IDDA 5U1PA 1C0IA 1GPDG 5IDWA 3JQFA 4XDZA 3TZQA 2CY0A 3ZV4A 1Q7CA 2CVZA 3WGYA 1I24A 2JFHA 1H2BA 3QVOA 1VJ0A 1N5DA 1ZSVA 2VHWA 1PWXA 2G0TA 2PTGA 3PGXA 2B4TO 3VTZA 4DQUA 4W9NA 3LQFA 1HYEA 3WFIA 1SBYA 4AJPA 1EQ2A 2NADA 5EN4A 4KUEA 1DFGA 3IKVA 4Q3CA 1N1EA 1O6ZA 3M6IA 3H2ZA 2VHZA 2QYSA 2O3UA 4XD2A 3WYEA 3H9EO 1M6WA 3WNQA 3K6JA 5BQFA 1BHSA 5DBGA 4MOWA 3P2OA 5ER6A 1PTJA 4MIEA 1C1XB 4HFRA 5JYFA 3HADA 1VSUA 1GL3A 4CQMD 1B16A 1P44A 3LT4A 4LSMA 3ZWMA 5L9AA 1I2ZA 3F3SA 4BO6A 4IMPA 4TROA 3VKVA 1MP0A 4PLTA 1GZ6A 1YL7A 4CM4A 1IE3A 2PD3A 3KRTA 4MVJH 3NUGA 3TNLA 1CRWG 4D43A 5KVSA 5CHEA 1DC3A 3T7CA 2J3IA 4QUKA 1JA9A 1YBMA 4E2ZA 1ZMOA 4C7KA 5HM8A 3DQPA 1U8XX 1CQJA 2GN4A 1N9GB 1I30A 1ZKMA 2O3RA 3F47A 1I32A 4CQMB 4XRRA 1VE9A 2WMDA 4F6CA 1MV8A 3M1AA 4IIUA 4BKQA 3DBRA 5JYAA 3JQGA 3OETA 4W9NC 3R1IA 2XOXA 3GEMA 2RH8A 5DCUA 2BH9A 3PJGA 4BO3A 2X9VA 3ZU3A 2EKPA 1I2BA 1GY8A 2P68A 4GX2A 1N9GA 3AUAA 1GYQA 1U2DA 2I65A 3GDFA 3W6UA 1T2FA 5CEFA 4UVHA 3H6KA 4KMSA 2PR2A 3WGHA 3EAGA 2PZJA 4R16A 4GI2A 4GBJA 1NHGA 2DFVA 2FSSA 2PH3A 1G0OA 3NV9A 3ZWAA 4F46A 3NJ4A 2DQ4A 4XYEA 4WK6A 1O0SA 3PHLA 1IHYA 3D5QA 4XQCA 4B7CA 3ICCA 3NX4A 4OQYA 1V35A 2FR0A 2Z95A 1LSUA 2FWMX 4EDFA 2FRDA 3VZSA 2A92A 4R9SA 5KCZA 2X9NA 3CKYA 3OHSX 2NU6A 1EEHA 5EIOA 2CVQA 3GNQA 1KEVA 3OH8A 3Q11A 1E5LA 1RKXA 1C0LA 5KVCA 3AU9A 1V9LA 2FPGA 3D1LA 3E9QA 3MWDB 3U9LA 3PZBA 4J9VA 5TT1A 3FRJA 4BV8A 2V6FA 4XZ3A 1GD1O 1X7HA 1H5QA 3QVXA 1QLHA 4DTIA 2BF7A 3C7DB 3LF2A 4P4LA 4JJGA 2J5KA 1JKJA 4YA6A 4D3SA 2NV6A 1CERA 4DMMA 5KKAA 1WWKA 2JD0A 4JCOA 2GN6A 1X0XA 3PXXA 4IGFA 4JJIA 2DFDA 1BXGA 4YCAA 3PEFA 2Y1FA 4EYEA 4CUKA 5IDXA 1F0YA 2FOIA 1EFKA 1H6DA 2W2KB 4RVDA 1PJBA 4OAQA 1RJWA 4I08A 3K92A 3VOSA 5EINA 1X1EA 3BMNA 3LU1A 1N7GA 3GK3A 1E7SA 3E9MA 3KYBA 1M2WA 4LW8A 3DZJA 3UF0A 4W7IA 1ADCA 4NK4A 1BSVA 3FWNA 5ENDA 5TNXA 3C8MA 3EY4A 3GH3A 4IMRA 1K6IA 3U49A 4FJ1A 3U62A 4H16A 2WYUA 4Y9DA 4DGSA 5L4NA 4GX5A 4PLYA 4BKOA 2HUNA 2FSVA 1B8VA 3KSZO 2A9FA 3PDJA 4CMIB 1PJQA 1HE2A 1VRWA 3Q2KA 2I3AA 3JQAB 3HJAA 1BG6A 2CFCA 2V7PA 1ZK2A 3ENKA 3PQEA 4RQUA 2NQTA 3U4DA 2HAEA 2Q49A 2AA3A 2RBEA 4PLVA 1DC6A 3BTUA 4CODB 2YV2A 3V1TC 4J1SA 1B8UA 3JV7A 1O5IA 4WKGA 2VNSA 3WIEA 5KJ1A 2FPPA 4BMVA 5F3RA 1B7GO 2FMUA 1PS0A 4XB1A 3ZCXA 3KZVA 3DBVO 4ZICA 3I52A 4FFMA 3RFXA 1ZO8A 1KOLA 1GCUA 3H3FA 2VT2A 4AJ1A 2X23A 5JAQA 3EDMA 3FBTA 2D5AA 2GDZA 2H9IA 3Q9UA 3L4BC 4HX5A 1NTOA 4M89A 4NR0A 3DZFA 2IXBA 4NBUA 5H83A 1NX6A 4I8XA 3CTMA 4BNIA 2QRKA 2RIRA 2P9CA 2YFHA 5JYDA 4LISA 4Z0TA 1RYEA 1IUKA 1PJ3A 1T25A 3MJEA 3NDJA 1I10A 1WMAA 4UULA 5GMOA 3DAFA 3KYCA 4TRRA 3ANMA 4DA9A 5IZ4A 3FNEA 4KQWA 4LCEA 4NH4A 3PYMA 4PZEA 2BI8A 3VZQA 1KVTA 3ADPA 1BMDA 2EWMA 3RBVA 2IEBA 4Y6RA 1R6DA 2ZTVA 2YQ4A 3PLRA 1D8AA 3GY0A 3RFTA 3FI9A 4LCJA 2IXAA 3UN1A 2BKAA 3H65A 4B4OA 4EITA 3DBHA 1R0KA 2HRZA 4XIYA 5JE8A 4IZIA 4BGUA 5FI3A 1NFFA 2NVWA 1WPQA 2GNAA 4HFNA 4AJLA 3NRCA 1I3KA 2HMUA 1OZAA 1HETA 3L4BA 3ZWNA 2VWPA 1RM0A 2R6JA 3QJ5A 3WLEA 3ITKA 2FP4A 2FR1A 1RM4A 3JQDA 4E30A 2NTNA 3H4VA 4IDAA 4BO4A 3G0OA 2C54A 1VKNA 3N7UA 4YT2A 3SLKA 3NDIA 3BMNB 3H9UA 1EDZA 2EP7A 2VHVA 3B1JA 5I9LA 1U3TA 5L51A 4R51A 3ZDFA 4NG5A 3KUXA 2QYTA 5DCWA 1A4UA 4TRJA 3EC7A 1QV6A 4UEJA 1BXGB 1Q0QA 4FQ8A 2PGLA 2VUUA 2PWZA 2B5VA 4E5KA 2QHXA 3L6EA 3ROMA 1H6BA 4ID9A 1V8BA 3M2PA 2JAPA 5BSFA 1IULA 2YV3A 4IJUA 4J43A 4FB5A 3VZPA 2PLAA 1GZ3A 2O4CA 2NUAA 1X14A 4BO1A 2ZTUA 3KO8A 3HNPA 3TZHA 2F1KA 2X86A 2P9GA 4Y8VA 1BRMA 5JXWA 1DC5A 1D3AA 2O48X 4RLHA 1T26A 4XWYA 3V1YA 3H8VA 1P1JA 3E48A 3BMQA 4XYMA 5G0TA 5A9TA 3PI7A 4DLBA 1MG0A 4E21A 5H81A 1HLPA 3GN2A 4D41A 4P4GA 2AQIA 4KP7A 3GGPA 3I9OA 5A9SA 4OKNA 5COQA 3WBFA 1MA0A 3WJAA 4TVBA 4KDFA 2YYYA 1CIVA 1YB4A 4WASA 2FR8A 4YJFB 2GD1O 1J5PA 1HTBA 1HYHA 4Z3DA 5GZ1A 3KYDA 4JLWA 4BKRA 2GZ1A 4OM8A 3ZH2A 2GRAA 1V3VA 4QEDA 2J6IA 3EVTA 1E77A 1J49A 1CQIA 1YVEI 2RHCA 2ZKLA 3B1KA 1OC2A 1PSDA 4E5YA 4WECA 5C37A 3ONEA 5MGBA 1PJ4A 2C5EA 1CYDA 2Z5LA 4WEOA 4IY1A 1Q2XA 3CIFA 3RUEA 1ML3A 2IZZA 3ASVA 3RD5A 2EGHA 2XAAA 3W4IA 2P2SA 4KWIA 4U8GA 1K2WA 1V0JA 4FC7A 4B3IA 4GKBA 1HE3A 2DT5A 4JNKA 2Y0DA 3FTPA 1MUUA 3TOZA 5A04A 1XA0A 1NYTA 1X1TA 2YFQA 3EK2A 1DIGA 4PLZA 4YRDA 4B8WA 2J5RA 4DYDA 1ZVMA 5TC4A 3UXYA 1M67A 2EKLA 5HTOA 3BMCB 4HNHA 4HP8A 3BTVA 1U5CA 1EUDA 5JAIA 4WEQA 1IZ9A 1HDYA 1T2DA 1QP8A 3FPCA 4B3HA 2Q1WA 1UR5A 1H0KA 1Q0LA 3FR8A 4Z0PA 4PLWA 1LLQA 2FZWA 4YAIA 4WGGA 2DVMA 4L73A 4YAJA 4PG6A 3RC2A 4CMBA 4UVEA 4CV0A 5DN9A 5G0SA 5L7WA 4W7HA 1HLDA 5LDGA 3TQHA 1IYZA 1UXKA 3ZWBA 1T4BA 1TI7A 2DBQA 4ND2A 2W2KA 4FBGA 4JP2A 4MO2A 4IS3A 3DXFA 2AHRA 1A27A 4ALIA 5CAEA 1NAIA 1JU9A 1ZNQO 4M54A 3ZV6A 4BNKA 4MIYA 3DR3A 4FN4A 5KWEA 1IHXA 2VRCD 1A9YA 3VPGA 3AM5A 1B15A 2CD9A 1QSGA 5DOVA 5J9GA 4YR9A 4MVJD 2OOSA 3B20A 4YRBA 3N74A 1OAAA 1W0CA 1QXSA 1YL5A 4HY3A 1FDWA 5TJHA 1TLTA 1I8TA 3GDOA 3NT4A 1EVYA 1E6WA 1PL7A 1ZFNA 2ZJ0A 3GZNA 4CR6A 4YACA 4DIFA 2BGLA 5JC1A 2G1UA 1NASA 1VKOA 2EJVA 3RIHA 4XYGA 2FN7A 3VZRA 1LSSA 1F17A 2ZYGA 5JFOA 1YH3A 4DIOA 3DTYA 2AEJA 4YT8A 1Y9AA 3AUSA 1DB3A 1KY4A 1GV1A 2Y1OA 3R6DA 4CJXA 2GR9A 1DJQA 4UAGA 1X0VA 1KEPA 4L8VA 1V3TA 4MP3A 5KIAA 1GU7A 2UDPA 3HWRA 3NT2A 3TOXA 3FWZA 2VYVA 1DAPA 5BT9A 3H7AA 5B37A 1FMCA 4AJJA 4XQ9A 1ZK4A 1GAEO 2PV7A 2YDXA 3IJRA 4A26A 2O4UX 1AHIA 4YDRA 5C7IO 3Q2IA 3SLGA 3AFNA 2UV8A 1I5RA 3JQEA 1A7KA 1OC4A 4J90A 5LCXA 3AOEC 4JBGA 4WCFB 1J4AA 1JVBA 3D5TA 2X0NA 3UAGA 4Z3KA 4LRSB 3VH3A 1UZNA 5JS6A 1KYQA 4BVAA 2EEZA 2Z1NA 3H9JA 2H1SA 3K31A 2PD6A 4RLSA 3TZKA 2Q1SA 2VNAA 3GPDG 3EZLA 1ADBA 2B69A 4RVGA 4QX6A 3OA0A 2Q2WA 1YDWA 4MKRA 3GOHA 2YQ5A 4YEDA 4RVSA 3K30A 1VJTA 4CPDA 2ILTA 3HDQA 4X54A 3ZHXA 2UYYA 4J1QA 5K6AA 2GERA 4RPKA 2PKRA 1Q7GA 4TRMA 3WGQA 3DHNA 3DL2A 1H93A 3GA0A 5IN4A 3W1VA 2JD1A 4AJ4A 2Q99A 3I83A 1L1FA 4CUZA 4Z0HO 1P31A 3ZWYA 3GAFA 3E6AA 3JYNA 5JDIA 4NBRA 4XA8A 1SZJG 3VAZA 3O4RA 3UCFA 4PLFA 3W8FA 5IAAA 1R4NA 1B8PA 5JDCC 1NQ5A 4B7XA 4XR4A 5I9NA 1GTMA 4UUOA 3UKOA 5LC1A 4KOAA 1ONOA 3AM4A 5JCJD 2EIHA 2X22A 1YS4A 2WM3A 3P2YA 5TGDA 3PJFA 4MVJP 4NJMA 1PZFA 2WDZA 4E5PA 2CDBA 3DOJA 2Q1UA 3NAQA 5K6AC 2HLPA 4CLDA 1SEVA 1WZEA 2W98A 5IDQA 2BLLA 3WMXA 2E49A 3DMTA 2DAPA 4M55A 4FFOA 4UEOA 1ISGA 2HCTA 1XDWA 4ZQGA 4C4OA 2UUOA 5A1TA 2GZ3A 1E3WA 3P19A 1TA4A 4FFNA 4CLRB 2Y0EA 4NK5A 1WVGA 4A0SA 1QORA 3UW3A 3RUFA 1T1RA 1X13A 4GX0A 4I5GA 3COSA 3IQDB 5A03A 1CETA 2VN8A 3WSWA 3U4HA 4QO8A 3G79A 5COBA 2A35A 5T73A 2RAFA 5JPIA 2QW8A 4MVJM 3RBXA 3E8XA 3GHYA 4OXNA 3GAZA 3F1KA 3D4OA 4J6FA 1K0UA 2EHDA 1MXFA 3JYLA 1U5AA 4EW6A 1H6AA 4I5DA 3RWBA 1OI7A 4NI5A 1HDZA 4BQRA 3DZHA 4XIJA 3M2TA 1LLDA 4WLEA 1A7AA 4XX0A 4PZDA 5TRTA 1JN0A 4ZQEA 1YBAA 3RU7A 2NU8A 3HSKA 4CM4B 1P0FA 1W6UA 1KIFA 2AQ8A 2NWQA 3NTRA 2WSBA 1SB8A 4NIMA 5A9SB 1I3LA 4W4TA 4E5NA 1RYDA 3ZWPA 1GEGA 1M66A 5I8WA 1OMOA 4Q3AA 2RHRA 1P9LA 4RVFA 1DIBA 1WMBA 3HUDA 3RUIA 4A10A 4UEKA 1UJMA 2NACA 3VH1A 5BSGA 2R00A 1ENYA 4D44A 1O9BA 5TS3A 5HS4A 2EJWA 2HK9A 3D3WA 4XYLA 3DMYA 2DPHA 3EYWA 3AM3A 1KBZA 1E1KA 4O59O 5L53A 3RSHA 5EESA 1I0ZA 3QWIA 4RPJA 4ZU3A 3MOIA 1F12A 1G6KA 4L0QA 1EUCA 4ZRNA 2B35A 1N2SA 3KTDA 4OXKA 3V1UA 3HDHA 4NMHA 4RPGA 4E2WA 3GVPA 4J1TA 1ORRA 2QRJA 1HDRA 1IB6A 2I67A 3H5RA 3L6DA 1YJQA 2JHGA 3ZU2A 5GZ6A 3H5AA 5KKCA 1DHRA
chains in the Genus database with same CATH superfamily
1ZN2A 2BFFB 5ALEA 3KTOA 4UOZA 4KDEA 4IM7A 1J07A 3EGXB 2CFOA 1U3VA 3UH0A 3LUKA 2AXEA 2G0NA 2V7GA 4FT2A 3AVPA 4DMKA 4EABA 4UE2A 5BMVA 4KPUB 2E4WA 3K96A 4HPXB 4E5SA 4ZHQB 1ZUIA 3AUXA 2IYRA 1RPZA 4PLCA 4Y6SA 5I4CA 5HEKA 1PNOA 1PFQA 4M83A 1J2EA 1YI8A 2M1XA 3DW3X 4J8PA 4TLMB 5CMLA 5G0VA 2LRHA 4WKNA 1AUVA 5B64A 4E2FA 1RLOA 2NZ8A 3A4NA 4BMCA 3V34A 1X7XA 1R0YA 1KI4A 2DSTA 2IIVA 4RD0A 2IXEA 3IMKA 4REQA 1XX6A 2J4FA 5LLTA 1TCCA 3H2GA 5BR8B 2XDWA 4R0VA 1D09A 1VKRA 3I23A 4KLCA 4Y98A 4S1PA 4YRGA 5J43A 4UUNA 2D7CA 1UPUA 1Z2EA 2VDKB 4R69A 1FRFS 1UDXA 4H1HA 2KM1A 4OYYA 5DU2A 3X1MA 1NW5A 4HNSA 3N3AC 4JI4B 1L5NA 2OCKA 3K0CC 3IDSA 1LBIA 3COVA 3WYBA 3CSSA 4OL9A 2IL1A 4KH0A 4WLUA 4J2TA 1D2HA 1QC5A 3O8CA 3VPDA 3B3FA 1PLLA 4HH1A 3HDYA 4XVUA 1IOLA 5KOJA 2JZNA 1QZUA 4DLZA 5HKOA 1CW2B 4YJ2B 1NVTA 4YJGA 2DBRA 3WQSB 3FSEA 3P0RA 1ZR2A 2NZVG 3CJQA 2FW1A 3OOHA 2VYVD 1JKMA 3TR0A 2FFJA 2H0QA 2OCIA 3IVMA 1T5SA 2OSVA 3HM2A 4ZVKA 3DS8A 4WA7A 4ZZ1A 3JWEA 1P6QA 2FSGA 3I9KA 2WMYA 4CYMA 5FLKA 3CX8A 4L72A 1RWMA 3LTEA 4QU5A 2HGSA 2NQ8A 5EPUA 1L5KA 3LRPA 3TF5A 1AQ6A 1OH7A 1VG0B 4JFRA 4PSVA 3KLBA 2Z1MA 3ZNQA 5ICCA 2G5CA 3I3OA 2QORA 1VRVA 4OQNA 1UZMA 1IONA 1SOUA 2Y6VA 4WOCA 4QNMA 5KMGB 5LXTB 2CJWA 4NU6A 3OWHA 1BMFD 2OAEA 3TRHA 3WQHA 4URXR 3A9VA 2Z58A 3C4QA 1Z0IA 1J00A 1V37A 3AW8A 4HAXA 1GIAA 3TPCA 3LVRE 1ZM3A 3W04A 3DEYX 2QTTA 3I12A 1L7NA 1KETA 1NT2A 4Q93A 5ILOA 1OZHA 2QTRA 3OOSA 2CLLB 3BSWA 2FKAA 3FKSA 4DRZA 2DFKB 3PTZA 4KJXA 3PKJA 4MJ3A 1M1YE 4PRZA 1NW8A 4RE5A 4BVFA 1FMTA 4IFTA 4B0OA 1C14A 1KP9A 1E3TA 1R66A 4U7HA 5DCYA 4RJTA 3R23A 3SDZA 2GXAA 4MO9A 2PRJA 4NRDA 3AR5A 1T2EA 1A5SB 4MWEA 4RULA 4X24A 1JLMA 3KR9A 4NDAA 4DWJA 4ZOQI 4BNDB 5AUPB 3KVOA 3OIFA 2FMTA 1KXZA 4XLTA 1QCDA 1DWOA 1NMXA 2UXDB 2RJNA 3L8HA 2B6HA 5AXAA 2J9GA 5CVUA 4YS6A 3M33A 5EMMA 5BUQA 3DDOA 3FKSD 3RTAA 2IHZA 2V96A 1KZ4A 1EEXB 1P5RA 4IRXA 4L0MA 1FRNA 5KWJA 1ZJ5A 1DHTA 2FHSA 3VU9B 4ILKA 2P5YA 3I5MA 5KJFA 5BVGB 1NW4A 5EYPB 1BVYF 4KHZA 3VKFA 2FB9A 5B1HA 2WQ6A 1SU4A 4L9RA 3ZNOA 2XXAB 3OFNA 2QA5A 2X5OA 1JMKC 1M9NA 2NTVA 2WJPA 3FDZB 3WR5A 5B3LA 1S4MA 4X45A 2WQZA 2TYSB 3FDIA 2IE8A 2YR0A 2QT0A 3GEIA 4M0EA 1NSFA 4XX0B 5E4YA 3JRNA 2V7QA 1Z4PX 3UWKA 2HEIA 2XKBA 3AYXB 3HYRA 5ITSA 4BJ6A 5K8UA 2Q8NA 1MHTA 1NXQA 2J48A 3DV2A 3DE4X 1JKFA 2CEAA 3BHNA 4CM9A 4CT5A 1EAMA 2VJMA 4XUGB 5ECGC 4Z9AA 2D5BA 1K7FB 2M32A 1NQAO 3N53A 1TEZA 1Z07A 4IDQA 1ZK0A 4RD2A 3BWXA 5EXDA 1GN8A 5D5PA 1XCGB 1KMMA 1R6TA 4RJJA 1KI8A 4HWOA 4MTCA 4PCUA 5HQJA 4ALKA 1KQGA 1BGXT 2X9QA 4YQZA 3UOWA 4CFYA 1P4SA 3CH6A 3GUUA 4FOPA 1AXGA 2ACEA 2XUIA 1EBFA 2ICAA 5T5QA 5CFMA 1ZZEA 2JGDA 3CEPB 3C1OA 8OHMA 3H1AA 4RD3A 3U4QB 4RF2A 4YJHA 3MF4A 4EF4A 4JOCA 5DBOA 5IJXA 1L5QA 2UZAA 1HKUA 3NTXA 4UUQA 3CF6R 3GPIA 2ZYIA 1PWHA 2D62A 3GPCA 4IUBS 2VDWA 5K0LA 4TTJA 2R8OA 3RRNA 1IAQA 4YJ2A 1JXMA 2PUWA 3WWZA 4CMGA 5LLDA 5JJKA 2ZB4A 3FOFC 5A4AA 4V3CA 1W5BA 4HBGA 4JQSA 3SFZA 5KJCA 2DGDA 5AOBA 5FDFA 1C80A 3LTNC 2IZ7A 1C0KA 4BXOB 4MULA 1HY3A 1TQDA 2O7QA 2PUDA 1U1EA 3EISA 2EW8A 3FPGA 1K88A 1WQ1R 2NTEA 2QT9A 4OYHA 2W0MA 3KXDA 1UKCA 2WOJA 4KXQA 1PVVA 4QO7A 3NUQA 4EO7A 3GO4A 1F0NA 1EXDA 1O08A 3IOEA 1ST2A 2Z2IA 3O4JA 1KRHA 4UHFA 1T9HA 1X1RA 3R0ZA 4RD6A 3LY9A 1L3BA 5EE0A 1L5LA 5A7FA 2BSXA 2ZW9A 3T3OA 4TWRA 3TW4A 4WLVA 4Q4CA 1K3TA 4QYIA 1DC8A 5H4HA 3SHFA 1SHTX 3LLUA 5A1JA 3IV7A 1L7PA 3W3AA 4MPDA 1NTRA 5AJYA 4YMLA 1NI5A 4BFUA 2GZDA 4RJ2A 2YY7A 1UMDB 2ZR9A 4LYHA 1XJWA 1KP2A 4MV3A 1CF4A 4W9RA 1EVZA 2QTVA 3DFZA 5JWRA 5JSKA 2OFPA 1JIVA 2BC9A 4R6WA 2RAVA 2XRMA 3D7RA 2R6GA 2I6FA 1U4OA 5CHYA 1D6MA 3GYGA 3HUEA 4P93A 4TV9F 1J8DA 5E0KB 2O7RA 3U7RA 3VR5D 1ONSA 1ZXXA 3NTOA 3SSMA 2ZSAA 2YASA 5AHKA 4MV6A 3AUTA 3WQBA 1V5IA 3IUEA 1C4KA 3H0CA 4FP9A 4H7IA 3WIBA 2H9AA 4FFDA 5IH3A 3S40A 3QPAA 3QUAA 4YQYA 1IJBA 1A5BB 4K9NA 4U5XA 1KTIA 4YMHA 3O9MA 4RUKA 3MTJA 4JEMA 5AT1A 2YWHA 2DX7A 3PTLA 3GLIE 1JTFA 3RK1A 4EPVA 5C4GB 3GQVA 3A3YA 2HA5A 3UWPA 4JBNA 2Y6UA 4Z9BA 4CTKA 2FN9A 1PFWA 4R1TA 1KK2A 1KE1A 4US2R 1Z5ZA 5A4DA 5CLJA 3JD0A 2B0JA 3AP3A 3L40A 4YBZA 1F3LA 5A5DA 2NVOA 2WJGA 4KWCA 1I7MB 1ES9A 3VDQA 4D9FA 2HNAA 2Q1XA 1K6XA 3CV3A 1URPA 3MBOA 1KZHA 2R5WA 4H18A 4P8RA 5G1NA 4MUBA 1IJEA 2OCXA 1XDBA 4GVXA 4FWIB 4M7WA 1UANA 3V8RA 4AFNA 3WTCA 1VRCA 1MOQA 3WS7A 4XVQA 3KLMX 4RVHA 1BVUA 3GMIA 5FRDA 3L4JA 1L5VA 2AK3A 3LDAA 4PLHA 1LTQA 2NAFA 1CS4C 2WD7B 3U3DA 1NI4B 1JI0A 1ZCAA 2XH8A 1S2OA 1WRBA 5CFOA 2ZUTA 1XCMA 3G0DA 4XSGA 3J80A 3NVKI 2QLBA 4NVRA 1UM9A 1VIAA 4WXMA 1YR1A 2PK3A 5E9QA 2YWJA 5FUQA 1G2IA 1I0IA 1K7YA 1N8NA 4N9QA 1SR8A 2J1LA 3R9IA 5JSHA 3S8YA 2C78A 3UC9A 3QX3A 3GRUA 1OHHA 3DR5A 3H6GA 4KWHA 5D7BA 3GGDA 3DMPA 2EZ8A 1N3YA 4M0UA 4J07A 2VDUE 3GPBA 2XTAA 4FDAA 4Y3UA 1HE1C 2GETA 3CZAA 2WLSA 3DT8A 3GDHA 3MOSA 5ALXA 3SBOA 4BKUA 2K7FA 3ML1A 2H5IA 3TRJA 4Z4FA 2XV1A 3PQ4A 4I2VA 1CCWA 1NNSA 1C2YA 3UZUA 1DTSA 4IJ5A 4D8UA 1PT9A 4S1VA 5ENVA 2R2AA 5I9MA 4ZT3A 2I71A 3ANLA 3E7DA 2BJHA 1HMPA 1RJ9A 3DAPA 2ZBRA 4IR7A 2R1ZA 3H9GA 4AM8A 3PYLA 1U28A 1QWOA 3N2KA 3M6MD 4ZVTA 5GPBA 1UK7A 5A5VA 3WWOA 1HZZA 2IBMA 4R2MA 4BEWA 1ZUNA 1QYXA 2ZJOA 2I54A 2UVDA 3Q6IA 2A78A 1BKDR 1U9IA 4OH7A 3CN7A 3ZS9A 4KFUA 4B6JA 1Z5VA 1JWAB 3EXFA 5K99A 2F3UA 3A14A 4I3HA 3QLUA 1TGYA 4DMHA 1G5FA 1T3HA 1VL8A 2PRZA 4B31A 4BJHB 1CUSA 5CB0A 1QHHA 3GXBA 3I9NA 5F1PA 5L7TA 2DFPA 4UTOA 3DMNA 2AXQA 1EKXA 1Y5IA 3T52A 1YZYA 2CVOA 2CLCX 4V38A 3SXUB 1OFIA 3KJIA 3OCVA 4OKIA 3WYNA 3UTCA 4A9AA 4REOA 4CEJB 2Q3DA 3ZK8A 4QQ8A 1TAHA 1JEQA 3C14C 4P5DA 4TV9B 1BOFA 5AW2A 5BO5A 3AFMA 5HMLA 4MI6A 4WH0A 3IMGA 1HLFA 4C30A 3RLIA 2H06A 5JSFA 1K63A 2WG1A 2G07A 1QKJA 3H9BA 5F9FA 4YK7A 4PG5A 3LUHA 5FPQA 1GXSA 5KHLB 3AB3A 2GCIA 3JALA 4KXVA 2CE2X 3FHLA 4P08A 1Q0PA 4MRAA 3N76A 1Q3TA 4WA8A 5F1YA 5AKEA 5F2NA 3AEQA 1BMFA 1U9IC 2Y1GA 3BTOA 4KTVE 5EJ2A 4TYNA 2JRCA 3BJIC 1MX1A 3SCZA 1DGQA 2PWAA 3IE0A 4D9MA 1VM6A 2PZFA 4RQBA 2VJNA 3FCXA 3O21A 3DTVB 2GCNA 3WYDA 1FIUA 2PKQP 4D4KA 5DGHA 2HLDD 2PD4A 2PFKA 2QG4A 5JNLA 5EZYA 1CUGA 2ISQA 3JAWB 1OB5A 3AESB 3RF6A 1E2QA 3PG5A 1JU4A 3COWA 2C8JA 1O6BA 4J6EA 2AMVA 1AGXA 1R12A 2GZMA 4HXYA 3AV0B 4ZAWA 3O4GA 1NV8A 1CWUA 2C5AA 1R3DA 5IVIA 4DM3A 5IXSA 1NDHA 5JMWA 4OGLA 3OZAA 3QLJA 3CNEA 3UTDA 2PAAA 1N36B 2BE7A 1T13A 1U3WA 3EEIA 4R2JA 5KYVA 3VPCA 2J59A 1WPGA 3T1YB 4Z7NB 4LV6A 3B6JA 4IMJB 3NHJA 4YY3B 1NBME 2QX4A 2GPTA 1RJGA 4XQGA 1NUHA 1E3SA 1R00A 3MCVA 4M1KA 4BCCA 2O59A 1ZGCA 2WINI 3N7AA 3NPMA 1C8KA 2AOXA 2OD9A 4BEVA 4HWRA 3EWNA 1SK9A 2VHYA 4RTLA 3OUUA 3UXEA 3HZZA 2Y1LA 5KHAA 2VQFB 4HVAA 2PZMA 3UHOA 5BV1A 1EDBA 2BMJA 3DB1A 4Z0NA 4GMFA 5T67A 3WO0A 2XTMA 2BYTA 3B13B 1Z0KA 3AEKB 4IIJA 5F64A 5CM8B 2FR8C 3WSVA 2IUEA 4KQXA 3PNLA 5BN5A 4XCVA 3MB8A 5BYBA 3HCCA 2E2WA 3E9ZA 3I2IA 1Y6JA 4FMCF 4GYYA 3EPLA 2R60A 1LA2A 3HZHA 4Q3BA 3W5VA 3DLAA 2PHZA 4U6QA 1QIDA 4YJFA 4WFIA 3S44A 2B2CA 3FMIA 3TLKA 4F45A 2ADMA 4L5IA 4DDHA 3KFLA 2GUWA 2C9MA 2BFEB 5HGJA 3HXMA 3OP1A 3MWGA 4EF6A 2FWJA 4R3WA 1CQZA 1QG0A 1WF6A 2QRHA 1XRLA 1UPXA 1XQ6A 2RGXA 4DLNA 1RQLA 4FW8A 1L1QA 3E70C 6AT1A 2CYCA 4DREA 3D7LA 1M8FA 1QVWA 4P80A 3WBBA 3V8BA 1B93A 1W52X 2C1ZA 5HJ2A 4YP6A 1Z17A 2R6DA 1Z7WA 4AJIA 1TO2E 4DWOA 4ZI7A 5BMOA 1P2VA 1VB5A 2ES4A 2FVYA 4D80A 1ZCZA 5DW0A 2YXDA 4C0LA 1BC5A 1ESCA 2EFCB 2GT1A 3NYIA 3OTGA 4GZ3A 3WLFA 2C5LA 1EE9A 1MOSA 1YQUA 2OGZA 2XNSA 4PIVA 4QDXA 4YCMA 3CRZA 4G8JA 4JN6B 4N7MA 1QUEA 1Q3KA 1Z06A 3KOZA 4PG7A 1PL6A 1QH1B 3LXMA 4Q3EA 2BP7B 3HBAA 3ACBA 1D04A 4YGXB 1E2UA 3QOFA 3RS8A 1AO0A 4L4YA 2D8AA 1NUTA 2RHDA 5DLQC 2C8VA 3PE6A 2O8CA 1W47A 4D9KA 3VC3A 3BHJA 5BR4A 1E5QA 1YB5A 2GZSA 4FHEA 4JBWA 2Y92A 4K6KA 1X70A 3OHMA 1MIOB 3QHPA 2YIVX 1TQ8A 4L8FA 4XUDA 4XPIA 2JA2A 4NBSA 3W2TA 3ZZTA 4N39A 4EG4A 3EE6A 5CB4F 4IV0A 2GO7A 4PO1A 1BYUA 5AP9A 2C4MA 1C1YA 3HI6A 1XZHA 2BHSA 1T91A 4DRYA 1Y4ZA 1VLMA 3QSGA 3NHFA 3DHYA 3WIDA 4TSFD 4CTMA 1XI2A 2WTXA 5HW0A 4KLNA 5J2UB 3ZIUA 4IDNA 5IAOA 4RZUA 3SQXA 3BZUA 4KKXB 5CIWA 5FPKA 2OV1A 3OSUA 3RG8A 1UXHA 2PLFA 1LU9A 5ALDA 3E81A 1DEKA 4RIIA 4ENWA 1UH5A 3CNQS 3RAFC 1UP4A 1T8SA 1O03A 1ETUA 3ZHCA 3O8OA 3SYLA 1VE3A 1Z5NA 2NO0A 3PX2A 1IUPA 1ZM7A 3MQFA 2YZ2A 4HQ6A 4IJVA 4Y2UA 2Z2ZA 1KU6A 3ABIA 4KX3A 3GA7A 1DFHA 3OKCA 2M98A 4GH5A 5B4UA 1UCFA 2DG2A 1CFZA 5FV7A 1RLTA 2O06A 2JLXA 1GL9B 4QBTA 5EE3A 6PFKA 2RG1A 5IC5A 2JLQA 1GTZA 3L7YA 1TGVA 3ZW7A 3N0XA 3HXPA 1EBUA 1NUAA 2D6FA 2VYCA 4UM9D 4KO2S 5D8DA 1RD4A 3U1TA 4EX7A 2WSYB 1WJGA 3OJWA 4BNDA 3BWMA 2A3RA 4MVJI 4Y1RA 2VHTA 2WE8A 4JJ8A 1V8ZA 1PEDA 2APJA 5CYFA 4U0KA 2A3NA 4HXEB 1ZESA 1B3BA 3PT9A 1UOQA 2ZIAA 3W1WA 1C3JA 3OEWA 1X1AA 5KSZA 2YS6A 3A6FA 1TLLA 3NGXA 4EY3A 1L5RA 2VR1A 3U3JA 3BM5A 4AY4A 5I4IA 3FPFA 2YN2A 4FFLA 4FILA 3RK0A 1U2DC 2CV0A 4NOMA 4AN0A 4GPIB 3SIRA 1RQXA 1F1JA 1I5EA 2IOYA 2NU9A 4PX2A 4MKHA 5FHQA 4M3NA 4CMAA 4DCUA 5K0TA 3R0XA 2YJTD 1T6BY 1WKBA 2ONCA 3FPHA 1YB2A 2IGBA 3CW9A 1HRDA 2PVPA 4WPGA 4Y2TA 1Q20A 5NULA 5IG2A 3DDNA 1P6XA 3EWIA 2EF0A 3RYIB 1A0OA 2IOHA 2WFAA 4QATA 4RVUA 3PXGA 5CDGA 5BN4B 3LMKA 4R3NA 4PN3A 4Z53A 4TTSA 3P4XA 2BI7A 3SIXA 4ZZ0A 2WAMA 5BSVA 3B12A 3I9LA 4J9UE 1G18A 3FNGA 2PWYA 2EJBA 1J2TA 1N6NA 2D2VA 1U7HA 3I4CA 5E7JA 1EXMA 3QNMA 5KYNA 3IAAA 1TZMA 2HHHB 4D6PA 2ZCUA 2VS1A 4HOYA 2OR3A 2XF8A 4JDPA 4OMUA 4Q48A 4MP8A 2JAHA 3G1WA 4BMYA 1JZTA 2ZE5A 2UVQA 2G17A 1E7YA 3RR2A 2PKWA 2ZJFA 3DWFA 3TOVA 2PEYA 1EIWA 3PRJA 2ERXA 1EE2A 1C7EA 3F6CA 4Q3NA 4DXHA 1UAYA 4BS9A 3JX9A 1LEHA 3R7WA 3V8VA 2ZGVA 2Y77A 4DTCA 5H59A 3BMCA 3Q41A 3ME5A 2BEVA 3DE0X 4EJ0A 1ZOSA 1V1MB 2FUG1 5H3LA 1WAMA 4M0CA 3Q15C 4N4AA 3OJEA 3TLZA 3ZJ5A 4ZZIA 2G80A 2CF6A 3PCXA 2BJWA 1FFXB 4DIDA 2POQX 2G8NA 3PC2A 4D3DA 1C8BA 2CLFB 2HZBA 3IULA 5BSKA 1II9A 4JC0A 3PIIA 5JLJA 4JI5B 4YRKA 5G3ZA 3EA4A 4QD3A 5JSYA 4N5MA 2ZQYA 1S8AA 1CQWA 2OZPA 4FS3A 3TSYA 4B46A 1MX3A 3RUDA 2CB0A 2XQFA 2JATA 4K6OA 4JVNA 2NZYA 3RKRA 4DUPA 2GEDA 3PQDA 4N3CA 5BOVA 2FEOA 2VYND 2YWFA 3DEJA 4EQZA 1M7GA 1Z68A 4XR9A 1VSBA 3URKA 2Q3MA 1WCIA 4IHJB 1YQ9A 3FPKA 4RAOA 2NZJA 3OIYA 3T9AA 4R1SA 5JARA 3MT9A 2HNBA 2FUG6 2I4TA 2Y67A 1YS6A 2HHLA 3MJRA 3CINA 2YBDA 3OZTA 4Y18A 2JLRA 4EKNB 1B6SA 5TF4A 2PZKA 1UEJA 1VSVA 2A5JA 5I7EA 4OLFA 3EPKA 4AY2A 4COKA 1OFTA 1R2QA 1Z3CA 4YR7A 5H82A 4FT4A 3RLFA 1AV6A 2GWHA 4KQ9A 3DZ7B 3YASA 1NOKA 3S2IA 1HUQA 1G8YA 3TKYA 4YXFA 1Z6ZA 3U48A 3WGIA 5JBNA 4M49A 2FZVA 2OGUA 4HZGA 4ZDIA 1LH0A 3GT0A 2JGFA 2OGWA 3QU4A 5KO2A 3UA4A 1MCZA 1HF3A 3O4FA 3E9NA 3SQWA 3LVQE 3DMTC 5K3BA 5KTKA 3OQ1A 2Z3VA 4POOA 1G8AA 2HJGA 1DMRA 4O02B 3UW1A 5I7WA 1C1DA 1WPRA 5T6BA 4GMDA 1WW8A 2P6UA 3CZPA 3PGJA 4LGCA 2PS9A 4BNJA 4AROA 1F06A 1F2UB 2BMEA 1EMDA 3LFUA 1SPXA 3A1CA 4IL5A 2HIMA 3WWCA 3ZQJA 3VKGA 2B83A 1Y81A 3G9QA 3ROPA 2IHUA 5WRFA 4AMUA 2P2NA 5F33A 1PDWA 2XZLA 4UW9A 3DEKA 2RBGA 1YZLA 3HFRA 3L93A 2FEXA 3OTWA 3PA6A 3RUPA 3F97A 2YCBA 4TMWA 4W8OA 1KZ9A 1Z33A 3FTCA 1T5LA 5FL7A 4CM8B 4JODA 4B35A 2IHVA 5HMMA 1ZN9A 4UHJA 3S8MA 3QFRA 3E5RA 5CP8A 3A11A 3S4YA 4CMEC 1LBEA 1ECLA 4JUAA 5JD5A 1PL0A 2Z08A 3ORSA 1K0FA 4QDKA 3K5WA 4OHRA 4CLEA 1WZNA 3AVQA 1XELA 4I14A 2HMSA 5IVDA 4FE7A 2MSEB 3R8XA 1OSNA 2PU7A 4QELA 4LBVA 3T7RA 2GXUA 1Y5MA 1CR2A 1VMKA 2PBFA 4LTNA 5DB4A 2DC1A 1XCPA 3CNNA 4Q9HA 5IABA 3MELA 2C2GA 2CL7X 1H3NA 5K3FB 3G7NA 3RAPR 5BSEA 2H4YA 1KKLA 1QVRA 2IEDA 1TU0A 5T57A 2M6SA 1D9XA 1STOA 2XADA 3FAKA 4P31A 3G8BA 3UGQA 3DPIA 1DX9A 1FUYB 4EKIA 4ZI7F 3T4UA 1UK8A 2XQVA 4PCLA 1WDKA 3P2MA 5HZMA 1EM6A 2LDBA 4F4FA 4ZOLA 1DQPA 3ZW8A 1FLVA 5AUOB 3GJ8A 3H84A 3K6SA 2JIBA 5IS2A 1QGOA 1EZZA 4G85A 3HWWA 1YU6A 5J59A 3TFOA 1ZISA 3DEFA 4PV7A 1NNEA 2IX9A 3L1HA 4EZIA 4YCCA 4P83A 1DJOA 2A9KA 3ZY2A 3X3HA 2JBHA 4HCJA 2RGNC 5L40A 5GQSA 1Y1SA 3BJZA 3CX7A 1OBCA 2ZRHA 2ZVDA 2NQ2C 1AMNA 3UAXA 2ST1A 3T5MA 1W9MA 2WV7A 3DEIA 4HK4A 4F5WA 2XTJA 3F49S 1E3QA 3IBTA 4I1VA 1HGXA 5CXQA 4CM9D 1RZUA 1H6CA 1UL1X 1WMSA 3ZU4A 4ZHQF 3AY7A 2W22A 2ZS8A 4D3FA 4EHBA 4F5ZA 4JGGA 3HV2A 4E4TA 3BL8A 3T9EA 4K1LA 5FL3A 3U3RA 3HJRA 5A6SA 4ANFA 3STHA 3OM0A 4HUJA 4R4JA 4OQDA 1RQ2A 1SXJD 1TT5B 4IGAA 4C3VA 2EX4A 4LNUB 4J94A 4ABTA 3RU2A 1L5YA 4FCWA 2DYKA 3R77A 2WM8A 4AIIA 2CJXA 1E92A 3N6VA 3A28A 1RCUA 2IEGA 2YHUA 2OYCA 3M8KA 4HMOA 5JOQA 1M8PA 2JGAA 1NLUA 3B2EA 4GLOA 1P5FA 2D1QA 3KOOA 5FPHA 1E6CA 5J9FA 1VB3A 5JPCA 2R5NA 1ACMA 1DJNA 1GGHA 3EA0A 3KQTA 3KZCA 3OTQA 2P5UA 3DONA 2CXTA 2AF3C 1GADO 1LFAA 1NMSA 1NBHA 1G21B 2WB4A 3G17A 3R75A 1E1QD 3WNCA 4C0AC 1MPTA 3CY6A 4NECA 2JIOA 1GCOA 3QVJA 4S35A 5MGNA 3MHPA 4N3AA 1KH1A 4MV5A 4E15A 4WT7A 5BR1A 3BFJA 3AZQA 1KZ6A 1LVUA 1GPLA 1M7HA 1P62B 3P0JA 1KVQA 5I7FA 3ZPXA 3TD2A 3EBOA 3KQVA 2F67A 1ONPA 5JS1A 1O89A 5EZYF 1MO2A 4LRXA 1SB9A 4WUVA 4WY5A 4RKQA 4JDUA 3AZPA 1GPYA 3PHJA 1ISIA 4GKJB 1WNTA 4C1BA 4C6TB 5AOCA 2XMRA 2E6UX 3ODPA 2PO7A 2XMGA 4WOKA 2BLNA 1EDEA 2CE7A 1ZMTA 2CVHA 3EZFA 4AJOA 4XWKA 1CY1A 3E8SA 1TU4A 2WJZB 3C3DA 5A05A 1QU2A 1XP5A 2QP9X 1I9CA 3A9RA 3D6JA 2YW9A 4O2AF 1R88A 5JNUA 4R5MA 5CYGA 4JUIA 2IW1A 2GKGA 4BLUA 1CUJA 3BGVA 5C53B 4FOOA 1FUEA 1KYZA 1ZICA 4EWLA 3NC1C 4DN6A 1HL3A 2VSYA 3C4JA 1OLSA 3EBPA 4ODIA 4CKYA 1WQ3A 5EJMA 1E96A 3U4AA 4HBZA 1P2SA 3MJ4A 4ZCIA 3HK2A 5L3ZA 1FJ2A 3B3GA 4HTAA 4L8WB 3I04A 3AUUA 1J6UA 2Q28A 2XOKA 1LTHR 1G9XA 2FLWA 1SEPA 1Z15A 2HA2A 1CQPA 2N1BA 4DQXA 1YA4A 4FW9A 1QZZA 1VPEA 4N47A 3KM0A 3KYDB 2O0JA 3I76A 1EYZA 1QIJA 4I5IA 4EMBA 1YVPA 3W7AA 3WWPA 5EIWA 5IF3A 4NFYA 2FXVA 3O2NA 3NCHA 4I5EA 1WBBA 3WG9A 1CZHA 3UK6A 1E7MA 1WDLA 4UKDA 1N3IA 2Z3ZA 4H7JA 2JGIA 4J7AA 2V6MA 5K3OA 4RCYA 2H57A 1A8SA 2W90A 1ZVKA 3EGCA 2DPGA 1KFKB 1V45E 3EMDA 2QR3A 3C0KA 3MCTA 3K9NA 1E69A 4F3YA 2XGOA 4GL4A 3L7OA 4YRJA 3KALA 4FYPA 3UG7A 3LV8A 1Z35A 2MSLA 3K1AB 2ROQA 5K01A 1FSPA 1PSZA 3U7GA 1V43A 3VO1A 2GPAA 4C76A 1RHRA 3ASZA 4V03A 4FZVA 2AFIE 4UVDA 3C5WP 3OQNA 1RI2A 3TDNA 1VHJA 2HJVA 4GPAA 1GEEA 1TECE 2P8JA 2H63A 5FA6A 4K9DA 1W4RA 4YWJA 1A8UA 1Q0HA 2J33A 4OYLA 2B92A 3WK7A 4DA4A 4U2BA 3T5CA 4NBTA 4RV4A 2W6CX 4H7KA 2IBSA 1U7DA 1QAQA 4JX9A 4M8IA 3M9XA 5FT9A 1UZLA 4GR5A 3CVJA 4JAVC 3L1VA 5LKRA 2VHXA 4RPLA 4TRNA 1RJEA 3MMSA 4DVGA 3SC2B 2P78A 3R3SA 3KUCA 4OK6A 3ZLJA 3MRXA 1V16B 1UDAA 1T4CA 3EXEA 2YWDA 3Q40A 1KVRA 3LRTA 2DULA 3R3ZA 5C52B 1NQTA 1NN0A 1W85A 2B4QA 3IJ5A 4PTYA 4RMNA 4D4MA 2JLBA 4PR0A 3FRIA 2ZIZA 3W2GA 4V1CI 4ARVA 4G5SA 3IKTA 1RTTA 3LDHA 4KO1S 4L6CA 3UMJA 3ZZUA 4BO0A 2GN2A 2O8EA 2GYVA 1AUPA 1SCAA 3U4QA 3TINA 1WB4A 4Q00A 5E7QA 2AWNA 4UEQA 4JI1B 4UMDA 3E7PA 5DM2A 1TZCA 2ZWOA 5AK5A 1ZGHA 2ZAGA 1YZQA 2A0FA 4IHAA 3BDAA 5FFFA 1FSZA 2N0SA 3GJ4A 5LP6F 1GA4A 4ZTZB 2Q5LA 1DCFA 2CDRA 3GMTA 1JU3A 3J81A 2WY2D 1KOGA 1FYXA 1PL8A 3WQQA 3EA5A 1Z22A 4P58A 4UCQA 2Q1TA 1E1CB 1KSJA 1XA3A 4PC1A 5B1IA 4YREA 2Y76A 5KOJB 1WUKS 3IA7A 3L05A 4U2CA 2FSUA 4O3MA 2DB3A 4ZAYA 3K4QA 4X8HA 2G70A 3LOQA 1J21A 3M6XA 4G67A 4PRKA 4Z4IA 3QE3A 1TQ2A 4OJQA 5GJVC 5EZQA 5L4SA 3V7YA 4LWPA 1G5HA 2IYTA 5FTNA 1M6NA 2IEZA 2I78A 3E84A 5JSZB 3ZWQA 1BA3A 1JZSA 1G21E 3G0GA 1YO6A 2AR9A 4JK3A 3KHKA 2FDRA 3NBZC 1L3CA 4XM0A 3RODA 3Q0EA 2EQBA 2XB4A 1YRQA 4B44A 1LWNA 4OGGA 3RIMA 3WBJA 4RTJA 1SMKA 1BGWA 1TIBA 3U5ZB 1NBOA 4B40A 4DYHA 1ZSNA 1WXHA 5FWYA 1RR6A 1W1WA 2D0PB 2Q29A 4IS2A 3WYGA 3JS5A 1FDIA 1NR7A 5DI3A 2PYDA 1CVLA 3B7GA 3MK31 4M60A 1QVVA 2I8AA 3BMQB 3GV0A 5ARCA 3VX4A 4CDGA 1LQUA 2L2QA 4AJ2A 5JZSA 1MNAA 1JR4A 2SNIE 4FGWA 2VF2A 3P2IA 3RJ9A 3I6IA 3EP5B 3WLSA 2G28A 2QTGA 4QTYA 2ZR8A 3FNQA 2RC6A 3KU4A 3EMKA 1IVYA 1WBJB 2P30A 2Q9AA 1DAKA 3L4EA 2BFEA 3PWZA 4R2KA 4AX8A 3LBNA 4TWBA 5AKYA 4TQGA 3DA8A 4TLEA 3FPLA 4MV7A 5DMHA 1Q14A 3EN0A 4B7UA 4AWBA 1FDSA 2JLVA 2A1TS 2OQ2A 4QYIB 5CVJA 2JRLA 2IS4A 1PYDA 2E1PA 3BHMA 5KDOA 1Q91A 3INYA 1SJ9A 3DM9B 1QBKC 1XD8A 2DQKA 2EFHB 4ND1A 4AS2A 3V8PA 2R84A 1ICIA 3G5LA 1KHHA 2WA1A 3PLNA 1SU8A 1V6CA 3OF5A 3QE4A 1YR6A 4K1XA 1ZU5A 5FOUA 3WRYC 1KJJA 4AZ0B 3L8MA 4JGBA 3RRYA 2P65A 2PEZA 4LXQA 2ODWA 4A6XA 5IZCA 3L7AA 1M1YB 3KQSA 1AGYA 1IOVA 5AVOA 1YJ5A 3A3OA 4CL3A 2C5BA 1U98A 2DKFA 3OESA 4LY9A 5A71A 3VNVA 5FTWA 2GJ9A 3D0RA 5K0BA 4I9UA 2IOQA 3QEBZ 3QE9Y 2WAAA 1UXGA 3HN7A 5DEIA 1U11A 13PKA 1B73A 4H1VA 1GFWA 2B1GA 2C9BA 3O9ZA 1RXEA 2OK8A 4Y2PA 2XMQA 5E1MA 2YC4C 5THXA 4DJAA 4I4TB 5FORA 5HE9A 4H2DA 2FFRA 3UAYA 1QLJA 3P52A 4BB9A 3X1ZA 4G0OA 1MKYA 1R50A 3QVTA 2R3SA 4LTDA 3RYHA 3U4CA 2HL6A 3OM8A 4HLQB 2PIDA 6LDHA 3NT5A 1JB9A 3B6KA 4EJSA 1E98A 5FJIA 1ZNXA 7ABPA 4LTMA 3KYCB 3LUGA 1RJ9B 5DSTA 1YZGA 2GJ4A 4BBPA 1Y8CA 1QMGA 4D9GA 2CL5A 4ALJA 5J5AA 3GLRA 4Z1OA 1EVIA 5FLXA 1JEJA 1CF2O 2QMZA 2R66A 3FLEA 3G2IA 4UNRA 5AKIA 5DBIA 2V8OA 1R8XA 2PBRA 2JKZA 2YL2A 1JAYA 4ER5A 4PTZA 3TJZA 5AM1A 1PJLA 3QW2A 1G60A 1P1HA 2FSPA 1OT3A 1L7VC 3LKDA 4UFNA 4I8DA 1XTUA 2QN3A 3GJQA 3LNTA 2NU9B 1QIKA 2Z8ZA 3AJEA 1QKIA 4LXXA 4L28A 4OHUA 4PQFA 5CVEA 4YHBA 3VU9A 1JXQA 4P34A 4D1YA 4FTWA 5AW8A 1MDBA 2JKYA 2XE4A 4NPHA 2JLZA 3Q8MA 1E5DA 1E9DA 3HDGA 1S2GA 1YE8A 4MDHA 4EY8A 4J3NA 3W7BA 1NXVA 5IXJA 2FV8A 3IXQA 3OIDA 1SXJC 4L4XA 4ZJUA 5HGXA 1PEKE 3GG2A 1W46A 1IHOA 4YT5A 4AULA 4XVHA 4I9GA 5HM6A 3JAMA 2ZP1A 1E1QA 2E82A 4RDCA 3V1LA 1RM5A 4E14A 2NVUB 5C1DA 5KX5F 1RLMA 1RYZA 4XIGS 5G4KA 2BEKA 4YRPA 1YRHA 1I1HA 4IJMA 1G291 2I55A 4HGZA 1OAOC 5EP3A 4BPRA 3QFFA 4BBAA 1I7DA 5F51A 2PZGA 4EBBA 1KY3A 2FCAA 2R65A 1CS0A 4M1ZA 2O0HA 4N3BA 5TJ9A 1NR1A 5K0ZA 2XLCA 2P91A 2HRCA 3WIOA 4JYAB 1HDOA 1R18A 3W2FA 4IZHA 1L5HB 1NNUA 3ZLVA 4C87A 3PUHA 4Y1EA 1G5RA 3E58A 4S1TA 5U4QA 1LDMA 3HNRA 3PHGA 1ZNYA 3PEYA 1NG9A 3EVFA 2VXCA 1BU8A 4JROA 1TTTA 1KSFX 3KBOA 4RS4A 2DOKA 2EBFX 2XUHA 4ZO8A 3ESDA 1OI2A 1X3LA 4X8LA 1BD3A 3GG9A 3LP8A 3OPNA 1WS6A 3GLHE 3ADKA 4K0RA 3SKYA 3CGWA 4H7FA 4BC0A 1Z2AA 1W76A 5I01A 3GC6A 3AU8A 3PUJA 5CT8A 1II0A 1TKCA 3I6ZA 4R7TA 2AC7A 2JFOA 2P3LA 4JXJA 4PNPA 3ZY4A 2H4XA 3TQOA 1RABA 1AUXA 1M6VA 3HP4A 2ZBQA 1G19A 1IY8A 3UJ3X 2FZ4A 3KQHA 1NE7A 4Q1DA 2A9JA 3K0FA 3Q1LA 3GJ3A 4U6NA 1XU9A 2CDCA 2C2OA 3GNTA 2GILA 4BQIA 4MI9A 3ZGLA 3UAZA 1UBUS 1CE8A 3M3PA 1FMFA 4PHHA 4V0SA 4OQEA 5A0VA 3GT7A 3QPCA 1CZNA 1PZNA 1RBYA 3A9CA 1AK9A 2RHHA 3OE4A 4RGYA 5E4TA 1QO9A 5LA6F 3TTSA 2JLUA 1VTKA 3I1FA 2Q2VA 3T0FA 3VDNB 4Z4QA 3PSHA 1ENOA 1X6VA 1ZBDA 2DFTA 2NZ2A 3GCDA 3IDFA 1E8DA 1F9AA 4UE6A 1PP4A 2Q45A 2BMAA 2H6EA 2ZI3A 3L1KA 8ATCA 3A37A 2XZPA 3NANA 1NQOA 5DRTA 4A0FA 2A1IA 4W5OA 1E1RD 1XKQA 2X0IA 1BX0A 2SCUA 1BD4A 3OT5A 4PWYA 2QTZA 4AN4A 1D2AA 3NC4A 3NBXX 5THQA 4E11A 2P9EA 4MQBA 4EPYA 1A9XB 1U7PA 4YCLA 1Y8ZA 1TEHA 4XOIA 4UVIA 3JVEA 4EVQA 2YCLA 1E64A 1E9BA 4Q1CA 1H8HA 1MX5A 2F3PA 3H7IA 4D42A 9GPBA 1ZS9A 2EXXA 4BNLA 3ZVNA 2BGNA 4IHKA 1W88A 4DZZA 2BFWA 4NESA 2BFPA 3RU9A 2C0CA 1PX0A 1GUZA 1O2DA 2FK8A 2PX3A 5FOTA 2QIOA 2BBSA 2EYQA 2QTNA 4M0MA 4RZXA 1E59A 4BGEA 6REQA 1O94C 2WE7A 3NJRA 1E1RA 3SEAA 1O96A 2ID9A 1T1EA 3ZGXA 2VPYA 1EZ1A 3LX8A 1YDHA 2CYAA 4MIOA 4YO7A 3C5CA 1IU9A 5EWJA 2H1OA 1PBTA 1SD2A 1G5QA 2XUDA 3GVXA 2OO5A 2GJKA 3PRHA 3AHFA 3F98A 4NOKA 1M5TA 2SKDA 4OFZA 5TT0A 2FEMA 3O6VA 1S9HA 3IEMA 4Q9AA 2IH4A 2IU6A 2PS3A 3ETLA 3LQKA 3W6ZA 2Q6VA 4G4SP 1XG5A 1VBKA 4LGVA 4LK3A 5BSRA 2H2WA 1HQYE 3CRW1 3EIFA 1XRMA 4ND7A 3N8GA 5ICSA 3JQBA 3PF9A 4KTTE 4KIWA 3ROKA 5LMUB 2XJ9A 4O0LA 3UMRA 4AWXA 2J3QA 2G6BA 2PLNA 3EH1A 3TI9A 5JH7A 3G2LA 5EMJA 1HXHA 1I4TD 3MWJA 2DBVO 1E5VA 3ITNA 1KNXA 1QHGA 3RANA 4Q39A 2NXEA 4X1YB 1N0IA 3UH1A 5FI0B 3SFVA 1Y1QA 3SYMA 3ZWOA 2H52A 2HLNA 1U7TA 2PRYA 3PGA1 4QPNA 5GADl 5JMTA 4JX8A 3DAOA 4Q1BA 2X40A 3M7IA 2BM1A 3V4VB 1DLJA 5BQXA 4TKZA