1H6DA

Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
383
structure length
383
Chain Sequence
QAATLPAGASQVPTTPAGRPMPYAIRPMPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein translocation
molecule keywords PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
publication title Crystal Structures of the Precursor Form of Glucose-Fructose Oxidoreductase from Zymomonas Mobilis and its Complexes with Bound Ligands
pubmed doi rcsb
source organism Zymomonas mobilis
total genus 126
structure length 383
sequence length 383
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2001-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h6dA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h6dA01
4NK4A 2VHZA 4J1QA 1UZLA 4J43A 1GV0A 4LCEA 3FSRA 1X7HA 3I9KA 5KVVA 2EJVA 1BGVA 2HK9A 5K9ZA 1NYTA 4A7PA 3S2IA 3DTTA 3MJTA 3EHEA 4UVGA 3OJFA 3KHUA 1CQIA 3GDOA 1GCOA 3K6JA 2ILTA 3VTZA 1XLTA 4G2NA 3U4HA 2BHLA 2GZ3A 5TF4A 2D2IA 1R4NB 4GVLA 1MG5A 4DA9A 1ZCJA 1FXSA 1YOVB 2X9VA 4TROA 3QJ5A 1E3WB 3W4IA 5C7IO 2CF6A 2NV6A 4AFNA 3AUAA 3S55A 4CLRA 1IYZA 3PZBA 3I52A 3ZH2A 1NQOA 3ZWWA 2W2LD 4ROSA 4EZBA 5CDTA 4Q3CA 4ZJUA 3ZV6A 3L6DA 4E0BA 1LLCA 2I66A 2ZB8A 1T25A 4Z0PA 3N74A 2IRWA 4DTIA 3EMKA 2P2SA 3E5MA 1HE3A 1O5IA 1P44A 3N7UA 4NI5A 1OZAA 3EZLA 3WLFA 3DFZA 3FR8A 3F46A 3MEQA 4YJGA 1ZW1A 4FPXA 1L7EA 4GWGA 4JBGA 3H65A 2HSDA 5TLSA 1VL0A 3B20A 3EYWA 2BFMA 2J3IA 2O50A 5JAZA 4YPOA 1NQAO 2Q50A 1U5CA 1AHIA 3OICA 1R4MA 1ZEMA 4ALKA 3BA1A 4Q3BA 4J1TA 4ALMA 2E82A 3NV9A 1YVEI 4XKJA 2AEMA 4NBVA 2NU8A 1WZEA 3T7CA 1JKIA 1OI7A 4XR4A 2O3UA 3PJEA 2IEBA 3DHNA 2BMAA 4FJ2A 4XQGA 2JD2A 4A03A 4WCFA 4WCFC 3JSAA 1MGOA 2ZTMA 3OBBA 3RIHA 4ZQEA 3SC6A 3JQCA 5ADHA 4BVAA 2Q22A 2ZTVA 2YFQA 5TJ9A 3ZNNA 4LRTB 2BFAA 2HMUA 3CZRA 3CH6A 2FR0A 3KBOA 3NT2A 5AXAA 1DBVO 1I3MA 1Z74A 2UYYA 3D4PA 4NNJA 4I9HA 3LT1A 3L4SO 1BDMA 4D43A 3H5NA 2AG5A 4IXWA 5FF9A 5JYEA 3WG9A 3GPDG 1V9LA 4Z0TA 1UR5A 4H15A 4W7HA 4I9UA 3RUIA 4FFPA 1DPGA 2HQ1A 4Z0HO 1VKOA 4DGSA 5F1OA 3WGTA 3GOHA 4NBWA 1ZIDA 1ZO8A 3P2YA 4A5OA 3CMCO 1AUPA 5DBIA 5JYFA 2O2YA 3FRJA 3GVPA 3GG9A 1JA9A 5BSGA 3AI2A 3KLMX 3NTRA 4B4UA 1N1GA 4RPJA 2NVBA 3LK7A 1W6UA 3ZZNA 4NG5A 4JP2A 1TA4A 3BMNB 1BW9B 4J4BA 3WMXA 5F5NA 2X0RA 3WGZA 3PIDA 1YE3A 2WTBA 5B1YA 4FJ0A 1ISFA 2BGMA 2HDHA 3DO5A 1DJQA 4L75A 4P4NA 2VYND 3SC4A 5L51A 2IYOA 3KB6A 3VPXA 1MLDA 3E6AA 2OP0A 1ID1A 2XOXA 3FPCA 3GC6A 3KSUA 1EQ2A 1KVQA 2GR9A 4FDAA 3AW9A 4XD2A 4QX6A 2WDZA 3TJRA 2IYPA 3C1OA 2PTGA 4UUOA 3QVTA 3FBGA 4FGSA 3U4IA 4CMCA 3HDJA 4MP8A 1O6ZA 4M89A 5TS3A 1N1EA 3B1JA 4NIMA 5LCXA 4YJDA 4C7JA 4BNGA 4OXYA 3OP4A 3ZU4A 3NDJA 5MGBA 3GZNA 4YRAA 2C07A 2HUNA 3V8BA 4YAIA 4J0FA 4HNGA 1T1SA 4GI2A 3D0OA 3VH1A 1J6UA 4YB8A 4IDBA 5L40A 3ZV4A 1GUYA 1XKQA 1DLJA 3CSDA 3RASA 2BFOA 2HRBA 4NDNE 3WQSB 1H93A 1WAMA 1LDGA 1YJQA 4XYGA 1LXCA 2QIOA 2XXJA 1EBUA 5AXBA 3IJPA 1DC3A 1VSUA 3GF4A 5FEUA 3P2OA 4JX8A 2NACA 1VLLA 4XEHA 3ZHZA 3G0OA 3ITKA 5TNXA 1HL3A 2QRLA 4O6VA 5I9NA 1M75A 3TFOA 4TVOA 2D59A 2O3RA 1P1IA 3MTJA 1MG0A 4U5QA 3RUHA 2P9EA 4K1LA 1NXQA 3W4JA 4WGGA 2VZ0A 2AW5A 2GERA 4BNZA 1ISHA 2XPCA 4PZDA 3SLKA 5IZ4A 4ALIA 3KYBA 1R0LA 1HETA 5G0SA 2W2KB 3QRWA 3RUEA 4PLVA 2PZLA 3NUGA 1PGPA 3K2EA 1X13A 1YKFA 4J4HA 3NJ4A 4BMSA 3W6UA 4MPDA 5DOVA 1E6UA 4MVJF 3RBZA 1AE1A 3S2EA 1DFHA 2JJYA 1IUKA 2G82A 3K31A 3GEGA 3KVOA 1YL5A 2C5AA 5JAIA 4TMFA 1JKFA 3VOSA 3CKYA 3LT4A 2Q1UA 4DMMA 4BNIA 2B0JA 4JIGA 2VN8A 3H9GA 4U6QA 3GNSA 4DVJA 2DFVA 1A72A 2C54A 1LTHR 5KJCA 3KYDA 1PS0A 4P38A 4KZPA 3RSHA 2DTDA 1Q0HA 3GGGA 5H82A 1ZK0A 1I33A 1NP3A 3IP1A 2R00A 2R00C 3F1KA 1B8VA 2ZYGA 1DRVA 4CMKA 2P4HX 5EQDA 2CDBA 1UXHA 3ASUA 3DZFA 4QECA 5TT0A 1VL8A 5L7TA 5C7LO 1AXGA 2Z1NA 1UDCA 2I5PO 1W0CA 2ZCVA 1S6YA 2P9CA 2VYVD 3C7CB 5A5EA 3GH3A 3JYQA 4YBZA 4LSMA 3NDIA 3TL2A 1Y9AA 1U4OA 1TI7A 2W98A 3QWBA 4NQZA 2PGJA 2NM0A 3WSVA 3B6ZA 4BKUA 1W4ZA 4OQZA 1DDOA 4II3A 3JD4A 1YWGO 1UZNA 4RQTA 4U6SA 4Z9YA 3FF4A 3AI3A 4CQLB 1HDOA 4BO5A 4CM1A 5BNIA 1PJLA 2FY8A 1KC1A 1NVGA 1I30A 1GU7A 2B69A 3BHIA 4RVSA 3MZ0A 1PGJA 5EINA 4E30A 3TZQA 3VDRA 3X2EA 2AQKA 1EZ4A 1U9JA 1T2DA 3NEPX 4K6FA 4MP3A 4B4VA 4DC0A 4DRYA 3IIEA 4PZEA 2O3QA 4ZRMA 1FK8A 5IZCA 5IZCC 3HFGA 5A9SA 3EC7A 3S2GA 3JD3A 2CZCA 4BNKA 2PK3A 4FQ8A 4CV3A 5TQVA 4CMIA 2Y0EA 4R1NA 1LSSA 1EBFA 5AXCA 1I3KA 2PD6A 2Q2QA 3UH1A 2YW9A 3GRKA 1W73A 2X0IA 1H2HA 1WVGA 4JJIA 2OFPA 2WWRA 1XQ1A 2ZATA 1DXYA 1Y9EA 4GAEA 4YAGA 1RM4A 1HE5A 1YL6A 1PZGA 2C0CA 3L9XA 1LSOA 1K6XA 3B1FA 3UN1A 1XEAA 3E1KA 1K6JA 2Q2WA 2VT3A 4ITUA 1VJ0A 4IZHA 2I3AA 3L0DA 2CVZA 3WX0A 5JMWA 1F8FA 1X1TA 2RBEA 4JNKA 1EEHA 1N7HA 3CTMA 3S2FA 3JD0A 4GMFA 1VKNA 1LJ8A 1TT5A 1ENYA 4RF5A 4R54A 1E6WA 5DNAA 4EBFA 5CDSA 4J4TA 3F5SA 1JWAB 4CLRB 1HDZA 1NFFA 3ROKA 3S1LA 1R66A 1ZEJA 4PLWA 3ZN2A 3ZV5A 3WFJA 4EDFA 3AM5A 3OJLA 4R68A 4YWJA 1JVBA 5DBFA 1LDYA 1PZFA 5BT9A 5B4UA 4C7KA 1GTMA 1U5AA 3L77A 4J6FA 4BMNA 3MWDB 4RO0A 3GDFA 3QQPA 1ZBQA 4HWKA 3TOZA 1VE9A 2P9GA 2PH5A 3IMFA 3ZWXA 3T4XA 4BKQA 3F4LA 4JJGA 2HCTA 3AOEA 3AOEC 3BMQA 5A04A 2DFDA 3O26A 2FPGA 4HFRA 2PLAA 2VHVA 5KVQA 1MC5A 3P5SA 4YJGB 4R3NA 3I1JA 2VHXA 3JTMA 3L9WA 1V35A 2BKAA 2RH8A 1FJHA 3F3SA 3HUDA 1P0CA 3QA9A 4R3WA 3RC9A 1YB1A 1X14A 1PJTA 2BFPA 2FHSA 5IXYA 1H2BA 3KRTA 3RC7A 5JC8A 5AOVA 3EW7A 5B4TA 2C59A 1MFZA 4CLXA 3WGOA 3EUWA 1P45A 1QYCA 5I7SA 4YJFA 1UP4A 2NQTA 1K0UA 4JGBA 2BI7A 3PIIA 4UVDA 2ZQZA 3TNLA 4HKTA 2R2GA 4RPHA 1QLJA 4IZIA 1XQ6A 4LISA 3D7LA 1NFRA 5DCYA 1N5DA 4R16A 2VWQA 2Q45A 5IFLA 1QORA 1QV6A 4IMPA 3CINA 1FDTA 1ULSA 3KLPX 1D8AA 2NTVA 1KVRA 2O7QA 4E3ZA 3DONA 3TSCA 4YJHA 4OHUA 1U7HA 1B8UA 2J3KA 4OQYA 4AG3A 3IC5A 1E1LA 1JWBB 1XU7A 3P19A 4WPGA 1GDHA 5GZ3A 3DBHA 1H6BA 1P1FA 1HDRA 1LQTA 1PZHA 3WWYA 2JCYA 2BGLA 2W90A 1ADBA 4QFCA 5CG1A 4JXKA 4RLHA 4WLOA 4MIEA 5L7WA 3G3EA 4RVHA 5L4NA 4J9VA 4O1MA 1H6CA 4XQCA 2EP7A 1HSOA 4L76A 4XDYA 5GZ1A 5BSFA 2YFHA 1T4DA 3MJ4A 1NASA 4ZHSA 3GLQA 4YACA 3MJEA 1E1MA 1I2CA 3H3JA 5HA5A 1YRLA 5CDUA 4PIVA 1WDMA 1DFIA 1GQQA 4TRJA 3QP9A 4RORA 1UXKA 3GN2A 5IDYA 3IS3A 3FBTA 3KSZO 4LRSB 1GZ6A 1QMGA 2FP4A 3KXDA 4NK5A 2DPHA 1H0KA 4IDEA 4KUHA 4PVDA 1PZEA 4ND5A 3GGOA 3F6YA 3ZI0A 4EITA 3IJRA 2W4QA 1PS9A 3GHHA 4UEKA 3ZNQA 5JCJD 1QYWA 4E33A 2Q1SA 2WE7A 2ZYDA 4I9NA 1DIAA 1UAGA 3RWBA 1X7DA 2VWPA 3EDMA 5AVOA 1E1NA 1CYDA 2C2YA 3H8VA 4N5NA 2Q99A 3G17A 4BNXA 3QV1A 5BNFA 3FTNA 3OQ6A 1A27A 4JBHA 4XR9A 4QO8A 1PJCA 4QQRA 4M54A 3NGLA 4XB1A 1IZ9A 2TMDA 4E13A 5I8WA 5G4KA 3GVHA 1I24A 5IJZA 3ULKA 3FCOA 4WJZA 2YV1A 2EG9A 4E32A 3D3WA 1K6IA 5JLAA 1ADFA 5DN9A 3PZRA 4GVXA 2NTNA 1IHXA 3U9LA 3NJ8A 4K6CA 1Y8QA 4CMAA 1QV7A 3H4VA 1ZK4A 3LSYA 4YCAA 4DREA 3WBFA 1C0IA 2C2XA 4WEQA 4D0RA 3TRIA 4N5LA 1JTVA 3IP3A 1F8GA 4GSLA 2NWQA 1UZMA 3BZUA 1P1HA 1X1EA 3JQ7A 2BRUA 3O4RA 1H6DA 2PA3A 3OF2A 1U1IA 1ZXLA 4CMGA 3ZW8A 5JNLA 4CLOB 1XELA 1P33A 2GRAA 5IAAA 4J1NA 2DBZA 4FFMA 4FOSA 4LK3A 3K8ZA 1JAXA 3JYLA 2A92A 2IEDA 2OBNA 3DXFA 3KM0A 4R51A 4TRNA 3PWSA 3H9EO 3PGXA 3F47A 4RF3A 1IULA 1HTBA 1IPFA 1KEVA 1MXHA 2EKLA 2YZ7A 5A02A 1ADGA 2WYVA 1YBVA 4GX2A 2YV3A 3KYDB 4JN6B 2VWHA 4TRRA 2DAPA 1NM5A 1NWHA 1YQGA 1XGKA 4RDHA 3ROMA 3OJOA 3WYEA 2C20A 2X8LA 5EPOA 2FZEA 1AN9A 3UKOA 5TT1A 1ONOA 5AXDA 1T24A 1B26A 4MJLA 4CM6A 4D45A 1T1RA 4XYLA 1R37A 4EUEA 1LUAA 1KVUA 3F1LA 1PS8A 1ZXBA 5HS6A 1C0PA 4D0SA 4R5MA 3TN7A 1LDBA 4CM4A 5TGDA 1QR6A 4CLHA 4B3JA 1ISIA 1PEDA 3JQEA 1N9GB 4NJMA 1E7MA 2AMFA 2Y1GA 2HJSA 3ANMA 3U62A 1C3VA 5ER6A 2O3SA 3H5RA 5HTOA 2EXXA 4MO2A 3Q3CA 4ZVVA 5THKA 4E4YA 5B12A 2C29D 4GLLA 3D64A 1UDAA 4IIUA 2O48X 3HFSA 1J0XO 3JQAA 4MVJI 1PQUA 4L4XA 3U09A 3I3OA 1ML3A 1I32A 4RLSA 1QYVA 4J7UA 1U3UA 4YXFA 1YDWA 3PHHA 1YL7A 3LYLA 3V2GA 2JL1A 4CMIB 4EJ0A 1JW9B 5ILOA 1HYHA 3M6IA 3TZHA 1DFGA 2HAEA 3COSA 1K89A 3KYCB 1KEWA 4LW8A 4XWYA 3WJ7A 2V6FA 1P1JA 3VZPA 3OIDA 1M2WA 2QX7A 4IGFA 5COQA 5C37A 4AVYA 3ZWBA 1XCBA 4CR6A 1K5HA 4CM3A 2EF1A 4FC6A 5BSHA 5F1KA 5I7VA 4HX5A 2EGHA 4MKRA 3JYPA 2FWMX 4OGWA 4PFJA 4YRDA 4BO8A 2ZJ0A 3IOYA 4I5FA 3K5PA 3PDUA 1B2LA 4CMHA 5FI5A 4BO4A 1YONA 1LRLA 3RBVA 2Z1MA 3UGKA 2PGLA 2EJWA 3OH8A 3PVZA 1SAYA 3K9QO 2DUWA 4GH5A 1A4UA 2O2SA 9LDBA 5H81A 3HN2A 1X0VA 1U3WA 4NMHA 1IL0A 3WGQA 1B3RA 3VVBA 1A9ZA 1NWCA 1WWKA 3OQBA 3BMQB 4N7RA 4E2XA 5ENDA 2NVUA 5A1TA 3VPFA 1ZSYA 1Q2XA 2RHCA 3VPHA 1DIHA 2DM6A 2YYYA 1WLYA 3FWZA 3TQHA 4D46A 4UAGA 3NTQA 2IZ1A 2DU8A 2VUSA 5KKAA 4KDEA 4QT0A 5DULA 1KC3A 4J49A 4QEDA 4J3FA 2DBVO 1DHRA 1S7CA 5AQ1A 1PJ2A 2RAFA 5HWSA 1KETA 1EUZA 1D7OA 1ZH8A 3DZIA 4FD3A 3RJ5A 4R01A 2VHWA 3WNVA 5AYVA 2DTEA 4DIFA 3WXBA 5CPFA 4G5HA 4BNMA 3INRA 3HDHA 4KDFA 1PQPA 1XSEA 2W2LA 3R0IA 1HSZA 1MB4A 1F17A 3AM4A 2QHXA 4OXNA 4KMSA 2Q1TA 4ND3A 1XR3A 5L4LA 4IQGA 3ENNA 4M1QA 5JY1A 3ANLA 4CM9D 4I5DA 1P9LA 4EJ6A 4HNHA 4O0LA 1M6WA 2C7VA 1GY8A 1A7AA 2X4GA 1NPTO 1BMDA 3TZCA 3U49A 3JQGA 2JCVA 4YJHB 2HMTA 3W6ZA 4ZD6A 4OOFA 4L4SA 4EUHA 3ON5A 3DAPA 1QG6A 5I9LA 3UW3A 5EERA 5KVSA 3DBHB 2H63A 4XQ9A 4B3IA 3SJUA 3B70A 3PQDA 1VJ1A 2FRDA 4O63O 3WLEA 1E5LA 3Q11A 3PGJA 4IPTA 3SBOA 4PG8A 3L4BA 3L4BC 4GKBA 3PTZA 6LDHA 5HRUA 4CQMB 4FN4A 4M87A 5FI3A 4MKXA 3QWIA 3M1LA 3ROPA 2XXBA 1RM5A 1AHHA 3HN7A 3L6EA 4TQGA 5A05A 2VUTA 3DBRA 3VHRA 3QY9A 4WUVA 2O7SA 2B4TO 4P8RA 4OXKA 1NBOA 4H7PA 3RKRA 5L53A 4BUCA 1H9AA 1PSDA 1LBEA 3JQ8A 3Q2IA 3DFUA 2NU7A 2Z5LA 5B4VA 3AY3A 2WD7A 4XZ3A 1ZJYA 3BTUA 2PZMA 8ADHA 3H9UA 2D5CA 3R6DA 1R0KA 2NU6A 2Y1FA 1K2WA 3UCFA 4YQZA 2Q49A 3HADA 3OJ0A 4FB5A 3GGPA 1VI2A 1HLPA 4RZIA 2Z95A 1GPJA 1C1DA 1R0SA 3EAGA 3UFXA 3CPSA 4LGVA 1NPYA 1QRRA 3GMSA 4B7XA 3PK0A 1E7QA 3LC7O 1G0NA 3H5AA 4KP7A 3QVWA 1SBYA 1UUFA 3PHIA 3HWRA 4C4OA 3WJAA 3MJCA 3ZV3A 3JYNA 4KUGA 3G79A 4PRLA 5KNLA 2FN7A 3HB4X 3R3SA 3C7AA 4HFMA 4GL4A 4J90A 3I23A 2H9IA 1EMDA 4XGIA 1J5PA 3SX2A 1KEUA 1LI4A 3PFFA 3W8FA 5COBA 2NSDA 1M76A 1EUCA 3Q9UA 3IAHA 3TZ6A 1WMBA 5L3ZA 2JHFA 1FDSA 2Q2VA 3DBLA 1ZK1A 1BXGB 2IZ0A 1N8KA 3OA2A 2DUUA 1SEPA 2JFHA 4ZICA 3RCBA 1YJ8A 5G4KB 4MP6A 1RPNA 4D3DA 4AJPA 4NZ9A 2VYNA 4S3MA 3Q2KA 2G5CA 2JFGA 3VC7A 1I2BA 2FZWA 2Y67A 1Y8QB 3LF2A 4IBOA 4R9RA 2V6BA 3RUCA 2RH4A 3PYXA 2UAGA 4JJFA 2E6UX 3G1UA 4CLEA 3IUPA 4NU5A 4NBUA 3RFTA 3ZNPA 4YT4A 1I01A 3CEAA 4WLEA 3WFIA 1E1KA 2GN6A 3JQ7B 4IINA 2OUIA 2HKIA 4OH1A 4PN3A 3LC2O 3DDNA 4BGUA 4HADA 2C7GA 1CRWG 5H83A 2NLOA 4L4RA 1P1KA 8LDHA 3JQFA 3JQFC 1P1RA 3U4DA 3DZGA 2GPTA 1O0SA 4RQUA 3WSWA 1PIWA 3BMOA 1X0XA 1R15A 4E5PA 2EIHA 5EQFA 3GT0A 5LDGA 4ESOA 1R6DA 4E2WA 2D4AA 4XYMA 3OA0A 4GWKA 1TEHA 1GCUA 3NKLA 2ZTUA 3JYOA 3QWAA 1E3SA 2CMDA 2UUOA 2OBYA 3HZZA 3C3XA 4KUEA 2JFFA 2EGGA 2PD4A 5CDYA 4HUJA 1E3IA 2CDCA 1HDGO 4TKMA 1SMKA 3KTDA 4BO6A 2PWZA 5EJ2A 3S8MA 2JAHA 3OIGA 5IN5A 3VH2A 3RUFA 1EQUA 3ICCA 1W8DA 4BKRA 2POQX 2G76A 2I3GA 2VRCD 4RGBA 3E48A 4HY3A 2RIRA 1WMAA 4NBRA 2NVWA 4RVDA 1PJSA 2X23A 4YYZA 7MDHA 2DT5A 5C7OO 1U8XX 1C1XA 2ZKLA 2R6JA 5U4QA 3TWOA 4WOJA 5A03A 4Q3DA 4YVFA 3PYMA 4EW6A 4CM4B 2QQ5A 3AFMA 4CV1A 2E4AA 2X5OA 4J7CA 1BVUA 3W4KA 1DSSG 3PQFA 3DMYA 3E9NA 2F00A 2VZ8A 2JD0A 3GUCA 1Z75A 4NJMB 1UXIA 3OIFA 3WTBA 5HM8A 4FFNA 4FOOA 3BMCA 1DAPA 5LC1A 5J9GA 3EZYA 2Y93A 1XDWA 2B37A 2A4KA 1SPXA 4EYEA 4RCVA 4AJKA 1HLDA 1CETA 1GL3A 1Z6ZA 4YQYA 2V6GA 1E3EA 1ENOA 3JQAB 4E5YA 4RVUA 3DZKA 3GR6A 3GEMA 1E7SA 3ETEA 4YAJA 3WNQA 3IUSA 1OC4A 1LDMA 4BV8A 5A9RA 3FN4A 3RU7A 1MXFA 1T2EA 5COAA 2P5YA 4E12A 3KUXA 2ZB3A 1NAIA 1NPDA 5I7EA 5BSEA 3DHEA 2GASA 1JN0A 1LRKA 2BLLA 3D5TA 5CPBA 1Q0LA 1R4NA 4WLUA 2WMDA 2UDPA 4DWVA 4U8GA 2CVQA 4U7WA 2EEZA 2O4CA 2C5EA 2VYVA 4RPKA 2NTJA 5CAEA 1YQDA 3PJDA 5HBRA 2FR8A 3V2HA 4Y9DA 3FI9A 4NFHA 2WM3A 5KKCA 4IIVA 4KWHA 2SCUA 4LVUA 4RDIA 1BRMA 3INTA 3OEYA 3FD8A 4OM8A 5A3JA 2BH9A 1SB9A 1Z7BA 4Q3NA 4XIYA 4AJ4A 4R69A 3ROQA 4O59O 1E0DA 1NAHA 1V3VA 3UICA 4BMVA 2DLDA 3HDYA 4UULA 4U0JA 1OBFO 4BNUA 3AY6A 5IG2A 3RBXA 5EN4A 4UREA 5TSDA 3TZKA 1UXJA 1D1TA 1ONNA 4HXYA 3SLGA 5L7YA 1ZZEA 5JDIA 5JDIC 1UDBA 2LDBA 2CUKA 3ETGA 3GRPA 3ONDA 3BIOA 1KVTA 3K92A 4A73A 1ZK3A 1G1AA 3ZGYA 2ET6A 2OP1A 4RPLA 2CF5A 4MIOA 1L1FA 3E18A 2HRZA 4XGNA 3WYBA 4YAEA 4OIMA 1F0YA 1R4MB 3A4VA 5ITVA 4TZKA 1SOVA 4I8XA 4CV0A 4CQMD 1VM6A 4IQ8A 1UAYA 5DP1A 1IB6A 1M66A 3ZHXA 2GYYA 5EMHA 1RM3A 1IE3A 4WCFB 3V1YA 1AXEA 1YBMA 4BGIA 4CM8A 1P31A 3WQQA 1I3NA 5IF3A 4R41A 4DIOA 1HE2A 2VWGA 2XF8A 3EVTA 1BXZA 1CEQA 4PRKA 3GHYA 4DQXA 2NU9A 4WNCA 3WYCA 1JLLA 4MVJG 3UXYA 2Y66A 1TT7A 1HXHA 5A06A 3HHPA 4JLWA 4XYEA 2I65A 4DUPA 5JY6A 3C1AA 2WE8A 2GUGA 4Z9XA 3FNFA 1HWYA 4QFDA 2B35A 4UEJA 2QZ9A 3LLVA 3A1NA 1BDBA 3MCVA 3ZCXA 5A4DA 4DPMA 1MA0A 4XB2A 4LVCA 4AJHA 4BB6A 1ZKMA 1B7GO 2B5VA 3BXXA 2D0IA 4IS2A 4BNFA 3HB5X 4CL8A 4EJMA 1E5QA 3DWFA 1XHLA 2O23A 1O94A 3GNQA 1DEHA 3FNGA 3G1TA 1TB4A 5JPIA 3INGA 4AJ2A 5L45A 1UH5A 3Q6IA 2IZZA 1BSVA 1HDCA 1HZJA 4AJLA 1LSJA 2J5KA 2VNSA 4Y6RA 5G2OA 5JCXA 2X9GA 3DC2A 3A14A 5G4LA 1Q1NA 5T67A 3GA0A 4FFOA 5KWEA 3KEQA 4Q9NA 3LDHA 5EL0A 4MVJA 2V6MA 1V8BA 3OSUA 1UJMA 2DVMA 4GQAA 2D1YA 3WIEA 1DRUA 4D79A 4WECA 4Y8VA 4ZRNA 2IXBA 1LDEA 2G0TA 2UUPA 2VTEA 4B7UA 4CV2A 1A71A 4PG6A 2FR1A 3V5NA 4DBVO 1LQUA 1KVSA 3ZNOA 1GZ4A 2VCYA 3LT0A 4EGFA 4AJ1A 4UUMA 1DC6A 3PFWO 1Q7BA 1GQYA 1MP0A 2Y05A 1U2DA 3JQ8B 4YTEA 3H3FA 3SJ7A 4JBIA 5KTKA 4BKPA 2Y0CA 3FNEA 4F3YA 4W7IA 3VH4A 3ANNA 3H9JA 4P4LA 2V7PA 1I10A 4DLLA 3K30A 2GN9A 4CMBA 3GZNB 2Y0DA 5KVCA 2OGUA 1GYRA 3FR7A 4ZA2A 3I4FA 1WXDA 2GD1O 9LDTA 4FS3A 3DQPA 1H94A 2CFCA 1U7TA 4I5GA 1Q7CA 2AQHA 5IDWA 1C1DB 3I5MA 2VZ9A 4PVCA 4DL9A 2Q4EA 1J4AA 2E48A 3H2SA 4W99A 1BTOA 3AY7A 4B3HA 1VPDA 2Q4BA 4INAA 5J23A 1EE2A 1PJQA 3AUTA 4YRBA 3UHAA 1EFKA 5KJ1A 2H6EA 2ZB4A 2PKRA 1VL6A 3GQVA 2IXAA 4KTTE 1JAYA 4R1SA 3RUDA 5L4SA 4ZQBA 4UVIA 4E5MA 2WJPA 1HDYA 3ADPA 4E21A 2NQ8A 3DOOA 4L9RA 3KOUA 3GG2A 4ID9A 3NX4A 3OETA 3EGOA 3QW2A 1HYEA 1YO6A 4NBTA 4CODB 3BTSA 4DLAA 1DOHA 1EDZA 3DBLB 3JQ6A 1SC6A 4R9SA 4UUPA 2B36A 4W4TA 4CLDA 4WE3A 1UP6A 3KEOA 4PG4A 1ONPA 1ZUD1 2X1HA 4OKIA 3UCEA 1O8CA 1H5QA 3ZWVA 3PJFA 5GMOA 2QW8A 2IODA 4RVGA 4Z3DA 5KCZA 4D44A 1ISMA 4GKVA 5DZSA 4M8SA 2ZTLA 4OSPA 3RI3A 1PL7A 1V3UA 3OJEA 1PJBA 1NX6A 1ZVMA 2P5UA 4XDZA 2X5KO 2BF7A 1NR7A 2A35A 3GVIA 3PRJA 4MIYA 3ZHYA 1PWZA 3QLJA 2CD9A 3JV7A 3JQDA 4BS9A 1CERA 1MC4A 2HJRA 4IM7A 5JCJA 3ZWAA 4BQPA 4DBZA 2FPPA 2Y1DA 2EERA 3WWZA 2P4QA 4B4WA 3E9MA 1JKJA 3M2TA 3DAFA 5DT9A 5DCUA 1HT0A 4ONEA 1EFLA 3U3XA 2B4QA 4R1UA 3IQDB 2AQIA 5BNTA 2PNFA 3BMOB 2EW2A 2EWMA 3E82A 4XCVA 3PXXA 3T7EA 3D1LA 2EKPA 4D3SA 1Y5RA 1B0AA 3RFVA 1PJ4A 4BNNA 4IJWA 3AM3A 2WD8A 5DOZA 4BIIA 4IY1A 3WGHA 3PWKA 3DOJA 3BHMA 3IKVA 2BELA 2FSSA 1MX3A 1QYDA 4A27A 3FWNA 2WSBA 1PQWA 1B16A 1C0KA 2OORA 4DPKA 1Z73A 5CG2A 3WIDA 5DP2A 1Q0QA 3WGIA 3NTOA 4ND1A 4MDHA 1XG5A 4M55A 3HNPA 3UF0A 4H3VA 2YHIA 4AJOA 1DHTA 3LVFO 4RZHA 1PL6A 1A5ZA 2HO5A 4YA6A 1GV1A 3PQEA 1X15A 5GY7A 1N7GA 1GYPA 4LN1A 4BNYA 2OHXA 3D5QA 1PWXA 3RU9A 2GZ1A 4XA8A 5T8KA 5T8KC 3UOGA 5KJEA 1V6AA 1ZK2A 1U8FO 1O9BA 4HBGA 2ZK7A 4XJTA 5BQFA 1E92A 4FSHA 2OXIA 5A9SB 4WLVA 1DIGA 3MTGA 4CUZA 4KWIA 1DO8A 4BO0A 1A9YA 3Q0EA 1LSUA 3ADOA 3CUKA 3QE3A 2D3TA 3UAGA 4CJXA 3GEDA 4B7CA 3JD2A 4JQCA 1A7KA 5JE8A 1QKIA 1RM0A 1NHWA 1PGNA 4S1VA 2YHUA 3ZW9A 4BGEA 4BV9A 3OM9A 1XYGA 4GMGA 3PPIA 4UUNA 1CWUA 2I6TA 3M1AA 4Z6KA 3PP8A 3LT2A 1YB5A 5ILGA 3TDKA 4PLZA 2QG4A 4QXMA 4J91A 3QWHA 3AK4A 4WASA 4K28A 3I83A 1XA0A 4TZTA 4BHTA 1LX6A 4UEOA 2Y68A 3ZU2A 3O38A 3C8MA 4ZU3A 4GX0A 3SEFA 2B4RO 3HJAA 3V1UA 2QZZA 5F1PA 2GLXA 2DC1A 1R16A 1RJWA 1VJTA 1TT5B 3A28A 2RCYA 5CEFA 5IDXA 1PX0A 1JU9A 5MDHA 3RFXA 4FIZA 3VZQA 2GNAA 5C3MA 1L7DA 4PLHA 1FDVA 1DC5A 3RC1A 4E2YA 5EIOA 1V0JA 4BNJA 5A5FA 3CZMA 5ICMA 4BGVA 2X5JO 2NUAA 1T4BA 4B8ZA 3K96A 2GCGA 1IHYA 5CFZA 1IPEA 1Z7EA 4JP3A 1O95A 2W8ZA 3GFBA 3RUAA 4DLBA 3LLSA 2PY6A 4J1SA 4D3FA 2PH3A 3X2FA 3GMDA 1SEVA 5JO0A 1LRJA 3KV3O 3A06A 1H6AA 1PR3A 4DYDA 1KBZA 3IDSA 2PKQP 3O8QA 4XJSA 1TXGA 1Y8RA 5T64A 3F5QA 1QYXA 3WOHA 3AJRA 1Y5MA 1HZZA 2QRKA 3HG7A 5TC4A 5JXWA 1QSGA 4WOKA 1YQXA 2I76A 3VTFA 4L74A 4XRGA 2X7HA 4XRRA 4GLOA 4QUKA 3E9QA 2D8AA 3O9ZA 4YT2A 4PLTA 1SNYA 3V1TC 1HE4A 2CSUA 1NQTA 1HKUA 3G49A 4YJFB 5EESA 4CM8B 1LNQA 1P3DA 3RD5A 4B8WA 5L9AA 4TKLA 4EEXA 4Q39A 4AICA 3CXRA 2EKQA 4NU6A 5F3RA 1GUFA 1PGOA 4J16A 2A94A 2OZPA 4NFSA 3GAFA 3GDGA 1WDLA 4BL5A 3MJVA 4YT5A 3DHYA 4DMLA 3WBBA 2ZJ1A 5JBIA 2GF2A 3DEYX 1BWSA 1LC3A 3I6QA 2Q3EA 1EK6A 2O4UX 5JDCA 5JDCC 1LDNA 3DR3A 4OYRA 2TMGA 4RVFA 3QVOA 4WLFA 1CIVA 1GZ3A 1H9BA 3U4CA 5CP8A 5I9MA 4KQXA 1KEPA 4NPCA 2X86A 5T73A 4OO3A 3P7MA 2LDXA 4XYBA 1C0LA 5G0UA 1K3TA 4BB5A 4FBGA 4CR8A 4IGEA 2GGSA 1IY8A 1PGQA 2XAAA 3UCXA 1WZIA 3RROA 3DOCA 4J0EA 1CQJA 1U3VA 2J3HA 3WGGA 4W6ZA 4A26A 1EUDA 3K73O 1OFGA 4IDAA 3RAJA 4KOAA 3W1VA 3W8DA 4TWRA 2X6TA 1FDWA 4FCCA 1WDKA 3L6OO 5GZ6A 2VUUA 1I3LA 4FFRA 3PYLA 1NQ5A 5JAQA 3CMMA 5U9CA 2VQ3A 4UVEA 4H16A 1XIVA 3T4EA 1RWBA 4CM7A 4ND2A 2WYUA 5A9TA 4OOEA 1EK5A 3ZDFA 3EK2A 1QLHA 1VRWA 1CDOA 2V65A 3PHJA 4B4OA 2OMEA 3GFGA 2DBRA 4CM9A 2D5AA 1EE9A 1DLIA 3AI1A 4OAQA 1B14A 2PD3A 1GYQA 2J5QA 1NFQA 4TRMA 2AG8A 3C1TA 2FSVA 5TX7A 5C5IA 4N5MA 4BKOA 3NAQA 5JO9A 3VPSA 4G65A 4OJNA 4Y6PA 1Z45A 4I5EA 5CHEA 2AEJA 4CUJA 2YV2A 3WICA 4W82A 4K26A 1Q7GA 2I67A 1BG6A 2WYWA 1IOLA 1LU9A 1DJNA 2HMVA 4FC7A 4IJVA 1O89A 3AUUA 1YB4A 4DQVA 4MINA 4R4JA 4FGWA 3R1IA 2IE0A 3OHSX 1DB3A 2AA3A 2UVDA 3GN1A 3ONEA 3C24A 3D3WB 3VZSA 5IDQA 2HK7A 4YEDA 3AWDA 2PFGA 4NR0A 4WLNA 4CL3A 5L95A 1B15A 4IJKA 4CR7A 1EVIA 4L8VA 4URFA 2DKNA 4BNTA 4A2CA 4K9DA 2GZ2A 3LU1A 3ZWOA 4ZQFA 3QSGA 4XX0A 4IMRA 3GZ4A 4ALNA 1T2AA 3AUSA 5JSFA 1Y6JA 1ULUA 4JK3A 3D4NA 4PZCA 1GADO 5KOIA 2AE2A 4FW8A 3RQSA 3IL2A 4IJUA 2ZIZA 4N54A 1WPQA 5TJHA 5G0WA 1B3BA 4ND4A 4CLOA 1NNUA 1CJCA 2CDAA 1U2GA 3H9QA 4BO3A 1PU2A 4GPD1 3ZU3A 1WW8A 1OMOA 1EVYA 3PI7A 1KY5A 3B1KA 1PJ3A 1DIRA 2UV8A 4EUFA 1FDUA 3E03A 4E5NA 5THQA 4BNWA 3H7AA 2Y1CA 4D42A 2AHRA 4LCJA 4BO7A 4ZQHA 5JYAA 3PEFA 4FR5A 2PZJA 3D3EA 5CEEA 4UVHA 3OECA 2DBQA 2GDZA 2HU2A 1DAOA 1M6HA 3PDJA 4MVJH 1DRWA 4CMEA 1M67A 4CMEC 3LQFA 2YDYA 3ABIA 2J8ZA 1R12A 1N2SA 5B37A 3A9WA 3QIVA 1FF9A 1E3LA 1F12A 5JS6A 3WR5A 2IDZA 1OAAA 3Q1LA 1P77A 1ZJZA 2HK8A 3Q9NA 4IDFA 3DB2A 1ZMTA 3MOGA 1LA2A 2PZKA 3I4CA 5KIAA 1TVEA 3QVXA 4E6PA 2VOJA 3ZWCA 4WKGA 3H2ZA 3C85A 1N9GA 5DDIP 2HLPA 1RYDA 1SOWA 2DTXA 3ORFA 2HMWA 3DBVO 2YHIB 2X0JA 2FOIA 1T26A 2DPGA 2VRBA 1I2ZA 1ZMOA 5I8ZA 3GVXA 5IN4A 4HFJA 1Z82A 3E8XA 4RF4A 2ZCUA 4XQEA 4LMPA 4I1IA 4XIJA 3ST7A 1BXKA 4BO2A 2I99A 3AU9A 3PHLA 4MKZA 4MVJP 1E77A 1U3TA 5FYDA 3I9MA 3CIFA 3N58A 5ER9A 1VSVA 3JCZA 4HV4A 2BI8A 4HFNA 1ZSNA 5DF1A 1PTJA 3RVDA 2VOEA 1JDJA 3NGXA 2VT2A 3KZVA 1OOEA 4LSWA 4E2ZA 2BD0A 3NRCA 4D7AA 4F6CA 4IDDA 1JQBA 1FMCA 4JROA 1ZFNA 4IS3A 1LLQA 1YOVA 3SVTA 1BHSA 3KYCA 5G0TA 3JQ9A 3JQ9C 4WK6A 5JMPA 2ZB7A 4J7XA 4QSMA 1AGNA 1E3WA 3MJSA 4AJJA 3ITDA 4OMUA 1GEEA 2YQ4A 4BNVA 4YR9A 1G6KA 2DQ4A 2VRCA 3LF1A 3KSDO 5IXSA 5F21A 2YQ5A 3FNHA 5K0ZA 4AJIA 4RF2A 1PR9A 4F6LA 3KETA 3NT5A 5F5LA 1ADCA 2CVOA 3ZHBA 5JAMA 1LC0A 3MOIA 4ZGWA 1UP7A 1A4IA 3F9IA 3I6IA 6ADHA 1GD1O 1YS4A 1Y7TA 3OMLA 1TLTA 2Y1EA 4OL9A 3FPLA 4L0QA 3GUYA 2EHDA 1KERA 4G81A 3BYZA 4QO7A 1I0ZA 3IKTA 3ZWNA 4EEZA 5TIIA 1NTOA 4N18A 4PLPA 5HS4A 4J9UE 1ZNQO 2X0NA 3PLNA 2OO5A 3EVNA 4HP8A 2RHRA 2NVUB 4FJ1A 4F45A 5K6AA 5K6AC 4DIBA 4A0SA 2F1KA 4A10A 3O8QB 4YAKA 4M86A 3E5RA 1Y8RB 2NADA 1ENPA 2YY7A 4BNLA 4DC1A 4R5HA 1E6EA 4X54A 1KS9A 5DCWA 1EVZA 4LMRA 1T2CA 1I5RA 1IZ0A 1NVTA 1SO8A 4PGFA 3I9LA 1DC4A 1LLUA 4MVJD 3TL3A 5CDGA 3U5TA 4BQRA 4MVJE 2QRJA 4PLYA 2J5RA 5KJ6A 1P74A 2PV7A 4JCOA 3BAZA 2Q1WA 4RV9A 4IQ0A 1BVRA 3F4BA 1GUZA 1KOLA 3WQRA 1GR0A 5JC1A 4Y98A 4R1TA 2CY0A 1G0OA 3U0BA 3K2BA 1D4FA 3WB9A 4W9NA 4W9NC 1GAEO 2QYSA 1ISGA 4GX1A 4QTZA 4E31A 3RC2A 1NHGA 4PLGA 3OFSA 1N92A 2FPIA 1U28A 5I7FA 4BOYA 2G17A 2A9FA 4PG7A 4II2A 1XWFA 3JQGB 4OKNA 3TOXA 2AXQA 1EVJA 1B8PA 4CMJA 2GN8A 1ARZA 3C7DB 3ENKA 3BHJA 3GY0A 3WGYA 3QWFA 5JYDA 4L73A 1T2FA 2X22A 4ILKA 1GEGA 3OEWA 1I36A 4YDRA 4P4GA 5ENVA 5JW6A 3NYWA 4OSOA 1KYQA 4CPDA 1Y81A 1SB8A 2E37A 3AOGA 4PLCA 4ZQGA 1LEHA 3RJ9A 4M49A 3BMNA 1BW9A 1E7WA 1EDOA 2J3JA 3VZRA 4CQMA 4AL4A 2OL4A 2PGDA 1GPDG 3DBRB 5KJFA 3VH3A 4ALJA 4GSKA 5A3VA 3UUWA 3VPGA 3HE3A 4DYVA 4I08A 3SXPA 3ONFA 1J49A 3MWEB 3CE6A 1YH3A 3PLRA 3DZBA 1HEUA 3FTPA 5FWNA 5T6BA 4GGOA 2WEKA 1MFPA 1MV8A 4BNHA 5ES3A 2WD7B 3VDQA 3DAGA 4NFYA 1NR1A 4MVJM 4DXHA 5LDHA 3M2PA 2AQ8A 1P0FA 4IXTA 1UXGA 1RKXA 3LZ6A 1GFSA 2E49A 4J2HA 2EV9A 3PWZA 4AJNA 2PR2A 1F06A 2JHGA 3ZWYA 3GAZA 4NJOA 3GNTA 1E7RA 1KY4A 2ZYAA 4AJEA 4B79A 1GQ2A 2Y1OA 1U4SA 3ZU5A 1DIBA 2YDXA 5ICSA 3AFNA 3ASVA 4WCDA 1YGYA 2G1UA 4Z3KA 1QXSA 4J2OA 3WTCA 4RJTA 1ORRA 2H1SA 4Y6SA 3ZWMA 2BGKA 2O3JA 2CNBA 1CF2O 2EW8A 2P91A 2X58A 3ZWPA 3HSKA 1KIFA 3TPCA 3NDRA 5DBGA 2AE1A 4DQUA 3DL2A 2FMUA 4TSKA 1YBAA 1YDEA 4TVBA 4Y67A 1ENZA 2JKVA 2Y99A 1XU9A 4PLFA 4CUKA 2GN4A 4DPLA 4P22A 1NVMB 4ZN6A 3QVSA 1MUUA 1VC2A 3O03A 5T57A 1BXGA 3AU8A 3DZJA 3PHGA 4ALLA 1ISJA 2W2KA 1HYGA 4F46A 2VNAA 4WEOA 2PKQO 2O3TA 4CM5A 1Y1PA 1RYEA 4NHEA 4U0KA 1LLDA 1I8TA 1F14A 3VVCA 2P68A 4BO9A 3STHA 2VHYA 3V2UA 1D1SA 3ICPA 1YXMA 1HRDA 5T5QA 3HQ4O 2ZQYA 3KO8A 5ITWA 1V3TA 4EI2A 3WS7A 4KQWA 2GSDA 4Z9FA 2QYTA 3JD1A 4Q3AA 4O5OA 5JFOA 1QP8A 2Q46A 4MOWA 4NH4A 2H5LA 4RL6A 3D4OA 3JQAD 5G0VA 3BTOA 3EY4A 2OOSA 3UVEA 1SCUA 3RKUA 5BR7A 4BO1A 3BTVA 1HDXA 2X9NA 2NNLD 2EP5A 7ADHA 3WMWA 2GO1A 3L07A 4KTVE 3VKVA 4IDCA 4WNIA 2I9PA 2C82A 4YT8A 3I9NA 1OC2A 3GPIA 4Q3EA 4GBJA 2YJZA 3HDQA 2VTDA 1WNTA 5FFFA 3FHLA 3W8EA 4D41A 3VAZA 1WP4A 3H6KA 2J6IA 3QHAA 3GK3A 1X7GA 3OQ1A 4RPGA 2B83A 1C1XB 1ZSVA 1HF3A 3DZHA 1D3AA 2JCXA 4PCVA 3JQBA 1JVSA 3JQBC 4CQLA 4E5KA 4GGPA 3PJGA 3DMTA 3DMTC 3R3JA 3I9OA 4FFLA 5TRTA 2AEFA 3VKUA 3WDSA 3DTYA 1C14A 5CEJA 1E3JA 2JAPA 3TFQA 5U1PA 3I9JA 4XGKA 1SZJG 2HMSA 3ETDA 3BMCB 1PL8A 4IUYA 3NT4A 2B5WA 1E7YA 2YUTA 5M6DA 4PG5A 2JD1A 4GX5A 3LC1O 3GVCA 3TF5A 4IDGA
chains in the Genus database with same CATH superfamily
1CFZA 4Q19A 1JR4A 2VHZA 1UZLA 3ILVA 1GV0A 4S12A 5AK5A 1JQDA 3V34A 1W5AA 3IQHX 4EB3A 1G8FA 1QCZA 3I9KA 2EJVA 4HZGA 4KQIA 3I53A 3RJTA 5KVVA 1NYTA 2H1FA 3M3HA 1N2XA 3S2IA 1MV5A 1GLGA 2I4LA 3MWFA 5BMVF 4EABA 4UVGA 2W7TA 3T54A 1KYYA 2NZJA 1CQIA 2O2IA 3N76A 4MV8A 4DR6B 2ILTA 2FDXA 4XPIB 2W58A 3DCNA 3EZNA 4BB0A 3U4HA 5EFOA 4K6HA 3G02A 3FOFC 3FIUA 2O2XA 5EMMA 4DA9A 2J08A 4REQA 3EFBA 5LQUA 1KZ7B 1ZCJA 4EJSC 4QG7A 1M2VB 2QTHA 3FPBA 4ZWNA 2P2DA 1U0FA 3NTUA 5CAEB 4NL4H 2V98A 1NY5A 1B43A 2XA2A 3L0PA 4RTPA 2YC2C 3MB5A 5HUJA 2OFXA 1A9OA 2PX4A 2NV6A 2ZBDA 4AS3A 3S55A 2H1LA 4X41A 1CJTC 2X8AA 1UPFA 3ZWWA 3AH8A 5CDTA 4DDKA 3LDAA 4LE2A 4NXNB 1Q77A 5JS8A 2I66A 4JUAA 1YZFA 4RW0A 3EMKA 4DTIA 1E2BA 2BKXA 1I2DA 2RGXA 1E9VA 3EAFA 1O5IA 5EGNA 1TC2A 4QGAA 5HIJA 3UWOA 1QVAA 3V7FA 2QRQA 1OZAA 3E1GA 3EZLA 3QTLA 4FOLA 3F46A 4IILA 4M7WA 4M76B 4P80A 2OT3B 4AIIA 5KX5F 5LYJB 4GWGA 1W7AA 4MGYR 3H65A 3STXA 1N6KA 4OVKA 1WQ1R 3RLFA 1CUFA 2OA0A 4HXEB 2ZYHA 4KG7A 5LZ2A 2PRYA 1JR3D 2WIJA 4YLEA 1YHNA 2PIDA 4IEIA 4LXGA 4YPOA 4DJFC 4FYWA 4QZVA 1AHIA 1R4MA 1L5HA 1ZEMA 3H5TA 1EG2A 2OGTA 5A4KA 4QBGB 4PXSA 4Z7QB 4J1TA 4ALMA 2E82A 1JG2A 3FSGD 1ZONA 2YFYA 4EKIA 4EZEA 1JKIA 3OWHA 3D7MA 4IWNA 1OI7A 1W48A 4E1BA 3P9KA 3HPRA 1UJBA 2BMAA 4PHFA 2JD2A 1GSHA 1RRGA 4MQFA 1MGOA 1AOXA 3OBBA 3FGNA 1W35A 2J9FB 3JQCA 4HR7A 4N39A 5EXDA 4DWOA 4WV3A 4BVAA 2V59A 5LBUA 3ZNNA 1OROA 3P9RA 2HMUA 2P41A 2EF0A 3CZRA 4BBZA 4JAVC 5C8XA 2FR0A 1R6AA 2IYQA 4BLTA 4C29A 5IKEA 5K0EA 3IOCA 3NT2A 1AUOA 1LB1B 2RHWA 5AXAA 3CUYA 1I3MA 3R3UA 1J2UA 2Q3DA 3O82A 3OC0A 4NNJA 1NR5A 5B7NA 2PXHA 3LT1A 3L4SO 4F38A 3KR1A 2CNWA 4Q4AA 3DL0A 1EDDA 1EFVA 2AG5A 4ZAWA 4X3PA 3WG9A 2FUG1 5ICGA 1V9LA 1UR5A 3M3PA 4FFPA 1DPGA 5JSQA 4Z0HO 3BXZA 1KR2A 1RHMA 3ZZ0A 2XQKA 4J76A 3BRWD 5ECGC 1ZIDA 3MGAA 3KTFA 3P2YA 1UKEA 3CMCO 3OCXA 3ORRA 1P1CA 5DBIA 3JWJA 4YCDA 1OYYA 2REQA 2O2YA 4EI8A 2JI8A 3UW1A 3RVNA 1V9CA 5BSUA 1W25A 4EB8A 4CTMA 2OAP1 3OCCA 3ICEA 1DS6A 1E20A 1JA9A 1YRYE 3EGCA 3AI2A 1R9GA 4HDAA 3KLMX 5AJUA 4B4UA 3B6KA 1N1GA 4CQNA 2VJLA 3UKDA 1ZH2A 1IJBA 4KC0A 2NVBA 1O5OA 3IAM1 4EHJA 2EJCA 2IYNA 3E7XA 1G8YA 1NLFA 4NG5A 2UYCA 5AKKA 1ZAYA 4TMWA 1TA4A 4R7TA 3BMNB 3MTBA 1BW9B 1J42A 2D2EA 3A32A 3SQWA 4MV5A 5JEDA 5F5NA 2X0RA 3WGZA 4XB6B 2PCJA 5HJ5A 1ISFA 3QNUA 3S44A 1PX2A 2JEZA 3E3AA 4P4NA 5AJTA 3V7UA 1SVUA 3VX3A 2ZE8A 5L51A 1KE1A 3E6AA 2XOXA 1IBCA 2QTFA 3VI3B 1KVQA 4AO6A 1A2KC 4R8VA 3TJRA 3DSRA 2MTBA 4A6DA 1FSFA 3MILA 3TMAA 2Q9UA 4HB2A 2ENWA 5IKMA 2XCQA 2ZSEA 1IY0A 2Q8PA 3SX0A 3TDMA 2GD2A 3COJA 1RACA 5B2ZA 2VDQB 4NIMA 1JTFA 5DWDA 5LCXA 1GDDA 3LKVA 3OP4A 4OXYA 4PR0A 3AVVA 3ZU4A 2H29A 3NDJA 4Y2JA 5MGBA 3TBKA 3FNQA 3KEFA 4WFQA 4DIFA 1Z2OX 3E35A 3VSAA 3IHWA 2QM0A 3PQCA 4WDRA 1X70A 4HNGA 3TUZC 3SG0A 1T1SA 4GI2A 3D0OA 4URXR 2RJNA 3FSJX 3PCTA 4K9RA 1TU0A 4DWJA 2VQ6A 5L40A 5ISMA 1CUHA 4QPNA 4I46A 4NYJR 3QF4A 1DUSA 1K98A 1TUEA 1XKQA 2C1ZA 3N1UA 4GI7A 4NZNA 2H4YA 2BFOA 2WRZA 2JB9A 4PTLA 4OBXA 4XIGS 3R20A 4K0KB 4NDNE 4DCUA 3IGFA 3G7SA 3COPA 1YJQA 4RA9B 4XYGA 3F8WA 1LXCA 5DJ5A 5C7YA 3BIFA 2EU8A 2QIOA 2A1UA 1DZ3A 2XXJA 4D97A 1YI0A 2PUWA 5AXBA 1VSUA 2JGMA 1QGUB 3LXUX 5DK4A 5FEUA 3L7YA 3CB4A 1XV5A 1WF6A 2PX6A 1D4ZA 2LCQA 1O8BA 1L7QA 2IHVA 3L49A 4FUTA 4EF4A 1RYMA 1BJKA 4U5QA 3GJ4A 2IUEA 1DTEA 4K1LA 2EYUA 4D1YA 4WGGA 2P9HA 2VZ0A 4D92A 3ZY2A 2GAFA 1ISHA 2GCNA 4PZDA 3O4IA 4W8HA 3STUA 4D0GA 5IZ4A 2JGEA 3KYBA 5BQXA 4AYWA 1XYVA 1T6YA 1HPLA 2AI1A 3EEFA 1HETA 1MO3A 1IMOA 3K0CA 4RL4A 4BKMA 1X1AA 4I2NA 3EEYA 4BEWA 5IYZA 3DT9A 1HORA 2XEDA 3K2EA 2E1PA 3FGZA 1J2JA 2I4MA 2WU1A 1CZNA 2JGLA 2DB3A 4BMSA 1QRDA 1TX4B 3FFWA 3OUZA 3SHFA 1E6UA 4MVJF 2H9AA 4YCCA 2P77A 5EWJA 2UZ0A 4KN8A 5CGQB 1FP7A 1G9TA 5HFAA 4ESEA 3L7JA 2NZXA 4C5BA 4HUQB 4V1CB 5JAIA 1XD2A 3TNYA 1Z5ZA 4G0QA 3A9RA 4G86A 1FW6A 2OESA 3D7SA 4QM7A 1U04A 1JEDA 4DUGD 2R5WA 4BNIA 4DMUB 3N8KA 2BGNA 3AR5A 2VN8A 4U6QA 2QTNA 1E2GA 1KQ3A 1ECPA 1Y1KE 4KR0A 1E5XA 3ER6A 1MQSA 1LTHR 3EP9B 1JFTA 4P38A 1SCUB 4CEJA 1SQ0A 4IIYA 1H8HD 3GGGA 5H82A 3MUEA 1NP3A 2N47A 3NRBA 3V7NA 3CZQA 4P7KA 1H69A 4C0SA 4V0LA 4HI0E 1JNYA 1B8VA 2ZYGA 4NEHB 4LZAA 5D5QA 3THWA 1JEOA 5K0JA 3DLHA 1V39A 1XF1A 2G1JA 4MUEA 2CDBA 4L5BA 4RTRA 1JIXA 3SR4A 1UXHA 2QBYA 4LOHA 3ASUA 4GBMA 2ZQ5A 3PHBE 1NSTA 3E8MA 2HA2A 1VL8A 5TT0A 3T0IA 1X7XA 4ER5A 1EX6A 5IKPA 2V4MA 2W6QA 4PO9A 1UDCA 2I5PO 3LZCA 4POOA 2JIDA 4P93A 5IVPA 2ZCVA 2P9CA 4F5EA 3C7CB 3GH3A 3TEFA 1FE8A 2QW1A 1ILEA 4LSMA 3TL2A 1AB6A 1M2HA 1PKXA 3ADKA 3SFTA 2PGJA 1Z83A 4WBSA 3MF4A 1X7WB 1EXMA 3K4HA 7REQA 1W4ZA 3ND5A 4OQZA 4OBEA 4FHZA 3UHPA 5K03A 1RRCA 1YWGO 2QM7A 5FPYA 1J8FA 2ZRHA 3LKDA 2QVGA 3OWOA 3QM1A 3W3ZB 4GBED 1TAQA 4G3XA 4Z9YA 1ZP6A 3FF4A 1SU8A 1XXHE 2YICA 3CUSA 3P8ZA 3QIAA 2Z2XA 1IU9A 3Q0TA 4QVKA 4M0MA 4Z4EA 1KC1A 1NVGA 2QUIA 3GLFA 1E3MA 4K40A 2DLCX 5EINA 1ES9A 2A86A 3A6KA 1QIKA 1RAAA 3URKA 3GRYA 3VDRA 2AQKA 1EZ4A 2A58A 3NEPX 4MP3A 1OXBB 2QVCA 3HB7A 4JLKA 1VJCA 1TTPB 4L9SA 4B4VA 1Z08A 4Q1EA 4DRYA 2VDNB 2O3QA 4ZRMA 5IZCA 1UM8A 1WHSB 3GFVA 4YASA 5FBVB 3JWHA 3EC7A 1KAQA 2NUPA 2Y2UA 2JH9A 2ZPUA 3R6TA 2GXAA 3NGMA 3VNQA 3PGKA 5FBHA 3TI7A 1KTVA 3ETLA 3I45A 2W6ID 3BMXA 1QZUA 1T0JB 3TR5A 1QHGA 1QH8A 3SZ3A 4O0MA 1TZ2A 3ZK7A 2FPMA 2O2EA 3VU0A 1BMFA 2UZ4A 2X0IA 2OGSA 4ECAA 3FKSA 4KNVA 3CCFA 4WVLA 1O6BA 2WWRA 3WJ1A 4DW8A 4LHEA 1MORA 4DDHA 5F76A 5FUVA 4GPEA 1N2IA 5IT5A 1JQ3A 1RI1A 1QQAA 1YL6A 1DWUA 2O05A 1LSOA 1LFDB 3SF8B 3B1FA 3IDQA 4HGPA 4E4TA 5JSZB 1B6GA 1G4AE 2ZSAA 1CUUA 1EX7A 4H3KB 4GKAA 4IIJA 1HTTA 3GGSA 2CVZA 2Q6IA 1QJ4A 2D1QA 2XGSA 3BL8A 5ALLA 1F8FA 2RHGB 4JNKA 2G80A 4MJ3A 3U6KA 3S2FA 1UYJA 2CXSA 3JD0A 1BA3A 5CXXA 1YNOA 2PSJA 4XTRA 3HGQA 3O8OA 2CXXA 4KX5A 1TT5A 1ENYA 2AYYA 1T8RA 2JDID 121PA 3PT9A 2BEWA 4GP9A 4G23A 4LSGA 4WZBE 5DNAA 1Y7IA 3FY4A 3A4TA 2O06A 1R66A 1K7YA 1JL3A 3LVBA 3PS9A 4FGZA 5AW7A 3WAGA 2QN3A 3CTPA 1JVBA 2R66A 2RSLA 1PZFA 5E6SB 3HH8A 5B4UA 3BN3A 4C7KA 3A6JA 4IHAA 1UKVY 1DARA 3L8FA 5CHYA 1XAHA 3BQMB 4RO0A 3KJHA 3JASB 1ZBQA 3TOZA 5CYFA 2PH5A 2D5LA 3IMFA 3ZWXA 3F4LA 3FM9A 3ZVLA 4JJGA 5AUOB 5JI2E 3DBOB 1ZH0A 1ZOLA 3CVUA 1CEYA 3BMQA 3NBYC 4Q00A 3TE6A 2CXUA 4U7TB 4EG1A 1CULC 3O8RA 1P2TA 2I29A 5BUQA 4ND8B 5KVQA 4YJGB 5I6DA 5AKLA 3SJAA 1P4AA 2ZS7A 4KRYA 2R6ZA 4PSCA 4WK0B 1BDHA 3HK2A 1S7GA 3KSMA 3L9WA 4K9PA 3S2YA 5DX1A 4D9CA 2H1IA 4UM9B 4MW2A 1CY8A 1CF4A 5HGXA 1P0CA 3W5AA 1FA9A 1U0EA 2B30A 3RC9A 2DQYA 5EKDA 2Z4RA 5IBPA 2QNIA 3OTIA 4EYGA 2J9GA 1H2BA 2O1EA 2VHCA 3K5HA 1WS6A 2QTCA 5TMEA 4L16A 4IV5A 4NAUA 1XKXA 1NMZA 4ZAVA 3L0CA 2AFRA 2PKYX 2ZRQA 3EW7A 5AOVA 3WK7A 5JC8A 4QDUA 2E5WA 3IXQA 4DZZA 4CZ2A 1LBQA 2OCPA 2YVAA 3EXEB 3F96A 4KJXA 4A0RA 4M1ZA 3AB8A 1QYCA 4OB6A 3MELA 1JHAA 5F35A 2DECA 2BI7A 2L19A 3ELYA 3BSSA 3IILA 2AWNA 4AZWA 1CNFA 1DG3A 4KH0A 2FE1A 3W5DA 1CW2B 2R2GA 1Q3HA 4PX3A 1XQ6A 1Q2UA 5BQ5A 5AVUA 2F1HA 1DKUA 3T7IA 1D03A 1A2BA 3PFIA 4KE9A 2V7TA 1U7WA 4EB0A 2MSEB 1ZD3A 1QORA 4UMFA 4JXJA 2YYZA 4L8FA 2QE7A 3UNXA 5KYTA 1ZH4A 3KLPX 1MRZA 2NTVA 3HKCB 4NCIA 2AG1A 4I1SA 3DONA 3RFCA 3TSCA 5ULLA 4KXQA 1U8YA 2OEPA 4NS4A 4OHUA 2J3KA 3A26A 2GJ4A 3LRXA 1E1LA 4IYRA 3VO2A 1CZKA 1DCFA 1M34A 1WBDA 2PPVA 2NZ8A 2QMEA 2BMWA 1XPUA 1P0IA 1W1UA 3ZTYA 1DC8A 2HGZA 4HGRA 1PZHA 3WWYA 4TQUS 1Y3HA 3ONWA 5AD1A 4GECA 3LQKA 1JJBA 4DRXA 2W90A 4MW7A 1ELOA 5BWBA 3EIWA 1F6DA 2YQZA 3D54D 3K16A 4RLHA 4WLOA 1GG8A 5FFNA 3GJRA 2J4DA 4JSTA 4P54A 1O94C 4BVHA 4M83A 5L4NA 2IQ5A 5LOVB 4CN8A 1D5WA 5GONA 4L76A 2BONA 2ODPA 4NCNA 1P91A 4W5JA 3BE5A 1NP6A 2FNAA 4H77A 3RSQA 5BSFA 2YFHA 4YJ2A 1TJ3A 4OM7A 5I7HA 5DM70 1NIPA 3KEOA 2ZXEA 3C4JA 1GP2A 4E70A 3GCZA 3GLQA 1FL9A 3KXKA 4YACA 3FSEA 3UYKA 1TDJA 2WR8A 1C3EA 3H3JA 4MI9A 4B34A 3GLHB 1QVRA 2GEBA 2JGAA 4PSVA 3GFQA 4ZT3A 1TGVA 1DFIA 3LUFA 4KV7A 4RMNA 4M1WA 4B6GA 1G8SA 4TRJA 1HQYE 2FN8A 2FFHA 2NZ2A 4CG3A 3AVOA 4DVGA 2CL7X 3HMQA 1UXKA 1PT7A 1CY4A 1N8TA 3OF5A 3FBTA 3E3OA 3HDGA 3K0HA 4FXPA 1TEZA 3CRNA 4QFBA 2HXYA 1BNCA 1Q7EA 3KXDA 4YAWA 3WMFA 4AD8A 1J2RA 5I48A 1XZPA 1NUTA 3DEZA 4IDEA 4KUHA 2QJFA 5IS2A 1L4YA 4QLBA 1D2HA 1MVLA 2OUKA 3F6YA 3WLTA 3GJ6A 2HJVA 3RASA 3GFFA 3PXDA 4RVOA 2W4QA 3WIUA 1FFYA 3DHVA 3GLUA 2JLXA 4UEKA 1LWNA 4YAUA 2PL5A 2DE0X 4I9NA 3RWBA 1UAGA 4K6GA 3N8HA 1X7DA 3EDMA 4LC0A 4DM7A 3VKFA 1GA6A 1CYDA 1IAQA 2B20A 2GNPA 2YOFA 4E4RA 4FDUA 5AIBA 2GCIA 4Q03A 3G17A 1TMYA 3QV1A 2ZRBA 4OJKA 3G9ZA 4HAXA 3FTNA 3HEMA 2JH3A 1YZLA 2ZUSA 1ZN8A 1DO0A 3OQ6A 1QMHA 3TTTA 2G8NA 1T3HA 4MRRA 2PANA 4RJKA 3O91A 4QQRA 4CDRA 1ZVVA 1J8VA 3AESB 4XB1A 5I8WA 2TMDA 4N3GA 1AQLA 1I24A 1NQUA 1YI1A 5IMBA 3SBDA 5IJZA 4AROA 5JV5A 5K7SA 2EG9A 2JIZD 3QLVA 4OCZA 4ZT5A 3TQQA 1SZDA 4ZYLA 5BW4A 3PZRA 1AM4D 1IHXA 2QPTA 3EGVA 4K6CA 1Y8QA 1M2OB 1P7YA 2SKEA 1ZK4A 2QR5A 3LSYA 4YCAA 4IG9A 4O4JF 5JBNA 1L4KA 1IXYA 3WBFA 3VDMA 1WMFA 1K3FA 3G9UA 4DV1B 4PE5B 3ZXYA 2ZJ6A 5H5JA 2ZDQA 3IP3A 1XRNA 2EBHX 2OC9A 3CURA 1ICIA 1UZMA 3CX8A 5DTJA 2CMHA 4ZAZA 1X1EA 3AKZA 2OFOA 4GRIA 2RHMA 1JFFB 3O4RA 3U39A 5IXJA 4Q7KA 3K9WA 3NRJA 2E9SA 2PMKA 4JU8A 2PA3A 3OF2A 1LS6A 4H27A 2YWEA 1ZI9A 2J31A 2CKMA 2NQ2C 4F93B 3PQ4A 2BUCA 3LNTA 3N3AC 4GOMD 3WL5A 1N2CA 2PXAA 4B33A 4B87A 5IAAA 1E98A 3BUSA 2DBZA 1RJFA 2BKUA 4TL8A 3K8ZA 2XRFA 1IZYA 1R2QA 2CNNA 3RIMA 3L0ZA 3DXFA 3IQEA 4W5RA 5H8WA 3HZRA 4HG2A 4LV8B 3H9EO 1TRKA 2YUIA 1UJ6A 4AZSA 2X3YA 1HTBA 4LQCA 3NHUA 1JWLA 5KNBD 1EWKA 1MXHA 2PX8A 4CKWB 1PK7A 3BGSA 1QGZA 2ERYA 5E1MA 4RKFA 5A02A 4ENTA 3HM2A 1V5EA 5DV9A 5FA5A 2ZBEA 1UQTA 2XODA 3HVUA 3KYDB 1GRVA 1TZMA 2CNOA 2JFBA 5F23A 1FMJA 2EJBA 1HQKA 3OJOA 3NIDB 4IJ5A 2ZU6A 3QZUA 1AV7A 1JEAA 2OCGA 2YIJA 1ZRNA 5J47A 3PUHA 1VZ3A 1T8PA 2NPIA 1ONOA 1ZGGA 1M8JA 2IUSA 2QPAA 3PCRB 4QDZA 4CM6A 2ISCA 4G0MA 5E38A 4EUEA 3FOBA 1GPAA 2D1SA 1KVUA 3F1LA 1PS8A 1EWRA 4LTDA 4ODIA 3NMUF 1ZXBA 1CS4C 4HNRA 1C0PA 1P7ZA 3L7DA 2FW7A 2VP3A 2PXCA 1QR6A 4JD5A 4CLHA 4X3OA 3VR5D 1N77A 3LY5A 5FOTA 1RC8A 1WTCA 2BKLA 3BSYA 4AYXA 1PEDA 3QX7A 4IL5A 1COZA 2ZS8A 1GLNA 3GZTB 3MLAA 1N9GB 4Q4JA 3IJEB 4ZO9A 2AMFA 2AFIA 3MRTA 5KSYA 2L2QA 3G6KA 1UDWA 3U62A 2NO0A 4P81A 5JPDA 2O8EB 4Y2RA 1C3VA 2VHUA 2O3SA 5ER6A 5DFAA 4GSYA 1PEYA 2C8JA 5CA1B 2G9RA 2FTKE 3KQWA 3KLBA 4ZVVA 5THKA 4BC0A 4DCSA 3N53A 3QPAA 2DCMA 1UDAA 1TLFA 3AMVA 3D6FA 4IIUA 1QQ6A 2WKSA 3M9WA 2HHAA 4U4AA 1J0XO 2WKPA 4MVJI 3T4PA 4L4XA 3U09A 5B3JC 3D0QA 4RLSA 3CCBA 3OZEA 3PX2A 2SECE 2ZUBA 3BZWA 2FLVA 5JWHA 3VYTB 1CRPA 2XHEA 4RD0A 3G2LA 1ZPDA 2YJ3A 3LYLA 4CMIB 1ZI6A 4UM9D 4DIEA 4A15A 3PQVA 2PXXA 3MMZA 2GN1A 4K0RA 3ADDA 3SHTA 3IP8A 2HAEA 2DX7A 1DC7A 1K7XB 2REXB 1SD2A 5L6MB 1MJGA 4LRQA 4ED9A 3W5CA 3QYJA 1T5IA 3WJ7A 2WKQA 2RGWA 3W5BA 1GSOA 5LP6A 1P1JA 1C1HA 1TMOA 2PPLA 3OIDA 1M2WA 2H3HA 2Z57A 4L8GA 4L6AA 3BD8A 5C37A 3ZWBA 1K5HA 2EF1A 4UOEA 2VP4A 4DNQA 3BWCA 1KAHA 1G5PA 2M1XA 2C2GA 2Q41A 2JAOA 4ZODA 2WY2D 1YA4A 4LDZA 4MKRA 4UXJA 4ZTZB 1G2OA 4C1NA 4G4IA 4BVGA 3AR8A 1S2MA 1JF8A 4KQ9A 2HCFA 2YYSA 2VDKB 1Z3IX 1UK9A 3WV5A 4CMHA 4CU5A 5FI5A 1G2PA 1LRLA 2JHCA 3PNBA 4YK7A 3D02A 4ZVOA 3R7BA 1N5LA 3RM3A 1SAYA 1YMQA 1EBBA 4MHSA 5BYJA 3X2SA 3B1ZA 1LW7A 3LE8A 4M0EA 2V97A 2G1KA 3I92A 1NVXQ 1JQKA 1LNSA 3AHGA 3D4LA 5AQEA 3VR3D 4D4KA 1OHHD 3LY7A 2WJGA 4XWKA 3L6UA 5MN6A 1IL0A 1TMGE 2OBFA 1QRUA 1JBQA 3WGQA 1NI4B 3R4CA 1KXJA 3E7DA 3LUBA 5HMLA 3VVBA 1GPWB 3NWJA 1AS3A 1GJRA 1UXOA 1C8KA 3A2NA 4FK8A 2PLWA 4UAJA 1WB9A 3TLMA 1EP3B 4EHIA 5ENDA 3OZIA 3HCCA 1N3IA 3PQ6A 4PAGA 4ENQA 3DF9A 1I5EA 2WIAA 1F7UA 4U8HA 4X95A 1XUOA 5A7GA 3ZBTA 1XBTA 1I1NA 1E0JA 1SRQA 2DM6A 3EP3B 4IH1A 4OXIA 5K3BA 4REOA 1H2XA 5D51S 1T9DA 1V25A 2D0DA 1X6VA 2VUSA 3VO8A 3N59A 4J49A 4QEDA 3R7SA 3FGPA 3TO5A 4HNVA 4S35A 1B74A 4LNAA 2QU7A 4KPEC 1II8A 4BVKA 2ZI6A 4QPPA 3JAMA 4TMKA 13PKA 1NW9B 1ZH8A 4K9KA 1QQBA 1NBMD 1WZUA 3A70A 3DZIA 4FD3A 1NMSA 4I8IA 2C61A 3QXXA 4RWEA 3RJ5A 4QGSA 5C1DA 5AYVA 4PSKA 1Z6PA 2VI5A 2WUEA 3O1JC 1KYWA 1XTTA 4G5HA 3HJFA 1Z6XA 4NE9A 2BJWA 1JECA 2AX4A 2H4WA 2Q5IA 3FWKA 3HDHA 4U39A 1NJ6A 4JL8A 5CB0A 3UEOA 2I3BA 3R0IA 3SYMA 1HSZA 2YC4C 3C3DA 5FA8A 2BOVA 3TX6A 1F17A 2LNDA 3AM4A 3GEIA 4FX2A 4F2DA 2QHXA 3EIQA 3HBFA 3N8IA 1T0IA 4OXNA 5L4LA 5BVGA 2JASA 1XNJA 2J6HA 4CM9D 4F8JA 4HNHA 4WY5A 1OTHA 2G7MC 1A7AA 1Y80A 3OCYA 4ZCQA 3U49A 2FSFA 1BCRB 2AJCA 4YJHB 3B7WA 1Q6ZA 2ZJ7A 2B7BA 2HMTA 2JNWA 5LA6B 4L4SA 2RKWA 3DAPA 3NJRA 3ON5A 4JBYA 3SZUA 5E0OA 2M2IA 3S3TA 4XQ9A 1YJ5A 3FMOB 5JD4A 1FP4B 3WLEA 1E5LA 2R5FA 4U9HS 4HYTA 2FZ5A 3L4BC 5EZ5A 2AW3A 4G09A 4K8OA 4UMEA 3FCAA 4FN4A 4BYMA 3KQNA 5FI3A 4D0NA 1Z29A 4MKXA 5JANA 2HF8A 3M1LA 2Z43A 4PO3X 1RM5A 1G5IA 2BEJA 3U56A 4TQGA 4OI0A 4N7JA 3UJPA 3PFBA 2QN1A 3DAOA 3TSYA 5CVTA 1LNZA 2B4TO 4OXKA 1ODJA 4D3YA 5L53A 4JJ6A 1ISRA 1I80A 1GCIA 1M2FA 1CC1S 2B4AA 2TMYA 3M5PA 4RULA 3JQ8A 4C76A 2EFYA 1QTRA 4BN5A 1NU8A 2DEUA 3AY3A 2CXPA 3HXPA 4W1QA 2VJAA 2WT8A 1ZJYA 4MLCA 4NICA 4ARCA 2HREA 2OPBA 3FOZA 1M33A 3BTUA 5JHHB 2O8BB 3R6DA 2OCXA 1R0KA 3UO8B 2Y1FA 3NIWA 3PGLA 2ZR0A 1NMEA 4Z7JA 2Q49A 2ODWA 3AC0A 1ORIA 4ZCRA 2ASVA 4U2FA 4N12A 3ZYZA 4DV7B 1HLPA 3C1UA 4GXRA 4YDQA 1GPJA 3LOPA 5EGSA 5H3HA 3DM9B 4MR8B 3AO0B 3TD9A 3FFAA 3ZGVA 5HKKD 1RE1A 4DV2B 2QL9A 4FCTA 3FPHA 4EO4A 1QRRA 3GMSA 3U7RA 3VHQA 4D9FA 3PK0A 3BDAA 3GUUA 3QNWA 4IIDA 3FUVA 4KP7A 5DN6D 1Y1SA 3BJZA 3QVWA 3PHIA 5DGHA 1W581 3HWRA 3FPEA 5FPQA 5TR9A 1QS0B 4QM6A 5E7QA 3K4QA 5TF0A 3NEYA 1IFXA 4PRLA 1CRZA 3HB4X 3R3SA 4FKMA 2DHRA 2PRKA 2Q5QA 1TZBA 1YFLA 3C7AA 1BWRA 3IRUA 2W6MA 4FEGA 3SX2A 4XGIA 3RFUA 3GJQA 5HPYB 1FLDA 3NR2A 1N6PA 1WMEA 1X1QA 2LCIA 2EZ8A 2WAMA 4UHCA 1EUCA 5WRFA 4E03A 5LU9A 4G6ZA 5REQA 3ESBA 5LZ5A 3BC1A 3VKGA 2IZ0A 5JZBA 3KFLA 1N8KA 3OA2A 1U98A 1SEPA 1L5QA 2JFHA 2OHOA 2IK8A 3GJ8A 5BRAA 3U5ZB 4KQEA 1XAJA 4ZICA 5LLDA 2X41A 2VQDA 4EJ2A 4AJPA 3ZE1B 4X20A 4NZ9A 4KI7A 1CVIA 5FBLB 2G5CA 2BE7A 4YR7A 2VA8A 4AB1A 4CIWA 1I2BA 1CUSA 2NO9A 1W0JD 2C42A 2D06A 2Y67A 2V6BA 2WHXA 3EGXA 3PYXA 4KBYA 1EHCA 3RS8A 2V4UA 3USES 4JJFA 1C30B 1K86A 3TM5A 5CIWA 1NKSA 4CLEA 4NU5A 1I4LD 3RFTA 1JAZA 1Q95A 1T4CA 3RARA 3PE3A 3ZDXB 3WFIA 3U7QA 2B5OA 3K2QA 5F73A 1GNQA 3JQ7B 3LOUA 5IBQA 2OUIA 4ITVA 2EL7A 4M0KA 2HKIA 3EULA 5D3ZA 4PY2A 5JZ9A 1CY0A 4BGUA 4HADA 2JAUA 4MV9A 4PN7A 3I62A 3IIJA 2NLOA 4LPSA 3JQFA 3U3OA 2MSNA 1I3CA 4G5SA 4I5IA 3DZGA 4FU0A 1JE1A 2CJWA 3T0GA 4LBZA 1J0BA 2GPTA 1O0SA 2XZTA 3IEPA 2IP1A 1QG2A 4ZDIA 1KZ1A 1EDBA 4YMTA 3DV2A 2AD5A 4ND6A 4TV9B 1X0XA 4E5PA 4DLSA 3W5UA 5FAXA 2GRUA 2D4AA 2VEDA 4E2WA 4FYPA 4GWKA 4DSAA 2QUAA 3A6LA 3AILA 3M33A 2CMDA 2UUOA 2WTXA 3C3XA 4RTNA 2BGTA 2YTZA 2JFFA 1HOTA 3PX3A 4PBSA 5B6JA 1ZUNA 1PNTA 1SG9A 1UBMS 3EPAB 2G77B 1HDGO 1QWSA 1R6XA 4K6MA 4NCJA 4TKMA 4BN4A 3EPPA 3SKYA 1W29A 1JXMA 2AYZA 1DBRA 5IN5A 1L5GB 1N25A 3RUFA 1EQUA 3TLKA 1H2RS 3I1IA 3NONA 5EXEA 3NPAA 1WMAA 3L1UA 4IDPA 1VKRA 2NVWA 1T5SA 1NYRA 1TYBE 4YALA 2X23A 3CKMA 3RS5A 3K70B 3WIVA 4JI4B 5C7OO 3BWBA 3GCXA 3HJRA 3FDXA 5IKXA 3PYMA 1WPRA 2OBXA 2P9ZA 1G5RA 4CM4B 5ALIA 1D2RA 4CV1A 3FMFA 1M5TA 4KXNA 2MSKA 1OAKA 3DMYA 1U9YA 2F8MA 4U6NA 3NTXA 2JD0A 3VZDA 2IYYA 2IHJA 4INZA 4NJMB 2FXIA 4AMGA 1VHTA 3BMCA 3N28A 1N0UA 1HG0A 1XZNA 3I6ZA 1EXVA 1VMKA 1B6RA 3UGJA 1HMYA 1HV8A 4FYJA 2XQIA 2C0QA 4CG0A 1HLDA 2HO4A 1RHRA 1GL3A 1SXJA 1Z6ZA 3DW3X 3CHYA 5DE3A 2W6OA 1K66A 1REQA 3JQAB 2Y0PA 5HF5A 3A1TA 4RVUA 5DHFA 3KPYA 2I2WA 4BZXA 4TTIA 5CMLA 4C0BA 4ER6A 2Q8NA 2A14A 4BV8A 4TKVA 1HFEL 4QHTA 1MXFA 2VTVA 1JBEA 1J2YA 2W2OA 3RF7A 1ZD4A 4E12A 1GRNA 1HTWA 2ST1A 2QUZA 1NPDA 2ZB3A 2DCUA 2J3EA 1N2JA 3OY7A 3GJ3A 1ONSA 1R6UA 1W8IA 1YQ9A 3JS5A 3QLUA 2VYCA 1LRKA 1FVXA 2DY0A 3QBDA 4DA4A 2WMDA 2UDPA 4OTZA 2CLIB 3P9IA 4MUBA 1YJXA 1QCYA 4H6XA 4U7WA 1L7XA 4BJ5A 3ORYA 2R8RA 1WVMA 4NG4A 2CHEA 3V2HA 3FPFA 4YY3B 3FI9A 3JRNA 2QAJA 1GUBA 4KWHA 2BWJA 4BZPA 4LFBB 4TLMB 3OEYA 3FD8A 4RIHA 5FFMA 1H2ZA 1QF7A 4Q3NA 4R69A 4IFIA 4LZNA 2J48A 4UE2A 2HRDA 4GEGA 5EZYB 4EHHA 2OZEA 2D7DA 5HVNA 1ZCBA 3G88A 4UULA 5JALA 1SKYE 3AY6A 2JIQA 1C29B 4U2CA 4UU0A 3CNBA 3HU5A 3RBXA 5CB6A 2R8BA 3L6RA 4BAUA 3W2GA 1UXJA 1D1TA 2AL7A 3EF3A 1UAAA 4ETWA 5L7YA 3R5TA 5JDIC 3AHIA 2XVZA 1UDBA 3BQNB 2CUKA 3A11A 3ESYA 4F1KA 3MCWA 2VFAA 3BIOA 2ZBVA 1PK8A 2ZAOA 3IP7A 2AFHE 4MGZR 5HFNA 4DSNA 3SI7A 5F9MA 1QBKC 1K88A 4H31A 1HBJA 3PUWA 4KK4A 4UBOA 3F7MA 5KOJA 1L1FA 3E18A 1JIUA 4YAEA 3UHJA 1F0YA 1R4MB 3TXXA 3FF1A 1YNSA 2VCEA 3Q10A 3DEFA 3ZUGA 2PWPA 1I4EB 5JPCA 1C9EA 3WAJA 1G5TA 1CVLA 5CNKA 2WA2A 2GEFA 3PNLA 1MOZA 5LNK6 5K2MA 1M66A 4EG8A 1U63A 5E7MA 2IIBA 1IE3A 3C8ZA 3KVYA 3V1YA 1YVUA 4BGIA 1P31A 2OCDA 3IUQA 2RGGA 4Q9DA 4R41A 5IF3A 1I7QB 1Z4KA 2Z2KA 2Z98A 3SOZA 3VV2A 4QG3A 1JG4A 1QG0A 4PRKA 1OA0A 2H06A 3HJCA 3PNQA 2NU9A 3C97A 3N2GA 2C4MA 2JEYA 3HBNA 4Q6BA 3OCJA 4C7MA 3FH0A 4YQEA 5D3QA 4IOJA 3E0XA 2H11A 4Q4AB 4DUPA 1SCIA 1E6KA 2ZVPX 4Z9XA 3C1AA 1RTTA 2IQIA 4RHCA 2ZJ5A 5EYPB 1GPYA 1CR2A 3HYNA 5HZGA 3A1NA 3ILYA 4AZ3A 5A4DA 4N7BA 3O8LA 3U61B 2A6PA 4M36A 3L92A 4UATA 1TJYA 1MH9A 5CDHA 1V6SA 2D0IA 2QX9A 1G7TA 4ES6A 1B00A 4QOJA 3ZX4A 4F6RA 5BN3B 4URYR 4LHYA 1KS2A 2O23A 2REQB 3GNQA 2XA9A 4YJ3A 3R8XA 1YCDA 4JJ8A 1TB4A 1MJ5A 2DERA 2I6GA 2JVKA 3BREA 2GLTA 4G0WA 2NTYC 3RH0A 1HZJA 1Y0BA 4CKCB 4B8YA 2AUMA 2VNSA 5JCXA 2XCIA 5BV8A 5JU6A 4R8RA 3A14A 1AQIA 4O8JA 3QX9A 3R0VA 4LMBA 4FFOA 5AKGA 5ECYA 1Y89A 2IUYA 4LJSA 3IPAA 4QASA 3KEQA 4QTUB 3T38A 4EWLA 1K7FB 1IHPA 1EXNA 1NLMA 1R0ZA 1Z12A 1I7CB 2Z2ZA 2DVMA 4XM0A 1IN4A 5DGXA 1EJBA 1N0WA 2VUIB 3AP2A 3AUFA 2AR7A 1ITZA 4WECA 5KPDA 4JYBA 4XJXA 4YMLA 2IY8A 2G0TA 2FSUA 5IH3A 2UUPA 1XRLA 2F9MA 3ZI4A 4CV2A 1A71A 2AJ8A 4DBVO 3C3CA 3TRFA 4I4TF 2QVZX 4F9FA 2VCYA 4IXNA 2B34A 3KZ1E 4AJ1A 2AOUA 4TTTS 1VCIA 2B8TA 1SM4A 3ZOKA 5KTKA 1GM5A 1R74A 2FF5A 2WYIA 3H3FA 4JBIA 5AI5A 4BKPA 4PU0A 5J5VA 2QKYA 4MUAA 3IOBA 4BJHB 5DHTA 2XT0A 4PFQA 3W0LB 3MJDA 4FTWA 4S04A 4BX8A 1RE0A 2CDRA 4G85A 3O2JA 4EYQA 1E8MA 1XQWA 3WC4A 2QYHA 3FR7A 1Y3IA 1YULA 3I4FA 1WXDA 2GD1O 1DWOA 3B3AA 2ZSUA 3BFXA 5EP3A 2YWDA 3DQPA 1X74A 2Y92A 2CFCA 3KT6A 4I5GA 4BRWA 2BH2A 3CN7A 1C1DB 4HNTA 3I5MA 2VZ9A 4C30A 3QF4B 1JEYA 3B6EA 5JWRA 3D3KA 2I80A 2VPXA 3H2SA 1PNOA 2OR3A 1GTZA 1XZGA 1ZOSA 1I13A 1BTOA 1FFAA 1P5ZB 3AY7A 4W99A 3G0BA 3V97A 4OLBA 4NULA 1QDUA 4INAA 2FGKA 1EE2A 1TKRA 1PJQA 1G21A 1W52X 2OM2A 2NW6A 2X19A 4JOQA 2QDXA 2FK8A 4MWGA 1MC1A 3UHAA 3SZRA 2IE8A 4G0YA 3QOFA 3GQVA 2IXAA 1JAYA 3ABZA 2Q5FA 3Q8XB 3UJDA 4YRSA 1VA4A 2WJPA 1HDYA 5LNK1 4E21A 1MIHA 3BWDD 2VQEB 4BBPA 1NVWQ 3NX4A 1WSBA 1PWYE 5I7AA 3K20A 4EHNA 4WBNA 3QW2A 4NBTA 1XMOB 4UBJA 1JMYA 4DLAA 3TB4A 4Z3OA 1Z0IA 3CEMA 1TD1A 2YL2A 3DBLB 3KOOA 3JQ6A 2XYQA 3GQBA 4R9SA 1D0SA 1QZTA 4UUPA 5LB2A 1JIKA 2B36A 3WK4A 4W4TA 4GWLA 4BMXA 4CLDA 2HSWA 3K70D 1BDIA 3CZAA 1UP6A 1QVWA 1ZYUA 1ONPA 1G20E 2A5JA 2IYUA 2PN1A 1SC1A 2X1HA 1YRQA 3MT8A 4FQ7A 1QE0A 1U02A 4CRWB 3DNFA 4FVTA 1OWPA 1O96B 1UMDA 3PJFA 4EM6A 1J70A 3CF4G 4NENA 10MHA 4DJJA 1ISMA 2HIAA 3OZGA 1NJ1A 5DZSA 4OSPA 1V3UA 3MQ2A 3CX3A 1WCXA 3OJEA 1NX6A 1OXUA 4H0NA 3LUCA 1SA0A 3B2NA 3FUUA 3LKBA 1XD2B 2BVNA 1RP1A 1JFRA 3IULA 3LGAA 1TUIA 4XDZA 3ONNA 1J8MF 1NR7A 2CLOB 3PRJA 1GPKA 3QLJA 2G72A 3RFFA 4UOZA 1CR1A 2R6R1 1X42A 2O0KA 3G5MA 4FN5A 3JQDA 5JH7B 3ELUA 4IM7A 4CE6A 4DBZA 2Q4TA 2XZDA 4DSTA 1Z0JA 2FPPA 3EEQA 3Q1KA 2HC9A 2EERA 3GRUA 4ZVNA 5C18A 1W5TA 4C88A 4CEJB 3SBEA 3WK8A 4G0UA 2Q2OA 1S01A 4GOND 1GGHA 5DCUA 3K1TA 4ONEA 2P9FA 4QBFA 1J7KA 2X8JA 4R1UA 3IQDB 1OXSC 3FVWA 3H83A 4GKKB 4QU8A 2OG2A 3THWB