1H6DA

Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
383
structure length
383
Chain Sequence
QAATLPAGASQVPTTPAGRPMPYAIRPMPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
publication title Crystal Structures of the Precursor Form of Glucose-Fructose Oxidoreductase from Zymomonas Mobilis and its Complexes with Bound Ligands
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Protein translocation
total genus 126
structure length 383
sequence length 383
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2001-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h6dA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h6dA01
2Y1GA 3DZFA 2HMVA 4EITA 2Z1MA 2CSUA 4J1TA 2OL4A 3PFWO 1UR5A 1SC6A 5G0WA 4EJ6A 5IJZA 4QFCA 4WLVA 3GDOA 4M86A 1OFGA 1F8GA 4EEZA 3AM4A 8ADHA 4RCVA 4BGIA 1OZAA 1WDMA 3AFMA 2X23A 5H82A 3JQDA 3MJTA 1YONA 4D0SA 2CDAA 3MWDB 1O8CA 4L75A 3U4CA 4BQPA 4BO5A 4BIIA 1HEUA 3EAGA 2ZYGA 5G0TA 2ZTLA 3D0OA 5L7TA 1CRWG 2RAFA 4Y6PA 5TT0A 1Z75A 6LDHA 4E12A 3GEDA 2X5KO 4FBGA 1E3EA 4EI2A 3V1TC 1CJCA 5F5NA 4RQTA 3ZHBA 4J4TA 3AOEC 4OHUA 3WWYA 1OC2A 1I2ZA 4AJIA 1LSOA 2VHZA 4OOEA 3HDQA 1QG6A 3NUGA 3OH8A 4JQCA 1EFKA 2JHFA 3C8MA 4L8VA 4ALNA 3HN7A 1DFGA 3RROA 1GUZA 4CM1A 5THQA 4YJDA 3ZHZA 4DIFA 5CEJA 2AG5A 1XEAA 1EZ4A 3WFIA 5F3RA 3BMOB 4KDEA 3DOCA 1LDNA 1O0SA 4DUPA 3WQSB 4MP6A 4Q3EA 2V7PA 4WLFA 1H6CA 3W6UA 1U9JA 2CF5A 2WD7A 4CMBA 4Y6SA 3KEOA 2OZPA 3CH6A 3K92A 3IOYA 3N58A 2Y93A 4GGOA 3QWAA 1T2EA 1Z74A 1W6UA 1WP4A 1L1FA 2BGLA 3DZGA 2PD4A 1IULA 4IDGA 1DSSG 3DAPA 1HLDA 2YFQA 3GNTA 3HN2A 5J9GA 1X1EA 2XOXA 3KXDA 4FFOA 3RKRA 3SLGA 2PZLA 3TWOA 5JC1A 1G0NA 1IY8A 1WDKA 3F1LA 4NH4A 3TJRA 2HK9A 4RLSA 3COSA 4GMFA 1UJMA 2WM3A 4E5MA 3QHAA 1FK8A 4FB5A 1GQQA 3AM5A 3L07A 5L4LA 4U0KA 1GZ4A 3ZV6A 1LLCA 3CPSA 4FJ2A 4C7KA 4EJ0A 1GTMA 1P45A 4U6SA 4YA6A 1JDJA 3AI2A 2G0TA 2JAHA 3CEAA 3HUDA 3DZKA 4CUJA 1QYXA 4OAQA 2YJZA 3JQFA 5EQFA 3I6IA 1NQOA 3WGOA 3WB9A 1QV7A 1D7OA 2VN8A 3RFVA 3ZV4A 3IUPA 5BSHA 1PZEA 5KVCA 1SZJG 1BDBA 4Z0PA 1UDBA 1CWUA 3QW2A 1GEEA 4QX6A 1ZUD1 1DIAA 2PKQP 1P1HA 1SB9A 4NHEA 1SNYA 3KYDA 3PDUA 2QYTA 8LDHA 4XGNA 2W2KB 3OM9A 3GVHA 4Y9DA 1R4MB 5DN9A 1XA0A 1U2DA 3MZ0A 5COQA 3EDMA 1T26A 4HFJA 2PD6A 1HZJA 4JGBA 4F46A 4NJOA 3L0DA 3GHHA 2C29D 2CUKA 2O48X 5B4UA 1XWFA 4ZVVA 2IYPA 2P68A 5B12A 1DDOA 3DFZA 3UF0A 1LBEA 4DLAA 2NU7A 3RC7A 1NVGA 1T24A 1XR3A 5KKAA 3CZRA 3OJEA 5A4DA 2Y99A 3NTOA 2X7HA 4BNNA 1ZFNA 1YJ8A 4BMVA 4YQZA 5FEUA 3P2YA 2IDZA 1PWZA 4J90A 5ES3A 1W4ZA 4E2XA 1EVYA 3DC2A 3U4IA 3NTRA 2VWPA 3B70A 5GZ1A 1ULUA 3F3SA 4J9UE 2B4QA 3V8BA 3ZHXA 1MUUA 4YAJA 1D8AA 2VCYA 3IKVA 4AJKA 4QO8A 1N9GB 3IC5A 2D3TA 3K96A 3D7LA 4PG5A 3D3EA 3PHLA 3N74A 4WKGA 5BNFA 1VJTA 4DQVA 3E9NA 4DIBA 2VRCD 4YYZA 5HM8A 2DVMA 2X0RA 3L6DA 4I9NA 4YB8A 5DBGA 5JO9A 3WDSA 4CQLA 5CAEA 1KVRA 4XKJA 5IXYA 2HLPA 1A4UA 3SEFA 4XYBA 1H9AA 1PJCA 2CY0A 3GN2A 2NACA 1A4IA 4MVJE 3OECA 5IF3A 1FMCA 3WXBA 2W8ZA 2P5YA 3D64A 4CMEC 2J3IA 2YZ7A 4Z3KA 1RJWA 2FY8A 1LDMA 5FF9A 2GSDA 3OJOA 3PZRA 4GX0A 4A0SA 4IBOA 4DMMA 5MDHA 3ZWPA 5L95A 4CL3A 2F00A 4FFRA 3DBVO 3ONEA 1J49A 2JCYA 1NFFA 4E30A 1NQAO 1LLDA 3RUFA 1DAPA 4M55A 4YR9A 3ICPA 5DOZA 4GKVA 4B79A 1ISHA 3PWSA 1XU9A 1Y6JA 1BHSA 4ZQGA 4TRNA 1V9LA 4ZU3A 5H81A 4YACA 1TB4A 2YFHA 1U28A 4FPXA 1AUPA 4U0JA 3OJLA 2I76A 4JLWA 1PU2A 1ML3A 2FN7A 3AU9A 4S1VA 4WJZA 4BO8A 1QKIA 1GUYA 1ZMTA 4W4TA 4DRYA 1E7QA 4YT2A 3G0OA 2ZTVA 1X13A 2OXIA 4CM8A 4UVDA 2G1UA 4CLRA 5I8ZA 3QVXA 2PZMA 3DOJA 3WSWA 3K2BA 1GYQA 4NU5A 3ROKA 4JJFA 2H5LA 3BMQA 4L76A 4LVUA 1YS4A 3O9ZA 2ZB7A 3GDFA 4OOFA 2WWRA 1N7GA 1GZ6A 3Q1LA 1GAEO 3DBRA 3G3EA 4KP7A 3K6JA 3H6KA 5EINA 3E6AA 1Y7TA 3UCEA 2Q2VA 3ZWVA 3GGOA 1NXQA 4XDYA 3UUWA 1BTOA 1Z82A 4PLWA 1HE4A 1YB5A 2GNAA 3WR5A 3R6DA 4D42A 4WLOA 1XKQA 2VHVA 3KTDA 2BFAA 3NDJA 3WNVA 3BAZA 1NAHA 4PCVA 1EQ2A 4XR4A 4OIMA 4N54A 4CJXA 3M2TA 2EKPA 4DMLA 1E3WB 3QQPA 3AW9A 3PWKA 2B83A 1T25A 3E48A 3L9XA 2ZB4A 2WTBA 5T57A 1EQUA 4QEDA 1A7KA 4NMHA 4CQLB 1C1XB 3KV3O 2O3RA 1LQUA 3PJFA 1LSUA 3FD8A 3IP3A 1LDYA 1DEHA 3FPCA 4KTVE 4AJ4A 4YAIA 3AUTA 4R5MA 3RQSA 5HBRA 3D4OA 4HBGA 5I9NA 4GQAA 3TF5A 2X0JA 2BRUA 2UUPA 2DPGA 3AI1A 4PIVA 2PKQO 1V3VA 5EJ2A 1ONNA 4BKRA 5K6AC 3LT4A 4P4LA 5CDTA 2EKLA 3UXYA 1DFHA 1E1MA 4CQMB 4DGSA 4CMJA 4U7WA 2FR0A 4X54A 2BH9A 4UREA 4XR9A 3RUAA 3ST7A 1B16A 4U6QA 3WYEA 2PH5A 3AY3A 1C0KA 2VTEA 4JP2A 3OIGA 4XGIA 2ZIZA 3VH3A 3RC2A 3C7DB 3GRKA 4N7RA 2VT3A 5C3MA 1BXGA 2Q46A 1HL3A 2OBYA 4IY1A 3V1UA 1VKOA 2C2YA 5DULA 2JCXA 2C59A 4IDAA 3Q3CA 1C0LA 4PLGA 2Y1OA 2E48A 4Q3BA 3QWHA 1OC4A 3U0BA 5DOVA 1GEGA 3VTFA 1HDGO 1SBYA 2O3TA 3ZN2A 5B4VA 1YOVA 3Q2IA 4IXWA 5IZCA 5BSGA 2YV1A 3H3JA 3KBOA 4KDFA 3VVCA 4GGPA 1QYVA 3R0IA 3UCFA 3SVTA 3HG7A 4XYEA 3VZSA 4PZEA 3DZIA 5DT9A 2IODA 2Q1UA 5A04A 1WZEA 4WCFC 4ND2A 4YBZA 3SJUA 4RF2A 1M66A 5AXDA 3ULKA 2YV3A 4PLZA 1ZVMA 3MOGA 4F6CA 3ICCA 1K6JA 3OP4A 2WEKA 4YPOA 2DFVA 2D1YA 1TVEA 2OFPA 3LF2A 4MJLA 3GDGA 4UAGA 3W8EA 4KWIA 2CNBA 3NAQA 1FXSA 2HJRA 2X4GA 1E6WA 4RDIA 1K5HA 5JCJA 4D45A 2A92A 1QXSA 3L6EA 1CYDA 4H16A 2ZJ1A 4IZIA 3AUUA 4YAEA 2RH8A 1H0KA 1HYEA 1UDAA 4HY3A 2FSSA 3D5QA 4U5QA 1BDMA 2EF1A 2GASA 3WIDA 1O94A 4WK6A 4KTTE 1E7MA 2OP1A 1YO6A 4M8SA 5A3VA 4TSKA 4W6ZA 5JAQA 4PG6A 3AWDA 1R0LA 4WEOA 4W99A 2CVOA 5L7YA 4CM4A 4A10A 4LW8A 3QV1A 3H5NA 4OXKA 1MC5A 1OI7A 4TKLA 3ZNQA 1NFRA 5T8KA 5BNIA 4TVOA 3Q0EA 2Q3EA 3PK0A 4GVXA 4YCAA 1EBFA 3HDHA 2IEBA 3L4BA 3DHEA 4C4OA 3GHYA 2DBQA 2VWQA 1W8DA 3WBBA 5LCXA 1U8XX 4MIEA 3TFQA 4R51A 4XYLA 5KKCA 3LT0A 4J49A 1IL0A 4BNLA 3I3OA 3FBGA 1P0CA 4B3HA 1M67A 1P44A 1ZK3A 4W82A 1TXGA 1NVMB 5F1PA 1BXGB 4AJ1A 1PZHA 4GPD1 3CE6A 4R68A 4P4GA 4CLDA 4E21A 3WLFA 5HTOA 1MP0A 4L9RA 4DBZA 4NPCA 4YJGA 4DTIA 1ZW1A 1K0UA 3DDNA 2FR1A 2J5QA 1YOVB 2AE2A 3ZI0A 3HSKA 5A9SA 4XGKA 3JD4A 2JD2A 1J0XO 2VZ9A 3HWRA 5ICMA 3E82A 2D2IA 1U2GA 4IJKA 1Y5RA 3GLQA 4IXTA 4ALJA 4EDFA 4H3VA 1ZEMA 4B3JA 1NX6A 4NQZA 2TMGA 3KLPX 4M1QA 4FJ1A 4IGFA 4XA8A 3QLJA 2J5RA 3VC7A 3DXFA 1KERA 4ZA2A 1YL6A 3UFXA 4E5KA 4EUEA 1I5RA 1U3UA 3PWZA 2NV6A 1C14A 3EZYA 2O2YA 2Q99A 1MX3A 3GVXA 1R0SA 3DR3A 4E4YA 4WLEA 3WSVA 3X2FA 5A03A 2R2GA 4BO9A 4RV9A 3INRA 2D59A 1JVBA 5EESA 1MG5A 1WPQA 4IIUA 5C7LO 1E7WA 4UVGA 3GVCA 4TROA 1E6EA 4XQ9A 5TGDA 5KCZA 4EEXA 1VL6A 2O23A 4KQXA 2YQ4A 5JSFA 4TKMA 5T8KC 2JFGA 4D3DA 4ZICA 2UUOA 3O38A 4FFNA 1PJTA 4Z6KA 4ROSA 1CF2O 3H9EO 3ZWWA 2HDHA 4BNZA 5TIIA 2W2LA 2HMSA 3I4FA 1WNTA 4DLBA 1PJLA 4GL4A 1ADFA 1P77A 4E13A 3N7UA 1HDCA 4MOWA 3I9NA 4MVJA 3KUXA 3I9KA 4NIMA 5B1YA 4AG3A 4K1LA 3QP9A 1EBUA 3EVTA 4KMSA 4EJMA 1GD1O 3GVPA 1AGNA 3H9UA 2DBZA 4RORA 1TT7A 4IJVA 3JYNA 4N5LA 1H6AA 1BVUA 1SCUA 2EJWA 1LC3A 1DHRA 5B37A 4BNVA 3C7CB 3HE3A 4S3MA 1YBMA 3GVIA 3NEPX 1RM3A 1U5CA 2PGDA 4GSLA 4AL4A 2CVZA 1NASA 3OQ1A 1GPDG 1DC4A 4XJSA 4TZTA 1PS9A 4ZQHA 1LUAA 2P9CA 1H2HA 4YJGB 3VKUA 3PFFA 1F17A 5L51A 1B26A 1AHHA 3AY6A 2I6TA 1RM5A 4HADA 4BNIA 5JBIA 2I3GA 2D8AA 4XWYA 4BGUA 4BMNA 2HJSA 4DYVA 2H6EA 5DZSA 1YGYA 5ADHA 3WMWA 2QHXA 5IDQA 3WTCA 4LCEA 3E18A 1NPTO 5L4NA 5ITVA 5JW6A 4FFLA 1WAMA 3GA0A 4D0RA 3GPDG 3G1TA 1UUFA 3DTYA 4HV4A 1ENOA 1RYEA 2DBRA 1PGNA 3QY9A 2J5KA 2UV8A 2YHIA 3DBLA 1EE2A 4ILKA 3TZHA 1HYHA 2XF8A 4ZQEA 4B7CA 5EIOA 1XDWA 5I9LA 3WGTA 2JCVA 2PFGA 1IOLA 3ROQA 2GCGA 1CQIA 4J4HA 3GEGA 2BGMA 3DL2A 1Q7CA 2QRLA 4KQWA 5G4KA 2NVWA 2NTVA 4JX8A 3JD0A 4NG5A 4D79A 3R3JA 2OMEA 3LT2A 1A27A 4EYEA 4A26A 2VOEA 4QECA 1T2DA 1I3KA 5U1PA 3ONFA 3ZWAA 1UZLA 2FP4A 4RVFA 1DIRA 2B36A 4LN1A 3W8FA 4Z0TA 3S2GA 2HAEA 5KIAA 4FR5A 3G79A 1YQXA 1MGOA 2BKAA 1P1FA 1VM6A 3L6OO 1GV1A 3ANMA 5L40A 2ZCVA 1U3TA 2Y1FA 3ZWYA 1I30A 2AEJA 2HMTA 3INTA 1HF3A 3WGGA 3S2IA 4P38A 4GMGA 4J3FA 3RKUA 2Y1CA 3BMCB 3FR7A 2EGHA 1VL0A 4PLVA 3T4EA 4OL9A 4IJWA 4DA9A 2FHSA 1ISIA 1OOEA 4PLTA 4DPLA 5DDIP 2AQIA 4I9UA 4P8RA 1MG0A 5KJ6A 3U09A 2Q1TA 4TRJA 3ZNOA 1FDSA 3ETGA 2G82A 3OETA 1YWGO 5KVVA 4PZCA 3STHA 2Y68A 2H63A 4RQUA 4EGFA 4CQMD 1SEVA 1UAGA 4UEOA 4ZRMA 3I23A 3HDYA 1DC6A 2Q45A 3GAFA 1BMDA 1M76A 1ONPA 2W90A 1BGVA 4NFYA 2VWGA 5B4TA 1WW8A 2POQX 1IUKA 3GC6A 4M49A 3MJ4A 2G5CA 4GSKA 4FGWA 4LMRA 4PLPA 1ZK1A 4HFMA 3F5SA 3E9MA 3WQQA 2DQ4A 4CLXA 2AEMA 1LQTA 3H9GA 2VHYA 3W8DA 1GYPA 5CDSA 3TFOA 2Q1SA 4R9RA 4KUHA 1ZCJA 1B0AA 1M2WA 3MJVA 1A7AA 1QSGA 4CMKA 4R69A 1LDGA 4J7CA 4GX1A 3JSAA 5I7VA 5JPIA 1L7DA 3I9MA 3JQAA 5AOVA 3U5TA 3DBLB 4BNUA 3ZU5A 3CMMA 4A2CA 1GPJA 2NSDA 5JO0A 3H2ZA 4LCJA 3OA0A 4HNGA 2EW2A 2IZZA 2X0IA 3DHYA 3EGOA 4W7HA 4B4UA 5G4KB 2C7GA 1X0VA 4IDDA 4HFRA 2GD1O 3ZWXA 2SCUA 1J4AA 3GK3A 4FN4A 3OMLA 4DPKA 4AJOA 5HS6A 4RVGA 3RU7A 1LXCA 2YY7A 3JV7A 3WYBA 2DM6A 2O2SA 3PP8A 3H2SA 1K2WA 2JD1A 1RPNA 1Z73A 2X8LA 2ZQYA 1QYDA 3VPGA 2WMDA 3JQ8B 5JCXA 4BNHA 5A9RA 4XYMA 4I5GA 3TN7A 4QUKA 2DU8A 4E5PA 2GF2A 5A05A 1DJNA 2OGUA 3BMNA 3FI9A 5KJFA 4URFA 1RYDA 4AJHA 4KZPA 1R4NA 1HETA 1SOVA 4CM6A 3I6QA 2DC1A 1AE1A 4Y6RA 1GCOA 4YT8A 3WQRA 3INGA 4WASA 4BO3A 5CDGA 5KOIA 3SX2A 4NBTA 4Q9NA 2WD8A 1VSVA 1CDOA 2CF6A 2Y0EA 1ZIDA 5FI5A 3GG9A 5COBA 1Y8QA 2NTJA 1KS9A 5TSDA 2EKQA 1ZH8A 4RVDA 3E1KA 1LEHA 1B14A 2JFHA 2IZ0A 3HFGA 4XB2A 1QP8A 3RI3A 3WNQA 2B4RO 1HDRA 1KYQA 1SOWA 3AUSA 4BOYA 2WSBA 3A1NA 2C2XA 3M6IA 1HT0A 3C1OA 1PX0A 1YVEI 5JE8A 2VYND 1P1JA 1E3SA 4CV2A 5IAAA 4CMEA 5JAIA 3GEMA 2YHUA 4AJPA 3KSDO 3ZV3A 1XQ1A 4MINA 4MIYA 1VE9A 1DIGA 2DUWA 1HE2A 3GY0A 2Q4EA 1LU9A 2IE0A 3I52A 5H83A 1ZK0A 3CMCO 2OBNA 1B8UA 3JQ9A 4OXNA 1P9LA 1P3DA 3VZPA 9LDBA 2Z1NA 4JCOA 4A73A 4UVHA 5G0VA 1LSSA 3U62A 3TZKA 1H9BA 5JYEA 4YJHA 3JCZA 3KZVA 4CV1A 2QYSA 3FBTA 4OMUA 3RD5A 1X1TA 1LX6A 1DRWA 4FOSA 1ENZA 2EP7A 1H6DA 2AW5A 3BYZA 2PGLA 2YYYA 5AVOA 2P9GA 1I0ZA 4DLLA 2YUTA 5T5QA 2WD7B 1KY4A 3GN1A 4Q3CA 1PR3A 3PTZA 4DWVA 3BIOA 5TF4A 3KYCA 4GI2A 5I8WA 3F47A 4RF3A 5GZ6A 2WDZA 3QVSA 2C5AA 3FSRA 3JQGA 4J0FA 2ZB3A 1P0FA 5HRUA 1PEDA 2YW9A 2EWMA 3D3WA 2V65A 1ZEJA 4RGBA 3VZRA 3GOHA 4AVYA 3PDJA 1JTVA 2GUGA 3TSCA 2AE1A 1WDLA 1R66A 2E49A 5EL0A 1EVZA 3GNSA 4K9DA 1C0IA 4YWJA 2JAPA 3HB4X 3M1LA 4FCCA 4YAGA 1R4NB 1S6YA 4PG7A 5A3JA 1DHTA 2WE7A 4RDHA 2GZ3A 3QWIA 3UOGA 4E5NA 3PRJA 5AQ1A 4TVBA 2VUUA 2EEZA 4PVCA 2NQTA 1U5AA 1W0CA 5JC8A 2IXBA 1I2BA 4ZGWA 4AJEA 1IPFA 2I66A 3HDJA 2RHCA 3V1YA 3HJAA 4ID9A 2JFFA 3GT0A 3WG9A 2YQ5A 3F4LA 2X1HA 5CEFA 3P7MA 2UYYA 1LNQA 3C85A 1MFPA 1GR0A 2C54A 3JQ9C 4OKNA 3ON5A 4P22A 3VZQA 1HE5A 4J1NA 1E1NA 2ZQZA 3SLKA 3B1JA 4YEDA 3GMDA 4LSMA 3MCVA 3MTGA 3RASA 2JD0A 2QRKA 4CLEA 1X7GA 5K6AA 5F1OA 5AXBA 1Q1NA 1QLHA 1WMBA 2HK8A 4BB5A 2HO5A 4ND1A 3ASVA 1KEUA 3KYDB 2V6MA 1B7GO 1KEPA 1Q7GA 2BHLA 5U4QA 1HDOA 3D1LA 4UUOA 4Q3DA 3NV9A 1P1RA 2FWMX 4XRGA 3WOHA 2E37A 4AICA 3JYQA 3X2EA 1MFZA 4ZHSA 5KJ1A 1PSDA 4GKBA 4J1QA 1H5QA 2O3JA 3OICA 1VI2A 2AG8A 3OF2A 1NWCA 2PV7A 2BD0A 4A27A 1GCUA 1PGJA 1TLTA 2J8ZA 3HQ4O 3I5MA 3TRIA 1XCBA 3NJ4A 5TS3A 4UVEA 3NGLA 4OKIA 1E0DA 4TRMA 4RVUA 1UXHA 1B15A 1I3LA 1FDTA 4YJFA 4NBVA 4ZQBA 3TL2A 3KM0A 2C20A 3FPLA 1P74A 3KLMX 4BB6A 4RF5A 4YVFA 4Q3NA 1ZMOA 3U4HA 5TQVA 3NT2A 4GLOA 3VH1A 4NR0A 3ZW9A 3V2HA 1LC0A 2A35A 5EERA 2GRAA 4L4SA 2ZK7A 1XELA 1HDZA 4WCFA 2VHWA 2NU8A 3KEQA 3HB5X 3RWBA 3V5NA 3IUSA 1HXHA 4CM9D 1U3WA 4RPHA 4NFHA 1XHLA 5ITWA 4L73A 3OJ0A 3PI7A 3BZUA 2D5AA 4HP8A 5JAMA 3VTZA 5BR7A 1E3LA 3ZDFA 1NVTA 4CODB 2Q50A 5EQDA 3PQFA 5ER6A 2Y0CA 3RU9A 4WOJA 3R1IA 1RKXA 3VOSA 4YQYA 2DPHA 2O3QA 1KC1A 1I36A 5T6BA 2NTNA 3ROMA 4KOAA 3WJ7A 3ABIA 3ZU4A 3PLRA 4CLOA 2QW8A 4MVJD 3PEFA 4L4RA 3S8MA 4E32A 2XXBA 1TA4A 4LRSB 5G0UA 4DVJA 2QZ9A 4IJUA 1U4SA 1ZXLA 2I9PA 5ER9A 1JKFA 1A9YA 4DC1A 1EUCA 3RBVA 1A9ZA 1B8VA 5ILGA 4RPGA 3OHSX 3ANNA 1PJSA 3WX0A 2P4HX 2GDZA 3WGYA 2J3HA 4BO4A 4CM8B 3JQ7A 3VPXA 4CLRB 3GMSA 4CMIA 3A28A 2PGJA 3BMQB 4WLUA 2VUSA 5BNTA 3B20A 4PGFA 4I9HA 5CDUA 3F9IA 4MVJM 1C0PA 5ENDA 3PGXA 3OEWA 1GDHA 3PQEA 3SC4A 1UXKA 3W4IA 5BQFA 1P1IA 3DBRB 1GFSA 5DNAA 1X7DA 3SBOA 1PJBA 5AXAA 1UXIA 2NU9A 4RPJA 5DCYA 3DOOA 3C7AA 3ZNNA 1KEWA 2Q22A 3PHJA 1YQGA 1H6BA 1KOLA 1BG6A 2CDCA 3QWBA 3TZ6A 3O4RA 4RVSA 1P31A 5KTKA 1IE3A 2B5VA 4WCFB 4AJJA 3K8ZA 4BNTA 2ZJ0A 4BNGA 4DQXA 1NNUA 3ITKA 2BFMA 2P2SA 4F3YA 4CV0A 1IB6A 3B6ZA 2OO5A 5T67A 3LC7O 4QSMA 2E4AA 5JNLA 4NNJA 1AXGA 3NX4A 2BFPA 3GNQA 3CZMA 4AJLA 3EHEA 4B8WA 3DBHA 3JYLA 4Q3AA 4ZN6A 2YDYA 2VRCA 1T1RA 4MDHA 4JBHA 1DXYA 5A1TA 2EGGA 4FDAA 5TNXA 1E7YA 1LLQA 4W9NC 5CHEA 1S7CA 4WNIA 4MKRA 3U49A 4J6FA 4O5OA 3C3XA 4CLOB 3S2FA 1PR9A 3OBBA 3RC9A 3H5RA 4IIVA 4WEQA 4CR8A 4R3WA 1HSOA 1T2AA 2C07A 1PWXA 3BTVA 3NKLA 1JWAB 2OP0A 3WGQA 1H2BA 1PTJA 2I99A 1OAAA 4XX0A 3LLVA 3S2EA 4PFJA 1FDWA 1XSEA 3A4VA 2HK7A 3JQ6A 3L9WA 1D4FA 3RAJA 3QVWA 5JYAA 3DZHA 3KYBA 3P19A 3ENNA 3K31A 2HKIA 2GERA 1YQDA 4ITUA 1DIBA 3BXXA 1O6ZA 3EW7A 1I2CA 3NJ8A 4BS9A 4L4XA 4GWKA 3W6ZA 4B4WA 3WLEA 1AXEA 1M75A 4IDEA 2ZATA 2RCYA 3DMTA 5A5FA 3RSHA 5IDYA 2P91A 1E1KA 3VAZA 1MA0A 3FN4A 5C37A 2AQ8A 1DFIA 3G49A 1MXFA 1OBFO 2WE8A 1ARZA 1CETA 4E31A 1KVSA 3KSUA 4LSWA 5ILOA 2FPIA 3JD2A 3HADA 1R6DA 1G1AA 5DF1A 5L7WA 1J5PA 1I10A 3KRTA 4JBGA 5L3ZA 4PLFA 1P33A 1I24A 3WTBA 3BTUA 4DIOA 1DRVA 4J4BA 1GY8A 4LRTB 4IQ0A 3BHJA 3EY4A 3TZCA 1QORA 4ZRNA 3OIDA 3PHHA 1X14A 2Z5LA 1ORRA 3IS3A 1VRWA 3LDHA 2NNLD 4IZHA 2DLDA 3UW3A 1Z7EA 1DOHA 4E0BA 1JA9A 5LC1A 1LSJA 1U3VA 1QMGA 2ZYDA 4O6VA 4MKZA 2QG4A 3QIVA 4D44A 3KB6A 1PGQA 3VDRA 1ADCA 3UKOA 1XG5A 2J3KA 4UUNA 4CM4B 2GN8A 1R37A 3DBHB 4BV9A 3MEQA 3GZNA 4BL5A 3IIEA 4BGEA 2I67A 1NWHA 4INAA 1B2LA 4JJIA 2AQHA 2VOJA 4A03A 3QWFA 4N18A 3FTPA 1UXGA 3PHGA 5IDWA 3K9QO 4HFNA 4E5YA 1YDEA 4ESOA 1Z6ZA 3RBZA 4GX5A 4IQ8A 3ZCXA 2D0IA 5TT1A 2EV9A 4IUYA 4XJTA 4YRDA 3DMTC 4XZ3A 2QIOA 2HRBA 2WYWA 1YBAA 4ZQFA 5EPOA 4J9VA 4BQRA 4YT4A 2JJYA 2GZ2A 1PGOA 3O03A 1HDYA 1NHWA 1PZGA 1LI4A 3IMFA 3LYLA 1UXJA 2WJPA 4NZ9A 3RUEA 4Z3DA 3DB2A 4PLHA 4ND5A 1EEHA 3GZ4A 4ALKA 5DBFA 3WGHA 3IQDB 5A9SB 5F5LA 1V35A 2NUAA 3K5PA 2X9GA 3ROPA 1YL7A 1K6XA 4FQ8A 4XDZA 1G0OA 1RM4A 1O5IA 3DHNA 1NYTA 1Q0HA 2AEFA 1TI7A 3DMYA 3NT4A 2QQ5A 2J3JA 5FWNA 3HHPA 5A9TA 1UP7A 1PL6A 4FOOA 2R00A 4DREA 2PZJA 1GYRA 3NTQA 5F21A 4D43A 3WGIA 4RVHA 1V8BA 2Z95A 4JROA 1SAYA 3IP1A 4FSHA 2VUTA 2V6FA 4NBWA 5G0SA 5IN5A 3PJEA 5C7IO 4BKPA 1U7TA 3BMOA 4WE3A 4RZHA 2Y05A 5DP2A 2B4TO 3VDQA 3V2GA 4FC6A 5BSFA 2X9NA 3ANLA 4WLNA 4CM5A 4PN3A 4YAKA 5L53A 3E03A 3H7AA 4OXYA 4PG4A 1U7HA 3I9LA 1E7SA 1KVTA 1PS0A 4G5HA 4N5MA 2A4KA 3HFSA 4LK3A 2P4QA 1UH5A 3NDIA 3CINA 1ZK4A 4BNWA 1K3TA 3DQPA 4FJ0A 2X86A 1DB3A 2V6BA 4CPDA 3P5SA 4BO1A 3H4VA 5JYFA 5JDIC 1O9BA 3PQDA 2Q2QA 4G81A 2P5UA 4RF4A 2NM0A 4R41A 4K28A 3RUCA 3AM3A 1FDVA 2FZEA 4OYRA 4TMFA 3OA2A 1M6HA 3S55A 3W4KA 5JXWA 2EIHA 3L77A 1WMAA 2GPTA 1DIHA 2B5WA 4QO7A 1ISFA 2QX7A 4JP3A 5IFLA 5JDCA 1YJQA 3BTOA 1KIFA 1O89A 2W98A 4RPKA 1FJHA 2DT5A 1E92A 2VQ3A 4PLCA 1I8TA 4BO6A 4IGEA 2R00C 1IYZA 3ZWMA 1MB4A 3ZHYA 2WYVA 2B37A 1ZNQO 4PRLA 1DJQA 2BMAA 3RC1A 3V2UA 1O95A 4M87A 3LC2O 5ENVA 3TZQA 2PK3A 2O4CA 3Q2KA 5HS4A 1C3VA 1IHYA 1TEHA 4B3IA 2W2KA 5G2OA 1DC3A 1HKUA 1R4MA 2YHIB 3A9WA 5L4SA 2VYVA 3EUWA 1V6AA 3ONDA 4OSOA 4KWHA 3ZWOA 5LDHA 2PNFA 4RLHA 2Y0DA 3GRPA 3ZH2A 1Q7BA 3H3FA 1GUFA 3GAZA 4WUVA 1IZ0A 2HQ1A 1T4BA 1QRRA 1JQBA 4BNFA 4ONEA 3L4SO 1YE3A 3D4PA 1N8KA 3ZV5A 3KOUA 1PIWA 3GFGA 3DEYX 1NR7A 1DPGA 1JKJA 2XXJA 3CXRA 3DONA 1W73A 1Q2XA 3RCBA 5KJEA 3SC6A 4RJTA 4BNKA 1A71A 4NBRA 4ND3A 4CR7A 4HXYA 2HMUA 4DPMA 1DLIA 2OOSA 3DFUA 3OSUA 2DUUA 3LZ6A 4IMPA 4AFNA 2PKRA 1PQPA 3NDRA 3PJGA 2GYYA 1BW9A 1N92A 2EHDA 1LRKA 2NWQA 4QT0A 4B4VA 1U8FO 4JN6B 3DAGA 3AFNA 1D1TA 3F1KA 1IZ9A 2VNAA 1KVQA 5HA5A 1N9GA 4G2NA 3LK7A 2BLLA 3BA1A 3RUHA 2E82A 5J23A 2OHXA 1F14A 4A7PA 5TLSA 2W4QA 1DBVO 5JDCC 4UULA 2F1KA 1E3IA 4NU6A 1XQ6A 1RM0A 3B1KA 3CSDA 4CMHA 1PJ2A 4FIZA 2FPGA 2UAGA 1DRUA 3I83A 4BVAA 5IN4A 1SMKA 3K30A 1MLDA 1EVIA 1PL8A 3MOIA 1R15A 3GQVA 3EVNA 1Q0QA 1ZZEA 4UUMA 1NQ5A 2ZYAA 1Z45A 3ENKA 3U9LA 1G6KA 1CIVA 1LDEA 1HYGA 4Y67A 1PQWA 5CEEA 1PZFA 2VHXA 5THKA 4L0QA 1ADBA 4OH1A 4IS2A 2IRWA 3AI3A 3ADOA 3ITDA 4DL9A 1QYWA 4AJ2A 4II3A 4BUCA 1JU9A 2ZTUA 1PJQA 3QJ5A 3I4CA 4R16A 4XQGA 2R6JA 5AYVA 3FNFA 4IPTA 4R4JA 3TDKA 3UN1A 4C7JA 5FI3A 4XD2A 3SXPA 4DBVO 2VWHA 3JTMA 3VPSA 5KVQA 4YXFA 7ADHA 1KC3A 2DKNA 3LF1A 2C5EA 4PLYA 3MJEA 4OQYA 3T4XA 2HMWA 2X22A 3JQAB 3CIFA 1I3NA 3VH4A 3U3XA 3A06A 2GN9A 4GWGA 3RJ9A 4ALLA 4H15A 3WS7A 3TOXA 2Q4BA 1GZ3A 1YL5A 1GV0A 2HU2A 3WWZA 4IDCA 3JQCA 2BI7A 5GZ3A 2Y1EA 4JK3A 5CPBA 3WJAA 4CLHA 4DYDA 3P2OA 4E2YA 4TWRA 4CM7A 5KVSA 3GF4A 5FYDA 4B8ZA 1EE9A 2BFOA 5ICSA 4MVJG 1AHIA 4NK5A 1E5QA 1LA2A 4MVJH 1ONOA 4LMPA 1I32A 5JCJD 3AJRA 5M6DA 3O26A 4I1IA 4RPLA 1JLLA 1KY5A 3CKYA 3BMNB 4BKQA 2D5CA 4R54A 2CVQA 1T2CA 2HSDA 2Q49A 3QRWA 2ZCUA 4XRRA 1MC4A 1DAOA 5T64A 3GR6A 1BW9B 4M54A 4CMGA 1VSUA 1QR6A 3RUDA 5BSEA 3VPHA 1DLJA 1KVUA 4FFMA 2BELA 1OMOA 2BGKA 1FDUA 1YKFA 3BHMA 2FR8A 4YRBA 7MDHA 4CMAA 2G76A 1E77A 1Y8QB 3AY7A 3ZZNA 3Q9NA 1E3WA 4O1MA 3UHAA 5TC4A 3B1FA 1VJ0A 4BO0A 5EN4A 3PHIA 2X0NA 4Z9FA 2CMDA 1EK5A 1H94A 2UDPA 2O3SA 4GAEA 4R1TA 1KEVA 4MVJF 4I8XA 1C1XA 1SEPA 1WVGA 3JQFC 2DAPA 1K89A 1VLLA 1HSZA 1U1IA 3C24A 2DTXA 5I7SA 4PZDA 5KWEA 2CFCA 2FRDA 1Y8RA 3JQEA 5KNLA 2VNSA 3PJDA 1ISMA 1EK6A 5CDYA 5A02A 3HNPA 4RO0A 1XYGA 1ENYA 1QYCA 3LU1A 2O3UA 3ORFA 5CFZA 1DO8A 3ETDA 3LQFA 4YRAA 4O63O 1X7HA 3JD1A 4G65A 4KUEA 5JY1A 1N5DA 1SO8A 4CQMA 3PYLA 5GY7A 4MVJI 3KO8A 4E2WA 3VH2A 3Q9UA 1PS8A 1A72A 3PYMA 3MJCA 5TJ9A 4YJHB 2V6GA 3KETA 4MO2A 4MVJP 4Q39A 4XQEA 5DCUA 3PZBA 3QSGA 1PJ3A 3DZBA 4FC7A 3FHLA 1ID1A 2LDXA 4BKUA 1CEQA 1ZXBA 4BO2A 3ETEA 3OIFA 3EMKA 3FF4A 3WBFA 4GVLA 4JIGA 1NAIA 3E8XA 1SPXA 1YDWA 2B0JA 3KYCB 5FFFA 2E6UX 1UAYA 4HNHA 3VPFA 1FF9A 4LISA 3E5RA 4D3SA 4R5HA 3PVZA 3JQGB 1XU7A 4UEKA 4PG8A 3D3WB 2X9VA 4H7PA 2CDBA 3TQHA 3WICA 3JYPA 1PQUA 1MXHA 1B3RA 3DAFA 5A5EA 3MWEB 5TJHA 3BHIA 1JN0A 3CTMA 1PL7A 5JFOA 2FOIA 1X0XA 5L45A 3DWFA 2X6TA 4EUHA 3UVEA 4J2HA 4NDNE 4OO3A 4P4NA 1ISGA 4I5DA 9LDTA 1UZNA 1VC2A 1EUZA 2NQ8A 2CZCA 3RVDA 4Z9XA 2A94A 3FRJA 2NVUA 5JYDA 4XEHA 4ALMA 2Y67A 1YH3A 1ZSYA 3KSZO 1Y81A 1GU7A 3FNGA 4OJNA 5DBIA 4B7UA 2VRBA 1I33A 5T73A 4W7IA 1E1LA 5LDGA 1DC5A 3UGKA 4AJNA 2W2LD 2GR9A 1NTOA 1UZMA 1I01A 3RFXA 2RBEA 4E3ZA 4I5FA 1V3TA 4II2A 3FR8A 4Y98A 3TOZA 1AN9A 4GLLA 4CV3A 1Q0LA 3QE3A 1F0YA 2CD9A 2EG9A 3PPIA 3M1AA 3OJFA 4GX2A 2X58A 1J6UA 4J0EA 5EMHA 5TRTA 4CUKA 4FS3A 3WMXA 1Y8RB 4GBJA 3EZLA 4K6FA 3H65A 2FPPA 3AU8A 4I08A 4ND4A 4W9NA 3C1TA 3W1VA 5JAZA 3MJSA 4BNXA 2YDXA 2EXXA 1H93A 4F45A 1GADO 2X5JO 3WFJA 4BMSA 2VYNA 3F6YA 1HLPA 1R12A 5F1KA 4MP3A 3LSYA 1EDZA 2PTGA 4QFDA 3VVBA 1Y5MA 5GMOA 3GG2A 5I7EA 2NU6A 2RHRA 3AOGA 1UP4A 4CMCA 1ENPA 1N7HA 4OQZA 1LDBA 1ZJYA 4I5EA 2EERA 3IKTA 3T7EA 4FW8A 4ALIA 5IXSA 4Z0HO 3KHUA 4XQCA 4ZD6A 5HWSA 3I9JA 2GN6A 3GGPA 3E5MA 3PYXA 4BNMA 4YJFB 1WXDA 1IPEA 2B69A 4O59O 3M2PA 1PJ4A 2C82A 1LTHR 3RIHA 4TRRA 4WPGA 4J91A 3GGGA 3DZJA 1E3JA 2HRZA 2YV2A 3LVFO 4O0LA 2FSVA 3GUYA 3KVOA 1NR1A 4D41A 4ZJUA 2PD3A 4IMRA 3RBXA 1R0KA 1LRJA 1ZSNA 2P9EA 2VZ8A 3ZNPA 4B4OA 1F8FA 1YBVA 2NVBA 4EUFA 3O8QA 4R1SA 2ZKLA 3VKVA 3ZU2A 1ZKMA 3LT1A 1EUDA 1IHXA 5IZ4A 3H5AA 1NM5A 1LRLA 4BNYA 1YB1A 4D46A 5KJCA 2PY6A 2GGSA 3AUAA 1NPYA 3ZGYA 4E33A 5L9AA 4J7UA 4XYGA 3ZW8A 1GL3A 2B35A 3IDSA 2H9IA 2NVUB 2VT2A 3D5TA 2FZWA 3JYOA 4BKOA 1NFQA 2NLOA 3MTJA 1NP3A 4YTEA 3H9QA 3IJRA 4IDFA 3U4DA 1RWBA 4NFSA 1BRMA 2BI8A 2VTDA 1VL8A 1ULSA 3G1UA 3WIEA 2Q1WA 1HTBA 4JXKA 4M89A 4IS3A 3I9OA 1U4OA 4IINA 1VPDA 3QA9A 4UVIA 5C5IA 1NHGA 1YB4A 5I7FA 4PRKA 2DTDA 1LLUA 1NPDA 2JHGA 2O7QA 3F4BA 3IL2A 5I9MA 1P1KA 4J16A 5K0ZA 4XB1A 4XIYA 4TQGA 3PLNA 1KETA 2I3AA 4JBIA 1L7EA 1BXZA 3AK4A 3UICA 1JKIA 3WGZA 2PR2A 5CG1A 1JW9B 4JNKA 1HWYA 3H8VA 4Z9YA 1EDOA 2O4UX 1YRLA 3NYWA 4K6CA 1V0JA 1ZSVA 2GN4A 1KBZA 2AMFA 2PZKA 4OSPA 1PGPA 3JQ7B 1UP6A 2FMUA 2Y1DA 4KUGA 2ZB8A 4LGVA 1D3AA 3F46A 2JL1A 4CMIB 2HUNA 1WLYA 2DBVO 3ASUA 1ZO8A 4MPDA 4N5NA 4WOKA 5IZCC 6ADHA 3TNLA 4BHTA 2EJVA 2EP5A 1SB8A 2GO1A 4BV8A 1XIVA 3DO5A 3K2EA 1F12A 3OQ6A 4BGVA 4D7AA 4WECA 3ADPA 1BSVA 2DFDA 3FTNA 3GPIA 5G4LA 3BTSA 1T1SA 3RJ5A 4CR6A 1B8PA 3JD3A 4TZKA 1JWBB 2XAAA 2PA3A 2AQKA 4CM3A 1Y9AA 4E2ZA 1E6UA 1YXMA 2XPCA 4R3NA 4LVCA 4QXMA 3ZWNA 1C1DA 4J2OA 3JQAD 3D4NA 1WZIA 3OFSA 3UCXA 2VYVD 4WGGA 1BVRA 2OUIA 3QVOA 2G17A 1TT5A 2LDBA 3JQBA 3OQBA 3O8QB 1I3MA 4CUZA 5BT9A 1XLTA 2DTEA 3FCOA 3GFBA 5JMPA 4DQUA 3A14A 3EC7A 2C7VA 1JAXA 1Y1PA 3FNHA 4HUJA 3G17A 2GZ1A 4J7XA 3ZWCA 2BF7A 4MP8A 2PH3A 2GLXA 3CUKA 4PVDA 2ET6A 4CM9A 1HZZA 5DCWA 1GQ2A 4OM8A 3UAGA 4IDBA 1K6IA 1Y9EA 3Q11A 3PIDA 1E5LA 1E7RA 1T2FA 4L74A 4IQGA 4FD3A 3W4JA 2RIRA 3LC1O 2X5OA 1BWSA 3EYWA 4EZBA 3RUIA 3GUCA 4QTZA 1Z7BA 1BXKA 1CQJA 1HDXA 2TMDA 2JKVA 1N1EA 2NADA 4HX5A 3T7CA 3LLSA 1CERA 2D4AA 2AA3A 3L4BC 5AXCA 4NJMA 1N1GA 5CP8A 1D1SA 1UDCA 1HE3A 2ZTMA 5JS6A 3TPCA 3FNEA 3K73O 3Q6IA 4RZIA 1F06A 3H9JA 2QZZA 3IAHA 1JAYA 2O7SA 2IYOA 4R01A 5JDIA 3BMCA 3GH3A 4J43A 2Y66A 5A06A 1VKNA 4WNCA 1EMDA 4XIJA 4R1UA 4RL6A 5C7OO 4EW6A 2PWZA 3QVTA 3PXXA 1ISJA 3ZWBA 5MGBA 4BNJA 1T4DA 2I65A 4MIOA 3FWNA 5COAA 4R1NA 3WYCA 2AXQA 4K26A 4OGWA 4D3FA 4R9SA 3UH1A 1A5ZA 4NI5A 4FGSA 3VHRA 1ZBQA 4QQRA 4UUPA 4F6LA 2O50A 4J1SA 1EVJA 2H1SA 2PLAA 4WCDA 1QV6A 5U9CA 4NK4A 4NBUA 3JQBC 4HWKA 4BO7A 4GH5A 3NT5A 4HKTA 1V3UA 2HCTA 3IJPA 3PGJA 1X15A 5DP1A 3E9QA 2IZ1A 1LJ8A 1QLJA 1C1DB 5JMWA 2OORA 1M6WA 1XGKA 5IG2A 5JLAA 3ZU3A 5CG2A 4YDRA 4XCVA 1EFLA 3TL3A 3AOEA 1TT5B 3R3SA 3NGXA 2IXAA 3C1AA 1ADGA 2AHRA 4B7XA 4DXHA 2A9FA 2Q2WA 3FWZA 4JJGA 3I1JA 2RH4A 3HZZA 4U8GA 5CPFA 2WYUA 4E6PA 3RFTA 4A5OA 4DC0A 5K9ZA 1R16A 5IDXA 3SJ7A 2VZ0A 3OEYA 4MKXA 2QRJA 3GZNB 2I5PO 1ZJZA 4UEJA 2UVDA 3S1LA 1GQYA 3EK2A 1HRDA 3NRCA 4Y8VA 1B3BA 4FFPA 4EBFA 1WWKA 4CL8A 2ILTA 2EW8A 1NQTA 2J6IA 1VJ1A 3JQ8A 1N2SA 4YT5A 1MV8A 3F5QA 1NBOA 1ZK2A 2C0CA 5JY6A 3DTTA 4NJMB 1JVSA 4IM7A 2IEDA 3PIIA 5TX7A
chains in the Genus database with same CATH superfamily
1CP3A 3T5CA 2VJOA 4EITA 4EY3A 2EKZA 4NCBA 1KJ8A 2C5GA 1ZH4A 2OL4A 2WU0A 3BFJA 4HAXA 3ABZA 1SC6A 3PNQA 2C8KA 3E3LA 2HWYA 2W83A 4WLVA 4M86A 4MW4A 2G1PA 1F8GA 1L4YA 5FNZA 4EEZA 1RYNA 4F5YA 2CMGA 4FT4A 4RCVA 1WDMA 2ORWA 4WFIA 3RSFA 3V7YA 2J6BA 4M7OA 5HCNA 1SHKA 4FLFA 3MJTA 4OQMA 2QX8A 3MCUA 4C3ZA 2BGWA 4NENA 4D0SA 3MWDB 2VDWA 2GI4A 1MA3A 3L3BA 3P9YA 4G0YA 4ZO4A 4D4LA 5ADWA 4YP9A 3NP7A 1HX7A 4JP1A 2VXYA 3L0ZA 2YZNA 3R7NA 2GXQA 1OSNA 2XE7A 5GOTA 4BIIA 5JH7F 2O8NA 4U7TB 8ATCA 1H4QA 2CLSA 2XWSA 3EAGA 5G0TA 1FMTA 2RAFA 3B5IA 5LMCA 4E4TA 1Z75A 4Y9UA 5JZMA 4AS1A 3H8WA 5EQJB 3FJYA 3KSBC 3HA2A 4L0MA 5B30A 2P77A 4TLAA 2QAIA 2CE7A 5FBHA 1ZLXA 1NVFA 5JCPA 3AX6A 1AK9A 2DHQA 4X93A 1J06A 1ND6A 1FX0A 3HKBA 1HE1C 4NARA 4HLDA 4MWSA 4DLKA 1DJMA 5DGCA 3GCZA 4DHWA 3C3PA 3RFXA 1KJWA 3HDQA 1QG6A 4H7DA 2QBYB 1ZJ6A 5JASA 3OH8A 1HV8A 2XLCA 3BZBA 3OZAA 4UPVA 3IUEA 3V48A 4PNPA 1EFKA 4MW0A 3A8TA 1RWKA 4QRDA 4V24A 5EUMA 4BQEA 4F1WA 2Q9CA 5THQA 2ACWA 3NWJA 5BWBA 2I6SA 2ZRDA 3QU5A 2V54A 4F92B 1EZ4A 1MHPA 3WFIA 1FFBA 1XQ9A 2WF9A 5D7BA 1Q50A 2C58A 4DG8A 2IHNA 2ZXFA 4ZVLA 4MP6A 4INJA 3HFJA 4N40A 2VDQB 1A88A 1CY2A 2OBMA 4YUYA 3SZUA 2O8DB 1DWQA 3STYA 4KWTA 4HXGA 1CRZA 1PKEA 1ZCFA 3K92A 2FUEA 1PBNA 3QTLA 1G4UR 3UC5A 3HV0A 2IPNA 3QWAA 4JR0A 1W6UA 4YO7A 3X1DA 3D8UA 4KFTA 1NVUQ 2EKDA 2R1UA 3K7EA 3M6MD 1IULA 1IN4A 4XTRA 5BSUA 5K2MA 3K0CC 3FGZA 3ZJ4A 4C0BA 3DAPA 4ZIRA 1EYZA 1L5MA 2IPOA 3HN2A 2P8JA 1N3IA 3R4VA 5LB2A 3SLGA 3ZXSA 3WMGA 2OFWA 2FMFA 4MEJA 1EFVB 4D25A 1TAUA 3TQTA 1G0NA 1QH1B 1WDKA 4IJMA 3CF2A 2Q1YA 1DI0A 3R5SA 5DNEA 5FLYA 1RXIA 3TJRA 3NG1A 1C3EA 3LUJA 1SVLA 5FUXA 3N59A 5ILQA 2GNPA 3QHAA 4E07A 1RPZA 1T6NA 3QYAA 1AUVA 3RSSA 5L4LA 2QN9A 3LGSA 2HLDD 3LPMA 3T9BA 4EZEA 2L69A 2ZUDA 2XT9A 4UXJA 1ZJJA 4YMHA 5CLFA 1GTMA 1P45A 5IX8A 1BFKA 2NUTA 4C4ZA 1P2TA 4E70A 4H6PA 3BJMA 5FAXA 1QYXA 1W19A 1J21A 2BEUB 4IHQA 4PZLA 2IBTA 2XYQA 1OX6A 3PC4A 4D3SA 1FIUA 1RRFA 5HQTA 4ZEOA 3QLVC 5EQFA 3EAQA 4UDYX 1Y3AA 3I6IA 3S68A 1C7QA 3SM3A 4R1LA 3A9SA 3WB9A 3T7RA 4NOJA 1YMVA 3EUFA 1UJ4A 2DH6A 2YNMD 3N8DA 5EWJB 1ICEA 1SZJG 1JT2A 3IILA 4NOLA 1XMVA 3IR5A 1IBMB 1H05A 1NDQA 2EFHB 2ZBRA 4HB0A 1ZI6A 5FWXA 2OV3A 3M33A 1J2EA 4QX6A 1K6EA 2GHIA 2DR0A 4OI4A 3GGJA 4IUDS 3M4YA 1P1HA 1SB9A 2GNOA 3PDUA 2QTNA 2PUWA 2W2KB 3GB9A 3GVHA 3EOAI 2O07A 3K5IA 3OM9A 1XA0A 4JAVC 1XJ5A 1QHEA 3MZ0A 1U2DA 2G67A 4L0CA 5COQA 5E0OA 2WYOA 2WF6A 5JMOA 4F7DA 5BURA 2VDRB 1D0IA 3L0DA 3GHHA 2H1IA 1ZM7A 2C29D 2OCXA 1WBDA 1F1BA 1UWLA 2CUKA 2I22A 3UYKA 1XWFA 1DINA 1GU0A 1QOQB 3D6JA 1NOIA 4EO7A 1EFPA 6ABPA 5FQOA 1DDOA 3BX1A 3LC0A 4X3CA 1EJ2A 4JYBA 2ORED 1V2HE 2DYKA 2HQRA 3PXCX 4FEGA 1QCCA 2V8OA 1S7GA 3H1PA 1PFWA 1QG4A 2F17A 4NTZA 4OATA 2X7HA 5F2KA 4IYJA 1JKJB 1EGQA 5CXQA 3P9PA 1GKYA 4BMVA 4DMKA 4IH1A 4MB6A 2VPWA 3N6RA 1FUEA 3P2YA 1FRNA 4N03A 2OHVA 3V8MA 1PWZA 4O4LB 3CUUA 2R6GA 1M5TA 3HRHA 1YHZA 2COUA 3QVJA 4HYYA 3DC2A 3R8XA 1ULUA 3ZHXA 5T7BA 4L85A 5EEHA 1B1CA 1SXGA 2OSVA 1NQWA 4ZODA 4LZJA 3GD7A 4IH9A 3VGPA 4Z4HA 3OD1A 1OWLA 1U9CA 2VCYA 3IKVA 5AKGA 1NDUA 4AD8A 1MW8X 3K96A 1J2TA 3D7LA 2NPFA 4RTNA 3D3EA 2PFSA 1KYTA 3I5XA 2BT4A 1JIXA 1Z35A 1Z4LA 3N74A 3VO2A 5ICCA 4LJYA 4D8YA 1EGVB 4KRGA 4DQVA 3P20A 2RI1A 4IOJA 1DCFA 1KFJB 2DVMA 5JO9A 5JNWA 1XEFA 1Y4AE 3T9DA 2VDPB 1SXJB 3SEFA 3WIBA 1H9AA 3NHWA 4ZCPA 3O7MA 1A4IA 4EB6B 1DZIA 2JIDA 4HDNA 4JWKA 4O3MA 3QEOA 1PR2A 1KU6A 3LQYA 4MWTA 4ZXPA 3BWYA 2J3IA 4UM5A 3AHEA 4ZAFA 2RAPA 2FY8A 2VA8A 1QIHA 2FNAA 4LNUB 4GX0A 2QSUA 1XXHA 5MDHA 3TXYA 3NHFA 4PYMA 1EDBA 4CF4A 4Q7EA 5A6SB 2V8BA 1NQAO 4G1BA 3RUPA 4AS2A 1VG1A 4MYTA 2QORA 3VPCA 3HI6A 1ISHA 1YZFA 5FPSA 3RYIB 1T1IA 5MHTA 3VJKA 4ZQGA 2OB2A 4W1PA 1BHSA 1NUUA 5EWLA 3S44A 4E08A 3AVPA 1TB4A 3D7RA 4X1IA 5J2UB 3WDLA 4OL0A 3T3DA 1AUPA 4U0JA 3OJLA 4HNVA 2I76A 5KUTA 1FW6A 1NVBA 2NUPA 3TNJA 4S1VA 3VR2D 3VNSA 2YBDA 4W4TA 2C4KA 4LVOA 1JQEA 2I4IA 4U2FA 1NUPA 2ZB2A 5DASA 4ZU6X 1SUPA 2ZTVA 3C7KA 1TAQA 3FDXA 1JG4A 2B7BA 3N6XA 3T5MA 4AKSA 4ROTA 3ZJXA 4NPAA 3WSWA 1OI3A 2X4LA 3K2BA 1M6YA 4D98A 4TTVA 1Y42X 4A8HA 1ZGAA 1OIWA 3BMQA 3GWGA 1RPTA 4IOLA 3T7TA 1P4RA 1YS4A 2VHQA 3ETJA 1D6NA 1X8XA 1YRAA 2QTLA 2WIJA 4XPZA 2WWRA 2GFIA 1A9XA 1K97A 3IIMA 2JH9A 5ELMA 3UB2A 2JHAA 4OQEA 1FDRA 4JXJA 1GZ6A 1LTKA 1E9CA 3DE5X 3Q1LA 3KUUA 5EA2A 4G5SA 2ZANA 3V4OA 3V8PA 4EG1A 1OHHA 1T5HX 1D2EA 3D2CA 4ZTBA 3FRHA 1W5BA 5T3UA 5EINA 3E6AA 5KOYA 4BJ1A 4OLHA 2DWPA 3VOAA 4FBMA 3ZWVA 3BJEA 4EVRA 4KMOA 4XDYA 2GK6A 4PLWA 3I12A 3PGKA 1HE4A 1YB5A 1JBEA 2G4VA 5AKHA 5IUKC 4KE8A 3SZ3A 3FUCA 2Y6UA 3L8ZA 5HRUA 3CRVA 4WLOA 3KTDA 3WNVA 4PPGA 1NAHA 1V6CA 4PCVA 4RKYA 4IHKA 1EQ2A 3CNLA 4U9IS 2Q6LA 2GK4A 3L2OB 2B61A 4N54A 3LA8A 3O5AA 4OIMA 3GO4A 4GZLA 5C80A 2XY4A 4P36A 2XZLA 3QQPA 3AW9A 3MUEA 4O08A 3MGBA 2OKCA 4MTLA 2C2OA 1V6SA 4QEDA 5AVSA 3AFOA 1LLFA 4NMHA 2IUUA 4CQLB 3KV3O 4QWWA 1LQUA 3GT3A 1LSUA 1LDYA 1VMKA 3BGOS 3FPCA 1RRMA 3PVSA 4KTVE 1T0JB 4D80A 1PBTA 3UJ6A 3S70A 4R5MA 5KEIA 3PFKA 3ILYA 3LFTA 1Z68A 2PJZA 4N7BA 5TMBA 4YYEA 3KQLA 1WZ2A 3N2KB 4ZJYA 4A8JB 1BFDA 1UC8A 4C5BA 4JYMA 1V3VA 4BKRA 3G2JA 4BEBA 1M0TA 4MW2A 4DNOA 5FX2A 4P4LA 3ZZMA 5CDTA 1E89A 3DP9A 2Q4OA 3UXYA 4BQFA 1E1MA 4DSUA 5A4KA 5HZGA 2KX7A 2HFJA 2IEAA 2OYSA 1EDDA 2HH9A 1KAHA 2XH8A 3ILSA 4GOKA 4UREA 2Z30A 3KAJA 3RUAA 9GPBA 3LBYA 1ZAYA 5E4YA 3O92A 3WVNA 4JP2A 5L3QA 3HY4A 3BE6A 1GSHA 3NH9A 1U7DA 4UHEA 1IOVA 1JJ7A 3EP5B 1U7WA 1DCKA 1COWD 1R64A 1X9GA 4IFBA 3RC2A 3C7DB 2YWCA 4IW3B 5JMTA 1DGQA 2CHVA 2VT3A 1BXGA 2N0SA 3CNOA 4X3PA 3W6NA 3R24A 3UJ3X 2LV8A 1L7RA 3SHTA 3BQ9A 2C2YA 3NYRA 1DRJA 4U2EA 1CJUC 1K86A 2E5WA 2FE1A 3ED1A 4DSAA 4F93B 4A36A 4X7MA 5AM4A 5GJBA 4N8DA 3PI6A 2CHQA 4H7HA 4ZP1A 2W8BA 4KPFC 1OC4A 3U0BA 4L51A 3THOA 1IU9A 1FBTA 1SCKA 1RWNA 1XAJA 2OGTA 2Z2KA 4XCXA 4X60A 5KSOA 1FNNA 5B4VA 1H1TA 1RHRA 1MB9A 3AEXA 1YOVA 1NY6A 3BRWD 4JSYA 1ORIA 1G21B 4LY0A 4DCJA 3VVCA 4BVBA 2DECA 2C5LA 3CNBA 5ALKA 2UZ1B 1GGJA 3R0IA 4PNEA 5HF9A 4CFYA 4HDCA 4LA4A 4XM1A 5C1IA 2VQFB 2C84A 4QNRA 1FNSA 1NVKA 2GARA 3BZWA 3RVNA 1I7SB 1V11B 3DZIA 4BAZA 4X44A 4X41A 2BFFA 1MZPA 1MEJA 3TKAA 2EF0A 4WCFC 1FCJA 4EA7A 4LRUA 1P0QA 4L5AA 3T1YB 2ZT7A 5AXDA 4I4LA 3ULKA 4G23A 1JDBB 4PS0A 4RCZA 1G98A 1P4HA 4UBJA 4UUAA 3WV5A 3OP4A 4Q37A 1AS0A 4D0NA 3W8EA 4KWIA 1JXQA 2YXPX 1EHYA 1CE8A 1GT6A 1ZIXA 1E6WA 1VI6A 1K5HA 2X4GA 2NZUG 4MW5A 4RDIA 4BFSA 1XPOA 2A92A 3AP2A 3BD8A 3UJPA 1CYDA 2FLWA 4H16A 1DZ3A 1ZPDA 2DFLA 2KBEA 2XRFA 2DQYA 2GA9A 1UDAA 1XZJA 3GRUA 2O2ZA 2AS0A 1D5CA 2WT9A 3E22A 3E7PA 4IZOA 4O4LF 2GASA 1G55A 3EG9B 5T4BA 2HNKA 1W4AA 1LV8A 2R5FA 2A1UB 2XJ9A 3A4NA 4KTTE 2IDKA 3R2JA 3CZPA 4EF4A 5LIRA 3H11A 5A3VA 3BRQA 3OY7A 1BEZA 1IWBB 5HK8A 4BX3A 1YULA 5H1YA 5HK9A 1FLVA 1R0LA 1XMQB 2GVNA 4WEOA 1BCSB 1V4VA 3HKDA 5T4HA 4W99A 4LF6B 4A1FA 4A10A 4CKCA 5HIKA 2PQ2A 1H2FA 1OGIA 3HLKA 4LW8A 4IP0A 4X1KB 3NXSA 5E7QA 2CEKA 1REQA 2OBXA 3F4KA 4MRMB 5FJIA 2RH9B 4HUQA 4DCCA 5B7QA 3I64A 1E1QA 2UYGA 3ND8A 3QPBA 2AFVA 4LI3X 3F8TA 2ZAIA 1T2VA 1EXWA 1RJGA 4ZT3A 5T8KA 1RKUA 1K7XB 3VPDA 2FG6C 1T0HB 1B1AA 1FSGA 3VNAA 3CNHA 4GVXA 5SZJA 4BTVA 2AF3C 3HDHA 3L4BA 1IOWA 3DHEA 4GSYA 4CF3A 4GBMA 5HSGA 3FJOA 3A27A 5DFAA 3EARA 1BKSB 4KKXB 4PYRA 5DI3A 3X0DA 1H1LA 3U7EB 3ZY4A 1MF7A 3GLGE 2VH2A 2MYTA 3QVUA 3ZHSA 3LT0A 4K9MA 2AF4C 2H07A 4BNLA 2NU6B 4LC9A 3FBGA 3LUBA 1P0CA 4IDPA 3VR3A 4B3HA 2ZTHA 2TSYB 3HYCA 4HNAA 1TXGA 2V97A 4P0TA 4L8FA 1EP2B 2G5PA 2N47A 2R60A 3CE6A 3KR2A 1G7TA 3KZMA 4KAAA 3TMAA 3V1KA 1IEWA 4E21A 1E4YA 2NV2B 2ZWVA 2PH7A 4GMDA 3LXMA 2XDAA 3RAEC 3SSOA 4L9RA 2HA6A 2SNIE 3L46A 3PR3A 4LZNA 2KWIA 4L27A 4NPCA 4YJGA 3SZMA 4E46A 2HQBA 4B5LA 4N49A 3U1VA 2GYUA 4MPRA 1I7BB 3JAKA 3QQ5A 5CIYA 1LZLA 5J2UF 3AUYA 3ECSA 4DHEA 4KPEC 1FRQA 2QMUA 1JLKA 2QZPA 5C46F 1U8EA 1UQUA 3JD4A 2JD2A 2VP2A 5ICMA 1BC5A 3GGDA 5NULA 2ZJ6A 4Z0NA 1QFZA 2H48A 1Y5RA 5SV2A 1ZEMA 3FTFA 4CFSA 3VOTA 1QIGA 4MGKR 3W2FA 5DIZA 2VYFA 3SQLA 4IGFA 5D6OA 1X6VA 3FSGD 2A5YB 4XA8A 5J5AA 2J5RA 3RABA 1EKXA 1QRAA 2FGKA 2HU5A 1YL6A 2WNSA 1YB6A 3UFXA 4EUEA 1X3SA 2UUBB 1RI1A 1MAVA 1ZMXA 1LB1B 1U5BB 3CEHA 3FTCA 3D5EA 3MCTA 4UKDA 3EZYA 1KEEA 5AIBA 3GVXA 1R0SA 2CB0A 4E4YA 2X8JA 3KL2A 3HN6A 3R0VA 4WLEA 5EP4A 3WSVA 3X2FA 5C8XA 5CBPA 3UK1A 2JFWA 4RV9A 4AWXA 4C2TA 2JJ1D 2XVXA 1RLIA 1XRMA 2VR1A 3SS7X 2FSIA 5C7LO 4UVGA 5KCZA 2BKLA 4K7JA 2GDJA 4LWZA 2F3PA 2Q5IA 3BF7A 1VL6A 3D8HA 3G9UA 2YQ4A 3HXPA 3JASB 4KQXA 4MULA 4MWZA 1P2DA 4OJTA 4MI6A 3ADBA 3AR9A 5BWCA 3K9NA 2QTVA 4TX1A 2FUCA 3AIIA 4GP9A 5F1YA 3RS3A 3K9FC 1NRIA 1RFGE 4GECA 1OLSA 4G0QA 4ND7A 3TSYA 2XCRB 1NMQA 3PHCA 1OPRA 2O2HA 4TT8A 2PSDA 1QGUB 1IB0A 1VE6A 2GQ0A 4UEQA 1XZEA 5KYXA 2J0VA 3JVIA 4LVNA 2HY7A 3HKEB 3ZWWA 3ANXA 3H19A 3CUYA 4R8VA 1CUVA 2WZCA 2W2LA 3S99A 1RQXA 3ZC3A 4BNZA 5TIIA 4MDFA 4FI3C 4MI1A 1R0BA 1MEOA 1N0UA 3PT5A 3FPEA 3PS9A 2PJUA 2Q3DA 1ADFA 1K9SA 1P77A 1ZRSA 4GL4A 4MOWA 4ZARA 2W5UA 3U13A 1M2FA 1NN1A 4AX8A 5ARBA 3I9KA 2RGCA 5CURA 1GOTA 1BE6A 4AG3A 4DDMA 2WR8A 1EBBA 1Q57A 1EBUA 4Q01A 3EVTA 4KMSA 4BVEA 1G5PA 2AKYA 1A4RA 2QRGA 4O2LA 5FWDA 1SXJD 3A25A 1KI4A 2OXEA 2N1MA 1QVRA 2SKCA 1HUQA 1TT7A 2ZJ2A 5JNRA 4JUIA 3HB0A 4B84A 1FMFA 1T5DX 1SCUA 3C6MA 3HJBA 4NYIQ 3KKOA 1DHRA 1K5PA 4BMDA 4BNVA 4S3MA 2EW1A 1UPFA 3LYAA 5K0EA 3THWB 1XTKA 1YBMA 4AL4A 1U5CA 5LZ9A 3ESDA 4R2WA 1CEYA 1VZ3A 5TGTA 2JGIA 4TSFD 3L0YA 1JG2A 2H1LA 5JNUA 1GPDG 3PRYA 3T06B 2VCHA 5JZOA 1FJXA 2B6HA 2HA2A 2WWHA 1EGMB 1B6RA 3H8SA 1LUAA 4RA6A 5IJ0B 2ZI9A 1H2HA 1Q83A 3PFFA 1F17A 5H59A 5M29A 2O8BB 3VSEA 1SVIA 1BKDR 4MGYR 3VKHA 3PNPA 2I6TA 1YQQA 1A5AB 2FVXA 4C14A 1HI9A 1V5IA 3PE4A 4YMSA 5DX0A 3DUFB 2CLDX 3KHSA 1DADA 3L5KA 2I3GA 4KX3A 2JIZD 1FP7A 2C83A 2HJSA 2QB5A 4P6VF 4WUTA 3B3QA 1SCDA 1S8OA 1N2CB 1QB8A 2ECQA 5JW6A 1VMAA 2YXBA 3NPMA 5ITVA 1E4VA 4AWBA 3GA0A 3UMCA 4NBNA 4MR9B 3G1TA 2P79A 2ZAOA 3THYA 4TTSA 2WB4A 5TMEA 2DBRA 3DDZX 1VP9A 2UV8A 4L50A 4EF6A 1B6SA 1EE2A 2OD9A 2XF8A 2WHEA 3LVQE 4B7CA 5EIOA 2FWIA 5H9VA 3WGTA 2PL1A 5AJYA 3S1AA 1KSJA 1I79B 5ICGA 2Z2ZA 3CWQA 4ZTZB 4F1JA 4OY3A 2GZDA 5BN3B 5F7OA 3T1HB 1Q7CA 4P81A 4KQWA 2P6OA 5ERYA 3TQFA 3FCSB 2YIJA 4DBLC 4PXYA 2OMEA 3LT2A 1BVHA 4FYJA 1NJGA 1MZVA 2C1XA 2VJMB 4QECA 3ZWAA 5FP0A 1KJIA 2AR7A 1DKMA 2VH5R 1VIDA 3CLUC 3PR1A 2X7XA 4JLVA 4W1QA 1QF9A 1DIRA 1JJIA 1E1DA 3H9BA 3QUQA 4IIYA 4JJAA 4JLDA 4NMLA 3IV6A 1QFXA 3LUHA 2Q3FA 5D51S 2FZCA 4YJ2A 4Q6WA 3TW3A 2NZ2A 1T9HA 1L7PA 4MUXA 3ZBTA 3K70C 4UARA 3HUFA 2NYVA 3K0CA 5EE9A 3L79A 1AQIA 4KO1S 4OXXA 1X1DA 3KP1A 4BQSA 2NYAA 4BLUA 4CEJB 2Y1CA 3FR7A 3GLIB 1YZQA 3WNDA 3DD5A 4L02A 5BWLA 3KJHA 4IO0A 4DA9A 1IBRA 2PG3A 5DN6A 3UAZA 4DMUB 1I6LA 1OOEA 4PLTA 3KPYA 4IICA 5IKMA 4RK4A 4Y2QA 3FYHA 4FN5A 4GC9A 5ALLA 4PHHA 1GZDA 5KYYA 1WOYA 3RYTC 3U09A 2Q1TA 2YYZA 1IUNA 2OT3B 1S4MA 2EZ4A 3KKKA 5L3SB 2HRRA 3AXTA 4RACA 4QA9A 1Z56C 5KVVA 4FK8A 3A6EA 3PBKA 3FWHA 2GK3A 2H63A 4RQUA 5BV0A 2YMQA 3OO0A 4UEOA 4ZRMA 4G5RA 4C0LA 2CLEB 2QYOA 2Q45A 1KJYA 2PKXA 3M8KA 4WBNA 3GAFA 2W90A 3CEPB 1BGVA 3Q7IA 2VWGA 4RIIA 3QLVA 4CF6A 3Q9LA 4B4KA 3OMWA 1WUYA 4HDKB 4PLPA 1MRZA 3OQMA 1C3JA 1ZK1A 1WJGA 1E98A 2K2QB 2CLMB 3FKJA 4H59A 3F5SA 1AKMA 4HFMA 4IIEA 2IS2A 2E2WA 3WQQA 1VL2A 3QE4A 4ENUA 5KQPA 1UPTA 1J9EA 2Z5GA 4WHMA 4XX1A 5KS2A 4KQEA 2DLCX 1LQTA 2VAWA 1X8LA 4U39A 2VHYA 1FVXA 1GYPA 1ZZGA 1PNTA 2HZ7A 4RDCA 5J4LA 3TFOA 4KUHA 4RTSA 1B0AA 4JLPA 4HRXA 5DW3A 1TPZA 4PYNA 4HX9A 2PRZA 1E9SA 1DKQA 2ZI4A 3MN1A 4GX1A 3CJRA 4O02B 3WLSA 5I7VA 5JSQA 2CB9A 5LQNA 3UJ8A 3NLLA 1L4KA 5DB4A 3I8OA 1N6NA 1AGYA 2QTMA 2WMYA 4CCYB 4KLNA 2RKWA 2GPAA 4EABA 3KJZA 3EGDA 1KTIA 3KR1A 5C1PA 4QXAA 5FTWA 4EMUA 3H2ZA 1X2BA 3OA0A 1O97C 4HNGA 1JE0A 2IZZA 2X0IA 2A0WA 3FWKA 5CK5A 3FH0A 5G4KB 1X0VA 2CXQA 1PJZA 1PQYA 2B1QA 3B48A 1RJEA 3U7QA 3DWGA 3GK3A 5K7SA 5JNSA 3QF7A 4PX2A 4DV1B 2HDWA 3ECCA 4RVGA 5HRCA 4H2DA 3WYBA 2O2SA 3MD0A 2BCEA 2QMHA 2VSNA 1N57A 1TKAA 2FP4B 1NE7A 2BGJA 3U7GA 1RPNA 2QUJA 3EEYA 3OI7A 4WA7A 3TAHA 4EY8A 3BWDD 3EZXA 2AOTB 3FBWA 5JCXA 3U7JA 5B7NA 1VLHA 3C3YA 4A6PA 5LQJA 4XYMA 5KJFA 3FI9A 1FP2A 1HEIA 3DVLA 5EHNA 1GJRA 2XCOA 1RYDA 3X1MA 3RVPA 4KZPA 1R4NA 3HJFA 3H5IA 4CM6A 3H05A 1AE1A 2F43B 1GCOA 3EQZA 1FFXB 1RE1A 4X3OA 1ZM9A 3LLUA 3MQ4A 1PUJA 3NHUA 1NW5A 4NAUA 4BO3A 4D9IA 1OKKD 3G6KA 3DDOA 4G4SO 1MO6A 4NBTA 4AZTA 4Q9NA 2F8SA 2WD8A 4MV9A 4AECA 1CDOA 2WVJA 4B6JA 5CBKA 5FI5A 3GG9A 4WY5A 1WE2A 1U98A 3GZJA 1E32A 4BCBA 2NTJA 1KS9A 1W93A 1ZH8A 1EFRA 2DCUA 4N41A 4X24A 1BIFA 5I3CA 2V7GA 2IZ0A 3HFGA 4E09A 3A70A 3L41A 1UQTA 4XB2A 3EXG1 1L9KA 1QP8A 5J9FA 2B4RO 1DTWB 1HDRA 1KYQA 2A33A 1ZWKA 2AYXA 5JTTA 2E1RA 3VU9A 3BGDA 2QRVA 2GFQA 1E8NA 2JB9A 1JDNA 1YVEI 2FW9A 1EINA 5DXAA 3PUKA 2X5NA 2UZ0A 3B2NA 4H7KA 4CV2A 1V7QA 5IAAA 3GLGA 5BSVA 1DP4A 4N39A 4QVKA 4LJ7A 1RBMA 3EXIB 3ZV3A 1Z0JA 1FC0A 3CX8A 4K6KA 4HWSA 5EHQA 2WUWE 4ATNA 4EGQA 4BCDA 3VNVA 1J0CA 1VE9A 2B1IA 3EIHA 2DUWA 4ZXFA 1M54A 2E18A 1EPUA 3CZ9A 3G0CA 4O2BA 1S89A 2YMMA 5H83A 4QDKA 3ZD9A 3IIKA 2OFXA 1B8UA 4M1KA 2XCLA 5CYFA 1M2KA 2BAGA 2RGEA 2Z1NA 2MTBA 3T94A 1Z0ZA 4A73A 3E7FA 5G0VA 4DEYA 3CRZA 3U3OA 3I62A 5JYEA 3RTGA 3KZVA 3RRXA 3ET5A 4CV1A 1ZR4A 4HLCA 4EJSB 3ISTA 2R3SA 2QYSA 4LTMA 3T9CA 2BC9A 3SNKA 2A3RA 4FOSA 4QDTA 2H1OA 2EP7A 1QBGA 2AW5A 3BYZA 4HQRA 3IKJA 1WCIB 4U02A 5AKJA 3C3KA 5AKXA 1V96A 1XEXA 3B3JA 1XKLA 2P9GA 3C8DA 1XD2B 4MS1A 4IEFB 2WD7B 4Q21A 3GN1A 4Q3CA 5IPFA 2DPMA 4DWVA 1JL3A 1XZMA 3KCNA 3TJMA 1JS1X 4AG5A 4NULA 4PC6A 4BLSA 5JADA 1G64A 2H1RA 3N0VA 4IIJF 4P31A 5E7JA 4MYCA 3RR2A 4D8XA 4YRTA 3QVSA 2C5AA 4RS3A 2OHHA 2O57A 4E5VA 3QELA 3CPJB 3AKZA 4Q1AA 5ITSA 3TLZA 1JQDA 1PFYA 2IXTA 2SCUB 1SCJA 1U7ZA 1YVUA 1CS4C 1M2OB 2NOAA 3PD7A 4RGBA 4ZYVA 1ZEJA 5BWNA 1D2NA 5C2JB 1NSFA 4K03A 5F3DA 4HZUB 4EEKA 5LOVB 4JZYA 3V7FA 1R8YA 2AE1A 3P0FA 1B43A 1YUMA 1R66A 2E49A 3WA6A 2RJOA 2J9FA 1EVZA 3RFFA 3GNSA 2ZRJA 4JSTA 1I6MA 1UPCA 2H18A 3R5KA 1GWNA 3M1LA 1R9MA 1GRNA 4K8OA 1Z2AA 1CYEA 3V55A 1Q7EA 5DMXA 5F9HA 3D4BA 1I9GA 1H5NA 1S6YA 5C8YB 5JD6A 2FEPA 4EFDA 1CNEA 1FTSA 1U1DA 3ZI4A 2VS1A 5D84A 2B2XA 3OKFA 3V33A 3VR4H 5KTPA 2WWYA 1L4GA 2GEDA 2VUUA 5J1TB 4F5EA 1W0CA 3N53A 2FUG1 1D4AA 3T4PA 1KZHA 1E59A 2FSUA 5B6PA 2I66A 2BEWA 1RWMA 2KQUA 2W00A 2IXDA 2F90A 2RHCA 1TJNA 3IRUA 3N2ZB 1XZCA 4ID9A 4RHUA 3WG9A 4KBGA 4MA0A 2WFZA 5I8PA 2YQ5A 2X1HA 3AHCA 2IYYA 1J70A 2IVZA 4L95C 5DPMA 4DWOA 4IXMA 4Q1BA 2GK7A 2RK4A 3FYUC 2V3VA 2WJAA 1WZNA 1JQ3A 1GR0A 4JNCA 3VAAA 1BGXT 4RQBA 3AHHA 3ON5A 4P22A 2UVPA 4A2PA 1JDSA 1WHTB 3UNXA 3SLKA 4JT8A 5A0FA 4YEDA 1W76A 5DNYB 3EF0A 3KZKA 1W4LA 1ST2A 4WVFA 4X7BA 4JI3B 3SR3A 2BEVB 2CUTA 2O0MA 2C3UA 4AKHA 3H2JA 4BB5A 3JVEA 2J6CA 1AVTA 1QP4A 1SUAA 2V6MA 1QIJA 1W5SA 1DEKA 2YWEA 4A0FA 1IVSA 3BIWA 1CIJA 5U4QA 1HDOA 1A9TA 3PCXA 4O4JF 4JBYA 3NV9A 1OLUB 1ZQ9A 2YOGA 1YR7A 2A59A 1TTHA 1FPQA 4ZHSA 1JYFA 2RK3A 3X2EA 3BH0A 3PRHA 3PNBA 1H5QA 3H5WA 4OHWA 4HVAA 3OG9A 1UC9A 3B3AA 2AG8A 3I58A 3LBHA 2IE8A 3KKNA 3HDGA 4H31A 3BDVA 1O08A 3NUZA 2BE9A 1RLMA 5G3ZA 4KO2S 1XCBA 3NJ4A 4QOJA 1TCAA 2PVCA 1E0DA 2D1SA 4TRMA 3O83A 2CXOA 3PNMA 3PPYA 1UXHA 3GEPA 4RVUA 4N8SA 4S2EA 2O8CA 5DXJA 1I3LA 2UUCB 2GAAA 4DCSA 4R9UC 4NBVA 4ZQBA 3TVDA 2C20A 1E58A 1VHQA 1P74A 2C4UA 3E35A 4BB6A 1U2PA 2PMEA 4KFSA 5D85A 4GLOA 1FTGA 4DMGA 2ODAA 4IJQA 2CHUA 4IVPA 2RG7A 4OB7A 1AZSC 3SC2B 4QE3A 3G82C 1FS6A 1VKHA 2R48A 4FHGA 4P3KA 1F6WA 4B3SB 2XADA 3A9TA 5ALIA 4CKWA 4WCFA 2VHWA 2JLUA 2CLFB 3RWBA 3V5NA 3PFCA 3AF0A 4UOEA 4MHOA 2A9OA 1E8MA 3RT9A 2P0YA 4CM9D 4V0NA 4RPHA 3HRIA 3N2NA 3K72B 5EIBC 1RKVA 3MTAA 5AI4A 1UBHS 5AKLA 3PI7A 1E61A 1PJ8A 1LI7A 3BZUA 5JXJA 2ZVQX 2MDTA 1EFTA 3TR6A 1GZSA 1MABA 3VR6D 2Z9DA 5AVYA 5MN5A 3AM1A 4C0JA 4CODB 3L4KA 5HMMA 2Y0CA 4PYLA 3CLRD 2OHGA 3IPLA 4W5WA 4YRCA 4F7WA 4WOJA 4LV8B 2FRDC 5DK4A 2DPHA 1QDUA 1I36A 1OPXA 2DF8A 2ETXA 4KOAA 3WJ7A 1QNFA 1XD9A 3FB4A 5K3DA 3ABIA 4LZPA 2AZMA 4TWBA 4U2CA 3H97A 4KGZA 1MW9X 4BFZA 4CLOA 1FFAA 1XEWY 4E32A 1KRXA 3WYFA 2G6TA 1TM3E 4EHFA 1ABEA 5G0UA 4FM9A 3NHMA 5AK6A 2XMQA 2QZ9A 1JR6A 1R8JA 1NV9A 1X7ZA 1U4SA 1ZXLA 4KH0A 1K8YB 4RDXA 2Q5FA 1JKFA 5F52A 2GEBA 5HF5A 3DQQA 3DKPA 1PLLA 2XHZA 4DC1A 3HWWA 3RBVA 1A9ZA 5ILGA 2WIBA 4JC5A 4A6EA 1TZ2A 2X76A 2SECE 2FQ1A 3BXGA 3J7AC 3UTDA 1PJSA 3T4UA 6NULA 1AURA 3AVQA 1ZRHA 4BU1A 1PWEA 3OEHD 1KL7A 4O89A 1E5VA 2B4KA 2J3HA 5AK4A 5TEVA 2M6KA 3T7KA 3U40A 4BO4A 4CM8B 3P52A 4LI0A 4ARZA 1JALA 3QI7A 2MR6A 2P67A 4CLRB 5HTKA 1QAMA 3K4HA 3GDWA 5LBUA 5HE8A 3DOHA 3HO8A 1QHXA 1ZLYA 2K7ZA 3DA8A 4WLUA 3B20A 4I9HA 3RJTA 1C0PA 3J7TA 4AN4A 1GDHA 4G8CA 4XIIA 3SC4A 2HFKA 3SQNA 4ID3A 5KOJB 5KWIA 3SKVA 2AYYA 1XMSA 4AX4A 4YUVA 2VDNB 1XRPA 5E1DA 3A05A 4QULA 4C0XA 5AXAA 2GKSA 4LFAB 2ISCA 3DTVA 2Y1XA 3TLXA 4P4UA 3ZNNA 3HBJA 3WIUA 5TS2A 1NW8A 5IC5A 3FHTA 1YQGA 1SULA 2CDCA 3TZ6A 1TM1E 1XJCA 1W1IA 2XMRA 3BKXA 3IV7A 3OOJA 1Y33E 4K6OA 4L16A 1B41A 1M2EA 4G09A 4DUGD 1UKVY 2B5VA 4OGFA 1N5LA 1PW5A 1XYYA 1SURA 2A9JA 3FMOB 4DQXA 2ZREA 1KQGA 4BQNA 4Z51A 2HJWA 3SU8A 4X7PA 3JALA 4LDRA 3UWDA 1WETA 1VIAA 4OPMA 1TD9A 4BNDA 3D54D 4G5GA 1IM5A 4IR7A 3LC7O 1MQ8B 5EAIA 2ZYTX 1AXGA 3NX4A 1Z2NX 1OXKB 2PL5A 3U3KA 2B8TA 2BFPA 5F98A 5LOVF 4U63A 2C2WA 2Q27A 3GNQA 4ASUA 4AJLA 5FBRB 2JI8A 2V7TA 3EHEA 1G7CA 2P5SA 3TAUA 2YDYA 4H35A 2VRCA 2JHPA 3HO1A 2Q5EA 4MDHA 4DA0A 5ESWA 5DHAA 4BN0A 4UJ3A 2YN0A 2W43A 1SGWA 4ZOBA 5TNXA 4DLRA 4LDQA 1M8JA 3ZY5A 4YRPA 3QBJA 5CHEA 4B6OA 4P84A 2Q5HA 2Y2VA 5MGNA 2BR3A 1L1RA 3E3OA 3FKSA 3O2NA 4BC0A 1BHJA 4BZPA 1N7IA 2YNMC 4RGQA 5FTKA 4EKIA 1Y1TA 2XCSB 1GG5A 1Z4NA 2FLKA 2P30A 4N5HX 4QYTA 5JPCA 4G0VA 4CR8A 3WKDA 2ALJA 3IEUA 5FI1B 3PB3A 4I66A 1PWXA 4ADSG 1S2MA 1BH6A 1JWAB 1S0UA 3WGQA 4YN3A 4BWVA 4D4KA 1YFKA 4BWYA 1EJBA 4MV4A 2XKKA 3DE1X 4R0NA 1Z4IA 1XSEA 2YIVX 4E14A 1EUCB 2XYPA 2Z6VA 3ZGZA 3A4VA 2AX4A 3JQ6A 1L8OA 1D4FA 1L5ZA 2AN9A 4KXYA 4CEIA 3DZHA 3P19A 3K31A 2HKIA 4X6LA 4JLBA 3M6VA 1E2PA 1JG3A 1J7JA 1YR8A 4S1PA 1G8AA 1KSFX 2QJOA 7GPBA 3GBSA 4I3GA 3I2JA 4L4XA 5E9JA 2FN3A 3AJ8A 2AI1A 3PQ5A 3WLEA 3U60B 1AXEA 1M75A 5EHZA 5LQUA 5KNBH 1FFEA 1XTJA 2WW8A 1ZGBA 3RSHA 3L06A 1TIKA 5F5XA 2PHZA 4DZRA 4IMJB 2QXYA 1MA0A 1OXUA 4OGGA 4JSRA 2D2XA 3SIWA 1ZM2A 3BSYA 3KE8A 1VPWA 1J7KA 2VDUE 3UY4A 1ARZA 3CZCA 3IR6A 1AHPA 5DSTA 2NMVA 2OENG 4E31A 5KTSA 5FV7A 2JK0A 3JTEA 1NW3A 1XFDA 3UMVA 2B5OA 2CXSA 1FFWA 3DULA 4JVOA 5ILOA 3DFMA 1QS0A 3DJFA 5DF1A 2H2FA 4JBGA 5L3ZA 1X7XA 2FJPA 5ELXA 3G5LA 3Q3VA 3RS8A 4RAQA 3WTBA 1YA6A 2QTGA 4LHEA 1JWLA 3BHJA 1JG7A 5KMGB 1UEXC 1QHHB 1DNPA 1QORA 5SICE 3W06A 1T2UA 1P2UA 1Q20A 3L6UA 3DXZA 2DKFA 5CLLA 5JYBA 4LQLA 3IS3A 4UXIA 3ORRA 3LDHA 2O9JA 2NNLD 4IZHA 3UMFA 3P0RA 4B32A 1H23A 3IBGA 4ZHQF 5NLLA 5IYZA 2WY2D 2B25A 1J5EB 2VTKA 2KB0A 4LG1A 4O2RA 1PFKA 2ZYDA 1QMGA 3K9LA 2H59A 2QG4A 3A6DA 3KJFA 1XA3A 3QIVA 1OXSC 5F4BA 1D5WA 4KPUB 1D2CA 1KYYA 2ZI5A 1U80A 4I8DA 4UUNA 1E9VA 4J3NA 3ZLVA 1AO0A 3SOZA 3T3OA 3M5DA 2DERA 4BV9A 4CIAA 2ZWAA 3MEQA 4BL5A 3IIEA 1CZKA 1FVFA 2HJ9A 4BGEA 2G40A 4ZT5A 2RGRA 1ZOOA 2VJYA 1YIDA 1RT9A 1B2LA 5L45A 3CF4A 3OE7D 5K3FA 3EPHA 1R6AA 1VTKA 2VOJA 5FOWA 4XARA 1WULS 4A03A 1FXWF 5JRJA 1Y3CE 2L2QA 1YQ9A 2JZCA 3OWOA 1SQFA 3IWDB 5DGXA 2QU8A 5GIOE 4JLJA 3DCYA 1M2VA 4HFNA 3TVTA 2WHQA 4HAUA 4RKRA 4UCQA 2FPXA 1CNMA 4UC0A 4MUKA 3BAFA 1L0BA 4PXAA 1S96A 1Z6ZA 1NI3A 1YZLA 4GX5A 4Z5XA 3F78A 5TT1A 3U7FB 1T6XA 5IF9A 3AHFA 2I80A 3EDQA 3DMTC 2ZSFA 5ICFA 1Z39A 2HRBA 1NBMD 1GTRA 3BQNB 4GP7A 2JJYA