1H6DA

Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
383
structure length
383
Chain Sequence
QAATLPAGASQVPTTPAGRPMPYAIRPMPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
publication title Crystal Structures of the Precursor Form of Glucose-Fructose Oxidoreductase from Zymomonas Mobilis and its Complexes with Bound Ligands
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Protein translocation
total genus 126
structure length 383
sequence length 383
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2001-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h6dA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h6dA01
3CTMA 3RUFA 3TZCA 3V8BA 2E37A 1PU2A 1Z6ZA 1RKXA 2B83A 3H4VA 3OFSA 3RFVA 2GZ1A 4BNTA 3W8EA 4R3NA 1A27A 1EQ2A 2WMDA 1RM3A 2B4QA 3AY3A 1U7HA 4ALIA 2QYTA 2AE2A 4NK5A 4PIVA 2BGKA 4B8ZA 4QO8A 3ZHYA 1LQTA 1CF2O 5JFOA 2XOXA 4NQZA 5HA5A 1SMKA 4JROA 2Q1SA 1NQTA 3FHLA 2EKPA 3KEQA 2BFAA 3PHLA 2Q46A 4CQLB 4RVUA 1D3AA 4MKZA 1DXYA 1WP4A 3G49A 4JCOA 3WMXA 4PRLA 4D45A 1VSUA 2B36A 4FIZA 4II3A 1P31A 2EHDA 4N5NA 3A4VA 1P1HA 2VZ9A 3AUAA 1T1RA 3Q11A 2CMDA 5GY7A 4HKTA 3INGA 2AE1A 2P2SA 1DFIA 4NJMB 1SEVA 2WE7A 3KRTA 1IL0A 3H9JA 5TSDA 4R5HA 2JJYA 4JJGA 5AOVA 1DFHA 1J4AA 3TZHA 2DTEA 2X8LA 2NM0A 5JDIA 1ZUD1 2HMSA 4D46A 1NXQA 2GSDA 3GFGA 4OJNA 4XEHA 2PWZA 4FC7A 1D4FA 5ENVA 4EJ6A 4GVXA 3UH1A 4A5OA 3TFQA 3RJ9A 1FK8A 3AI1A 4WK6A 3ANMA 4BQRA 1QYWA 4ID9A 4PG7A 3UOGA 4LRTB 3E9MA 5TJ9A 3QP9A 1H94A 4W6ZA 4PZEA 1N7HA 1ADGA 2BD0A 2O2YA 3RIHA 2WDZA 3U4IA 1I2ZA 3S2FA 2HRZA 3DMTA 1OMOA 1UXIA 3GZNA 5I9NA 3WTCA 2C2YA 1NVGA 4MVJP 1DRWA 2Q2QA 5F1KA 3RD5A 3X2FA 4BV9A 3TF5A 2A4KA 3AFMA 2WEKA 1DJNA 2PKQO 3GQVA 3NJ8A 4JP3A 2DU8A 1DJQA 2V7PA 3S8MA 4BNLA 4INAA 4CR7A 2UDPA 1B14A 3HNPA 2J3IA 4YT5A 4MPDA 3JQGA 2I3AA 4DPMA 2GPTA 3WICA 4CR6A 1MUUA 1SC6A 1K89A 1NAHA 2DPGA 1O8CA 1EVYA 1KYQA 4GMFA 1SBYA 4PRKA 3F46A 6LDHA 1SAYA 3UAGA 1H6BA 4MJLA 3F47A 4IMRA 1L1FA 4BUCA 3UCFA 4CJXA 4CM7A 1PTJA 4RVGA 1DFGA 2E48A 1HT0A 2RHRA 4IIUA 1GZ6A 3MCVA 1BSVA 1WVGA 3ZV3A 4ZN6A 3BHJA 3TOZA 5FWNA 4CM3A 1EDZA 5AYVA 1DIAA 2VNSA 3NGLA 1A4IA 2LDBA 4AJ4A 8LDHA 2VYVA 3HUDA 2X9NA 5FF9A 2OMEA 1K2WA 3A06A 4OHUA 5IDWA 4EITA 1OFGA 5HWSA 3DBHA 1I2CA 4JJFA 1NM5A 4O1MA 1I0ZA 4OM8A 4H3VA 3TDKA 5J23A 2X6TA 3C7AA 4J4TA 1NP3A 4M54A 1X0XA 3INTA 4J3FA 1Z73A 1HEUA 5BNTA 5KWEA 3OEWA 7MDHA 3M2TA 4J9VA 3ZHXA 5ADHA 1Y7TA 2WE8A 2GRAA 4KWIA 3BXXA 3UKOA 1M66A 4H16A 4L8VA 1PWXA 4PLCA 3S55A 4KOAA 3AOGA 3P2YA 1R12A 3RC2A 4IXWA 1ISIA 5TGDA 4IQ8A 3D3WA 4NR0A 3MTGA 1HDZA 1T2CA 3GGGA 4WE3A 1H0KA 2YJZA 3WQQA 4DGSA 3PHJA 1Y1PA 3E8XA 4FOSA 4WECA 2AEJA 3RC1A 1ENPA 4DVJA 2C0CA 5KJFA 3PJDA 1HE4A 3Q0EA 1IB6A 4YACA 4BNUA 1DLJA 2CSUA 1CYDA 5EQFA 4JX8A 2PGJA 3Q3CA 2EG9A 1CWUA 4FR5A 4FDAA 3DONA 4O59O 4DQUA 4PZCA 4FW8A 4RZHA 1A71A 1NHGA 2BKAA 4EJ0A 1UXKA 1R37A 2JKVA 1YQGA 5F1PA 3F9IA 4ND4A 4DL9A 1HYHA 1ONOA 3OETA 1ZSYA 4R1SA 5JXWA 4OMUA 1I5RA 1KVRA 1LDEA 3G17A 3TPCA 3ZWAA 3GEDA 4BNIA 2D8AA 1I3MA 2JFFA 3LT1A 4YXFA 2FR8A 2B5VA 1YBAA 2VWPA 4XQGA 4YRDA 1N1GA 2VHWA 3DTTA 3RUDA 4FBGA 1CIVA 3GG2A 4L73A 2YV1A 4XGKA 3V2UA 3COSA 4WEQA 4OO3A 3WX0A 1KS9A 2Y93A 1FDWA 3RBXA 2RH4A 1Q1NA 4Y6PA 4YRAA 3D7LA 2OHXA 4MVJI 1BW9A 2E49A 1BRMA 2ZB8A 1AXEA 2NVBA 5JBIA 5JMWA 4MP8A 4TSKA 3U9LA 1H2HA 5JYEA 3DWFA 4W82A 2NU7A 1DIBA 4M87A 2O3TA 3X2EA 3L6OO 1C0PA 1ULUA 4TKMA 3FD8A 4I5GA 2DVMA 4YJGA 3QWFA 5FYDA 2Y0EA 4BO8A 4O6VA 1PL6A 4E5MA 4B3JA 4O63O 5EQDA 1PZHA 3RJ5A 4IY1A 1Y9AA 1NVMB 3JQDA 4XGNA 4YAEA 4GKVA 4BO5A 2NU9A 2AW5A 4I8XA 4I08A 4YJHA 3HB5X 3MZ0A 4R5MA 3JQ7B 4XB2A 3NEPX 5DCYA 1YE3A 3DZGA 1YBVA 4RF5A 1HETA 3EUWA 1X13A 3PWZA 1GCUA 1H2BA 5DN9A 1NWHA 4Z9FA 3WNQA 2PD6A 3ZV6A 1ZO8A 2YQ4A 4BGIA 4RVSA 2IZ0A 4YAKA 3QLJA 2CD9A 4OXKA 3U62A 3TL3A 4Z6KA 3O9ZA 1C1DA 3UVEA 3C8MA 2EXXA 1YOVB 4XQCA 2X4GA 4DC1A 3KSDO 3SEFA 1MGOA 4CMAA 2FPPA 3TRIA 1ZFNA 3NTOA 4J9UE 5LCXA 3TZKA 4HV4A 1I8TA 2O7QA 2Q4EA 3EC7A 4BMSA 5G2OA 3DFUA 2EF1A 3CKYA 1SNYA 2PK3A 4MKRA 2GGSA 1UXHA 3D64A 3L0DA 5B4UA 1UZNA 3PTZA 5G4KA 4DXHA 2G82A 4Q3EA 2OXIA 1E7QA 3ZWCA 2A9FA 5COAA 1RYDA 5ENDA 3P7MA 4FQ8A 4UVEA 2ET6A 1H93A 2FP4A 4JNKA 3TJRA 4M49A 3KVOA 4IJUA 2W2LD 2ZB7A 3BMCA 1NR1A 1T24A 3EMKA 1F17A 4WPGA 1XLTA 4GLLA 3TWOA 4A7PA 2O3SA 5IF3A 5JSFA 4HP8A 2O4CA 2IYOA 2Q45A 4NMHA 3WBFA 3O8QA 2HK9A 1SEPA 3IP3A 4RZIA 2J5KA 1N5DA 1DAOA 1HE3A 3RWBA 2VWGA 4XWYA 2BFMA 3OA0A 3GEGA 2EGGA 3SX2A 4AVYA 1I3NA 2ZB4A 5ITWA 2JD2A 5T73A 2E4AA 2O23A 2O3RA 3E48A 1NPDA 4RDIA 1LA2A 1UH5A 5F1OA 1V8BA 3SC4A 3WMWA 5KTKA 3CXRA 3ZWWA 1E3JA 4R16A 1E0DA 1YL7A 1M6HA 2BFOA 4BNGA 7ADHA 5DZSA 4K1LA 1YB1A 3BAZA 4D3DA 5L4SA 4ALJA 2I66A 1E7WA 2QX7A 5K9ZA 1ZJZA 4GWGA 1T4BA 3EW7A 4IGFA 3DOCA 2ZKLA 4NBUA 5CPBA 5KJ6A 1EQUA 1GYRA 3C24A 1XDWA 2VNAA 4WCFA 4YT8A 4QECA 5DP1A 1A9ZA 2UV8A 3FCOA 1EK5A 4DYVA 3KYBA 5G0UA 1U3VA 3JD2A 4CMBA 4HNHA 3GY0A 1MFZA 3CE6A 5JCXA 4N7RA 2V6BA 3WGOA 1N1EA 1ZKMA 3OA2A 1LSSA 1XIVA 2O3UA 4U7WA 1H9AA 1GDHA 3M2PA 4Q9NA 5G0VA 5AVOA 1UDCA 1DRUA 1FDUA 5H82A 1BVUA 5HS4A 1LQUA 2I65A 1EVZA 3Q1LA 1X0VA 4DQXA 4J0FA 4E12A 1GQQA 5AQ1A 1XR3A 4IQ0A 2A92A 1E3IA 3JV7A 5IFLA 3GN1A 2IODA 3E1KA 1VRWA 2YHIA 5EL0A 2HRBA 2IYPA 1M2WA 3ETDA 4BNVA 4QEDA 2QYSA 2WWRA 4FFOA 4RO0A 3IC5A 4CLXA 3GR6A 3S2GA 4XCVA 2YYYA 4CLRB 4YYZA 4ZQGA 4K28A 4AJLA 3I52A 5DCUA 3PLRA 2BELA 4YJFB 1EBFA 4EUEA 5JDCC 3MJEA 1JQBA 1VJTA 3VH2A 3H3JA 2OGUA 4GX1A 4CMEA 3NTQA 3TZQA 1ZEJA 1JTVA 1AN9A 1Q2XA 1EEHA 1Y8RB 2PH3A 3GNSA 3H9UA 3HFGA 3WNVA 2ZQZA 2XXBA 2AQ8A 3HDQA 3OHSX 2C5EA 5CG1A 3DXFA 3KBOA 3ICPA 5ICSA 2BRUA 4XQ9A 4FGWA 4CMKA 1YB5A 3T4EA 2OP0A 1N2SA 4CM8A 3PP8A 2WSBA 3U09A 1PJQA 4C7JA 1NFFA 1QLHA 2BI8A 3PGJA 4WLUA 1NFQA 4HFJA 2A94A 5BNIA 2GERA 4ZQFA 4E3ZA 1HZJA 3QVXA 4BGUA 1GQYA 4R54A 2QRJA 4ZGWA 2JL1A 2IZ1A 1R4MB 1EMDA 1I24A 2JAHA 4IS2A 3T4XA 4CM5A 1PS9A 2HJSA 1LLCA 2NV6A 2VHVA 3AUUA 1YQDA 3VPHA 2ZK7A 3CSDA 2JCVA 1HZZA 2H63A 4JLWA 5JY6A 2NU8A 4DBVO 4AJIA 2AG8A 2PZKA 2W90A 1Y8QA 3EAGA 1DIHA 5K6AA 3PHIA 1ADBA 3W1VA 3JQAA 1DO8A 1AE1A 3PHHA 1PL8A 3HJAA 4BHTA 4E31A 2UUPA 4ZICA 3GK3A 2NWQA 4BO7A 5A9SB 4PFJA 4D7AA 4P4NA 3WJ7A 4KTTE 1HSZA 4Z3DA 5B4VA 3B1FA 4OSPA 1YRLA 4YEDA 4E13A 1X15A 1UP6A 4YR9A 1X1EA 4HBGA 4F6CA 2O7SA 3R1IA 1QXSA 4HFRA 1BMDA 4XYEA 4ZRNA 2PKRA 3CEAA 3AI3A 4EGFA 5I9LA 5IJZA 5A4DA 2R00A 1IZ9A 3PDJA 3HDHA 3S2IA 4E2WA 1QYDA 1UJMA 2WD7A 4OKIA 4XR9A 4E5NA 3U4HA 3VDRA 1QLJA 1BWSA 1G0OA 1U3UA 2CFCA 3BTOA 5KOIA 5JYDA 9LDTA 5CG2A 3OF2A 1H6CA 3ZW9A 3BMNB 5JCJA 4BO1A 3QY9A 3D5QA 4TRNA 1A5ZA 4EBFA 4CM4B 5IAAA 2B4RO 3VOSA 2D3TA 4RLSA 1RYEA 4GKBA 4LISA 4WLNA 1BTOA 4PLGA 1ZIDA 2POQX 2XPCA 3D0OA 1QYVA 4O0LA 4YDRA 5KVSA 1ZK1A 3BMOB 3U0BA 5L9AA 2X5OA 1IPFA 1NQOA 3G1TA 3KLMX 5L7WA 5G0SA 3OMLA 2AEFA 3RFXA 4R51A 5CEJA 2JCYA 4WLFA 1PS8A 3G3EA 5U1PA 2DAPA 4FB5A 2UYYA 3DZJA 5F21A 5GMOA 5EMHA 2HAEA 4ND5A 1N9GB 4FFLA 3DZIA 3AOEA 4RORA 4XYMA 4BNMA 2Y1OA 1T2DA 2C29D 4QTZA 1MG0A 1I2BA 1R4NB 4BNHA 3PJGA 2EV9A 4LW8A 1XU9A 3BIOA 1C3VA 1Z7EA 2AHRA 4JQCA 1QR6A 3OJLA 4PLZA 2V6GA 4E2YA 4BMNA 2LDXA 4Q3DA 5L51A 1GL3A 2EW8A 3HFSA 3QVSA 1EUCA 3ZI0A 3M1LA 4BQPA 4D3FA 2EEZA 3M1AA 4UEOA 4D79A 1LEHA 4LVCA 2HMTA 3SBOA 2Y0DA 3WBBA 4YRBA 1G1AA 3IMFA 1K6IA 2DLDA 3ENNA 3V1UA 4RCVA 3H9EO 1YJ8A 1M6WA 2JD1A 1JA9A 3E5RA 1HLDA 4ZD6A 4CPDA 2AMFA 3L4BC 4CQMD 4OSOA 4KWHA 5I7FA 1ZK2A 1E3WB 1RPNA 1UDBA 2D5CA 1EE2A 3PVZA 1MFPA 5TLSA 1E7RA 2QHXA 2ZJ1A 1W4ZA 1ZK4A 2Y67A 3H2SA 4AJJA 3CMCO 3SJUA 4ROSA 3K2BA 1DHRA 1RM0A 2PY6A 3LQFA 5JPIA 4B7UA 3LLVA 3L6EA 2EJVA 3KETA 4XRRA 4P4GA 2C07A 4DMMA 2CNBA 1GY8A 1E5LA 4FJ1A 4R01A 3VHRA 3JYPA 4E5YA 5TRTA 3C1AA 1YO6A 3AU9A 3NDJA 4PLTA 1QV7A 3NT5A 1LRKA 2YUTA 2DQ4A 2PH5A 3JCZA 2NVUB 4CLOB 3AM4A 3AY6A 3NJ4A 1IHYA 5FFFA 4A03A 1KEVA 2VYNA 1OC2A 4IQGA 4BO2A 2X0JA 5ITVA 4YAJA 1MV8A 4TMFA 4IDFA 1PJ2A 3RKRA 2HJRA 2ZTMA 3VZRA 1P1RA 1XU7A 3ANNA 1TXGA 3UF0A 1WWKA 1KC3A 3RC7A 2RIRA 4YWJA 1VKNA 2ILTA 3WLEA 1MC5A 1KETA 3AFNA 3V1YA 4NHEA 4IGEA 3RASA 3MOIA 1F12A 4WOJA 3LU1A 2VZ0A 3FNFA 1KY5A 4A0SA 2D2IA 3DMYA 4S3MA 5ER9A 2YW9A 3OIFA 5TC4A 1JVBA 4DREA 5JO0A 3PYMA 2YV2A 3I3OA 4L9RA 2Q4BA 4UVHA 5U9CA 2O48X 5IN4A 2Q1UA 5BQFA 2PLAA 5DOVA 4IMPA 4J7CA 3ZGYA 1BXGA 1G6KA 3GC6A 1VL6A 5L4LA 1DPGA 4WNIA 2B37A 3IS3A 3K2EA 1V3VA 4OYRA 4CM9A 4AICA 1E1KA 3Q2IA 2B69A 5B37A 4RVDA 3PWSA 3DBRB 2UAGA 4DLLA 4NFHA 5A05A 2AA3A 3OH8A 4YT2A 4RL6A 3K31A 4DMLA 1YL5A 2XF8A 4KZPA 2AQIA 1AHHA 2WM3A 1C0KA 3H8VA 5IN5A 4C7KA 1PGOA 1YQXA 3JQCA 3RSHA 3OQBA 3W4KA 4BO9A 4GBJA 2EP7A 1MX3A 5CDUA 4R4JA 3PQDA 2GN4A 1GU7A 3IKTA 3ICCA 1V35A 2FPGA 5AXBA 2FZEA 2PZLA 1E3LA 1V0JA 3BTUA 4FFNA 2FOIA 2X9GA 3PWKA 4BKPA 3PLNA 3U4DA 2VQ3A 4J16A 5ER6A 1Q7BA 1TT5A 4LRSB 1DHTA 1PWZA 1W6UA 1AGNA 4I5EA 4UUOA 1U2GA 1IE3A 5EIOA 3ZU5A 4KTVE 4CLHA 2IRWA 2FSVA 3BTSA 3JQ8B 4DYDA 3GFBA 3HQ4O 4Y6SA 5JO9A 1PGNA 1U8FO 1R66A 5F5LA 2GN8A 3PHGA 3K92A 5J9GA 1ISMA 5EJ2A 1Y81A 3T7CA 3L07A 1PGQA 3VVBA 2BFPA 4LN1A 1HDGO 3ROPA 2FZWA 4IPTA 1YVEI 3OECA 1EUZA 3WXBA 4AL4A 2NQTA 4Y98A 3JQEA 1E5QA 4ZVVA 1OAAA 3AJRA 2J6IA 3PQEA 4OL9A 1EZ4A 1UP4A 3QW2A 4LGVA 1FDTA 3FRJA 4L74A 1LTHR 4NZ9A 3JQBC 4II2A 5MGBA 2EWMA 2G76A 1GPJA 3VTFA 3FWZA 2QQ5A 2JCXA 2GYYA 4BO0A 2VRCA 2AG5A 1J6UA 4F3YA 3DDNA 1X14A 4TRRA 2F00A 1KVSA 4P38A 1EK6A 2NTNA 5CDSA 1QRRA 4FPXA 3V2HA 4F46A 2NNLD 3IUSA 5M6DA 5CHEA 4XD2A 3KO8A 2RHCA 4UREA 4Q3NA 1CRWG 5JMPA 5JDCA 1A72A 3INRA 4L4RA 3MJSA 1NNUA 3MJ4A 1E6WA 3NV9A 4W4TA 4HY3A 3BMQA 1O89A 3SC6A 3LYLA 4BNNA 1NPYA 1WMBA 1MA0A 3KOUA 4AJ1A 1TLTA 2HSDA 2YV3A 4LCEA 1UP7A 1R16A 4JJIA 4CMIA 1NFRA 4XKJA 3BHMA 3DOJA 1LX6A 3DZKA 5THQA 3UN1A 1HRDA 4E4YA 1PEDA 2HUNA 2EIHA 3KEOA 3ROMA 2X5KO 4FN4A 3F4LA 1VE9A 4CQMB 3ETGA 4AG3A 4RPKA 2CZCA 3GPDG 1XELA 5I7EA 1B26A 2JAPA 2W8ZA 3FNHA 1UZMA 2AEMA 3BA1A 4QQRA 5DBFA 3W6ZA 2Y68A 4KP7A 4ITUA 1CJCA 4FJ2A 4OOEA 2DBRA 4R3WA 4ALMA 2VT3A 3GAFA 2J3HA 4YQYA 3H65A 1GEEA 3FBTA 3U49A 2JHFA 5HM8A 1GTMA 2AXQA 4A10A 3U5TA 4J4BA 3U4CA 3ZNNA 3ONEA 3D4OA 4F45A 4NDNE 1VC2A 1LDGA 4MIEA 3UUWA 2ZJ0A 4DA9A 3KXDA 3SLGA 1R15A 1ZXLA 1N7GA 1ZK0A 2G0TA 5COQA 3DTYA 2Y66A 4Y67A 3WGZA 3PZBA 1KY4A 3EZYA 2DBVO 2PV7A 3QIVA 4CL3A 3EZLA 1ADCA 1FDVA 2ZIZA 4OH1A 4GX5A 3LDHA 3UW3A 2OBNA 2EKQA 3OIDA 3RAJA 3EHEA 4L4SA 3AY7A 4D3SA 3GUCA 4L0QA 4U6SA 4KMSA 4N5LA 1WMAA 4W9NC 1OZAA 2F1KA 3GF4A 2ZB3A 1HYEA 3G1UA 4WJZA 1UR5A 2Q22A 1EDOA 1LLDA 3H9QA 4RLHA 4ALKA 2VYVD 4U6QA 4RVHA 1YS4A 1LSJA 1Q7CA 3GNTA 4RPGA 4CV1A 1YGYA 4CMCA 1JN0A 2Q2WA 1ONNA 2VTEA 2IEBA 4PGFA 1U28A 3RUCA 4XB1A 4AJNA 2DPHA 5IDXA 3QA9A 5CPFA 2IXBA 3GA0A 2P68A 3FBGA 3GGOA 1IYZA 3RROA 3RCBA 1JLLA 2ZCUA 1U8XX 2VOEA 1E7YA 4ZRMA 3C3XA 3CINA 1SO8A 4GL4A 3RUAA 2O3JA 2GN9A 1Z75A 3NT4A 2B5WA 1A7KA 4XYGA 3OQ6A 4OXYA 1C1XB 3ZNQA 1VM6A 1E6EA 4UUMA 4JBHA 4R1TA 4MVJG 2SCUA 3DBLA 2GASA 3JQFC 4B4VA 4QFCA 5T8KA 3DAFA 2QW8A 1LRLA 3TL2A 4XYLA 4JBIA 4P4LA 1PQPA 3O26A 2I6TA 3P5SA 2IZZA 5KVCA 2C5AA 2JD0A 1PJCA 3VZPA 1KBZA 4J1QA 2A35A 3GDFA 3MJVA 2VTDA 3EY4A 3Q9UA 3KYCA 1C0IA 1T26A 4BO6A 4WNCA 4BS9A 3EGOA 4XDYA 2X23A 1D1SA 5I8WA 1NBOA 1ZNQO 3B20A 3ZV5A 4MIOA 2FRDA 1LBEA 2D4AA 1WW8A 3VPGA 4BMVA 4IDEA 5A5EA 2Y05A 1YXMA 2O3QA 4WOKA 2DFVA 3HG7A 4FS3A 3GH3A 4CLDA 4Y9DA 1R0LA 1NASA 2DM6A 2W2KA 2PZMA 2X58A 3ULKA 4E21A 3GGPA 3AWDA 2VHYA 3CPSA 5EN4A 1PJ4A 3DEYX 4HFNA 4BV8A 4J49A 1KVUA 2GO1A 2Z5LA 4NIMA 1QSGA 2OBYA 2X9VA 4XZ3A 5MDHA 3D5TA 2VUTA 1EBUA 1B16A 1E92A 2DBQA 4X54A 2ZCVA 4IDGA 4XYBA 5JYFA 4Y6RA 3DZHA 2PNFA 2O50A 1J5PA 2ZQYA 3WG9A 2VHZA 3S2EA 1ZSVA 3I9LA 5EINA 2X5JO 2C82A 3D3EA 1NQ5A 1HTBA 2GF2A 2H5LA 4I9UA 3VDQA 3W6UA 5FEUA 4CLOA 5LDGA 4OXNA 1GV0A 1W73A 4R68A 1ISHA 1RM4A 2YDYA 4IDDA 4OAQA 1GFSA 5JDIC 3FI9A 1VPDA 5JY1A 3RBZA 3WQRA 3KZVA 3IQDB 3ZWBA 3I9NA 4YCAA 1K3TA 1NWCA 2X0IA 2Q1WA 5CP8A 4NPCA 2EGHA 3WFJA 4AJKA 1H5QA 4CQLA 1B2LA 1K0UA 2YY7A 3JD0A 3NAQA 1RJWA 3B1JA 4J2OA 4LVUA 3DAPA 1F8GA 5TX7A 4EJMA 4BL5A 3VTZA 5C5IA 1YH3A 3K6JA 4NBTA 3RKUA 1O5IA 1DBVO 5A3VA 3F6YA 3MWEB 4Q3CA 2Q2VA 1W8DA 5KVVA 2AQHA 4PVCA 4NJMA 4XIYA 1F0YA 5BNFA 3ZNPA 4H15A 3QVOA 1VKOA 3DMTC 5A06A 3RUHA 1Z7BA 3PPIA 3WSWA 1MXHA 5TJHA 4J43A 4N5MA 4ZA2A 3DQPA 3TFOA 3VVCA 4NU5A 4G5HA 3MWDB 3WGYA 3H2ZA 4TVBA 4B4UA 4YA6A 3K30A 1PIWA 2WYUA 1LXCA 2I9PA 3GZNB 4M55A 4MIYA 3CZMA 4XA8A 4QXMA 2Q3EA 3B6ZA 2GZ3A 1B3BA 2HCTA 1QKIA 1GR0A 3WYCA 3STHA 1LDYA 4LCJA 5DNAA 3KB6A 1ORRA 1E7SA 1H6DA 1PQUA 1IPEA 5BSHA 3LVFO 2DT5A 1ENYA 3WB9A 4AJHA 2OZPA 5DBGA 1D1TA 1KEUA 5TIIA 3JSAA 2JFGA 5A3JA 1JVSA 4J1TA 4M89A 5TT1A 3JQGB 3ZN2A 4ILKA 1XGKA 3K73O 3WGQA 2B4TO 4GSKA 3GPIA 4BKQA 4HXYA 4IUYA 4P8RA 2VUUA 4OQYA 5T6BA 1E3SA 1YJQA 4FFRA 5F5NA 2NVWA 1LSOA 2JFHA 1KEWA 5TQVA 1PJTA 3JQ8A 5JAMA 4J0EA 2VWQA 1QP8A 4PLPA 3W8FA 1NHWA 4YPOA 3DZFA 3LC2O 3WLFA 4BB5A 4NJOA 3H9GA 1NPTO 2DTDA 5T64A 4RJTA 2OL4A 1C0LA 2C20A 1V6AA 3RI3A 1ISFA 3DBHB 5CEEA 1YBMA 4YAIA 3FF4A 5I8ZA 1ZK3A 4WKGA 5DOZA 3GMDA 4O5OA 1HLPA 5BSGA 3D1LA 3P2OA 1XWFA 4WGGA 4ZJUA 3FNGA 4JXKA 1CERA 3BTVA 1BVRA 1FDSA 1GEGA 1U1IA 2VZ8A 2QZ9A 2ZTUA 3GVIA 1LRJA 1VL8A 4OQZA 3O03A 3QWAA 4TQGA 2NLOA 3QE3A 4BNKA 3FR7A 1YKFA 1IHXA 3QVWA 3CUKA 1UZLA 4BNXA 4MVJE 4Z0TA 1BDMA 1XEAA 3WYBA 4W7IA 1R0KA 3NKLA 4AJOA 1XQ6A 1DIRA 5JAZA 3D3WB 4ALLA 4YJDA 5LC1A 3NRCA 3HSKA 3UXYA 3W8DA 4XX0A 3RUEA 4R9SA 2HLPA 1J0XO 1DC4A 4Q39A 5AXAA 3A1NA 5I9MA 1JDJA 4MVJA 3ADPA 2X22A 4GGOA 4UVDA 3RQSA 4AJ2A 3LT4A 4G65A 4CV0A 4CODB 4TROA 4NBVA 2G1UA 1GUZA 1HF3A 1U4OA 5HRUA 3LSYA 2BHLA 3JYNA 3ROKA 4L4XA 1HDRA 1GYPA 3OJOA 2CVZA 3ONFA 4CV3A 1FXSA 1LJ8A 4DRYA 3PFFA 3IOYA 2FWMX 3FNEA 1QYCA 4YVFA 1L7EA 1HYGA 2CF6A 5JYAA 4DLAA 3CMMA 2VT2A 2BF7A 1GZ4A 3HDYA 3VPSA 4WLVA 2BH9A 1ML3A 4MDHA 5DULA 4TRMA 1U4SA 2IEDA 2DUWA 4BOYA 2P9EA 2Y99A 3FTNA 2R2GA 1FMCA 2ZTLA 5FI5A 3ZCXA 5H81A 5TS3A 3UICA 4CUZA 3WFIA 4LMPA 1JAXA 3ZHBA 4R1UA 2YDXA 4RF2A 2PZJA 1Z74A 4I9HA 4TZTA 1Z82A 2ZTVA 3GG9A 2QRLA 4NNJA 4BNWA 3GHHA 3JQ9C 3FPLA 4PLHA 1UXGA 1DB3A 1DLIA 2VWHA 3DO5A 2FHSA 1CQJA 3LK7A 1SZJG 1JKFA 2HMVA 1P1KA 5A5FA 1DC3A 1U5AA 3OJEA 4PLWA 2WD8A 4YJGB 1MC4A 3EVNA 3IJPA 5I7SA 3TZ6A 1ADFA 2Q1TA 2D5AA 3LT2A 4UEKA 1XKQA 2CDAA 3HDJA 5DCWA 2VHXA 1XA0A 3WTBA 4ALNA 1PS0A 5FI3A 4EZBA 4NU6A 3GDGA 3IUPA 4IIVA 4W9NA 4PLFA 4YJHB 1PR3A 3ABIA 3C7CB 3WIDA 2WYWA 4QX6A 1Q0QA 2HK8A 3Q6IA 5KKCA 3TSCA 3WGHA 1JKJA 3ST7A 4EUFA 3GLQA 2ZYDA 4I1IA 4UVIA 4J2HA 5B1YA 3KYDB 4QFDA 1U5CA 4B79A 3JQAD 1XYGA 4YB8A 3Q9NA 2H6EA 4YTEA 2PTGA 1C1DB 2RH8A 3E6AA 2EP5A 2GN6A 3W4JA 4B7CA 6ADHA 1JWAB 3QSGA 4A73A 3JQ7A 4KQXA 1CDOA 1LU9A 5G4LA 1WDLA 5L4NA 3R3SA 5GZ6A 3QRWA 5AXDA 1GQ2A 4DBZA 3GT0A 3R3JA 3WDSA 4QT0A 1PJ3A 1WDMA 2PGLA 5G4KB 5JS6A 5DT9A 3F1LA 3A9WA 2YFQA 1LI4A 1YOVA 3GNQA 1XSEA 5L7YA 4NG5A 1WNTA 1IZ0A 2VUSA 3RBVA 2X86A 4QSMA 2X0RA 3VPFA 3I6QA 1U3WA 3GEMA 3PRJA 3OQ1A 1IY8A 1WLYA 2FMUA 3BMCB 4FCCA 4CLEA 4K6FA 4ZHSA 3KTDA 1ZH8A 1ZBQA 4R41A 1HDOA 5JCJD 4XGIA 2CDCA 2GD1O 4KUGA 3E9NA 5JNLA 1T4DA 3O8QB 2JHGA 3A14A 1VJ1A 3SXPA 4Z9XA 2OFPA 3GUYA 3LT0A 3DHNA 4M8SA 5U4QA 1T25A 4E2ZA 2Y1GA 4NH4A 4C4OA 5JC1A 4YQZA 4NI5A 5IZCC 2P5YA 2NACA 1KEPA 3DL2A 1GV1A 3JYQA 4E32A 1M75A 2I67A 3DZBA 3U3XA 1PR9A 3IP1A 3LC7O 5A9TA 5CEFA 4MOWA 1E1NA 1O95A 2TMDA 3GRPA 4W99A 4HX5A 3RUIA 3WSVA 1JAYA 4WCFC 1H6AA 5L53A 1ZMOA 1JU9A 3PJFA 5BSEA 2DBZA 1QG6A 3F5SA 5EERA 1ENOA 4GAEA 4H7PA 1IULA 3OBBA 2I99A 4Q3AA 3VKVA 1SPXA 1KVTA 4GPD1 3NDRA 3S1LA 3ASVA 1Y9EA 4WCFB 3MTJA 1ISGA 4BGEA 5L7TA 4DIBA 1GUYA 4PG6A 4LK3A 3OJ0A 5EPOA 3GHYA 8ADHA 1QMGA 1PQWA 2FR0A 4KUHA 1ZCJA 5HBRA 3WWZA 4XIJA 4M86A 2P4QA 2PKQP 5KJEA 1GYQA 1WAMA 1V3TA 2UVDA 2BGLA 3LF1A 4EW6A 1G0NA 3GDOA 1E77A 1ONPA 2NTJA 4JIGA 3BHIA 1UUFA 3AW9A 4N18A 4N54A 1DDOA 4BNJA 1WZIA 4WLOA 4JN6B 1WXDA 4CMGA 3H5RA 3C7DB 3Q2KA 5HTOA 3V2GA 2Z95A 2NUAA 5COBA 3I5MA 1HDCA 3I9OA 1I3KA 2WTBA 2YHIB 3DR3A 4BO3A 1ISJA 1LC3A 3QQPA 5A1TA 1DC6A 3PFWO 3JD3A 4CMEC 5BR7A 1HSOA 2V6MA 3OSUA 4MP6A 1EVIA 4GGPA 1I10A 4DQVA 2FPIA 4DIFA 3FPCA 5BSFA 2X1HA 2PD4A 3F5QA 1EVJA 1S7CA 4K26A 4IS3A 1PGPA 2VYND 3C1TA 1UXJA 3B1KA 4WUVA 5EESA 5I7VA 3PXXA 1TEHA 3UCEA 1K6XA 3N58A 4IZIA 4OKNA 1RWBA 1T1SA 4Z0PA 5K0ZA 3DC2A 3JQ6A 1RM5A 4E5KA 4CLRA 2FR1A 4D43A 4D42A 3ORFA 3VH3A 3AM5A 4Q3BA 3ZWVA 4YJFA 4CM8B 1JW9B 5KKAA 1XCBA 4DTIA 3WYEA 3HE3A 3ZH2A 2ZYGA 3RU9A 5LDHA 2YFHA 1YDEA 1EE9A 1IOLA 1Y8RA 2IDZA 3PQFA 4FSHA 5JC8A 4L75A 4WLEA 3ZW8A 4ND2A 3ADOA 1E1MA 4BNFA 1ZMTA 4I5DA 4BKRA 4BNYA 4FFPA 1H9BA 3WOHA 1P0CA 2W4QA 4TZKA 1BXKA 1B3RA 3JD1A 3VKUA 1U7TA 4W7HA 4AJPA 4CM9D 2AQKA 3ETEA 2PGDA 2EW2A 2H1SA 2Q99A 1JWBB 3BYZA 3I1JA 1DAPA 3K8ZA 5K6AC 4GWKA 1GZ3A 1A9YA 4CMHA 1MLDA 1YB4A 3AU8A 3P19A 3QHAA 4EEXA 3SLKA 4MP3A 3PGXA 4TRJA 1Q0LA 5CDYA 1QYXA 5KVQA 1U3TA 1Y8QB 2E82A 1I01A 2UUOA 3C85A 3GVCA 3B70A 3JQAB 4NBRA 2J3JA 1A7AA 2XXJA 1R4MA 2P5UA 2ZYAA 5JAIA 3DBVO 3WWYA 1P3DA 2DKNA 3KSUA 4B3IA 3SJ7A 2WJPA 3HB4X 4KQWA 3K5PA 4RGBA 3L6DA 1B15A 4GQAA 3MEQA 3ZDFA 4UAGA 5T67A 3WQSB 1XG5A 1YONA 1T2FA 5F3RA 4UEJA 2R00C 3EK2A 4IDAA 2EERA 2X7HA 4QO7A 1ZSNA 3VZQA 2P9GA 4J1SA 3PJEA 1C14A 3DB2A 3NTRA 4E2XA 4MVJH 4P22A 1JKIA 1P9LA 2ZATA 3I4CA 3UFXA 4PLVA 2WD7B 5A9SA 4DLBA 4JBGA 1MP0A 3OICA 5L45A 3IKVA 1HWYA 4CR8A 4IBOA 4BVAA 2DTXA 4DIOA 1B8PA 4PCVA 1PX0A 4S1VA 5AXCA 1KIFA 4NFSA 3E03A 2YHUA 4ND1A 5JE8A 4Z3KA 2GNAA 3AI2A 5C37A 5JW6A 4XJSA 1W0CA 3KUXA 2QIOA 3D4PA 3RU7A 4R69A 4QUKA 4BIIA 3AUSA 3DFZA 2NU6A 4ZQBA 1NQAO 4OGWA 2FSSA 2W2LA 2C7VA 1SOWA 3AOEC 1O9BA 1SOVA 4EUHA 4JP2A 3K9QO 4UUPA 2QZZA 2V6FA 2VRCD 3VH4A 4IJWA 3BMNA 3G0OA 2BI7A 3KSZO 4E0BA 4CM4A 1ARZA 3I83A 3SVTA 1DIGA 3QWHA 4RF3A 2C59A 1ZVMA 2YQ5A 4GX0A 4MVJF 1EFKA 3H5AA 4JK3A 5G0WA 4FFMA 1PJBA 3GMSA 3NGXA 3VZSA 3ENKA 4IZHA 3BMOA 4CUKA 3KLPX 2BLLA 1X7GA 5TNXA 1GPDG 4B4OA 4F6LA 3GZ4A 1Q7GA 4CL8A 4MVJM 1DEHA 1I32A 2Y1CA 4RV9A 3E9QA 5C3MA 1DSSG 3VPXA 4HUJA 4AJEA 2GDZA 1BDBA 3JQ9A 2TMGA 1N9GA 1BXZA 2DFDA 4G2NA 1M67A 1SB8A 3I9MA 4A27A 4DPLA 2X0NA 1LDNA 1R4NA 1WZEA 2PFGA 4G81A 1BHSA 1PL7A 3FWNA 5JLAA 3GOHA 1DOHA 3WGIA 3HZZA 2QRKA 2YZ7A 3ZU2A 4GSLA 5HS6A 1LSUA 1KOLA 2C2XA 2IXAA 4GMGA 1OBFO 1OI7A 1GADO 2DUUA 3NYWA 2VCYA 5CAEA 5TT0A 4XDZA 3JYOA 4B7XA 1DRVA 5L95A 4ZU3A 4DC0A 3LC1O 3ZU3A 3WGGA 1BGVA 1Y5RA 1P1FA 1CQIA 3TN7A 3QVTA 2Y1DA 1PZGA 1NVTA 2FN7A 4YBZA 4BKOA 3QV1A 2C54A 3KYDA 1T2AA 4BGVA 1L7DA 1LDMA 2NTVA 3NUGA 1F8FA 3ZWXA 1E3WA 3LF2A 2FY8A 2OP1A 3I4FA 4RQTA 4EI2A 3AK4A 9LDBA 3L9XA 3O38A 3TNLA 2RBEA 2RCYA 3OEYA 3E18A 1P1JA 1PGJA 3L4BA 1M76A 3V1TC 2B0JA 1VSVA 1MG5A 1HE2A 2CVOA 2BMAA 1NX6A 5DDIP 5CDTA 3ANLA 5KJ1A 2HMUA 2NQ8A 3HN2A 2P91A 1KC1A 1GD1O 4HADA 1I36A 2D0IA 3N74A 4BO4A 3HHPA 1B8VA 2PR2A 3ZU4A 2NVUA 3IJRA 5C7IO 5TF4A 1AHIA 4KDEA 3EVTA 3GVXA 5GZ1A 3VH1A 4FGSA 5ES3A 4UVGA 5ILGA 1MB4A 3I9KA 1GAEO 2WYVA 2PD3A 4J7UA 4WEOA 2Y1EA 3EDMA 1TT7A 1YDWA 1SB9A 1O0SA 3FR8A 1CEQA 2DC1A 3RVDA 1BXGB 2QG4A 4J7XA 1V9LA 3ZWYA 3ITDA 2I5PO 1PJLA 4KDFA 1WDKA 1ULSA 2OUIA 2CY0A 4WCDA 4GLOA 3L77A 3ZHZA 4NBWA 4B8WA 2O4UX 4LMRA 3JYLA 4J6FA 3FN4A 4ZQEA 4B4WA 4YT4A 5IZCA 4CM6A 2Y1FA 2NSDA 4URFA 2I3GA 4EEZA 3AUTA 1TVEA 4JGBA 3KM0A 1X7HA 2J5RA 2D1YA 3OIGA 3FTPA 2HDHA 3DBRA 1CETA 4HNGA 1F14A 4RQUA 2H9IA 4M1QA 3HN7A 4R9RA 3JTMA 4MINA 4ONEA 2EKLA 3AM3A 4IDBA 2Z1NA 2IE0A 3F1KA 3QWBA 1TT5B 5CFZA 4E5PA 1TB4A 4D44A 4FC6A 3QWIA 3WGTA 3PYLA 1PZEA 2V65A 3TQHA 5G0TA 2GZ2A 1P77A 2EJWA 4U0KA 1N92A 4OIMA 1PZFA 3PIDA 5A04A 5IXYA 1P1IA 3RC9A 5KNLA 3DOOA 1K5HA 1ZXBA 4LSWA 1I3LA 4RPJA 1LUAA 4ND3A 4XR4A 1AUPA 4D41A 3DHEA 4EYEA 1PJSA 4NFYA 1TA4A 1FF9A 5A03A 4RDHA 4CUJA 2GUGA 3H3FA 4IDCA 4WASA 4HWKA 3L4SO 1AXGA 1QV6A 1Y6JA 2VOJA 2HQ1A 4R1NA 1I33A 2W98A 1P44A 1OC4A 4UULA 5THKA 3PZRA 3OM9A 2Q49A 1R0SA 1NR7A 2J8ZA 3PI7A 3IIEA 2OO5A 5IZ4A 4J4HA 3HWRA 2HO5A 5L3ZA 3H6KA 2R6JA 4FD3A 1NAIA 3WIEA 1HL3A 5KIAA 4MO2A 3ZZNA 1HDXA 2P4HX 4BKUA 2HU2A 4ZQHA 1EUDA 5CDGA 1ENZA 2J3KA 4OOFA 3GN2A 1T2EA 3NT2A 1IUKA 2C7GA 4I5FA 3L9WA 3WR5A 5KCZA 1HDYA 5ILOA 3V5NA 2HK7A 3JD4A 3T7EA 4EDFA 1A4UA 1KERA 1U9JA 3WS7A 1E7MA 3BMQB 1PSDA 4Y8VA 4E33A 3ON5A 3DAGA 4IM7A 4NK4A 4UUNA 3A28A 2CF5A 4U8GA 1O94A 3CZRA 1LLUA 1XQ1A 4IJKA 4RF4A 5T57A 4D0SA 3I23A 3DHYA 3PK0A 5KJCA 3JQBA 2VRBA 1ZEMA 4RVFA 3GVHA 1E3EA 4CMIB 5GZ3A 3ZWMA 2D59A 1B8UA 1OOEA 1U2DA 3CIFA 1GUFA 1UAYA 3GRKA 5C7LO 5DF1A 1HE5A 1ZZEA 4TKLA 1P33A 2HMWA 3R6DA 4CV2A 3ASUA 1YL6A 3G79A 4CM1A 1N8KA 1F06A 2CVQA 1UDAA 1FJHA 1I30A 3K96A 4GX2A 3M6IA 1XHLA 3F3SA 5H83A 1X1TA 4XRGA 1EFLA 3WJAA 4RPLA 3PIIA 5L40A 2B35A 1X7DA 2RAFA 1HXHA 2PA3A 5IDYA 4YAGA 1D8AA 3PDUA 3IL2A 3GVPA 3I6IA 3PEFA 1O6ZA 4CQMA 3LLSA 3MJTA 3CH6A 3F4BA 3QJ5A 4A26A 4GI2A 1Z45A 1E1LA 3NDIA 1S6YA 1ID1A 3UGKA 3ZV4A 3ZWNA 1DC5A 1QORA 4PG5A 4FOOA 4ESOA 1K6JA 2G17A 5IDQA 4TWRA 1LDBA 5JAQA 3R0IA 1BG6A 3KV3O 4HFMA 2P9CA 1P45A 1ZJYA 3I9JA 4Z9YA 4DWVA 2BGMA 3ZNOA 5IXSA 1LLQA 3O4RA 4XJTA 1KVQA 1E6UA 1TI7A 2XAAA 3ITKA 3GAZA 3TOXA 3UCXA 3W4IA 4CMJA 4PLYA 2I76A 4TVOA 1BW9B 2CDBA 1YWGO 1NYTA 4AFNA 1MXFA 2GR9A 2G5CA 5A02A 4U5QA 1P74A 3EYWA 3OJFA 3BZUA 3ROQA 5B12A 4K6CA 5C7OO 4MKXA 2CUKA 1J49A 3ZWPA 4K9DA 1GCOA 1B0AA 1HKUA 3RFTA 4Z0HO 1V3UA 4E6PA 3H7AA 4RPHA 2Q50A 3C1OA 4BB6A 4GVLA 5DBIA 2Z1MA 4PZDA 4PN3A 1LC0A 3D4NA 4FJ0A 5T8KC 2NADA 4D0RA 1NTOA 2VN8A 1Y5MA 5T5QA 3PYXA 1ZW1A 4IJVA 4IINA 2Y0CA 1SCUA 2E6UX 3LZ6A 2HKIA 3DBLB 2OORA 4B3HA 1R6DA 4U0JA 3E82A 3H5NA 3FSRA 3UHAA 1VL0A 1UAGA 3IDSA 1VLLA 2O2SA 3VC7A 4BNZA 1D7OA 2GLXA 4J90A 4DUPA 5DP2A 3MOGA 3ONDA 4MVJD 3KYCB 1C1XA 1WPQA 5B4TA 4DPKA 3E5MA 2J5QA 4J91A 3OP4A 5A9RA 4I9NA 4PG8A 3IAHA 3MJCA 1P0FA 1B7GO 4LSMA 1LNQA 4KUEA 1Q0HA 3KHUA 4PG4A 1VI2A 2OOSA 5BT9A 4E30A 4L76A 2W2KB 3HADA 4IXTA 3ZWOA 3JQFA 4PVDA 3N7UA 2GCGA 3NX4A 1VJ0A 4A2CA 5IG2A 3VAZA 4XQEA 4GH5A 4J1NA 5ICMA
chains in the Genus database with same CATH superfamily
5ARBA 3RUFA 3T3IA 3TOSA 5PNTA 3TZCA 5HZKA 2E37A 3EN0A 3IPXA 3UT5A 2ZIXB 1Z26A 3DNFA 4QODA 5TMBA 3IEMA 3BHNA 3SJZA 5FNVF 2IY9A 3CVXA 4R3NA 1ILWA 2WMDA 4KWCA 1B41A 2B92A 3AY3A 3MPUA 3KDSE 5DGXA 5AHRA 5CFOA 1CUWA 3CB4A 4R2MA 3T1TA 3O8DA 2ONKA 4GS5A 1IHOA 3EC2A 4NK5A 1DQSA 1WMSA 1JG4A 2L2QA 3USES 2ISCA 5LXTF 2OBBA 4B8ZA 1XRPA 1AMNA 1P6UA 2OHGA 3TTSA 2XGMA 1LQTA 1QHNA 4OXQA 2XOXA 5J47A 3HI6A 5D00A 2Q1SA 4DVJA 4XGRA 1NQTA 3OVMA 3FHLA 1WULS 2AG6A 2BFAA 4G07A 2VJOA 3ZX4A 4RVUA 1M1YE 1MR3F 5EJ4A 4G5YA 4JCOA 4PRLA 3ETCA 3GRRA 3VI4B 1UOQA 4QDTA 1U0GA 1KOLA 3OF3A 2ZETA 5KCMA 4J2TA 2PZEA 2CNOA 2CUZA 7YASA 3EZ9A 2EHDA 2N47A 4NARA 3PF9A 4CKWA 2VZ9A 2P1ZA 3PC2A 1SHKA 3LDFA 1TM4E 3VYVA 5FXMA 3CF4A 2HRQA 1TC2A 2X3FA 5F73A 4TLLB 3INGA 2V3VA 2YJNA 4O2BA 5DTEA 1KYXA 2WE7A 3KRTA 1YS7A 3H9JA 4HD8A 3RWOA 5AOVA 4R8LA 4AWXA 4D2IA 1B6GA 1M1YA 2DP4E 2J9RA 2DTEA 4ENQA 1C2YA 2YS6A 5FDFA 1CBUA 1OZFA 1ZUD1 2Q0QA 2BMJA 4FONA 2GSDA 2VRNA 4OJNA 4TZ6A 1XYYA 3AF1A 2X9QA 4ZI2A 5HM6A 4TM8A 3BK7A 1R6VA 5BURA 3M5DA 1SCBA 4Y2JA 3LUJA 4V1CB 3ANMA 5T4BA 1ZD2P 1CZNA 4IXNA 4BQRA 1E3QA 1FL9A 3BB3A 3ZVNA 4PG7A 2QGNA 1I7BB 3UOGA 2Z6AA 2UYGA 3QU7A 1SBHA 2PFKA 2OSBA 4RH0A 2H08A 3E9MA 2KM1A 2QGZA 3KVVA 3IUQA 3DF9A 4EK9A 2BVNA 1ADGA 3S0JA 4QBKA 3SE7A 1JFFA 3I32A 1DKLA 2HWWA 2H2FA 2YWRA 3L40A 5AW7A 3RIHA 1OFVA 1O58A 1ZQ9A 2WDZA 4MUBA 2KE5A 1YULA 3L84A 5BNWA 2JANA 1Y4AE 4CDGA 3S2FA 3K8OE 2HRZA 3KZKA 4B6EA 3QFRA 1QPZA 1JDBC 1N2ZA 4CIXA 2C2YA 1NVGA 2Q2QA 1RMQA 1GGKA 3E2PA 4FQ7A 4NCIA 1YC5A 5F1KA 3X2FA 4Q6WA 4EELA 2OKGA 4BV9A 1SKBA 3HYNA 3AFMA 5GWXA 3NJ8A 4H6VA 4B6SA 1MPXA 2INGX 1RT9A 4O3FA 6Q21A 3S8MA 2HA7A 5AOBA 4INAA 1GCAA 2QJWA 2JZCA 1KAMA 4UUBA 3HNPA 2J3IA 3EFBA 4EKNB 1T8RA 2C9OA 1MB9A 3JQGA 2VXBA 3GXBA 4H1UA 4ZDKA 1FYEA 2ZJ2A 3OX1A 1IEWA 4PRKA 1NAHA 2DPGA 1EVYA 4GMFA 2WTUA 1AK1A 2WUDA 3IVCA 6LDHA 1QHHB 1SAYA 1U7ZA 2CUNA 1NGSA 2F3PA 3UAGA 3DXYA 1GAJA 3F47A 4QGAA 2FSIA 2NQ2C 4BUCA 3IAEA 5JXJA 3G5TA 5E95A 1IWBB 2FFBA 2P7IA 4Q24A 4WOPA 4P54A 4CM7A 4MZDA 5JBNA 3AL0C 1OY1A 3TW0A 4RVGA 1DFGA 2E48A 2RHRA 4IIUA 2XAUA 1A9QA 3MNFA 1BSVA 1ZRSA 2XA1A 3GJTA 2P65A 3NFRA 4U8HA 2UXBB 3BHJA 3LPCA 4C9BA 1NXOA 5FWNA 3I6MA 1JE0A 2Y9PB 2BHTA 2E6KA 4AMBA 4AJ4A 4Z99A 3WLJA 3G59A 1YIAA 4RPCA 3UANA 3D8HA 2R44A 2I2BA 3HV0A 1UINA 1F0NA 3FE2A 3PEEA 2OMEA 1K2WA 1ZP6A 1GTG1 1MAHA 1PCXA 2V7BA 2YICA 4ZO4A 5HJEA 1CFJA 1RYBA 2CE2X 2O8BB 2WJGA 3DBHA 4NCJA 1CB7A 1NM5A 3SSNA 3ZW7A 4CTJA 1WHTA 3DVAB 1QG2A 1WLSA 2P3QA 3BXFA 2IPOA 2WVAA 3JAWB 5H70A 2JVKA 3ECSA 4YXWD 5DNUA 1USWA 1IMJA 4KYIB 3H2GA 1NP3A 3AHDA 5JO9A 4J3FA 1S1CA 2XB2A 2CW5A 4JR0A 3PKZA 2BL4A 1T0PA 3M2TA 2DQSA 3ZHXA 3RYIA 1ZN7A 3CE9A 3EZGA 4LJ5A 2GRAA 4TTJA 2ADMA 2D13A 5C8XA 1U6KA 2PT6A 3W2FA 3FOAA 4PLCA 1PUXA 2I29A 1NQXA 3OX4A 5E6SB 4QUEA 2IHZA 1S2NA 2HRCA 1L5WA 4LYGA 5IUJC 3RC2A 1MJNA 2IITA 3LYAA 4Y2XA 1JEAA 1XD2B 3SQMA 4NR0A 4IOKA 4L5JA 3LV8A 3RVSA 1H5UA 1VMAA 4Q7MB 2PPVA 3GGGA 3A1TA 4Q4HA 3EPJA 4KE8A 2IHUA 5GPBA 3C3JA 3LUDA 1UJ5A 1I0IA 1SUDA 1PWHA 3BRCA 4M1ZA 3T0FA 3I64A 1QNLA 1JHPA 1AKMA 1S4MA 2AEJA 3ADKA 3RC1A 2FDXA 1DTWA 1YQEA 2CNWA 2PSHA 4G23A 4OLHA 3LPAA 4PCAA 4QU8A 5FKJA 5HE8A 5SYAA 1JVNA 4JH0A 3X1KA 1EXVA 3W04A 5KJFA 3P9XA 4D1YA 1MO4A 4YACA 1GFWA 3IAUA 3H8JA 5I4IA 3E05A 1TU0A 1MQ8B 2HV9A 3T1NA 4JP5A 5KMGB 1UJBA 5AHXA 3PXAA 1ZJWA 3SQWA 1I94B 5AVVA 4LE0A 2X15A 3ISJA 1XPUA 1UBRS 4PZCA 4FW8A 4RZHA 4ZYXA 3EH2A 2RGUA 1V1MA 5HYVA 3SG0A 4EJ0A 1UXKA 2JKVA 4JL8A 4W1PA 1A7JA 4LOIA 1AU9A 4DL9A 3MWFA 1IM8A 2J6BA 3I8XA 2LP4Y 1U2ZA 3TAHA 2R84A 5JXWA 1Z63A 1TO2E 1TM7E 3ZWAA 3BJMA 1HH4A 2XMDA 3GEDA 4JT4A 1Q0ZA 4MULA 4BNIA 4IX1A 4D9JA 4BIMA 3LT1A 1U7WA 3GGJA 3GFRA 4OTZA 2B5VA 4RWEA 1BDHA 1KMQA 2QP3A 3DTTA 2F9MA 1J8DA 2XKJE 4F6RA 4C6TB 5BUSA 3C8UA 5DNWA 1POWA 2PM8A 3SBXA 2YV1A 3VX3A 4XGKA 3G0BA 3OE7A 4BLSA 2V6IA 4LWPA 4OQEA 4IHQA 4HRYA 1JHMA 3P32A 4TWIA 2JHCA 1Y37A 4UQOA 1FDWA 1KRXA 4Y6PA 3TECE 4YRAA 1JEYA 4D9HA 5DFAA 3W5CA 5BY2A 2YYSA 2IYLD 2ZIGA 3DVQX 1R5OA 4QOGA 2ZB8A 5JBIA 3UY4A 5JMWA 1DJMA 5J5CA 3FFTA 5BSTA 4TSKA 1FYWA 1H2HA 1SR8A 2NO7A 2YHBA 1WTAA 3DWFA 2ZSHA 5FX2A 5BVHA 1JTFA 3P2IA 1H8ED 4P4SA 5TARA 3T5DA 5C81A 1D2GA 1N2JA 4B85A 3CNLA 2O3TA 1HY3A 2GNPA 3EGDA 4UUAA 3X2EA 4E5UA 1Z4NA 4TKMA 1C0PA 4CF4A 1INLA 1RXWA 1PVVA 1P91A 1UOOA 2DVMA 1E0JA 1CULC 4YJGA 5K3AA 3FVVA 4HVTA 1V95A 2ENWA 3B7PA 4O6VA 4C6SA 4NS4A 3LKZA 2IC5A 4Q15A 3JWPA 4YV7A 3RM3A 4O63O 4ZAGA 4G0WA 3EP8B 1Y9AA 1Y4DE 2RJNA 1Y6QA 2WJ4A 3NKFA 1VECA 1KO4A 3SIPA 2I7XA 3PE3A 4PCUA 3ENZA 4PNHA 3T3MB 3U4AA 4AW9A 4GKVA 1K88A 1TTQB 2NU9A 2AW5A 3PDHA 4BO5A 1W5EA 4PHGA 3K0CC 4E4TA 3KZXA 3PDIA 4W9MC 4RKFA 2CCJA 3U44B 3OIVA 3GEIA 4CKZA 4KJZA 5MFZA 3WLKX 1JQJC 1I5OA 3WNQA 3WNDA 2PD6A 1SBTA 3IV9A 4C01A 1K7CA 4RVSA 2YMMA 1P6QA 3OIUA 3REFA 3VPAA 1CEYA 2GXSA 4OXKA 3U62A 4Z6KA 3O9ZA 2RK3A 1PYOA 2AB0A 1VGQA 3EGXA 4M38A 2OK8A 2GBPA 2QPTA 4YJ3A 3AR4A 1KMMA 2A7XA 1MGOA 3IALA 5I47A 2FPPA 4OGGA 5CCXA 1LJUA 1ZFNA 3SHVA 3TZKA 4RD0A 4I6EA 4XJVA 1Q57A 5EZSA 3EC7A 2QX9A 3U7QA 3EPKA 4RHXA 1NLUA 4CEJB 3PTAA 3JZFA 2GEVA 5C8YA 1SHTX 5EIAA 2J1LA 2P11A 5EIHA 3KPYA 4RV5A 1SNYA 1TC1A 1TCVA 2GGSA 2PK3A 4MKRA 1UXHA 2Y4OA 3D64A 2FX3A 1UZNA 1ZKDA 5DXAA 3V3KA 4BP9A 2IHKA 2J07A 3QEKA 1LNSA 4B2IA 5G3ZA 4DXHA 2W7TA 4Y2GA 1TYBE 1CIJA 2B82A 1RYDA 3FJOA 1L8XA 4FQ8A 4KH1A 5EZQA 1WBBA 1EH5A 2ET6A 1QZ3A 2PZFA 3OG9A 4X8MA 5G1PA 2B1QA 2B8NA 2VHUA 4M49A 4KPYA 4FE3A 1H0SA 5KWJA 3IVGA 4P4UA 2ZB7A 1Q16A 3AF3A 1OLUA 4F3RA 5HKLA 3DT9A 1T24A 3AFGA 1SA0A 3F5FA 3NBMA 4KPUB 4IIFA 4WPGA 5LIRA 1VXRA 2MU1A 1OH8A 4NCAA 3NATA 1BU5A 1EK1A 4OG2A 3TMAA 2O4CA 3DPUA 4UOQA 4X9XA 4CIDA 4BU1A 5FAXA 1KYVA 3H0KA 2IL1A 4YAOA 3OQNA 5K0TA 2DQZA 3WGLA 3GAMA 3LPMA 1A9XA 1CUZA 2J5KA 2VKTA 2XHEA 2JDID 1HE3A 2ZRIA 1NN3A 4AMYA 2KLBA 2BFFB 4FX5A 2EGGA 3O21A 1I3NA 2ZB4A 1DELA 4MJ3A 5HZMA 4FFDA 2WIKA 2JD2A 5KSOA 1G3QA 1ONSA 1NPDA 2DFPA 3CUTA 2JAXA 4RDIA 1V8BA 2ZM5A 2PUEA 2BFCA 3CXRA 3NHAA 3H1BA 3ZWWA 3LP5A 3O8BA 1E3JA 2BY4A 1E0DA 1JEOA 1M6HA 3E7XA 4BNGA 1QRAA 2IE8A 3C3EA 1IOZA 4G4SP 4K1LA 3RYFA 5LQNA 1SG0A 3NAZA 2Q41A 1E79D 4Q6BA 4F85A 5K9ZA 2PUDA 2IU3A 4GWGA 3DMHA 3TR5A 2ZKLA 3A0UA 4LSZA 3OO1A 5CPBA 5KJ6A 3PPWA 4J0QA 2R7AA 1EINA 1GYRA 2CE7A 2VNAA 1YZNA 3KFLA 4WCFA 4ENTA 4QECA 2OBXA 5DP1A 2G80A 2PUCA 1RXEA 2UV8A 1Z5UA 1ABFA 4CF3A 1U98A 1O4WA 1U0FA 1MPTA 4Y2RA 3ITNA 3TLEA 1XNHA 8ATCA 2ATCA 2QL6A 2J0UA 2DWUA 1E3TA 2J0VA 2NUAB 2A9QA 1F2VA 1RRGA 3C87A 2V6BA 3IB6A 1N1EA 2FMTA 4PYJA 4R2WA 2X1MA 2Q4TA 4UTNA 2ETVA 3I2GA 2O3UA 2RHMA 4BJ6A 3P20A 1QRSA 2OYRA 7REQB 5KYTA 2P30A 4C0AC 3L04A 4OPMA 5HPYB 1UDCA 1XTIA 3PEYA 2FPIB 2XQVA 4BASA 5HS4A 4LF5B 3CVWA 4US2R 3IERA 2EWWA 3Q1LA 3VTKA 1R8SA 3EARA 1N0VC 1LF5A 2DBYA 1M33A 3DV0B 1KDPA 2AFVA 1NQVA 4HGOA 1RBZA 1SVUA 2QSUA 3JZIA 3QLVA 2NPOA 4UPEA 1VRWA 1JJBA 1HE8B 2D74A 2OMKA 3B89A 3ETDA 1AQYA 3PG5A 1XRRA 1SCKA 2L18A 2V4ZA 4PONA 4PWYA 4HVLA 3GR6A 5FWYA 4KKVA 1YZUA 1YZLA 2YYYA 3WAKA 1QFJA 3S40A 4ZQGA 2C9ZA 4K28A 3K09C 4TMYA 3A2NA 1KKUA 1X87A 1B43A 3FDZB 5DM60 2XWQA 1J7JA 2PKCA 2FFHA 4EUEA 2BJWA 3MJEA 4M36A 2CXOA 4BE9A 2YWCA 2GBGA 4TX1A 4X6UA 1BE1A 2PIDA 4RZUA 5HCUA 2WLSA 3NTQA 1N5JA 3OC6A 4HDQB 3TUJC 3V42A 1E61A 3T3HA 1AS2A 2REBA 4I7EA 4D74A 1Y8RB 1EEHA 3ETLA 3GNSA 1RIFA 2IOQA 4FHEA 4U3JA 2ZQZA 4ZO6A 4C1BA 2AQ8A 2ZANA 4DY6A 5CG1A 4IO0A 3F96A 5KU1A 3ICPA 4K86A 4HXFB 1KI6A 3OOYA 2BRUA 2QBYB 3H4IA 1FFBA 1Z29A 5JS2A 1FP4B 3C6XA 3CNEA 3KQSA 2GJ8A 4H4DA 2CGEA 4WXMA 2OP0A 3TDMA 4BN0A 4CG2A 5CYGA 5MN5A 3EEYA 1USVA 4BVGA 1XZAA 4K2HA 2W4IA 4MICA 4JAVC 2J31A 2WU1A 1NFFA 3BB1A 1RKBA 5SY6A 4O2AF 3ER6A 3R5HA 5CFNA 2O1XA 1NFQA 1VG0B 2XQFA 3OU2A 5HILA 3UWKA 3PX7A 4B3DA 4L72A 2C5HA 1BDJA 2A6PA 1RCUA 3LZDA 3NNNA 1DU4A 3QVXA 2A0UA 4JKIA 4Y6LA 4R54A 2C84A 3P0EA 4GE0A 4KZKA 2J7PA 3FLAA 5HFAA 4ZGWA 3LOUA 2IZ1A 4RK6A 5LL6P 4YCNA 4EGCB 3EE6A 4IS2A 4XDHA 3KNZA 3UMGA 4ZCIA 3T4XA 2AKAB 1P0PA 1PS9A 2Q0SA 5BUCA 2XMGA 4KQ1A 4NAUA 4R2XA 4JOBA 4FT4A 3VPHA 3KBBA 2ZLBA 3IILA 2H63A 1P9NA 1FSSA 3DYBA 1ZU5A 4TL7A 1RYHA 2ZITA 3DXXA 1SCNE 1JHQA 3QBTA 3KKZA 4L4ZA 4RDCA 1XLUA 2JKZA 4L78A 1PT8A 4X8OA 4YWHA 1XUOA 1Y8QA 3NQ41 3PLAE 3A70A 4GKJB 3PHIA 5B55A 5DN6D 1I1OA 1ZXXA 1U7UA 3W1VA 1W49A 2RGCA 3PHHA 1JI3A 1GGFA 2ZJ4A 2XLCA 3G2HA 3GLRA 3MJDA 5FLEX 2MSCB 5AKXA 5EVCA 1L7VC 1T9BA 1SHUX 3G7UA 1JHAA 3PKIA 2JKYA 2XSZA 3L1IA 2FMFA 3TIFA 1LW7A 1UEIA 4BO7A 5IAOA 5KYXA 1GT6A 4P4NA 1E5TA 2VSYA 3RIEA 1HSZA 1Y1LA 2IYFA 3HGMA 4NBKA 4ZTBA 4CL0A 4MRVA 1U7DA 4YEDA 2JLCA 2PWBA 3D43A 4DJ5X 5ALWA 4P7BA 4D9CA 4HBGA 4I19A 1DX6A 1RNLA 1GNTA 1HV8A 1MDFA 1PUIA 2CFRA 2ZRLA 1GGEA 2PKRA 3EEIA 1GFIA 4W8HA 3CEAA 4UMVA 3PC8C 5EWLB 4ER6A 2QN7A 3VUEA 4FOTA 4LY0A 1I1HA 5FQOA 4YV0A 4NZPA 1JLSA 5BW8A 4E5NA 2I87A 2WD7A 4OKIA 2REOA 4ZAYA 1X38A 2QN8A 4EHJA 3J80A 1PHPA 3PS9A 4H4EA 4HEQA 2WJYA 3G6KA 3GT3A 4OREX 5AVRA 2EOAA 2JLAA 1GM5A 1PR4A 3PGLA 4C3OB 1XJQA 1YFLA 4YMVA 3OF2A 4M4SA 5CG2A 3N3BC 3K3PA 3NNSA 1M83A 3D5QA 1HDEA 4UMFA 1FYDA 3EG9B 3NAGA 3RJTA 4INOA 4HUTA 3VOSA 1WY5A 2C3OA 3G2JA 1G5PA 4L1KA 3OTHA 3QMWA 4Z2AA 1UM8A 3REGA 3UMVA 2IXEA 1JLMA 4ARZA 3EP4B 4WI1A 2VXYA 2HLNA 5A4IS 5KVSA 2VAWA 3BQNB 4TV9F 3D59A 4QM6A 1NF8A 3CONA 3DEFA 1Y8CA 1OTHA 5FNVB 3DDSA 2I7TA 4Y2TA 4EHKA 5G0SA 3IUEA 3OMLA 5CA1A 1NJSA 3KELA 3STUA 4R51A 1LS6A 4E94A 4FHDA 4KL8S 5IJWA 4OK5A 4P80A 1O94D 4HCJA 4POOA 2GBIA 4DQDA 3FOBA 4X1IA 3W2TA 5LXTB 3IAXA 1HBJA 2IZ6A 3KPVA 4BB0A 2EJUA 1Y6FA 4RORA 4XYMA 5CLLA 1QOPB 3DXZA 1HKHA 1YMVA 3TBFA 5U4XA 1V26A 4R2KA 2QDXA 4GI5A 3VDMA 3BIOA 1HT1E 1Z7EA 3CCCA 4MO9A 3TKLA 1W5BA 4KQCA 4ZKDA 3A4TA 5F1YA 3KZOA 4Q3DA 1AD2A 1N0IA 1PEYA 3HFSA 4BQPA 3R4VA 1JSCA 2EEZA 3M1AA 4LY3A 4HH3C 1SKYB 2XZPA 3GU3A 4D79A 16PKA 3ZCQA 1D8TA 2XE6A 5CAEB 5KC9A 2HMTA 4YRBA 2Y0DA 3BL6A 2G77B 5BN5B 2IHJA 1EFPB 1P0IA 1KZ6A 4Q1EA 2DLDA 4QELA 4PZLA 1VLHA 1B42A 4P9NA 3ENNA 4PTYA 4X62B 4H35A 4DV7B 3MYRA 5INTA 3HKBA 3QPAA 4AO6A 2J3EA 3SZLA 4QL3A 2C4KA 5IVHA 2HA4A 4AIIA 2PH1A 3RNOA 2WIFA 4CQMD 2WU8A 4OSOA 5DGIA 4KH0A 4M8IA 3RB8A 1ZK2A 5M2QA 1E3WB 1UDBA 3G0CA 1EE2A 4LVOA 3PVZA 4KE7A 3W1WA 5BWBA 5D3MB 2I8LA 1W4ZA 2Y67A 3PA6A 3NTLA 4ROSA 3FYTA 5BT8A 1E4VA 2Y0BA 5JPIA 4AZWA 2BMVA 2CFOA 3L6EA 2EJVA 2FDRA 3LLVA 1U3CA 4G09A 5E8JA 4B2LA 3KETA 4KR2A 2QRQA 1ZNWA 2CNBA 3O82A 1TVMA 3N75A 1J00A 3VHRA 5AJXA 3MGCA 5AOCA 4E5YA 1JA0A 1VDMA 2ZRJA 3C1AA 1M1UA 1YO6A 1W2WB 4PQFA 3K0BA 2F1OA 4DXAA 3JCZA 4NESA 1FE8A 4Y9UA 3NJ4A 3AY6A 2NVUB 4E2FA 1GJRA 4HBZA 3B6KA 1OU4A 2Q5LA 3BK2A 2VYNA 2J4FA 2BFEA 4BO2A 2XHZA 4BB9A 2ZXUA 2ZTMA 3WNCA 3A25A 1P1RA 2VTVA 1RKQA 3DWGA 5SZKB 1N9KA 1R50A 1GAQA 1Q21A 1TXGA 3UF0A 3B5IA 3C0KA 5H3LA 3VU9A 5T4EA 2FSUA 1KC3A 3ZQUA 4GM0A 1HQYE 2RIRA 2ILTA 1O97C 3AFNA 3N8DA 2DRIA 4IGEA 5TEWA 1BYIA 1F12A 4MUYA 2XGGA 3B53X 3MB8A 1PQ4A 2VZ0A 4CCWA 4LDZA 3O7MA 5JI3E 3ZGNA 4KK3A 5ER9A 4RETA 3NHBA 2AN4A 2P8JA 2ERCA 3D6AA 3OCVA 5GGYA 2ZRAA 4UVHA 1HFKA 1O6GA 3BBPA 4GOOD 2O48X 1MB0A 1UMCB 1H4QA 5EOVA 4HDRA 3RQIA 2XYPA 4ZVSA 3REOA 2JK0A 4IMPA 4IIJF 1JHXA 1BXGA 5L4LA 4RMHA 1E2MA 1R3UA 3AVQA 2Z9CA 2B37A 4IOLA 1VA4A 3C41J 4OYRA 2ZRBA 4PHCA 4CM9A 3ZLJA 1BMFD 4XFJA 1RI3A 4UBLA 1N2BA 2A0KA 3L7OA 1QPBA 3PWSA 5H3HA 2QAGB 3ZIDA 5JSUA 1XFDA 1Z7GA 1XEWX 1TL7C 3COYA 5E1BA 2R85A 4EQ6A 4YLGA 3IO5A 2ZWIA 2XF8A 2AQIA 3CR8A 1AHHA 3JVEA 2WM3A 1C0KA 2AZMA 3EULA 4C7KA 5EHIA 1P2VA 4NRDA 3NALA 3OQBA 3WQBA 1R0BA 5JMOA 4BO9A 4DCPA 3RVNA 3U4QA 4FYPA 2EP7A 1MX3A 3L4KA 1TO1E 4GLBA 4HQ6A 5EIBD 4RZXA 2C2BA 3ND7A 3PQDA 2GN4A 5TDHA 5BWCA 2MSLA 3ICCA 3QF4A 2JC3A 4N7MA 3X0DA 3IKTA 2FPGA 2FZEA 1E3LA 1X39A 3BTUA 1YA6A 4BATA 1FDOA 2FOIA 2VLIA 3AEXA 4DRXA 4BKPA 4ZVKA 3K1AA 3PLNA 2R4UA 2YJGA 1RPAA 2VQ3A 1JG6A 5ER6A 3GGCA 3R76A 4DSAA 4L6IA 1DHTA 2Q5HA 2Y76A 4ARVA 2ZRMA 1RI2A 4LYEA 3NXKA 2O0LA 1S9DA 4YROA 3K0KA 3PC4A 2OGTA 4C0KA 2OO5C 4TTTS 4KQ9A 3I2HA 4YO7A 2X76A 4DCNA 1VP3A 5B6IA 2M9MA 4EG6A 3ZU5A 4LTDA 2FSVA 4K46A 3V7NA 1CY7A 4QLOA 4BWYA 4NCBA 2KB0A 3PUHA 4FXOA 1QMIA 5CTAA 3T7TA 3SE0A 4DYDA 3GFBA 3HQ4O 1RC0A 1KIMA 2G71A 2ORIA 3HVJA 3HMKA 2XUHA 4Y6SA 4ZVOA 1I13A 2ZI9A 4G5SA 2P2YA 2G9NA 1MD9A 3WMRA 1U8FO 1SK9A 1EWKA 1OI2A 1SVSA 5F5LA 3OZFA 5B7PA 3EXHB 3OUUA 1NBHA 2NO1A 2IYRA 5JXIA 1ISMA 1GNPA 1ORVA 3FNIA 1N75A 1FNCA 1WKVA 1VBNA 1UMDA 2HMYB 2FN4A 3BOSA 4MK4A 4WKOA 1G5FA 1HDGO 3HBJA 5AUNB 1Z47A 2LTAA 1JIVA 3CRW1 3L06A 3AR3A 3QKRA 3OQIB 3RJMA 2BSAA 4RSMA 2ZJYA 4M6WB 5DHTA 3B8HA 3RYTC 1E5QA 3W2HA 3AJRA 4AF8A 2QTWB 4Y2HA 1N36B 4LHVA 4DMUB 2Q3BA 3DZDA 4KSYA 3CIOA 2PLRA 4NZ9A 1GU0A 1V6SA 3ZVKA 2Z04A 4UU0A 3C6KA 1P5HA 4RE6A 2CNLA 5C3UA 4TTSA 2X41A 3FWZA 3K9GA 4QPCA 5HUJA 1H4VB 3I1FA 5AIAA 2F00A 2PBFA 4MPRA 4P38A 4N3NA 1TQ6A 4NXMB 1OXSC 4WQMA 1GNRA 4FPXA 3BD6A 3R24A 1KWKA 4U7TB 3V2HA 3I6ZA 3KT0A 3MILA 3IUSA 3N5CA 5M6DA 4M22A 4RJJA 5CHEA 2DGDA 4UQLA 1CRQA 4UREA 1YAJA 4DNQA 1EGMB 5JSZB 5JDCA 2TYSB 3CVOA 2JF0A 1DG3A 3I3SR 1RAGA 3NHJA 4LOJA 3VO9A 4EMBA 5HJ5A 3NV9A 3QGMA 4W4TA 2QYHA 1ODCA 3KAQA 5DNYB 4KDRA 1LFDB 2C42A 5GV7A 4M9CA 3OE5A 3TSZA 3N2GA 1MA0A 1Q5PA 2A4MA 1QHXA 4YFYA 3ETJA 3AR9A 4IIHA 5E4YA 2CUTA 3MUEA 4C4RA 5IBQA 2HSDA 1MZVA 3HNRA 3LLCA 2YV3A 1T91A 3Q3GE 1ID8A 4Q3OA 3BG5A 3A3OA 3BXHA 1D4ZA 4XKJA 3OF5A 4HAXA 3A9UA 3FMOB 4ZT6A 1LX6A 3DZKA 4G84A 1HRDA 1RRKA 1YKSA 4KFSA 4L0CA 1W36D 4RS4A 2HUNA 3Q7PA 3KEOA 2X8JB 5F33A 1E2NA 4AKEA 5LBUA 4C0LA 5EP4A 4EB8A 1GGNA 3RE1A 1N5MA 1KI7A 3FPSA 3ILSA 5DHRA 2G9UA 4EKYA 5AVTA 1IXYA 4BWFB 2VDPB 4YECA 2PO7A 2BMDA 1Z15A 5JD5A 5JMTA 3QE4A 3SF0A 3W2EA 1XELA 5I7EA 1GCIA 3F9RA 3H6GA 1S8NA 1A2BA 1QO0A 3FNHA 1TYAE 4LDQA 2VPIA 1KQNA 3BA1A 1UCFA 5JQGF 1EXDA 2JG3A 2QXYA 5DBFA 5IHXA 2ZAYA 1XRSB 2VPXA 4ITUA 4RIGA 5ABPA 3NVMB 4IJ6A 3UB2A 3BCSA 2VT3A 1ZD8A 4YQYA 2BI4A 2QQEA 3IAFA 4OMDA 3FBTA 2A78A 4QPJC 1JI0A 3B5JA 3U49A 1AO0A 1SRQA 4A10A 1H1LA 3U4CA 3ONEA 2IUTA 5GGXA 4NDNE 4COOA 4DA9A 1XQYA 4REMA 1EM6A 2HGSA 5L6MB 5J63A 1N7GA 3UMFA 5HRCA 2HA2A 2IX9A 3ZZUA 3DTYA 1E2BA 3S8EA 1NOKA 3VOAA 4F5YA 2ZRGA 1KY4A 4K6OA 3SICE 4X6XA 1QMPA 4LWOA 3EZLA 3P4YA 1ADCA 3FY4A 2VJAA 4XWGA 5C34B 4DR2B 1JEYB 5FTJA 2FLKA 2XY4A 2I2WA 1FDVA 2ZIZA 3NUZA 1AZLA 4OH1A 4M7WA 3AKZA 2AIRA 3THWB 1U0TA 3SHOA 3N39C 5GV8A 1JSRA 3R9IA 4B82A 2F9FA 4R0VA 3J81A 2B5OA 1Z6AA 3EHEA 3NWBA 3EG5A 4OCZA 4OQQA 3RT9A 3TLXA 3UK2A 4D3SA 3VXKA 3LPNA 1II0A 1ZRHA 1WMAA 3NHKA 4OMCA 3A1EA 4YRGA 2C7RA 3G9UA 1FYFA 4KACA 1K66A 4B09A 4Q12A 3GF4A 4IJMA 3B1XA 1KZHA 3IB3A 2ONYA 3KB2A 5M7EA 4QTUB 1DZIA 3T9BA 4K6GA 4M2LA 4K3VA 5G02A 5CFMA 3QEBZ 2VYVD 4W9RA 3LX4A 3O75A 3T61A 4J7AA 2HU7A 3O3OB 1AA6A 2EJTA 3MT0A 2IUEA 4CMCA 1JN0A 4YS6A 3CBGA 4JI4B 3DE0X 1ONNA 1CJSA 2OK7A 4G63A 3WLAA 4RTKA 2VHCA 1VPVA 2XUJA 1ML4A 2QTCA 3QA9A 1AV7A 5CPFA 2KW5A 1AK9A 2V1UA 2NYUA 2AHOA 4HMOA 2CNNA 1NW9B 4AUKA 1VHWA 3PQ5A 3RCBA 3TGWA 1UMBB 3MWLA 4X24A 3JAKA 1QOQB 2QDKA 3N9IA 1ZD1A 3UC9A 1XL0A 3EA0A 5LA6F 2PUTA 2EX4A 2SECE 5EP3A 3GQBB 5LPNA 1CY4A 5FOXA 4XVQA 4FOPA 5BV8A 3AETA 3OQJA 2WHYA 3ND5A 2RGWA 2J9FB 1M1NA 3H1PA 4TV8A 4ZK6A 5KDOA 4XYGA 1X86B 1NUPA 3LFTA 2LD4A 4OXYA 1DV2A 4RTMA 2O7VA 1Z5VA 3HXQA 1E6EA 4UUMA 1VLVA 2WTAA 4Q4CA 3I9V1 3ZHTA 3TM4A 4E5SA 2G8NA 4NZOA 1TCAA 3R3UA 5FNZA 2GASA 3UJ7A 4ZC8A 5EZYF 3KL4A 5T8KA 3B3QA 2EIXA 4HAIA 1HEYA 4JBIA 3D81A 1V2GA 3RGWS 4PPGA 5KVCA 1RJFA 1U2SA 3MT9A 1NW8A 1PJCA 4G0PA 4CGZA 4ZO9A 2AUNA 5CX4A 1Q50A 3G8AA 2HO4A 2NAPA 4EGQA 1IIRA 4KQMA 2A9PA 1EG7A 2X77A 3VFDA 2ZPAA 3OQPA 2AWOA 4JSRA 1W0JD 3EY4A 2IKSA 1M7GA 4X1YB 4BFWA 2WZCA 1T26A 2BKLA 4WNCA 4BMDA 1BX3A 3RRFA 5JI2E 1ICIA 4L2IB 4LI3X 5I8WA 4INPA 1ZNQO 4M3NA 2JBWA 2XYGA 3M5PA 1OPXA 3W5IA 2JAOA 5FH9A 1FCJA 1LBEA 4DM3A 2XW6A 2O8EB 2H11A 1CS0A 4WOKA 1XFAA 1NLYA 1VJDA 2CEKA 4CDMA 1B6SA 3DVRX 3U31A 1E3MA 4DUGD 4ZV7A 2ZRPA 3VVMA 1SU6A 1UJCA 3U6KA 2QTVB 2NX2A 2GVZC 2Q9UA 3OZWA 2EFCB 4PYLA 1NURA 4UM5A 3RV3A 5I8PA 3CPSA 4XVRA 1OLOA 1T9DA 1SVWA 4HFNA 1CUVA 5FB3A 4RLFA 2Z5LA 1C3OA 2QNRA 2QR2A 3N87A 3RTGA 3CLSD 3PUKA 3D5TA 3S29A 3WK8A 4XYBA 1EBUA 1B16A 2DBQA 4X54A 1K2VN 1QH9A 2AJCA 3DYIA 4IDGA 3AT1A 4LF7B 1RI1A 1YI1A 4DDMA 2YUIA 2YCBA 1CHNA 1RIIA 1KDZA 1ZSVA 4JLUA 1J70A 3WV5A 1WR8A 4X8HA 4H7KA 4I9UA 4X94A 4ZAXA 3OQVA 3VDQA 3W6UA 3RR2A 5FEUA 4UBMA 4WK0B 1UK8A 4R68A 3OKCA 1IWPB 4ER0A 4V02A 5LLTA 3TCKA 2FG7C 2PU5A 2GKGA 3QVVA 2OBFA 3V8EA 1SCQA 3L8GA 3FI9A 4R9NA 3WQRA 4P2BA 4Q34A 4MX8A 4PRZA 3T6KA 3ZBQA 3ZWBA 3KR2A 2VC2B 5EJFA 1G6HA 4DG8A 3I6YA 4AJKA 5CP8A 3W9UA 1VBFA 3C3CA 4NDZA 2ZDQA 3FMVA 1H5QA 3SFVA 3K9FC 2YY7A 3N2KB 5FEMA 1K5PA 3ZXUB 3NAQA 5FPQA 4WJKB 2H9YA 5C5CA 2BTEA 3C3WA 4C2BA 1YH3A 2I6GA 3D4BA 3HVHA 2FUKA 4NBTA 4G37A 3L0SA 4GXNA 4JBXA 3MWEB 2B1RA 3Q2OA 4MRNA 5KEIA 5HUQA 2Q2VA 4Q9IA 4P33A 1FUKA 1Y9DA 3FYUB 1YCGA 2GK3A 3ML1A 5KVVA 2AQHA 4UAJA 1USGA 1VSBA 1SKUA 4YLEA 2V6JA 2XGJA 2Q4OA 4XIYA 5BNFA 1UWCA 1HQCA 1PUJA 1WV0A 2G40A 5A06A 1U0JA 3BAFA 3EGVA 1G7RA 3ZOKA 1G8GA 5KHOC 1ORDA 5IVDA 3WSWA 3VVLA 4J43A 4O2AB 4OXRA 4O3MA 5ALGA 1D03A 1LBIA 2VPYA 3WGYA 5LR6A 3MIIA 4JIMA 4TVBA 3H9CA 5E8RA 2ZVDA 5LMUB 2WYUA 3KEMA 4CV0A 1CR4A 1D4AA 4IOJA 2GZ3A 1B3BA 3PC6A 3WYCA 2P27A 1LDYA 3K1ZA 4FLFA 4QFBA 3VNAA 1ORRA 4AP9A 4EMSA 4ZDJA 3ZCPA 4B9EA 3LVFO 2DT5A 1JQKA 4A8JC 3JASB 5KNDD 4K1XA 2OZPA 5F51A 4IP0A 4F3NA 4PN7A 5TIIA 3FPJA 5FUWA 2XUPA 4RTPA 2ZRKA 2AKYA 5BQXA 3I5XA 5IKMA 1U02A 3UAWA 4PZAA 5DISB 4LXTA 5K3SA 3H11A 4WHMA 2FUCA 4H6WA 4X97A 1GTRA 1W19A 5JRZA 4BQIA 2H0QA 1C1YA 2PLNA 4YLYA 3IAS6 4YRTA 1G19A 2R8RA 3GPIA 4E51A 5BN4B 1PR6A 4BRSA 3IQEA 1ZMXA 2ZBFA 4IUYA 1EG2A 3A04A 1X9HA 4KDCA 4LK2A 4OQYA 4RY2A 1F7VA 1M2OA 3GAAA 1TJ4A 5KREA 4MW2A 2IEAA 5K3FA 3JQ8A 4BFLA 4WZAE 4JI1B 2P1RA 4PLPA 4LHYA 1SULA 1EGVB 2BHRA 1BEEA 1N5RA 2GAOA 4OK6A 6ABPA 3WLFA 4NJOA 3EXFB 2P40A 1BU8A 3IE1A 3H9GA 1Z2PX 1UMKA 4N3GA 2HPAA 2GM9A 4QFMA 5EXDA 2PE5A 2NSLA 3L0OA 4HF7A 1ORWA 1GZUA 2PHZA 5KSWB 2QZSA 2CXQA 1USKA 5CEEA 2VQ6A 3FLBA 3KLOA 5JR3A 3IOMA 1TJPB 4JLOA 1J24A 4WZAA 5BSGA 1IBMB 2AGVA 5BVGB 2WMNB 2QI9C 2R1TA 4B46A 4ZJUA 1S89A 5KOHB 1BVRA 1FNDA 1BS2A 3RSZA 4DZRA 1U1IA 3H0WB 4Z54A 4HNVA 3QE9Y 3A9VA 2ZTUA 3GVIA 3WIBA 2IH2A 1V39A 2QL9A 4LBZA 3HYTA 3QWAA 4TQGA 5IEBA 4Z7JA 2PQ2A 3QE3A 3HVKA 1D2MA 1YKFA 3CUKA 1UZLA 3ORQA 4NG4A 3KIPA 4UAUA 3K9NA 5DTQA 2GPYA 2GAAA 3KUKA 4B3RB 1XXHE 1YI8A 5C5EA 2XUDA 3MQ2A 2A84A 4HLQB 1Q74A 3V4VB 4TV9B 4M9ZA 2DCUA 3LRXA 4TMXA 4B3SB 5FWAA 4YJDA 3OQOA 1IN7A 4QBTA 2I54A 1N6PA 2C5GA 2LCFA 1V5GA 1EX9A 1RYMA 3UXYA 4M1MA 2WFLA 3O92A 5KYUA 4XX0A 5BO5A 3QX3A 5KYVA 2QNBA 4N8EA 3BH0A 3BK1A 4R9SA 4C7MA 2HLPA 5F64A 5BRNA 1NXVA 1Z39A 3NM6B 3ZTWA 2FPNA 3L6CA 5AXAA 4D5EA 3RQSA 4AJ2A 1JDJA 5JIBA 4KLZA 4UVDA 2PUHA 5DK4A 5ALUA 2VAVA 3DVLA 1XXHA 4NBVA 4BFCA 1LKZA 4QXQA 1U0NA 3K0EA 2I1VB 1GUZA 4ITRC 4JLJA 4NPHA 4CT4B 9ABPA 4CKYA 5BOSA 1EE1A 1U4OA 3L7DA 3V4ZA 2BHLA 2VDJA 3LVBA 3WE7A 3DT6A 3ONFA 4CV3A 1FXSA 4R31A 4N6NA 1G8PA 1S0UA 1Z2CA 1PVOA 1BXRA 4BEVA 4O4JA 2WV7A 3GP5A 2F7SA 3P9RA 1TUGA 4M0PA 1VKRA 2BF7A 3VHXB 3HDYA 3VR5H 3ISVA 4MVWA 3VPSA 5C46F 2BH9A 4FX2A 3HO6A 1ML3A 1DEXA 4NF2A 3MJHA 2Z4TA 5DULA 1I80A 1B76A 1FW8A 3AIIA 2IEDA 4GPIB 4KBFA 4TRMA 2IFTA 2ZTLA 1FMCA 4RFVA 4W8GA 1EK0A 2G88A 2EEPA 1XZMA 3NHWA 5H81A 5DMXA 1PNOA 1Z33A 3IBTA 3KKLA 1JZSA 1JAXA 3VR4A 2YDXA 1EZ1A 1U65A 1G64A 1HFJA 1WDTA 4W1QA 4H7IA 1DG9A 1SXJB 1U5BA