1H6DA

Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
383
structure length
383
Chain Sequence
QAATLPAGASQVPTTPAGRPMPYAIRPMPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Precursor Form of Glucose-Fructose Oxidoreductase from Zymomonas Mobilis and its Complexes with Bound Ligands
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Protein translocation
molecule keywords PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
total genus 126
structure length 383
sequence length 383
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2001-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h6dA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h6dA01
4R51A 1PGPA 1PS9A 3H5RA 2P9EA 3QA9A 2YJZA 1OC2A 5CHEA 4YJFB 2Y68A 4WLUA 3DZFA 1LBEA 5CEEA 4MKZA 3INRA 3JQDA 4DPMA 3GZNB 4YAJA 1GEEA 1I33A 1H0KA 1IOLA 1X13A 4CODB 4WJZA 3VKUA 4CLOA 4CM4B 2J3HA 3T4XA 1M2WA 1PL7A 1XWFA 1XGKA 3IJPA 4W9NA 3AU8A 1K0UA 4RQTA 4CM9D 5I7SA 4NK5A 3EVNA 4BGIA 5A05A 3DTYA 1PJCA 4YRBA 4URFA 1B26A 3Q9UA 3FTPA 2X23A 1WNTA 1MLDA 1AN9A 4XB2A 5JXWA 2LDXA 3JD4A 4RPLA 3D0OA 3OP4A 4QO8A 2GZ1A 4D44A 1JU9A 2FOIA 5BNTA 1CETA 2BD0A 4J16A 4BNVA 2W4QA 4R54A 3RC9A 5A02A 1N2SA 2V7PA 2HSDA 4FFNA 4HNGA 1X7HA 3RKUA 1RM4A 1MUUA 4GBJA 3ADOA 4BNLA 1H2BA 1YDEA 4MKRA 3AJRA 4FW8A 1U28A 1IHYA 2JD2A 1T26A 2X5JO 2D59A 3AUAA 4ROSA 3RKRA 3PZRA 2C82A 1BTOA 1MC5A 1V0JA 3DAPA 2BRUA 4NJMB 4BIIA 3HZZA 4D79A 3QW2A 2ZCVA 4B8ZA 2AQHA 4XEHA 1RM0A 5K0ZA 1JKIA 4TZTA 2VRBA 2X0RA 3QJ5A 5DF1A 3ZW9A 2GRAA 3LC7O 1PGJA 5TQVA 4E32A 4IY1A 3T7EA 3I9KA 1C1XB 1B0AA 2CSUA 2QG4A 4O6VA 1E7RA 3AI2A 5FFFA 4XRGA 3O03A 1I0ZA 1W8DA 2CF6A 1WMAA 5KTKA 4AJOA 4QUKA 2G82A 4JGBA 3RJ5A 3PHHA 2XF8A 1BXKA 1GQYA 1LNQA 1PGNA 3PLNA 3WLEA 4BO4A 3W4KA 3SJ7A 3HDJA 3ANMA 4IPTA 7MDHA 1XYGA 2JJYA 3IP3A 3NKLA 4IBOA 1D1TA 1CWUA 2YV3A 1AHHA 3I5MA 3A9WA 4JJIA 4AJHA 1HDRA 3WGTA 2EP7A 3KEOA 3BTUA 4I9HA 4IS2A 3ZWCA 3GNTA 1H9AA 3LVFO 1QORA 3KYBA 1Q0LA 4IGFA 4BO2A 4ZQGA 2H1SA 3ZU4A 5IG2A 2PD3A 4HY3A 2A9FA 4TROA 4J43A 4XJSA 3BMOA 3U3XA 2FR0A 3PYLA 2VHVA 5HS4A 1LDNA 5JNLA 3INGA 1DFGA 3PTZA 1HTBA 3GVXA 4CLOB 3JYOA 4J9VA 3P19A 3VDRA 3IJRA 5CAEA 3DQPA 3WJ7A 1DEHA 2QZ9A 2R00C 4RLSA 3KYCA 4JNKA 2I99A 1RJWA 3JQEA 1PJ2A 4FD3A 1NR7A 1AHIA 1PJTA 2VHYA 4FDAA 4YTEA 2BI8A 4L4SA 3UKOA 3V1YA 4RCVA 1BW9B 5CP8A 3QV1A 3GH3A 5IDWA 1NWCA 4XYLA 1LJ8A 1HE4A 2PGJA 2O4UX 3S8MA 4ALJA 3MEQA 3EK2A 4GVLA 4IDFA 5JCJD 4P8RA 2AMFA 4BO9A 1GAEO 3S55A 4L8VA 2E6UX 3F5QA 3BMCB 3G3EA 3V2UA 2W2KA 2IEDA 4Z9XA 3NJ4A 4OM8A 4E12A 3S2IA 2YY7A 3H9QA 2B0JA 4JJFA 4W6ZA 1DFHA 1A9ZA 1R4MA 3K5PA 3LC2O 1KY5A 1ZCJA 1ZSYA 2BGMA 2VNSA 3SXPA 1CEQA 3CH6A 4PLGA 4NBRA 4EYEA 2BH9A 2DUUA 2PR2A 4IIVA 4IQGA 4CQLA 2EHDA 5TX7A 2IODA 2AEFA 4QX6A 3RUDA 3VVCA 4S1VA 4D45A 2GSDA 3PHJA 4JCOA 3RBVA 1IYZA 1P3DA 1T2FA 3VC7A 4EBFA 5H81A 3SX2A 5DCYA 1JLLA 4RF4A 2GN4A 4EDFA 3PDUA 4QTZA 2H5LA 1YQXA 2GF2A 1SB8A 1PJSA 3OQ6A 4MVJE 3F6YA 5DZSA 5TNXA 3FF4A 2JHFA 4GGOA 4MIYA 1EQUA 1KY4A 3LF1A 3QQPA 4NG5A 4B4WA 4B4VA 4OMUA 1MXFA 1NHGA 5TJ9A 2IEBA 2I5PO 4FN4A 1UDAA 4OKIA 3GC6A 4IDEA 1TA4A 4XIJA 2GCGA 1R6DA 1CF2O 3F46A 2FR1A 3W8FA 1JKJA 5JSFA 4INAA 1ZXBA 3EYWA 2WD7A 3KO8A 3NT2A 1UAGA 3GPIA 3Q3CA 3CE6A 4W82A 1JDJA 4W9NC 4XIYA 3AY6A 1ZJYA 3WDSA 3T4EA 3WGZA 3GEMA 2X8LA 3D4NA 1ISFA 4CL8A 2DC1A 2ZB8A 3WWYA 1GYRA 3W8EA 4BB5A 5IZCA 4CMGA 3HADA 3RD5A 4D3SA 1EVZA 3W6ZA 1VJ0A 2C7VA 2IYOA 4JBGA 1U5AA 1FDSA 3ZWYA 4CM4A 1NFFA 1QV7A 2NLOA 2WSBA 1DB3A 3GLQA 4BNUA 5L95A 4CLHA 3SC4A 2B5VA 4CMJA 2IRWA 2E4AA 4U6QA 1GUZA 4R16A 1DOHA 2QRJA 1FK8A 1I2CA 1UXGA 2YYYA 1YE3A 1EDZA 1HDXA 3TJRA 5DCWA 5M6DA 4BNKA 3EZLA 1T25A 1ZVMA 5T8KC 3U9LA 2C59A 2FPIA 4J7UA 1EZ4A 1NTOA 5AVOA 3DMYA 4TMFA 3MWEB 2Q50A 4NMHA 2W2KB 3PPIA 2EJWA 3K9QO 3FR8A 4ONEA 5G4LA 8ADHA 3OBBA 1XR3A 2UAGA 4GSLA 3PJGA 3FWZA 3C8MA 3ZWVA 3ONEA 5IDYA 1SC6A 3VZSA 3PWSA 4KZPA 1W73A 2I3GA 1EUCA 2YV2A 2EERA 5DDIP 1K5HA 4I5FA 4EI2A 4Z0HO 1L7DA 5B37A 1GV0A 2H9IA 4JBIA 5COQA 3OA2A 2IZZA 3D4PA 2NUAA 3GVCA 3GY0A 1ZW1A 3GRPA 3QP9A 2EF1A 3AM4A 3BHMA 4GX2A 2P2SA 3H7AA 3ZHXA 1E3LA 4BMSA 4AJKA 3K92A 4YRDA 4EGFA 2I65A 3AU9A 2Q4BA 4N54A 3JTMA 5TT1A 4MVJP 3ZU5A 4F45A 3WFIA 1HZJA 3RFXA 4FS3A 1QLHA 4Q39A 2ZQYA 2EEZA 1ADGA 4E21A 4ZRNA 5KVCA 3OIDA 1Q7GA 3ZDFA 5EJ2A 2G17A 2QQ5A 1GUYA 3GNQA 1R0LA 1B16A 4H7PA 1XU7A 2TMDA 2JD0A 1EBUA 2HK8A 4HBGA 4HFJA 4PLFA 4E2YA 3WX0A 1P45A 2RIRA 1O94A 1NAIA 1DIAA 4XYEA 1DLIA 2EXXA 2Q3EA 4TRJA 2BGKA 3DOJA 3VH4A 3VZQA 4CR7A 1NBOA 2XAAA 5KIAA 4CMEA 2ZCUA 1TB4A 3VHRA 4Y67A 3UFXA 2Y1EA 5T64A 5IXSA 3W4JA 1U7TA 2Q46A 5I7EA 2VT2A 3DFZA 3H4VA 5A9SB 1E1KA 1QLJA 3G1UA 3GZ4A 4J0FA 3CIFA 1ONPA 2HRBA 2G0TA 1C0KA 3OEWA 5CDTA 1U8FO 3GDOA 3QHAA 1OBFO 2OOSA 4JQCA 4AJJA 1DO8A 3PK0A 1BVUA 3SVTA 4HUJA 5THQA 5IZCC 1XSEA 4CLXA 4IQ0A 3GG2A 3I52A 5L7WA 4AJLA 5HWSA 3OQBA 3C7CB 4R9SA 1LDBA 3QWAA 4AJ2A 5BR7A 1IL0A 3DC2A 2WMDA 1OI7A 1U3WA 1U4OA 5HTOA 4YYZA 4YB8A 2HKIA 2C20A 1N9GA 1YXMA 4EJ0A 3K31A 3I4FA 4RPHA 3I9OA 3EC7A 1WXDA 1HDCA 1UR5A 4BB6A 4RVHA 4E33A 4TVOA 2EW8A 2FR8A 4JJGA 1P1RA 1DPGA 2JFHA 2CZCA 1BXGB 1R16A 1NNUA 4IJWA 2OGUA 2VOJA 3F3SA 4MOWA 4YJGA 3ETGA 4CQLB 1EVYA 5C37A 4FPXA 3NYWA 4HP8A 3GG9A 3GGOA 4LCEA 5AXCA 3ZGYA 4M54A 3CKYA 4AG3A 5JBIA 3DBHB 1A71A 2VUTA 4OH1A 1QR6A 4Z9FA 3EDMA 3ZZNA 1T4BA 1NAHA 4YCAA 4DUPA 2Y05A 4GWKA 2Q2WA 2Q2QA 1KVUA 5K9ZA 3RC2A 1LRJA 1YO6A 2PH3A 1F12A 3GF4A 1YS4A 1GZ3A 4LMRA 3COSA 2OP1A 5TS3A 4XGKA 1VJTA 1O89A 1GTMA 1Q0QA 4D41A 4CV2A 1TLTA 3BHJA 4GH5A 1LDEA 4LVCA 3WBBA 1QG6A 3DONA 1A4UA 5DULA 1A9YA 3FPLA 3H3JA 4Q3AA 4BNZA 1LSJA 4CQMA 1DAPA 3PYXA 1ISGA 4HV4A 1HRDA 4N7RA 1LXCA 2X9VA 2ZTLA 4F6CA 4PVDA 3Q2IA 4K6CA 3ST7A 4DPLA 4JLWA 2WDZA 4E2WA 3WGOA 3VPHA 2BKAA 3ZNPA 4AJIA 3A28A 4TVBA 3BHIA 2GD1O 1HLPA 5L51A 3BMQB 3AWDA 1PJ3A 1PTJA 3GN1A 1J4AA 3IUPA 5JCXA 3LYLA 1P1JA 1HDOA 1KYQA 2VRCA 3D5TA 1TT5A 2X4GA 3FSRA 5A9RA 5CPBA 3WSWA 5KWEA 3PJDA 3AOEA 4FQ8A 3GHHA 2B4QA 5HS6A 1X1TA 4R4JA 4BNHA 1MFZA 2JAHA 2UUOA 1YJ8A 1DBVO 4J0EA 1GUFA 3RUIA 4Z0TA 1WDLA 1MG0A 3X2FA 1KIFA 2Y0CA 3DOOA 4ZU3A 1D3AA 1E92A 5JAQA 2Q1TA 5ENDA 4NBVA 1NXQA 2C54A 4OSPA 3GZNA 2NU8A 1ONNA 2CFCA 3JQBC 4WNCA 3DHYA 1HZZA 3P2OA 2X9NA 3LQFA 3OEYA 3GPDG 4RPGA 4IJVA 1A27A 4L4RA 3PP8A 4WLNA 1AE1A 2PY6A 4IJKA 4LVUA 4DXHA 3RI3A 1LU9A 1R0KA 3ETDA 4DA9A 5DN9A 3UVEA 3NDJA 4P22A 4NBWA 1J0XO 1YBVA 4MIOA 1F14A 1LLDA 1UXIA 3WYBA 4CLRA 3JQ8A 3MJTA 5EN4A 4WUVA 1I2ZA 4QFCA 4JXKA 2ZYGA 3ZHBA 3TWOA 3BTSA 4KDEA 1QV6A 4ZN6A 5A03A 1ADBA 4BNGA 4KOAA 4MIEA 2YDXA 4QFDA 4ALMA 3P7MA 2JCVA 1R4NA 1DC5A 1WMBA 1L1FA 3E48A 1UXKA 5I9LA 3BMOB 3WNQA 2Q2VA 3RC1A 4CPDA 1DLJA 3JD3A 5I8ZA 4ITUA 4WLFA 4XQEA 2J5RA 4PZDA 1DRVA 3HG7A 2HMTA 4MVJM 3I3OA 5L7YA 2HMSA 4IXTA 1NWHA 2DM6A 4KUGA 3S1LA 4DLBA 3HE3A 2GPTA 3LC1O 2NACA 1YB5A 5T6BA 5DP2A 3FPCA 1HSZA 2OP0A 4JROA 4CV3A 2NTNA 3RROA 1GZ4A 4JP3A 4RQUA 3WXBA 3C7DB 3X2EA 1UP6A 4ND1A 5JMWA 1PZFA 3JQ7A 4XD2A 4N18A 5CEFA 4BO7A 4BVAA 2J3KA 3LT1A 1LC3A 3UOGA 1Y5MA 1NX6A 4RV9A 4XYGA 3BMNB 2PGDA 1NVMB 3ROQA 3AW9A 4MVJA 2Y66A 4ALNA 1K89A 4EUFA 4F46A 4MVJG 1H93A 1IB6A 1LSOA 3I6IA 1H6BA 1G1AA 3ADPA 5A3VA 3TDKA 4BO0A 4NFHA 4EEZA 4JBHA 4XQCA 1WP4A 2VNAA 4J2HA 2OMEA 4E13A 1T2EA 4EW6A 1BVRA 3GUYA 4S3MA 5TJHA 4BKRA 3V5NA 3E6AA 1LUAA 3O8QA 4ALIA 4J7XA 4B4OA 2UVDA 4ZQFA 5EL0A 2RBEA 5IF3A 2J8ZA 4M87A 3ZHZA 2CDBA 4WCFC 5KKAA 3HUDA 2WE7A 4ID9A 2GN8A 5ILOA 5B4UA 3U09A 3ICCA 1TT7A 4DTIA 1Y1PA 1B14A 1SOVA 5A4DA 1XIVA 4CMIB 5FYDA 2OUIA 3Q2KA 4TRRA 3BZUA 3ZNNA 2O3RA 4C7KA 3PGXA 4FIZA 4KWHA 1DC4A 4UVDA 2OORA 4OXNA 1NVGA 4Y6PA 3DMTA 1Y6JA 1Y8QB 2C5EA 2O3QA 3VPSA 3Q11A 1PS8A 5DNAA 4AICA 4M86A 2O3UA 4ZICA 5JDCC 5JW6A 4K28A 4DYVA 4LK3A 4NR0A 4XA8A 3V1UA 3TRIA 2NVUA 3PIDA 3I9NA 1ZKMA 3LT2A 1DDOA 3BAZA 3ITKA 5A9TA 4BKUA 1P1FA 2GZ3A 2ZB7A 1OZAA 4CR6A 2WYVA 3JQFC 3R6DA 5BQFA 2J5QA 2UUPA 2O23A 3ASUA 4M49A 4B3IA 4ZHSA 1U1IA 1UDCA 2WEKA 2PZLA 4J90A 4M8SA 3EHEA 3ENNA 3TZKA 4GLOA 2YUTA 1R0SA 2F00A 2EIHA 3WQSB 1M75A 3FCOA 1LQUA 3TQHA 2CY0A 4YT8A 2VZ8A 4CM8A 2PZJA 4FJ1A 4B3HA 4W7HA 1UUFA 3ZNQA 2DPGA 3FNFA 4GKBA 2ZATA 1BHSA 1GZ6A 4XB1A 1RPNA 2ZYAA 4B7CA 3DZHA 1YB4A 4GMGA 3NT5A 1O0SA 3L4SO 4HWKA 4DMLA 3E9QA 4CQMB 1C0PA 4MDHA 3ZW8A 4NBUA 4R5MA 1T2CA 3JV7A 3BIOA 4F6LA 1S6YA 3MWDB 3GN2A 4XYBA 2I6TA 4BNIA 3F4LA 4U0KA 1SAYA 1C14A 1PJLA 1QSGA 4HXYA 4Z6KA 3GEDA 3E5RA 3RCBA 5KVSA 1Y81A 3LLVA 1FDVA 4FGSA 4GI2A 2QHXA 5C7LO 1GV1A 4CMBA 5TRTA 2D2IA 3DHNA 4A27A 1ENZA 2Y1CA 3JYPA 4NIMA 3OIFA 5L3ZA 1C0IA 1RYDA 2H6EA 5H82A 4BO6A 4BKQA 3H3FA 4IMRA 3M2PA 4UUOA 5GZ3A 3LZ6A 3ABIA 3V8BA 4WEQA 4DC1A 1ZSNA 4PLYA 2HMUA 4J1NA 1T1RA 2QYTA 2PZKA 4F3YA 3WTCA 5KNLA 1KOLA 4L4XA 1E3WB 1LRKA 1V3VA 2B37A 4Q3CA 4UVGA 4J49A 3WS7A 2GN6A 3ZHYA 3DZGA 4XQGA 3DWFA 3INTA 1QYDA 4TZKA 4AJ4A 1PSDA 3L6OO 1TT5B 4HFRA 2PA3A 3CEAA 3WYEA 4KTVE 4A7PA 1YWGO 3RUCA 2CUKA 3MJEA 4TQGA 4XJTA 4M1QA 4NQZA 3QVTA 1V35A 3NEPX 4U8GA 1EFKA 3DZJA 3GAZA 2Y1OA 4WASA 1E5LA 1JWAB 4BKPA 3PQEA 1XKQA 2Y67A 4UULA 1IUKA 4R68A 2P4HX 4BNNA 3DOCA 3DBHA 5JYEA 2YW9A 3JQ9C 2GERA 1VM6A 2Y93A 3WQQA 1GYPA 3JQ6A 1U2DA 2BELA 3IC5A 2D5CA 3ULKA 1UH5A 1X15A 5CG1A 2BGLA 2VYNA 1YOVA 1QYCA 1NPDA 1HT0A 1UP7A 3UW3A 3BYZA 4PLPA 3PLRA 2QIOA 2FSVA 1EBFA 1C1DB 1XU9A 3JQ8B 3H65A 4NZ9A 2W2LD 4ALLA 2Q99A 2VWHA 3IKTA 4R01A 4YQZA 4MVJD 2ZB3A 3R1IA 5GZ1A 4WPGA 1E6EA 1WAMA 4OXKA 3QVOA 3NDRA 5B12A 3ICPA 3QSGA 2GLXA 3JSAA 1D4FA 4D0RA 1PGOA 3FTNA 1H6DA 1M6HA 2CNBA 2VHZA 3OF2A 1ZZEA 4YAGA 2Y1GA 3C85A 3WGGA 5A04A 1MGOA 2OL4A 2OBNA 1GADO 3PFWO 3L4BA 3IAHA 1NM5A 5CDYA 5COBA 2X7HA 1JWBB 3GQVA 1PU2A 2GUGA 5EPOA 5DBIA 4RL6A 5BSFA 3TFOA 3L07A 4I9NA 4PG5A 3I23A 3B70A 1KERA 4WGGA 1ORRA 3WIDA 4BGEA 4TKMA 5AXDA 5ICSA 4HFMA 4QO7A 5LDHA 2DTXA 1YQDA 1C3VA 5A5EA 3ZNOA 1BDBA 3VTFA 3NX4A 4XR4A 3L0DA 2ZK7A 3CPSA 2C2YA 3C1AA 3JYQA 5IN5A 2NQ8A 4BOYA 1YBMA 1E1NA 1YBAA 4ND5A 4R9RA 3HDQA 3K73O 3KZVA 1BXZA 4XX0A 1Q7CA 3LT4A 1YL6A 3ROPA 1K3TA 4R3WA 4HKTA 5I9MA 1GY8A 2VWPA 2A35A 4K1LA 2P68A 1UXHA 3G49A 3HWRA 4PVCA 3W8DA 1I2BA 2HLPA 5TGDA 3UCEA 3ASVA 4CM3A 1C0LA 2DLDA 3ONFA 1KBZA 4Q9NA 1PQWA 4A73A 5JS6A 2JKVA 3PYMA 3HN2A 3I4CA 5JDCA 2BFMA 1E1LA 4Z3KA 3MZ0A 2ZKLA 4CM8B 3UH1A 1VE9A 2YHIA 1P74A 1ISMA 3B6ZA 3E5MA 3H2SA 5JLAA 5A1TA 1V9LA 1VL8A 3ANNA 4CUKA 4ND3A 5FEUA 3AUSA 3PEFA 4FJ0A 2EP5A 1EUDA 3CTMA 4LRTB 3RU9A 1PS0A 2BI7A 5HRUA 5U1PA 3Q6IA 5F1OA 2O7QA 4WCFA 1KEVA 3PIIA 4PLVA 3WOHA 4UEKA 4GKVA 3PRJA 3HQ4O 2PV7A 3WTBA 2V65A 6ADHA 3OFSA 1YGYA 5B1YA 3VAZA 2VTEA 3LU1A 3GA0A 2DTDA 4FR5A 1YL5A 1WZIA 5LCXA 2RHRA 4AJNA 3RC7A 1Y9AA 4UEJA 2PD4A 2XXJA 1UXJA 2VN8A 4I1IA 2CVZA 4WK6A 5F1PA 4KQXA 1EMDA 3DBLB 3MJVA 3RAJA 5J23A 2YQ4A 3AFMA 3DB2A 2WTBA 1ZK1A 4R1UA 4WLVA 4WLEA 5IJZA 3PWKA 2GDZA 1V3TA 3VPXA 4W99A 2BF7A 3SEFA 5B4VA 2FHSA 5JCJA 3KYDB 1SPXA 3FBGA 1X7DA 3ZV5A 4CMCA 4CV1A 3W4IA 1ZK3A 2FZWA 2Q1SA 3E03A 4BNTA 3PHLA 5IFLA 3STHA 1XQ6A 3ZI0A 1CYDA 5ITVA 1MP0A 3P2YA 2O2YA 1Y5RA 5BT9A 2SCUA 2ZTUA 4MP6A 5T57A 1QYXA 2FPGA 2I9PA 3V2HA 1BW9A 2RCYA 9LDTA 3TZCA 3MTJA 4NHEA 1N8KA 4CMEC 3WGIA 3G17A 3IOYA 2A94A 1JQBA 2D0IA 3TOZA 4CM1A 2EJVA 1MA0A 2OBYA 2EKLA 4M89A 3DZBA 2VZ9A 4R5HA 4CQMD 4FFRA 1ZJZA 3KVOA 1XQ1A 1YKFA 2R6JA 2V6GA 4YT5A 1BDMA 3CZMA 4RF5A 5G0UA 5KJEA 3SLKA 3DFUA 4J7CA 1NR1A 3GT0A 3O26A 2PWZA 4IS3A 2P91A 4MVJF 3CMCO 3BMQA 4EJ6A 3AOGA 2GASA 1SOWA 2NU6A 1T1SA 1GYQA 4J3FA 3JQBA 1DIHA 1IPEA 3TSCA 4C4OA 2YQ5A 4E31A 3FBTA 4NI5A 4JK3A 3C24A 1DRUA 1H2HA 4I5DA 1QYVA 2PFGA 1FF9A 3EMKA 3PQFA 4YJHB 1A7KA 3QWBA 5FI5A 4BNFA 1E1MA 4YAIA 2YFQA 1UAYA 1CRWG 3EGOA 4IDDA 4L76A 2QW8A 4DRYA 4L0QA 5LC1A 3B1FA 4XRRA 4ESOA 4FC7A 3IIEA 5ER9A 5L4LA 4BKOA 4D43A 3GDGA 3HFGA 5H83A 1YRLA 1FDTA 3A1NA 4XQ9A 1GCOA 3CUKA 4GSKA 3BTVA 1KVSA 1N9GB 4LCJA 1KS9A 1SBYA 4XZ3A 2Q22A 4TKLA 4E2ZA 4L75A 1ZK4A 2QZZA 3ONDA 4U6SA 3FWNA 1QKIA 2AQKA 2NVUB 3CSDA 5JDIA 4QT0A 5L45A 2Z1MA 1F8FA 1E7MA 4YR9A 5HM8A 1HE5A 4ZQEA 1JTVA 1UP4A 3ZV4A 3ZWPA 1NQ5A 2PGLA 2PNFA 4RVUA 3S2GA 1PR9A 3I1JA 4BL5A 1J49A 5EIOA 4QECA 1CQJA 3AM5A 4OAQA 1TVEA 3CZRA 2IE0A 3OM9A 4BQRA 5G4KA 3TN7A 1JA9A 2G5CA 2DFVA 1E0DA 1G6KA 3HJAA 2P5UA 1NPTO 2X1HA 3Q0EA 2HDHA 2HUNA 5BNFA 1EK6A 4TSKA 1Q1NA 4BNMA 1EEHA 5C3MA 3U4IA 4NH4A 1E7YA 2CMDA 2EW2A 4ZJUA 5C5IA 1VL6A 3O38A 1WVGA 1BXGA 4I5EA 2HAEA 2NNLD 4OL9A 1P0FA 3PVZA 4BGVA 4YJHA 2GNAA 2B36A 2ZQZA 1E6UA 1JKFA 5MGBA 2G1UA 3GMDA 1XA0A 4CM6A 1XEAA 1DIBA 4IMPA 3S2EA 3WICA 1ULSA 2RAFA 2VWQA 1AGNA 3AI3A 4RJTA 2P9GA 1NASA 3WR5A 4ZD6A 1BGVA 1UZMA 3ENKA 1WLYA 4B8WA 1DIGA 3EZYA 3AUUA 4O5OA 3E18A 2XXBA 5EQDA 2DAPA 1NP3A 2NTVA 3I9JA 2VYVA 4NFYA 4DBZA 4HNHA 1F0YA 1I10A 1PZHA 1BMDA 2Q1WA 3JQAB 1T4DA 1MG5A 4JX8A 5JFOA 2BFAA 3JQAD 3E1KA 3NRCA 3PGJA 4OOFA 4OOEA 5G0SA 4QXMA 4XYMA 3ZV6A 2HQ1A 4DLLA 3H6KA 4AJPA 4A5OA 4ZRMA 3V1TC 4WNIA 1E3SA 2Y1DA 1ZUD1 5JDIC 2X58A 4G81A 3ZWOA 5JMPA 1E7QA 1R66A 5DT9A 3L9WA 4OSOA 4WCFB 5DOZA 3GUCA 4WOKA 3FNEA 5F1KA 3IKVA 4ALKA 3KBOA 1BG6A 4R1TA 3VVBA 4FFLA 5TSDA 5K6AC 3VDQA 1JVSA 2NU9A 2YFHA 3QWIA 4BGUA 4CMKA 5THKA 1RM5A 2AQ8A 2I76A 4BMNA 2VRCD 3D3WB 1NQAO 7ADHA 4JP2A 2AA3A 3FR7A 4H15A 1LDGA 4ILKA 5MDHA 2DKNA 4LSMA 3K30A 3MJCA 3K8ZA 3U5TA 1KETA 3JD2A 4J2OA 1T2AA 1VL0A 5C7IO 1Y7TA 4FSHA 2B69A 1H6AA 1JW9B 1YVEI 3MTGA 4G2NA 5JAIA 1J5PA 1CDOA 3AI1A 2NVWA 2ILTA 1ZMOA 3LK7A 2UV8A 3OH8A 3MOIA 1F17A 4OO3A 4D3DA 3JQCA 1E7SA 2ET6A 1I3MA 3WLFA 1UDBA 5U9CA 1ZMTA 2CVQA 4XCVA 2EKPA 2GGSA 3PJFA 4P38A 2VTDA 3RFVA 2AQIA 2NM0A 4HADA 1KVRA 1ZO8A 3TFQA 2DT5A 3F47A 4YEDA 3GVPA 1I3LA 4K9DA 3EUWA 3MJ4A 3MJSA 3RQSA 5EESA 4CM7A 4GQAA 4H16A 3HDYA 4E5MA 5LDGA 1SNYA 1EE2A 1LLUA 1ENYA 4DREA 3RU7A 4GX0A 4MO2A 4DIBA 1HYGA 4BV9A 3AOEC 4OIMA 5C7OO 1DAOA 2FP4A 1TEHA 1JN0A 5JYAA 3PDJA 1CERA 1HDGO 3A14A 4OQZA 5K6AA 3NV9A 5L7TA 1GU7A 4PGFA 1Z82A 4YQYA 3RUHA 4XR9A 4W7IA 1P0CA 5JAMA 2PZMA 2A4KA 4CM5A 4N5MA 4J1TA 2C5AA 3B1KA 1HF3A 3JQ9A 4IDCA 1O5IA 3KXDA 5GZ6A 3VKVA 2QRKA 2NU7A 1FDUA 5BNIA 1X0XA 1E3EA 3IUSA 1VI2A 5TC4A 3AFNA 3UUWA 2UDPA 5I8WA 4NK4A 4OGWA 1MFPA 1FXSA 5IN4A 3KSDO 2EV9A 5EERA 5J9GA 1B15A 5GY7A 3VZPA 4OJNA 2GR9A 1E3IA 3QE3A 3VH3A 3C1OA 4UEOA 4YAEA 1T24A 3KRTA 2AG8A 1GPDG 4UVEA 1Q0HA 5G4KB 4G65A 1I36A 2JL1A 4PG8A 3UCFA 3WBFA 2FWMX 3U4DA 5KJFA 4EUHA 3HB5X 3DBLA 2C7GA 1EUZA 3JCZA 3MCVA 4XDYA 5T73A 4G5HA 3H5NA 4RVDA 4D46A 2AE2A 1IY8A 4D0SA 1P31A 4J9UE 1P1HA 1N1EA 1YJQA 3EW7A 4YT2A 1X1EA 3FNHA 4NJOA 1F06A 3F1LA 1KEPA 2GN9A 2WWRA 3WG9A 1GQ2A 1PZEA 4IZHA 1ISIA 3D64A 3W6UA 4CUJA 3BMNA 3K6JA 4MP8A 4B3JA 2RH4A 3OETA 2O50A 4P4LA 4WCDA 3OMLA 4ZQBA 1IZ9A 4U0JA 2D4AA 1O9BA 4DLAA 3F5SA 4N5NA 4NDNE 2X86A 5AXAA 2NVBA 2JCYA 4GVXA 3UCXA 4EEXA 5CDGA 4UUMA 3DAGA 2WYWA 6LDHA 3LT0A 4E5NA 1ADCA 3I6QA 5JAZA 1A4IA 3ZWNA 1Q7BA 3C7AA 3DZIA 3QWFA 2P4QA 5DP1A 1XLTA 1G0NA 1GD1O 3LLSA 3ZU2A 1HWYA 1B3BA 1OAAA 4ZVVA 3KSUA 4YACA 4PLTA 5KJ1A 1ZIDA 1DHRA 4Y98A 2A92A 2WD7B 4OKNA 4CUZA 1B2LA 3H5AA 2ZTVA 2R2GA 4MINA 4N5LA 2FPPA 1I5RA 2Q45A 3ZWWA 2PH5A 3OQ1A 1EVJA 2HK7A 4NFSA 1Z7EA 1X14A 2O2SA 3IP1A 4TRNA 2Y0EA 4E4YA 4Y6SA 3WSVA 4C7JA 4BNJA 2X0IA 1XCBA 3PI7A 3DXFA 4RVSA 4CLRB 4DBVO 4FFOA 3NTQA 3DAFA 3GK3A 4NPCA 4B4UA 1LA2A 2PTGA 2WYUA 1DJNA 1NPYA 3SBOA 5JYDA 1U3TA 1UZNA 2FSSA 4UVIA 1WPQA 2VHXA 4QQRA 1LLCA 3C1TA 3TL3A 4U5QA 3BXXA 3RJ9A 4O0LA 4ND4A 3HNPA 3ORFA 3WNVA 4YBZA 4KQWA 3DEYX 4RZIA 3RUAA 3AY7A 1RYEA 3R3SA 2HJSA 3M1AA 5JPIA 4O1MA 3VOSA 1WDKA 5T5QA 4DIOA 1QRRA 2CVOA 1HXHA 4IJUA 2LDBA 4WOJA 4DPKA 3DBRA 1MV8A 4I8XA 1KVQA 1SMKA 3KSZO 1HSOA 5EMHA 1NVTA 5DBFA 3NAQA 1L7EA 1ONOA 1VPDA 5IXYA 1X0VA 4AVYA 1N1GA 4Q3BA 2RH8A 3QLJA 3JD1A 2I66A 1YB1A 5JC8A 1H9BA 3DBVO 4IDBA 3L4BC 4ZQHA 1XELA 3H9GA 2DBZA 4II2A 3E9NA 1W4ZA 3WWZA 2TMGA 4AJ1A 2B5WA 3E82A 4RO0A 2HRZA 3A06A 1ZK0A 3RBZA 1B8PA 2OFPA 3AY3A 1LSUA 4QSMA 1SB9A 3FRJA 3UHAA 1E3WA 3C3XA 3DTTA 4PLWA 1W6UA 1IULA 4FCCA 1PR3A 1ZNQO 4R41A 1J6UA 1ZBQA 2O3SA 3PZBA 3GHYA 3D4OA 1E6WA 4DWVA 3L77A 5KVQA 2Z5LA 2JAPA 1I8TA 4IM7A 5KCZA 2W98A 3IDSA 3KB6A 3GAFA 1R37A 3LDHA 1B8VA 2EGGA 2V6BA 1HE3A 3I9LA 2IXBA 4BNXA 2JFGA 1PL6A 4YRAA 2VUUA 1NFRA 2GO1A 1ISJA 3CXRA 1GFSA 5ES3A 1DRWA 4KMSA 2EGHA 1SEVA 4XWYA 4CV0A 3RWBA 5FI3A 2BFPA 1I30A 3PXXA 4Z9YA 1DXYA 1T2DA 2IYPA 4BHTA 4A03A 5ADHA 4MJLA 1OMOA 4J1SA 1OC4A 2Z1NA 1K6XA 5G2OA 5U4QA 3UAGA 1MX3A 3OIGA 1R12A 4PRLA 4NU5A 1ZSVA 1CQIA 2P9CA 3L6DA 4D3FA 4EUEA 2YHIB 1IPFA 1D8AA 4CLDA 3PFFA 4BNYA 4MP3A 3NDIA 4R1NA 9LDBA 2HK9A 4R69A 4KTTE 4PG7A 1YDWA 3N58A 2ZTMA 4JIGA 4GWGA 1QMGA 1BRMA 4TRMA 1G0OA 2JD1A 3FN4A 4FBGA 1GR0A 1H6CA 3B1JA 2OHXA 4IINA 5F5LA 5G0WA 3IS3A 2J3JA 4J91A 2NWQA 1P44A 3DZKA 4BO1A 2XPCA 3PHIA 4FJ2A 1N7HA 4YVFA 1XG5A 4BQPA 5KJ6A 2VYND 2QRLA 5TF4A 2EWMA 2VZ0A 1IE3A 4YJDA 1ENOA 2PKRA 1IZ0A 4LW8A 1B7GO 2O7SA 1KVTA 3KUXA 3VH1A 4FOSA 4GGPA 1H94A 1PWZA 1EQ2A 3D3EA 3M6IA 1HLDA 1A7AA 3SLGA 5A9SA 4GLLA 4OXYA 1R15A 3DHEA 3RFTA 3P5SA 2W2LA 5KKCA 1C1DA 1WW8A 2C2XA 5JYFA 1FDWA 3GOHA 3ANLA 1XHLA 3QWHA 3WIEA 4B7XA 1I3NA 3G79A 2HCTA 4GAEA 1N92A 1DIRA 4LISA 3ITDA 5KJCA 5EQFA 1SEPA 4DMMA 4R3NA 1GDHA 2FRDA 1JAYA 3LF2A 3ZN2A 1K6IA 1ML3A 3H9JA 5F3RA 4L9RA 4RZHA 4HFNA 2YHUA 3U0BA 2JHGA 2HJRA 1I32A 1HETA 3L9XA 2E82A 4RDHA 3RUEA 2FMUA 1ZXLA 1LI4A 3KV3O 1ID1A 2DQ4A 3JD0A 2F1KA 4AFNA 2E49A 4RDIA 2EG9A 1DC3A 3K2BA 3OHSX 4MKXA 1W0CA 2V6MA 3BA1A 2GZ2A 3O8QB 5DBGA 4XKJA 2B4TO 2C0CA 5BSHA 4IDGA 4JN6B 4K6FA 1RM3A 1K2WA 1Z7BA 1M6WA 4Z3DA 4PN3A 4YWJA 2Y1FA 2VT3A 2P5YA 3WGQA 3GEGA 2W90A 4ZA2A 4DIFA 5CEJA 2D1YA 3OJEA 1I24A 1KC1A 4QEDA 4E2XA 2WD8A 3WQRA 1NQTA 4UUPA 2I67A 5TIIA 1PL8A 4HX5A 2NV6A 1NQOA 1PEDA 1Z73A 2NADA 5JC1A 3ZCXA 2O4CA 2AXQA 3GNSA 5CG2A 2NSDA 3EVTA 3HB4X 1OOEA 1QXSA 3HDHA 1M76A 1BSVA 1Y8RB 1H5QA 3CMMA 4YDRA 5I9NA 4J4TA 1Z75A 2QYSA 3R0IA 2PKQO 2E37A 3H8VA 1PJQA 3JYLA 2WJPA 3S2FA 2B35A 4MVJI 1LDYA 3OJLA 3FNGA 1PZGA 5AXBA 3DMTC 3CINA 4L74A 1VLLA 5KVVA 4UVHA 1GL3A 4YPOA 5L4SA 1AUPA 2PKQP 2Q4EA 3VTZA 3BMCA 2HO5A 1X7GA 5T8KA 5L53A 3OECA 3L6EA 4DQUA 1VRWA 3HN7A 3TZQA 1V3UA 1MXHA 3TOXA 3WGYA 1WZEA 3DDNA 4NNJA 4A2CA 4I9UA 1PGQA 4RGBA 4IQ8A 2CF5A 2DUWA 4PLZA 4DQXA 1Z45A 3PWZA 4AL4A 1LQTA 1ENPA 2ZYDA 8LDHA 1V8BA 3TF5A 3KYDA 1O8CA 3M1LA 4EJMA 1FJHA 1B3RA 1YONA 2DBQA 1LSSA 2XOXA 3EY4A 3GGGA 5TLSA 2JFFA 1ZH8A 2J5KA 3PQDA 3F4BA 2I3AA 4U7WA 4RF2A 2WM3A 4DVJA 3KTDA 1HDZA 2FY8A 5EINA 5G0TA 1IHXA 2J3IA 2BMAA 1BWSA 2D8AA 1KEWA 4J4HA 3OJOA 3M2TA 3LSYA 3FI9A 2CDCA 3NTRA 1EDOA 5B4TA 5L9AA 4W4TA 5G0VA 1D1SA 2AEJA 2D5AA 4RVGA 5JE8A 3ZU3A 3KETA 4B7UA 3QVXA 1VJ1A 3D1LA 3O9ZA 4RF3A 4BMVA 2POQX 3GMSA 1R4NB 1XDWA 1A5ZA 4YT4A 1RKXA 1ARZA 4UAGA 2IXAA 3D7LA 4BUCA 4L73A 1MC4A 1YL7A 1HYHA 5DCUA 3VPFA 2G76A 3HFSA 4EITA 4BV8A 4RLHA 1I3KA 2Y0DA 5ITWA 3UF0A 1F8GA 1A72A 4MPDA 4J4BA 2C07A 5BSGA 3JYNA 2R00A 4OQYA 3TZHA 3B20A 1U7HA 4IGEA 4WKGA 3I83A 4I08A 1ADFA 2VCYA 1K6JA 5BSEA 1I01A 3QVWA 1U2GA 2AE1A 1Y8RA 2BFOA 3G0OA 3UICA 2NQTA 3DO5A 5L40A 2Z95A 2DPHA 4FFMA 4CMHA 4ND2A 1PJBA 2HU2A 2YZ7A 4FFPA 2W8ZA 1LRLA 2J6IA 4BO3A 3K96A 4E6PA 1DC6A 1GCUA 2VQ3A 1Y9EA 3AM3A 1LTHR 4Q3NA 2X22A 4NU6A 1DJQA 4Z0PA 1EVIA 4P4GA 5FF9A 1YQGA 1HDYA 4YAKA 1SO8A 3WFJA 1CIVA 1LDMA 2CD9A 1ZFNA 3JQFA 1VSVA 4K26A 5ENVA 2DTEA 4PZEA 1E7WA 2OO5A 2FZEA 2VUSA 2X0JA 5F5NA 4E5YA 1UZLA 3QVSA 2DVMA 3QRWA 4PG4A 2IDZA 2DBRA 3WMWA 3N74A 3NJ8A 3ZWMA 5I7FA 4WLOA 1WWKA 4OYRA 3DL2A 4CMIA 3K2EA 4CL3A 1VC2A 3MOGA 3IMFA 4Y8VA 5F21A 1N5DA 3GGPA 3QY9A 2X6TA 5IDQA 1PIWA 4XGIA 4FC6A 3GFBA 4IDAA 4EZBA 1LLQA 3D5QA 4PFJA 4LSWA 3BTOA 4WEOA 2DU8A 1CJCA 3RSHA 4RPJA 4DYDA 1VSUA 2H63A 2IZ1A 1AXGA 3OA0A 4LMPA 3RUFA 3SJUA 2JCXA 1EFLA 1E77A 1Y8QA 1YOVB 5COAA 4MVJH 3EAGA 4E5PA 3NGLA 4LGVA 1M66A 3HSKA 3ZWAA 5IDXA 2ZB4A 4YA6A 3OJ0A 1TXGA 3H9UA 2FN7A 4XGNA 3Q9NA 5AYVA 3IQDB 4NBTA 2X9GA 2B83A 3RVDA 3F9IA 1ISHA 1E5QA 1HEUA 4PLHA 1V6AA 4IUYA 2V6FA 3KEQA 3U4HA 4E5KA 2RHCA 2D3TA 1NYTA 2QX7A 5JO0A 2PLAA 2ZJ0A 3FHLA 3AK4A 3WYCA 1GEGA 1HE2A 1U9JA 3GVIA 4PLCA 1PX0A 3QIVA 1P33A 2VWGA 4GPD1 2EKQA 1Q2XA 1Z74A 4FGWA 2PK3A 1P1IA 1N7GA 4GL4A 5HBRA 4D7AA 4Y9DA 3V2GA 2X5KO 4B79A 4NJMA 1GPJA 1ZEJA 3PHGA 1MB4A 1O95A 5KOIA 2HMWA 2VYVD 3JQGB 3RASA 4D42A 1LEHA 4O63O 3AUTA 3I9MA 5AOVA 1DSSG 5A5FA 4BO5A 4BO8A 1U8XX 3JQ7B 4J6FA 1O6ZA 2AG5A 4FOOA 2O48X 1U4SA 5JO9A 2E48A 1U3UA 2DFDA 1LC0A 4E30A 1ZK2A 2UYYA 3E9MA 4O59O 3RBXA 1EK5A 4R1SA 1PQUA 2Q49A 2AHRA 3ZV3A 5JY6A 1NFQA 5AQ1A 1NHWA 4CJXA 4DL9A 4P4NA 3W1VA 1FMCA 4IZIA 3JQGA 4KDFA 3ON5A 1S7CA 1SZJG 4GMFA 1SCUA 3D3WA 4KP7A 3ROKA 1DHTA 4UREA 3T7CA 3WMXA 3PJEA 3DR3A 2O3JA 1U5CA 2X5OA 2NTJA 4KUHA 5DOVA 4Y6RA 1RWBA 4GX5A 4H3VA 4YJFA 3ZWXA 4X54A 5CDSA 2BHLA 3GRKA 2AEMA 4LRSB 1ZEMA 4DQVA 3UXYA 2Y99A 2Q1UA 3VZRA 3KLMX 3R3JA 4IXWA 5CPFA 3WGHA 1QP8A 2YV1A 1JAXA 3TPCA 2VHWA 4M55A 3VH2A 4IIUA 3A4VA 4PZCA 1HKUA 3KYCB 1P77A 3N7UA 4ZGWA 2OXIA 2DBVO 4E3ZA 1PJ4A 3ZWBA 1D7OA 3NT4A 4YJGB 1GQQA 2YDYA 3Q1LA 3F1KA 5CFZA 4E0BA 5I7VA 3SC6A 1WDMA 3NGXA 3OSUA 4WECA 2B4RO 3O4RA 4RORA 5A3JA 4PRKA 3ZH2A 4FB5A 4KWIA 4XDZA 2OZPA 1YH3A 1KC3A 3DBRB 1ULUA 2O3TA 3WB9A 3TL2A 5IZ4A 4Q3EA 5A06A 3UN1A 4CLEA 1U3VA 3IL2A 3U49A 1EE9A 3H2ZA 3KHUA 3ETEA 3OJFA 4A26A 4PIVA 5ER6A 1OFGA 3GFGA 1Z6ZA 4PG6A 1VKNA 3JQAA 1QYWA 3KM0A 1M67A 1P1KA 5T67A 4LN1A 1HYEA 3FD8A 5HA5A 3HHPA 4OHUA 2ZJ1A 3ROMA 3TNLA 3U4CA 3GVHA 4BS9A 4GX1A 4WE3A 2HMVA 1R4MB 5ICMA 2BLLA 4AJEA 3GR6A 5TT0A 1VKOA 2C29D 4I5GA 1C1XA 1P9LA 4KUEA 4A0SA 3NTOA 3RIHA 1PQPA 3GDFA 2VOEA 4RPKA 3E8XA 4DC0A 4CM9A 1UJMA 4II3A 1PWXA 4TWRA 3KOUA 4DGSA 3VPGA 4RVFA 3TZ6A 3G1TA 5ILGA 5L4NA 5FWNA 1KEUA 2PD6A 1B8UA 5JY1A 4PCVA 3OICA 4CMAA 2CDAA 3KLPX 3WJAA 3H9EO 1TI7A 2AW5A 3UGKA 4BNWA 4J1QA 2GYYA 1AXEA 3U62A 2IZ0A 2X0NA 1E3JA 4UUNA 4YXFA 5IAAA 1DFIA 4CR8A 1JVBA 4A10A 5GMOA 4Q3DA 3NUGA 2WE8A 2ZIZA 5CDUA 1HL3A 1LX6A
chains in the Genus database with same CATH superfamily
3BF8A 4E09A 1PGPA 1J9GA 3H5RA 1OCEA 2P9EA 3FUTA 5JH7B 2AFHE 1GR1A 1W1WA 4YJFB 1KR2A 4CF4A 1D6MA 2OQRA 3FB4A 5MFZA 1Q1GA 3JQDA 2R68A 4LJLA 4EYOA 2JRCA 4CODB 5F5XA 5ALFA 5AICA 4LBWA 1Y9ZA 3JQPA 2C7BA 4OHMA 1QQAA 5CVCA 3ZE0B 1YOBA 3KBBA 2J3HA 3ZK8A 1M2WA 5IARA 1T8PA 2I6SA 1XGKA 3LUBA 1ZG3A 4WVLA 3AU8A 2Q5FA 1CQXA 1EJ2A 1K0UA 4JC0A 4RQTA 4CM9D 4BXOB 1TK9A 4NK5A 5A05A 1XP8A 1JG3A 3BIFA 2MSWA 3H05A 4NJEB 4NSNA 5ESWA 5KDLA 4YRIA 1RXIA 2WSYB 4N5HX 3PQCA 2AMLA 3Q9UA 4TLEA 1IN5A 3D6AA 3MD0A 2PUFA 2R8ZA 1OPXA 1WNTA 4P3PA 5BURA 2BDTA 2PL5A 2LDXA 4LXIA 3OP4A 2Q8PA 1JHRA 3CLTC 2FOIA 2FWJA 3WNCA 2RAUA 4X6UA 4BNVA 1H69A 3EQ8A 4IHAA 1GA6A 1XTRA 1N2SA 3MWEA 3OHPA 4N9WA 5AI0A 5TPWA 2HSDA 2VAMA 1IH8A 1ORVA 2ADOA 2J5XA 5ALDA 5CX1B 4GBJA 2HA5A 4EJSC 3ADOA 1KZ1A 4YO7A 3GO4A 3OCYA 1H2BA 1YDEA 2VS1A 3B2EA 1JEAA 1NU8A 3HH8A 1TUIA 3KZXA 3O1HB 4MKRA 4PZLA 1E2PA 1X94A 2X3UA 4CU2A 5JS7A 1LFDB 2XQFA 1OLOA 1FNMA 4ROSA 3T95A 2WKPA 3VSAA 3BWVA 4QBFA 4UM8B 4EHDA 1MC5A 3DAPA 2NZ8A 3HZZA 3LKZA 3QW2A 1RYFA 2R2AA 3A8TA 1SBTA 5DTQA 1MF7A 4YBRA 1Q1ZA 3UAYA 2GRAA 4URZR 3DTVA 1J1IA 1PGJA 4G67A 5TQVA 4KN9S 6GPBA 2CJYA 4E32A 3IALA 5C4GB 3G8YA 1X2EA 3P52A 3CBGA 1E7RA 5ALZA 5JEEA 4ZGGA 2P35A 2X9LA 1L5RA 3AI2A 2EEPA 4J76A 3DNMA 2ZUTA 1I0ZA 2AFRA 1EQAA 3G02A 3TE7A 3WQHA 1I6LA 1P7ZA 4TTJA 4AJOA 1KI6B 4QUKA 3EPHA 1K88A 2G82A 3A05A 5TEWA 1O54A 1ODSA 1PGNA 5GM2A 3WHLA 1V7CA 4BO4A 2AG0A 4KXMA 2O06A 3EZ6A 4H1UA 1XZKA 2X4LA 2JJYA 1S2MA 3NKLA 4LYYA 1MJFA 4NQRA 4H6WA 4ARVA 3W90A 3KFVA 3SOPA 3VNQA 1CWUA 1CRZA 5IJ9A 4JI0B 5F52A 3ZDBA 4TS1A 2D5IA 1AY0A 3A9WA 5JNTA 1NXTA 1GNQA 1YE8A 3FWYA 3ZWCA 3WGTA 2FN4A 3KEOA 5BOSA 3TLGA 3HXPA 3E3MA 1EWKA 1X39A 4Z7NB 1JJBA 2WINI 5BNZA 3LZCA 4BO2A 4ZQGA 5AVZA 2H1SA 3ZU4A 3BJZA 5CA1F 1GQFA 4LY0A 4RENA 1CJMA 2RGAA 1R1DA 4HY3A 4NZMA 3FDFA 4QUEA 1C7QA 1RC1A 4XJSA 1C8VB 3BMOA 1QHGA 2M98A 4IV8A 3PYLA 4L5CA 4MRMB 3OFJA 3LOPA 3INGA 3P2IA 3OD5A 3PTZA 3QX9A 1KJYA 3GVXA 4RA9B 5FB3A 3QPBA 1NMQA 1GUBA 1GUDA 3JYOA 1CYEA 4MV5A 3ZBQA 2O6LA 4A3SA 4EG0A 5CAEA 4KMOA 2Q3CA 3OPYI 1KMNA 1ZYUA 4XWWA 2QUKA 3KYCA 2GXSA 4JNKA 1QO0D 1DRKA 3H2JA 3L0OA 4ZARA 3TRHA 3PPYA 2AFHB 3SSOA 4RM2A 4DIMA 5EJEA 5L3SA 2ZROA 3JQEA 4EB8A 4P93A 4ZJPA 1K5DA 3SC2A 2VHYA 1R8JA 2VAWA 3PKJA 3QITA 4M99A 4X1YB 3SNKA 1CUXA 3V1YA 4RCVA 3AZPA 4RH0A 5EQTA 5CP8A 3GT3A 1EINA 3VNAA 1YMVA 1ZNZA 5ADWA 4OJQA 2Q3HA 1U2DC 3VYTB 5DYIA 2AOUB 3TVYA 3UUFA 1YQTA 4ALJA 2ECQA 3DNFA 3QH4A 4L27A 1YIAA 2AMFA 3AXSA 4M9CA 4KSBA 2YCLA 3HGQA 2CN1A 4PYRA 4BO9A 3S55A 4YAWA 3N2IA 4IVNA 3FG9A 3G3EA 3O3NB 2YZMA 1JDZA 4MR9B 4B6OA 1PWEA 3V2UA 2W2KA 2ZETA 2OUKA 5EUBA 2TYSB 3O2SB 2IEDA 4Z9XA 2OAGA 3S2IA 1KI3A 1SBZA 1JB9A 3INNA 5KDOA 2HSEA 4RJLA 3AYZB 2W58A 3M9WA 4O4HB 2NYRA 4FUTA 2QAGA 4CIYA 2H1OA 1DFHA 2YRWA 3TW6A 3KXKA 1JDTA 1R4MA 4DCGA 3TH5A 4YUWA 1W75A 4MPTA 2XZTA 1ZSYA 2BGMA 3SXPA 1C4WA 1CEQA 1N8NA 2R96A 3JTEA 4NBRA 4EYEA 5BMVF 2N47A 4PM4A 5JIBA 2DUUA 3L1IA 4GKKB 4JC8A 4U63A 4FYKA 2K7ZA 4Y0NA 4UBMA 3BA6A 4K6KA 3VVCA 1O5OA 2GSDA 1WSBA 3PHJA 5AI6A 4JJ7A 1UDWA 4PPFA 3KSRA 1IYZA 5AP9A 1ULHA 1BROA 2QQGA 2C1EA 1JLLA 5C18A 5IHPA 3KTAB 2B5OA 3IP5A 4Q34A 3IO5A 1SGWA 5AKIA 2GF2A 1X42A 3N8GA 1JXOA 1SB8A 4CF5A 5LYYA 1KHHA 1QG0A 2BZ0A 2G8NA 4HQRA 4LDNA 3J7AC 2JHFA 3AR2A 1L4BA 1PNRA 1PT9A 2OCYC 3MS4A 5J2UA 3QLTA 1V4BA 1MXFA 1DX9A 1ZD4A 3GI1A 3L0ZA 3MTDA 2PCJA 1Z5OA 4OKIA 4IDEA 1HBJA 4ZT2A 3UGJA 1COWD 1S2GA 1TTTA 5E1OA 1E3TA 2ETVA 3F46A 5GQSA 4JITA 2PMKA 2YNMD 4F92B 1U98A 1JKJA 5K8IA 5BSTA 5JSFA 4INAA 1OFTA 3K16A 4DMFA 1LWNA 2I2CA 1OU0A 2VT6A 4GNKA 4W82A 5T3YA 3NT2A 4G0MA 3WDSA 3CE6A 1ZJYA 3EASA 3EBOA 5HKLA 2DR2A 4HDSA 3D4NA 4JJKA 4QL3A 3LPAA 5I4IA 2BVNA 4B3BA 3L7CA 1A97A 4O4JF 5JJBA 3ZJ5A 2OK8A 2DC1A 4TLLB 4AF7A 1W4BA 3IVXA 4A8HA 3QPAA 5LJIA 1V25A 1WCIB 1EP2B 3B52X 4KQKA 2KS6A 4PC6A 4X90A 1VJ0A 3URKA 4AIIA 4D3SA 5HYVA 2DXIA 2G4VA 1UWCA 1THZA 3GAAA 4KI7A 4OGGA 1RFLA 3CLVA 1U5AA 1FDSA 5ALXA 1AUQA 1BOOA 2YNMA 3OPXA 4UMVA 5IAOA 2A30A 2W6ZA 4KYUA 4LSZA 4Q1VA 2NLOA 3OX2A 4AZ3B 1AH2A 2X19A 5EIHA 3H4IA 4FHEA 4CCAA 3DWEX 1M1UA 3PUXA 3T38A 4CMJA 2OO3A 1QJCA 3KAPA 3OOSA 4JC4A 2BOVA 4TN5A 3GJQA 2H0AA 5F51A 3TCXB 4F72A 3JASA 1I2CA 1YE3A 1EDZA 1V39A 1WKBA 2I03A 2JBHA 3MTIA 4PV7A 3H6GA 5M6DA 2MR6A 3AEQA 3ER6A 1T25A 3FPGA 1J9EA 2RCNA 5T8KC 1CRQA 2ZRGA 2IH5A 3U9LA 2C59A 2QQEA 1E8NA 1EZ4A 3LO8A 5CNIA 3BFXA 2Q5CA 4L7QA 1A9RA 5AVOA 2V7BA 5B2EA 3IPCA 3T52A 1JLLB 4TYPA 5DYTA 1YBHA 1KFJB 3N3AC 5GP1A 2Q50A 2VRWA 2XQJA 5IKOA 4C7BA 1CY6A 2EJWA 3K9QO 1TL7C 5JXHA 1HEYA 2XTZA 1O2DA 3FYSA 2XZDA 5DX8A 1RS0A 2FPWA 5EKSA 3OBBA 1OB2A 1G20A 2D1QA 4OA5A 1L2TA 3ZVLA 7ABPA 3PJGA 2XNHA 4G85A 3ZWVA 1V1MA 3ONEA 4MI9A 2FSGA 4QXAA 3UMRA 4UQPA 3ZHQA 3PWSA 4KZPA 2GVDC 3DVRX 2I3GA 1PDOA 2EERA 4Z0HO 3DVAA 5B37A 5C52B 2QN2A 2VYQA 3JAKB 1ZGHA 3KK0A 3GVCA 2A0WA 4Q9JA 4LJYA 4QOGA 1S1CA 1SCBA 2OD2A 3THWA 1S2DA 1R9NA 4TTPA 3BHMA 4LDRA 2P2SA 2EWWA 2QTFA 3FCCA 4Y2RA 2CHUA 2D2VA 4D9HA 2VPWA 3OOWA 3ETNA 3K92A 2ZULA 3PC8A 4MV6A 4DDKA 1P1CA 4B33A 4PR3A 1F2UA 1XZEA 1JA0A 3OMWA 3OX4A 1DEOA 4LOIA 2P11A 4Z3OA 1SUDA 3DMDA 4FS3A 4Q39A 2ZQYA 3KPYA 2JGLA 3VNVA 3R0ZA 1NXXA 4HEA1 1YUBA 4E21A 3KLBA 3ZKAA 2P30A 4IJQA 1NMYA 2IX3A 1DBSA 5KTMA 1Z3IX 2N75A 5A3SA 3UGQA 1U8UA 4B3RB 5EJ2A 4G1BA 2CLCX 2CVFA 3ZWDA 4ZZ1A 4V0LA 2QN1A 1SHLA 1P5FA 1L3IA 1Z16A 2GBIA 5JWOA 1SKUA 1XV5A 1DXQA 1EBUA 4BP8A 3ENZA 1DQPA 1X74A 2IC5A 2PSHA 2WA2A 1YZYA 3BWBA 1X9IA 3PGMA 2G3YA 1NAIA 1DIAA 2MSCB 4D2IA 2IIQA 2BM8A 4C21A 4TRJA 4N8SA 2YZNA 5CYFA 2BGKA 3V33A 3DPSA 3LUDA 4CR7A 2XAAA 3F71A 5KIAA 1QK3A 2HPAA 3TW3A 4CMEA 2ZCUA 3VHRA 3GYBA 4LPKA 1PAUA 5KNDD 3AQ4A 3EVAA 3V7NA 4MS3B 1Y6FA 4PXSA 4JHLA 5IBPA 1U1FA 2WOOA 3OQNA 4A6PA 4B32A 2GM4A 2QJWA 2GCNA 3Q88A 3MIZA 4WINA 5A9SB 5BN3B 2JJQA 2WP8J 1CHDA 4WY2A 4QPJC 1ODTC 5HTKA 1MHTA 2WHPA 3BSFA 1E79A 4G0QA 4M0UA 2HRBA 2G0TA 3OEWA 5FNVA 3SU8A 1U8FO 3GDOA 4EYGA 3CT4A 2JA1A 1DO8A 4H18A 5IKMA 4Y9RA 3TZEA 4HUJA 1G41A 3JVIA 1PV4A 1XSEA 2A78A 2QN9A 3V48A 4CLXA 4IQ0A 1X7WB 1E2UA 3SQXA 1A3CA 3I52A 4F4FA 4OVKA 2JATA 4WWHA 3BCRA 3Q72A 5BR7A 1LDBA 4AJ2A 1MTOA 2BL4A 1JEQB 1R0CA 1U4OA 3O93A 4EW1A 4F2GA 5IJ0A 1M7GA 3AT1A 2HKIA 4RD6A 3MFYA 3LHKA 4TLMB 4QPPA 4ABYA 3JWHA 3L05A 3PNKA 1M5TA 3K31A 2YIVX 3VYSB 1BMTA 1EX7A 4PGAA 1L1EA 1IN4A 2PPVA 1IHPA 1J2TA 3C3KA 3V4FA 4BU0A 1R6XA 4Z4GA 2HV9A 3MTQA 3CF6R 1IXRC 5F73A 5FA5A 4QGSA 5JTUA 2QN6A 4JA2A 2JFHA 3ETCA 4GMXA 4E1VA 1V2GA 1LPBB 2FSIA 2I4OA 2OGUA 2VDKB 3F3SA 4IIGA 4LMBA 4MOWA 4Q4LA 1M0TA 4XOIA 4YV1A 2QJTA 3CVUA 3ETGA 3P9CA 1EVYA 4IJMA 3UMBA 1YHZA 1UKAA 4HP8A 2FZKA 1CE8B 3GGOA 1T5SA 3LP5A 4LCEA 3O47A 5DGDA 3FPBA 5AXCA 5HFNA 4MWDA 4AG3A 1AC5A 2AN1A 5JBIA 3DBHB 3OZTA 3UYKA 1A71A 1CUVA 1T3ZA 2I80A 2DP4E 4L9WA 1HZZC 1UCFA 1QKJA 3DZDA 1ZL0A 5DHAA 3M1YA 1CFJA 4HATA 4YCAA 3TQQA 2Q2WA 1OFIA 2YXDA 1KVUA 1WXHA 1LRJA 1SUAA 3RADC 1YO6A 3C5HA 1GZ3A 3O8BA 3COSA 1AQYA 3LDGA 2QUBA 5TS3A 1JAZA 5K2MA 4F5EA 4CIVA 1GTMA 2I0FA 2QBYB 3OT1A 4YP6A 2P6PA 3WBBA 2GRJA 5I6DA 2AX4A 3OWXA 5FAKA 2PBRA 2VPTA 2VSFA 1LSJA 3TQCA 4CQMA 1C3OB 3IE0A 5HG0A 1DAPA 2ZS9A 2ALJA 2GS9A 2H2IA 2QTHA 1HRDA 3KOXA 1LXCA 2X9VA 4M7PA 3UM9A 1MJHA 2ZTLA 3DL0A 1B4DA 4E22A 2EGUA 4F6CA 2D2XA 3DXZA 4UTOA 4H2DA 3TVTA 2K7FA 4RWZA 3HU2A 2A59A 5HF5A 1Q2UA 1FXWF 4BECA 4QU9A 1VFPA 2BKAA 3N5KA 5SZKB 3ZNPA 2BF4A 2YWEA 1VKRA 1JIUA 4E3WA 3FLBA 2GD1O 1HLPA 3GLIE 5F35A 1PI3A 1Q1EA 1PJ3A 1TPZA 3HI4A 3RVNA 2HM7A 4ZMRA 2EOAA 3D8SA 3KR1A 3TPFA 2WHYA 2GCOB 1UJ4A 1R00A 1UQTA 1KYQA 3D5TA 1TT5A 4YJ2B 4KE9A 3D2LA 2J87A 2X4GA 3FSRA 3HPQA 3IPAA 2H2DA 1BCSB 1FYFA 1Z0SA 3AOEA 4ENPA 3ZHSA 2VXBA 5K3EA 4KXLA 2PJZA 5HS6A 1VL2A 2L2QA 1IWPB 4X6XA 3I0ZA 5SZJA 3SEZA 1MFZA 1ZLXA 2XB4A 3DT8A 2UUOA 1FDRA 4BC0A 1O87A 1P9OA 5BN4A 1AUOA 1NURA 1OAOA 1GUFA 2VPZA 3HU1A 4M9UA 4RK1A 3T3MB 3TXAA 4BJ5A 4E2FA 3H2GA 2WQZA 1SUWA 4NP6A 1QVRA 1EJBA 4YCJA 1VBKA 1GZ7A 2AVNA 2FPPB 1EWYA 1DBQA 4PQYA 2X9NA 3OEYA 3H5TA 3PDHA 5C1DA 4IJVA 1A27A 1O96A 1P9RA 1Q7EA 3C8HA 3PP8A 4KPUB 5K4AA 1P7PA 1XJ5A 2PX6A 2PY6A 2YWGA 2P2DA 3K1TA 3KQYA 3LVBA 4IJKA 1MN6A 3ZDYB 2IYUA 3N0TA 2Q9BA 3IA2A 3O8OB 1PZXA 4NBNA 4QLOA 3NDJA 4QUHA 1YBVA 3L93A 4IRUB 1JJAA 2B8NA 4CLRA 5CVJA 5J3JA 1G3RA 3MJTA 2GNOA 3HO8A 3NV7A 2AJTA 3B38A 3T5MA 2O8BA 4QOEA 4OUDB 2ZYGA 3UV7A 3ZHBA 1FQWA 2EHJA 3DWGA 3OQIA 3OZAA 5AVUA 3KFXA 4HDMB 4YCNA 2C4MA 5A03A 4MIEA 4K7JA 3IRUA 3P9SA 1GPBA 3HJFA 3P7MA 2JCVA 1ODCA 2C2WA 1NVEA 1WMBA 4YROA 2O7NA 3G2KA 5C7YA 4F2WA 2J9FA 1M34E 1QIDA 4EPYA 1P4RA 1K63A 2Q2VA 1DLJA 3L7JA 3MJDA 4IOLA 4WLFA 2J5RA 1XTIA 1FPMA 1SXJD 1VIYA 1GGNA 1JAIA 5L7YA 3ZBPA 3HTXA 3FAZA 4IXTA 3G23A 2FFJA 1RFGE 2DM6A 3S1LA 4DLBA 2BFEB 1K97A 4CFSA 1BCSA 3ZTWA 1YB5A 5T6BA 1D1QA 5DP2A 2HQBA 4LWZA 5DM0A 4D8VA 2XMZA 3V3KA 1TA0A 2OP0A 5CH3A 5EWLB 4CV3A 1V11A 4EHFA 4J0GA 3WXBA 3X2EA 3MRVA 3C7DB 2GM5A 2DMRA 4OHYA 5FOVA 2E55A 1CQWA 2R6HA 1XJQA 2WHQA 3JQ7A 3N2NA 4JXJA 4IILA 1UBOS 1SOAA 2GHQA 2O0KA 4HB0A 4BVAA 2J3KA 1M33A 3LT1A 3RS4A 4YLYA 2ODQA 3V2IA 4L2IB 4DLYA 2W2XA 1NVMB 1OX6A 4WCVA 1ISSA 4E6EA 1D0SA 1NT4A 2MSLA 3QUAA 4ZT4A 4JB0A 1OYWA 3WGVA 1WLSA 1ZH4A 4UPEA 1KWGA 3UPTA 4ZYZA 4P5EA 3W78A 1H6BA 1DOAA 1G1AA 1I2DA 3ADPA 4BO0A 1GJRA 1UKYA 2W2TA 4RHYA 2I2BA 5C1IA 2YMMA 4JBHA 1KNXA 2I4LA 2K2QB 4KG7A 1KMHA 1ULTA 4W8HA 3M9XA 2VNAA 3K05A 2GN0A 1BVRA 4I9FA 3RHSA 3Q4GA 4FE3A 5B3AA 4BKRA 4E2YA 4DEYA 5K05A 3F73A 1LUAA 3TSOA 3IPRA 4LBZA 4ALIA 1OR8A 1VSBA 4LXQA 4K9QA 5EJ5A 5IF3A 1IZZA 4LFAB 4COKA 2CDBA 4WCFC 3IV7A 1GFIA 2PWYA 5AM1A 1Z5WA 5CFNA 2DE0X 1C9YA 5B4UA 3LCJA 3ICCA 1TT7A 2GXUA 4COOA 1B14A 4DTIA 1ITZA 5BSRA 5A4DA 2NXEA 4E5UA 4TRRA 3WGUA 3L1VA 1RRFA 2LNDA 3PGXA 3PL5A 1UADA 4KWHA 3JARA 1WBBA 1DC4A 3AEKA 1H5NA 4CKBB 2OORA 1GA4A 3PI6A 4LOJA 3JVEA 4UTPA 5CAEB 2O3QA 5FTKA 2MYUA 4A9AA 1L7BA 4AICA 1YR9A 4PIMA 2PPLA 3CT6A 3RYFB 5JW6A 3NM6B 3K6SA 4J0IA 2QVCA 5A4KA 4LK3A 1YE5A 3QQ5A 3HA5A 3KPJA 1Y33E 1Q6ZA 1F0NA 3N05A 3Q2OA 3TRIA 2J0UA 3V1UA 4MW2A 5IH7A 1QC5A 2GK6A 2BFFA 5A4MS 1ZKMA 3LT2A 2E3JA 1Z4PX 2FV8A 2I1LA 3ITKA 3KYJB 1AT1A 4UNNA 1IN8A 1PTJC 1TIKA 2LIVA 2WYVA 3G5MA 3R6DA 5FWXB 2F9FA 4ENSA 1UM9A 4IVRA 2WJVA 4J0KA 5ABPA 2WEKA 3NALA 1T9KA 4J90A 4A8JA 3EHEA 3O8CA 3RAFC 2CNOA 2ZRIA 2VYFA 1F3LA 3SSNA 1LNSA 4N5DA 4HLDA 3WQSB 4V1CA 1I3OA 2QL6A 5EIXA 1W5AA 3VJKA 4IXMA 1PK8A 1ESZA 4L16A 3VO9A 4MGYR 4YT8A 4O02B 1SFRA 4Q9KA 3B3QA 4RK0A 2DHQA 1A77A 4DR1B 4RSHA 1PDWA 1T0JB 4HH1A 2UZ4A 4XB1A 4LY6A 4CKCA 1AS3A 3RG8A 4AY5A 5DLPA 1W4AA 3H8JA 3OQVA 5BYBA 3QLUA 3AP1A 2EX4A 3L4SO 1P19A 4FEYA 4I55A 5I7OA 3G0BA 3RVOA 5D1NA 1C0PA 1TW3A 4UDOA 3EPAB 1W581 2OFOA 5IULC 4NBUA 3KKMA 3W8RA 1XF9A 4R5MA 1T2CA 3NETA 4F6LA 4EO7A 1OZHA 1ZNWA 3NBUA 1P29A 2I8CA 3DZ7B 1S6YA 3OE4A 1G5QA 2PQ6A 1X8XA 5FX2A 3GN2A 5HPYB 1CUGA 4TMZA 3P94A 1ZD1A 2PFSA 3JARB 4U0KA 3QFFA 1C14A 4D0NA 1QSGA 4ZQIA 3RCBA 1BGXT 4BY9E 1E2EA 1Y81A 5KINB 4D26A 4FGSA 2INGX 5M3BA 2QHXA 5AUPB 1F7UA 1PT6A 2ZE8A 5TRTA 2D2IA 2R6R1 3IEIA 3JYPA 4ME6A 2JANA 4U2BA 3BXOA 5FPTA 3TTWA 1FUEA 1YR8A 5L3ZA 4AYWA 1C0IA 3IMKA 2H6EA 5CYOA 1XQ9A 1Y37A 3STTA 2AUMA 2OT3B 4JJ8A 4IMRA 4UUOA 1JQAA 3BDAA 1YFJA 4P53A 3LZ6A 4PO8A 1F51E 3PNSA 3T0GA 4ETWA 1N2CE 4DC1A 4ML3A 1PYGA 5D86A 4JVSB 1T1RA 1TM4E 4I6JA 3LD9A 4BQEA 4F3YA 3WTCA 1W8IA 5KTOA 5KNLA 1KOLA 3ZHOA 1KQPA 3ZX5A 1E3WB 1V3VA 5FUWA 2ABWA 5HKOA 1H4TA 3NPMA 1T35A 5KB3A 2FDCA 1H3EA 4TPKA 4H35A 3ZHYA 4EKEA 1P7WA 1YC5A 1E9RA 1H2FA 4O8CA 1ZD2P 2P27A 1QYDA 3A3YA 3INTA 3FVWA 4TZKA 1PD0A 5JSUA 3HBNA 2CCJA 4UXHA 4G4JA 4BQIA 5THXA 4RK4A 1P6XA 2JLXA 2XGJA 3CEAA 1F1BA 2PMWB 4A7PA 1EFRD 3OZRA 3KSAC 4M1QA 1GSOA 4NQZA 3NEPX 3S2SA 2G0AA 1ATZA 4MUBA 2JGJA 1FFHA 3CZ9A 4QUDA 3IIKA 5JV5A 1JJIA 1IXSB 2HRCA 4MTLA 4DR5B 2PJRA 2Y1OA 3OAAD 3O1IC 1BC5A 1KJNA 3P20A 4BKPA 2FPRA 4RGVA 1KDYA 2Y67A 2O1WA 4UULA 3DKKA 4PCUA 4NCBA 1RAHA 1UBSB 3DBHA 3F67A 1O08A 1G3UA 4XI9A 3JQ9C 1K8QA 2GERA 2IYQA 1KI1A 3QNUA 4WZBA 3NFRA 2BELA 2AH5A 1I2AA 2B8TA 1ZH0A 5EXTA 1EFRA 3ULKA 5CG1A 3R6TA 4FLFA 4MI6A 3WKBA 2B3TA 3QJYA 1G20B 4RBNA 1UOEA 2J07A 3I73A 1U3DA 1UP7A 4PLPA 1F0PA 3PC4A 3PLRA 3ZIDA 4MUXA 3TUIC 2UUAB 4NYIQ 4O4IF 3MHPA 2HBQA 2B34A 2JGIA 1C1DB 4MA0A 3M34A 1XU9A 1W4RA 3H65A 4DCTA 4OQXA 3EGDA 3BZBA 3KTOA 2JBAB 4YQZA 1YMQA 2JVJA 4MVJD 5B6PA 4C43A 5GZ1A 3HCDA 1E6EA 3LXMA 4MO9A 5K0FA 4PSKA 3RTCA 4OBBA 1JDPA 3LHSA 1M1XB 2Z43A 3NDRA 4V38A 3RKSA 4LE0A 3QSGA 4QLBA 3LPDA 3HL0A 2DB3A 3M3PA 4UM9D 4FNAA 2RGXA 1AB6A 3UJAA 1M6HA 2I2XB 3NHUA 3OF2A 3IR5A 4GM0A 4OGLA 1Y8CA 2BCGY 3C85A 4EG5A 3IA7A 3IBTA 2XUQA 4RU1A 5CBPA 1O9HA 5TS2A 4YV2A 1W5TA 3PFWO 2A5JA 1QVAA 3CX7A 2W2MA 1NM5A 3IAHA 2Z4TA 4UNIA 3KQLA 5DHQA 2R85A 5DYNA 3B3JA 2AHOA 3GQVA 3HPRA 1PU2A 1RBYA 3DV9A 5EPOA 2XB2A 2WAMA 4A36A 5DBIA 3EZ9A 5BSFA 3SOZA 3STXA 4G0WA 3NHFA 1IQ0A 3X3HA 4I55F 5AOAA 4PG5A 1G38A 1OGJA 1P5JA 5HF6A 2FPOA 4GZ5A 5DNCA 5HIJA 5HIAA 2D7DA 3NIGB 4QO7A 3MUFA 3VGJA 3CZCA 4R81A 3VR2D 1XL0A 3RQIA 1C3VA 1MJGM 2YC2C 3FLMA 5CH8A 5IMSA 1PSWA 4GR5A 1N2CA 2NYVA 1N57A 3FJOA 2JLZA 5B57C 2VP0A 3CPSA 4JLSA 1EAYA 3KAKA 3JYQA 3LS2A 1J97A 1JXAA 1UMCA 1F60A 2NQ8A 5GVRA 3VR3A 1E1NA 2C5FA 3U2QA 2I3BA 1V71A 4ZGBA 4KPYA 3K73O 4CIWA 4MDFA 1BXZA 1Q7CA 1YL6A 2W6OA 4JX9A 3D02A 3ZU6A 2V96A 2WJWA 4R3WA 5C32A 1GY8A 4IP0A 4R2WA 5EEHA 1U7WA 1KK1A 1VRCA 2A35A 2XVZA 3HLYA 4IZ6A 1ZOOA 2PFKA 3G49A 4R8KA 4UNQA 5AO9A 5KDDA 2YOGA 4FYPA 1I2BA 3FMVA 1FNSA 1Q77A 3BEDA 1U65A 2GK7A 1RI5A 2RGBA 3F78A 3E8SA 3I9V6 2VSNA 3HCRA 2A5GA 2J3QA 1MD9A 3NATA 4PX3A 2GPBA 5JS6A 4ZVOA 2QSZA 1XN1A 3HN2A 3OD1A 3DOFA 1BIFA 2BFMA 1KY3A 2ZAYA 3JXEA 4K81B 4ABTA 2M32A 3ZJVA 2Z2YA 1T8RA 4OQMA 3F5MA 4TXMA 2QXUA 2FMKA 2AEEA 2IXEA 4MYTA 2ERXA 1P74A 1H8HD 2YXPX 3CEJA 1TVMA 3CUUA 3O3CA 4P4UA 5JLAA 3DDOA 1XEWX 2UZ0A 4QUIA 1ND5A 3LQ2A 4YMLA 5ED0A 1SELA 3AUSA 4TV8B 4DYHA 3LYUA 1PQ4A 3PUKA 1YS6A 1E3DA 4Q1AA 3VR5D 3R5KA 3RU9A 1E2NA 3ZVRA 1G6OA 5U1PA 5F1OA 1FW8A 2OHJA 4F4DA 1EVEA 3A32A 5A6SA 2FSVC 5BYAA 4V1CI 1O95C 2P3QA 1I7QB 1KEVA 3PIIA 3A1DA 4W8GA 3A6EA 5BWMA 2XWQA 2VJMA 1Q0ZA 5B1HA 1KZHA 1JG1A 4TL8A 5HOQA 3HQ4O 1V47A 1MX1A 2X7XA 5JNRA 6ADHA 2OHGA 1TMOA 5F2KA 2Q5JA 4Q7EA 3V8PA 1TK2A 3MRTA 2AR7A 5BWBA 1YIOA 3TRDA 1RXWA 1RRKA 2D1RA 1SIBE 4MRNA 1Y9AA 3USES 1N5KA 3V97A 2QDXA 1TQHA 5CBKA 6ABPA 2PD4A 1TCVA 2J7KA 2NV2B 4I1IA 1HFWA 2CVZA 3ZLTA 4KQXA 3OHMA 3A2LA 1R0XA 2BM1A 4FFVA 1Q21A 1WF3A 3ZBUA 1KMIY 2JCSA 1KYTA 2EL9A 5LB2A 2YQ4A 4Y2XA 2X8WA 5FOXA 1KZGB 2FUG6 4FS8A 3DB2A 1II8A 1ZK1A 2ADFA 2WTBA 4LYFA 4WLEA 4WLVA 3T1NA 4I3HA 2GDZA 3TEMA 2REQB 2YIMA 4U7GA 3OE5A 1A98A 3C3CA 4W99A 2BF7A 3SEFA 4YMUA 2FHSA 3W9BA 3KYDB 3IEXA 2JI4A 2VQ6A 2W48A 5LMNB 1JG7A 4CV1A 3V8VA 3K0EA 1UJ2A 3O73A 2Q0QA 2O1EA 2Q1SA 3E03A 3K8OE 4O33A 5AKGA 2QI9F 3A6HA 4G2TA 2ZTSA 3STHA 2JBWA 4UHCA 1ZIXA 4FGLA 4UATA 3MIIA 3E0XA 3SDBA 3VO2A 4A5SA 4F6RA 4HVCA 2QLJA 1QX3A 3L6BA 2IP2A 2JDID 4EO9A 4F2DA 2RJ3A 4I1PA 4CL2A 2AN5A 3O2NA 3RF7A 2IS6A 4Q05A 1XCMA 2C2HA 5CNJA 5K3FA 4F3NA 3ISVA 2XTJA 4WBNA 1FL9A 2WBLC 4WBNF 4UMFA 2FPGA 2EZ8A 5EE9A 2XMCA 2FFHA 3TZCA 1RYNA 3COJA 1P5HA 2F17A 3MTJA 2R65A 2ZUCA 1A9PA 3A6ZA 3U3OA 3G17A 1QWOA 3U81A 3IOYA 5LBIA 2D0IA 1Q91A 1Z62A 4A6DA 4RESA 3C2QA 4M89A 5WRFA 2VZ9A 4CQMD 4HTFA 4FFRA 2V6GA 3M8KA 3Q8MA 3H42B 1DTWB 3V4ZA 1WRBA 4IO0A 5KJEA 4GYWA 3UJ7A 1APBA 4EZBA 3K1YA 3ICVA 2PWZA 4DWWA 1YASA 1T9GS 3BMQA 1YGPA 2WW8A 2WT4A 3GFFA 3K15A 5E6SA 2VJOA 4OP2A 2FUCA 2AFIA 1TF2A 3JQBA 3QXCA 4EVIA 1DIHA 5JMOA 3KPVA 4REQA 4C4OA 1BXRB 2YQ5A 4XGQA 1SHUX 3SHWA 4NI5A 1ZM7A 3QHPA 4U4AA 2CHGA 4DA7A 5DGCA 4DMGA 2PFGA 3EMKA 3PQFA 2OK7A 4YP5A 3N2GA 4QPCA 1YZQA 3CSSA 4IYRA 4ZJYA 1G21B 4YAIA 1TAUA 3O83A 3HVRA 1P1BA 4HQNA 1XRNA 2QPTA 3EGOA 3BWXA 4AK9A 2BSQA 3T12A 4D81A 4DRYA 3DJYA 3DF7A 4ESOA 2XODA 4ZYXA 3IIEA 3AXTA 2YVUA 4Y9SA 4EEKA 1U5BA 4BKOA 3R4CA 4N47A 3GDGA 5H83A 1DE0A 2QTMA 1I9CA 3W0LB 2QENA 1LBIA 1ABEA 3SZRA 3A1NA 1GCOA 1SA0B 3CUKA 3V6MA 1DI0A 1DTSA 1N9GB 1SBYA 3SR0A 1A9OA 1WQ3A 3N2KB 4BMCA 4C01A 1SVMA 4L75A 5AVYA 2HSJA 2PMCA 3LPLA 3VMMA 3FWNA 1QKIA 4DSAA 3CSDA 3EOBI 4QT0A 1DKNA 2ZU6A 3OWOA 4P0PB 1RZRD 2Z1MA 1E2QA 4ZOLB 3CURA 3QBTA 5BPHA 1X8KA 1E7MA 1B43A 3TO5A 1NF2A 5H68A 2HJHA 4PC3A 1X70A 3ZV4A 3M4YA 2PGLA 2ZDQA 3MXTA 3I1JA 3S2GA 4BL5A 1EHIA 3II6X 5HJ5A 1J49A 2OAQ1 4QECA 2PX4A 3MVEA 4OAQA 5AJTA 2HFKA 1T9GR 2IE0A 1TJ4A 1BKYA 2HZ7A 2ISCA 3AUJB 4FVTA 3TN7A 4BQRA 3CVXA 1PR5A 5CLJA 1U2TA 2H1HA 2P5UA 3DM5A 1J25A 1N0IA 4LRXA 2HDHA 4L3VA 2M2IA 5IKXA 1I7NA 4TSKA 3X2FA 2VJNA 3SWWA 3T54A 1J2YA 1O96B 4W5TA 1EEHA 1FSPA 3U4IA 1C3JA 1TZJA 1E7YA 2O1XA 2EW2A 3ESZA 4G26A 4YALA 5C5IA 5JEDA 1MO5A 3OLYA 4ERXA 2E4XA 5D6OA 4FTWA 2G1KA 1BXGA 4I5EA 2HAEA 4BGVA 1P0FA 1WL8A 2UYOA 5B5SA 3G6WA 5J58A 4KNWA 1O6FA 1V8PA 1XYYA 1KE1A 2VNJA 3CIOA 2ZT5A 1LF5A 3JY6A 1M1NA 3E27A 4ZTBA 3ZJUA 3UKJA 1XA0A 4CM6A 5CGQB 4D4LA 4M0MA 2QL7A 1YB7A 3I0NA 4IMPA 3WICA 1ULSA 4KQ2A 4DCJA 4GICA 4CE6A 1PFUA 3AI3A 2KPOA 1DPFA 1JZTA 3KAQA 5HJ7A 1NASA 4Q7MB 1UBTS 1IU9A 1CTQA 1W5FA 2IHBA 3TAHA 4FMDF 3ZS9A 4YP9A 1T3LA 4AWBA 2I6GA 3ENKA 4BRZA 2VK2A 2XD9A 2GXQA 2OM6A 4TT3A 1FCJA 1JQKA 4WT7A 4XPIA 3HU5A 2DAPA 1NP3A 5EQDA 5KAPA 2VYVA 4DBZA 4NCKA 1BMDA 1QQ7A 2Q1WA 1ZMXA 3U7HB 3GLHA 3OFNA 1NC1A 2CYBA 3K4QA 5AJVB 1BX0A 3G88A 5AJXA 1G8YA 2I1WA 2P1RA 3C7TA 1FQOA 4OOEA 4YAFA 2XUGA 4MMYB 1C7JA 4PC1A 4YRLA 4ZO8A 1TCBA 3U7JA 3WL3A 3ZV6A 1FNCA 1G4HA 1KAEA 4AJPA 1JEYA 2IP4A 5LJLA 2OB2A 2PZAA 2F43B 3WMEA 1B6SA 2FQXA 4DNXA 1N4AA 5CD1A 1E3SA 1ZUD1 2CC2A 4EAAA 4UCXA 4HLQB 3AETB 4P0QB 2W2NA 1PUJA 1R66A 4M2LA 3L9WA 4OSOA 4RS3A 5HIMA 5TDHA 3RVQA 1NJ1A 5F1KA 3CB2A 3SFTA 2Z8ZA 2EIXA 1RP1A 1CNFA 4EUKA 1G20E 5EKUA 2AG6A 4JLAA 4FFLA 3QSYA 1Q92A 1IIBA 4M9RA 5IC4A 1E6CA 3B8EA 3NAMA 2NU9A 4IHJA 4RZUA 5BV7A 1N6LA 3GQBB 3KDAA 5IHXA 4KR6A 1Y4DE 1SCUB 1F6BA 3ZLVA 3CG4A 1RM5A 4ETIA 3R74A 2AQ8A 2I76A 3D3WB 4DCCA 2ZRCA 2DFNA 1KZ6A 2BTQB 3DE7X 2XNJA 2VJKA 2CXPA 4ILKA 4L28A 2DKNA 4UAUA 10MHA 4IJ5A 1XZQA 3I5XA 1KETA 4J2OA 1O94C 1CZRA 1RBZA 1VL0A 3DFKA 4MS4A 4QRDA 1NBHA 2FP4B 3MWYW 4FEAA 6Q21A 1J0EA 1Y7TA 1DAEA 2C77A 1NUHA 1H6AA 1JJFA 1DS6A 3FE2A 3MTGA 4OI4A 4YMGA 5JAIA 4BFTA 3AR6A 2NVWA 3D0RA 3PNOA 5DEIA 2FPNA 1NUPA 2UV8A 1KIAA 4IGAA 4BKMA 2DERA 1SVOA 2ET6A 5IJXA 2VTKA 1YJAA 1V1RB 1D2AA 5EKTA 4ZZ0A 2FPLA 3MQ2A 2CVQA 1T8WA 2PZGA 3WLLA 2O5VA 2WSLA 5FOUA 1SKAA 2E9SA 2RHTA 3DXYA 5HP4A 3RFVA 2Z98A 3QBVA 1ZS9A 4ZTUB 1E5TA 1VHDA 2NM0A 3TMYA 2HF2A 1MDFA 4F8EA 1MW9X 1Z7YA 1WUJS 3H11A 4IKPA 4YJ3A 1OV4A 1ZO8A 1DT5A 3B5EA 1D8TA 4GHWA 1WXWA 2LUOA 1I3LA 1W46A 1E66A 1TLFA 1ZN2A 2Q8QA 3A2MA 3GVPA 3EUWA 3S4YA 1FEZA 5FOSA 5KPDA 1CX9B 3EA0A 4ISBA 5KS2A 2A5DA 4ITRC 3B1WA 5E6UA 4Q9HA 5I7RA 2PUTA 3K0SA 1JFTA 2VTBB 4PU0A 4QAJA 2XNDA 3PQ4A 3HCEA 2CVHA 1IONA 3LA6A 1R9JA 5LB4A 1ENYA 4GBED 2QGFA 4RD1A 5FWDA 3RU7A 4K9PA 2C2GA 2J6BA 4GX0A 1EK0A 2LZ0A 5BUCA 2OM2A 4OLHA 1E5DA 3AOEC 4BV9A 4GECA 1DAOA 3AINA 4FZVA 1P3JA 5JVDA 2EZTA 2F1RA 5EJAA 2V5UA 3GIDA 5JYAA 3PDJA 2P6OA 5CT5A 5TEVA 3ZZUA 4X00A 4YCCA 1YFLA 1ZMRA 2CV2A 3FCYA 5CCEA 4L5IA 4GOND 4JD5A 4W7IA 4XR9A 4FLEA 1J33A 3F7OA 3W1EA 2A4KA 4Z4IA 3P27A 3O95A 3WISA 1RQ2A 1GGMA 2C5AA 3B1KA 1C2TA 3G8BA 2H4YA 2JRLA 1O5IA 4IHJB 4U7PB 5FULA 1Z2DA 2NU7A 3GBVA 5DH9A 1FDUA 3OF3A 2YZ2A 4YDSA 5I9IA 3KKQA 4KFTA 1JNYA 1E3EA 2IVFA 3IUSA 3IUNA 3UB3A