1H7CA

Human tubulin chaperone cofactor a
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
PRVRQIKIKTGVVRRLVKERVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-Dimensional Structure of Human Tubulin Chaperone Cofactor A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords TUBULIN-SPECIFIC CHAPERONE A
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02970 TBCA Tubulin binding cofactor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1h7cA00
3CKDA 3MXZA 3QK6A 4CQIA 2MBGA 2C5IT 2X9XA 1QSDA 1IJ5A 4J2CA 2G0UA 2X9WA 1ZKEA 4FI5A 3FXDB 2C5JA 1LVFA 2CA5A 3L3PA 3QUJA 1LRZA 2XTLA 4DNDA 3N5LA 4B6XA 1Z0PA 4EYYR 3CVRA 3S4UA 1IJ6A 3FXEB 2X9YA 2C5KT 2IC6A 4L0RA 2K48A 2IC9A 1H7CA 2KWHA 3P7IA 2KWIB 3TKLB
chains in the Genus database with same CATH superfamily
2P9BA 3UUBA 2J62A 3NBXX 4AISA 2N1GA 5JR9A 2MBGA 5JR9C 4CXYA 2W62A 5EZYE 3U78A 3VRBA 1HF8A 5JH7E 2V7JA 3JC6C 4ISSA 1ZV4X 3AEFA 4H9QC 3ZCIA 4YY3T 2KSRA 2XSBA 4X62T 4DV7T 2VVNA 2V6XA 4IL4A 4UIGA 5FXXA 2V5CA 2CPTA 3KV4A 4IIJE 4QH1A 5IYZE 4GKKT 3GN5B 3VRAA 4IDNA 2WDVA 2KXPB 4DR1T 1B7TA 2RP4A 2WSSV 1Y01A 3WI3A 4DUYT 2L8KA 3D0TA 2JMHA 5L3BB 5DABA 1R8IA 2BG9A 3P4QA 2WM9A 4GYRA 4L9IA 2XQ5A 3U3IA 2VL8A 3PJAJ 4YTNA 3CPZA 4KX6A 4TWDA 5LHIB 3VKHA 1J1JA 2E5VA 4ILAA 3MK7C 1M7KA 4JBWF 3AA1B 5HEOA 5L4HA 5KDMC 4AKHA 2XM2A 3H37A 3V5SA 3T1YT 4UF0B 2ZMAA 5ABFB 4JI5T 2JQHA 5FXWA 4ADZA 4WNKA 1NAFA 1WRDA 3QC9A 4YSYA 5LHHB 1IBKT 3ZMVB 5LNKA 1LRZA 3E0ZA 2EHOB 4P0BA 3RYFE 4WZXA 1XMOT 4IE0A 4QH4A 2XAQB 3Q5EA 3RYCE 3SWHA 4AQFA 2V1DB 4EEBA 5L3CB 4B3MT 1UX4A 2K5BB 1HX1B 2VURA 2A3DA 1L0VA 2C0SA 1KNPA 2VKOA 1W9RA 3CQXC 4WBNE 3ONLC 4UV9B 3UUNA 2MTQA 2CHNA 4JI4T 2FBWA 5AFUL 2XHEB 3N9MA 1QLBA 2FJBA 2E9XC 5KX5E 2XQAA 2EHOD 4G63A 4WW0A 5LOVE 3AE2A 3RPUA 2UU9T 2DHRA 3UU8A 3I9WA 5AQFB 4B3TT 5LG4A 3OJAA 5L3FB 1N32T 5HWXA 5J2TE 2XZEA 3EDVA 1KEYA 3ONXA 3QB5A 2UXXB 4U72A 2HPJA 3QUJA 1D1CA 4PJLA 3ANWB 3C98B 4U7YA 1WCRA 3MKDA 5JDFA 3RGLA 3RC8A 2V7IA 4DMVA 3OTOT 3FZFB 1ZP0A 2AE9A 4UV8B 4DNDA 4DBQA 4X66T 1BR2A 1VCSA 2XQ7A 3N9QA 4H9RC 4X1IE 2X9HA 4HGAA 4IREA 5C2TA 5CFBA 2MAWA 3N9PA 4YLHA 3E22E 4AI6A 3VR8A 3RYIE 2IC9A 2N2NA 2NR4A 4LFCT 3RLFF 3KFWX 2QYWA 4IL9A 3P4RA 3P7IA 3RI5A 2CXDA 4Z90A 4LMLA 3QK6A 4JV5T 2BDEA 1DU2A 2BG9E 2DI4A 4HE8A 3K3QC 2SPCA 1YW0A 3OBVE 4AXPA 4DMWA 4EGWA 2UUCT 4H9OC 2C5JA 5JDLA 2ZM8A 4I55E 1KNZA 3P4WA 4DV6T 4YJ2E 2KLQA 2ZM0A 3NZQA 4YHJA 4OX9T 5JQGE 2XAJB 2CCQA 2CXFA 1D1AA 2YDQA 4N78D 4TX5A 4FJOA 4TWFA 4V1Av 4AQYT 5ETWA 3ZYLA 5CGMA 5L4EA 4KMCA 4DIDB 4TV9E 2LJLA 3ZSTA 2LM2A 3ZKRA 5EK2A 4NPPA 5AQQB 5FYMA 3UUXB 5ABHA 5LJMA 4TNWA 4CXXA 2Q9QB 2A9UA 3M3ZB 2LE8A 4TUYE 4DR2T 2V7MA 5H6QB 4ZZCA 3CX8B 4U3CA 1E7PA 4QWNB 4YFSA 4K0UA 4AKRB 4E7SA 4DR4T 4HWHA 2VWAA 3KBTA 4EAHA 4XAXB 2NW7A 5LGNB 2W2UA 1HFAA 4UELA 1N34T 2X9XA 3C51A 4MFRA 3L09A 3TLVA 4FI5A 1W0BA 3ZT5A 4LMKA 2B1EA 2JIWA 2V8SV 2BBHA 4PK6A 5FXZA 2E9XA 4U2YA 2PG8A 2XQ9A 4MBQA 2W67A 5AQHB 1MMGA 2W66A 4LF6T 1KK7A 3BQKA 2CE7A 1AJ3A 3RKGA 1FIOA 3UUMA 4HFVA 5J0ZA 4DR3T 3UQ4A 4U2ZA 4BA9A 4X20E 4AQGA 4DV3T 2Q9QA 4YHHT 3CX6B 3F31A 4X5TA 4C90A 5LMUT 2JRKA 3N2GE 2M67A 2VQFT 5FNVE 3DTOA 5ADXL 2L3LA 3ESLA 2UXBT 1YKEB 5JRCB 2V6YA 4DO0A 3IBPA 2K9AA 3FZKB 3AE4A 4JEHB 4O4IE 4OFZA 1FJGT 4P0AA 2LKHA 1SUMB 3AVSA 3WAKA 2ACZA 4CI2B 5HYAA 3HR0A 2C5IT 1QSDA 4TZ4C 2E5LT 2VB6A 2XPKA 2WWVA 5JRCA 1ZKEA 2QRXA 4AKLA 1UURA 4O4LE 5LBMA 2VASA 5LB7B 2BG9B 4E7ZA 2WAUA 5LGUB 2W4XA 2D0UA 3FZMB 1D0ZA 4KI0F 2XSAA 2JQQA 4HFIA 5H6RB 4ERRA 4F6RC 4DUZT 3DJBA 2OA5A 4MALA 3B13A 4OYKA 2LSYA 3QOFA 3CQCB 4HFEA 3AE1A 3GN5A 5AQOB 4EYYR 3B5MA 3ZEFB 4IDOA 5HXSA 4DV2T 4HWFA 5JDMA 4YJ3E 2KT9A 2MPKA 4CN6A 5JDHA 4UVCB 5AQGB 3O4XE 3LG7A 2BBJA 5TAOA 5HEHA 2VKJA 4Z91A 5LMNT 4YTPA 2LSKA 4JI6T 4TV8E 3CIRA 3LK42 2NP9A 1X9BA 3AB3B 4ILUA 5HEGA 3ZMUB 3KVBA 3LBXB 2Y6XA 3ZSSA 4DVDA 4EIWA 1VOMA 2XQ4A 3AEBA 4ZS3A 3RQUA 4YSZA 4KHPT 2WDQA 3RH3A 3CX7B 3UQ7A 2VVSA 2X9WA 2D0TA 1Y64B 3N2KE 3ZT6A 2WY2A 4AIUA 2E8IA 5LXTE 2PJQA 3T8OA 4F8HA 4GK5E 4UXNB 4BJNA 4A56A 4LFBT 3NWIA 5FY7A 1EZ3A 2YU1A 1BR4A 2UXNB 3N5LA 5HCJA 5HEUA 2Z6EA 4PJNA 3ZMSB 4KP3C 5BMVE 1N36T 4JEUB 3TLWA 4CI1B 3S4UA 5BR8T 4TWHA 2BVLA 2HHHT 2KZ7B 1FMVA 5HXHA 4HFBA 2UUAT 2WDRA 4QX8B 2YK0A 4JYAT 3P50A 1UX5A 4IE5A 2R6GF 3Q9DA 5FXVA 3RRWA 4P09A 3NRYA 3HKEE 1MIVA 2N9DA 3N9LA 3PUAA 1W09A 4H63V 5AQIB 5HEJA 1J5ET 4JI7T 4U7IA 3PU8A 3TKLB 3UFGA 5L47A 3LBXA 2XQ6A 3OVUA 2E9XB 3R84B 4A97A 4HWDA 4CQIA 2ZM2A 4ZZBA 5AQJB 3UU3A 1HNXT 2ACXA 3B57A 2WU5A 3ONJA 2BKNA 3RKOA 5FVKA 4DR7T 4WBOA 4QH5A 2DCFA 3L3PA 2A72A 2YINA 2LOPA 3ABVA 5AQNB 5FMNA 5LBQB 5ABGA 4NUUA 2X67A 4EOZB 4NXNT 1FMWA 1WYCA 1YXRA 3EHZA 2CBIA 2XTLA 2DL1A 5HXCA 4LF7T 1X79A 2ES0A 1SE7A 4GKJT 2OLTA 3UU4A 5IHYA 2J4GA 2RA1A 3EAMA 2V6YB 4U31A 3RRCA 2WB5A 2IC6A 1YKHB 4L0RA 4DV4T 3ZC0A 3AA0B 3AE6A 3BQLA 2CLYC 4AQFC 1W0AA 1ZHCA 3AEEA 3Q2MA 2IW5B 5LG3A 2BKOA 3JAEA 3A8YC 2PBIA 2JJ9A 3GMIA 4HWIB 4O4HE 4HN9A 3CKDA 3J7Yq 3Q5XA 2WU2A 1MMNA 5J1GA 4PNIA 1KF6A 3SRZA 2HPLA 3PU3A 3ZLIA 2YDRA 1G73A 4LF5T 3HI2A 4A5XA 2XJ7A 3O9XA 1XDPA 2Y8DA 5LHGB 1NWMX 5AQUB 3JADA 3TLUA 3HL6A 5F5WA 4U74A 2YOEA 4NIQA 1YQ4A 2I59A 5FY1A 3HKDE 4L5GA 1NENA 5LP6E 3RYHE 4DV0T 3AEDA 4ZHQE 3P8CD 4KHZF 5LJNA 3PTRB 5JDNA 4DR6T 1HG5A 3SS1A 4YTMA 1BR1A 4LF9T 3EI0A 1VRBA 2GK9A 2J47A 4ZI3D 2FJAA 4ZOLE 5AQLB 3ZPOA 4JI8T 3PUGA 3Q5DA 2LKGA 1WR0A 2PFVA 2KINB 2FUPA 3AAAB 4OHFA 5ABFA 2CBJA 5KXJA 5L3DB 1I94T 2VK9A 2ZLYA 5A1LA 1OWAA 4I50E 2YDSA 1IAPA 4NUVA 2W63A 3RHWA 3HA4A 3C4WA 3ANWA 2X66A 4X65T 2E9XD 2DWKA 3OYXA 3HKCE 4QXHB 2G0UA 3KV5A 2KNDA 3N9OA 4CZZB 3GA8A 3AE8A 5IWAT 2M6BA 4HFDA 4B3ST 1XWMA 2W61A 3L39A 5GONE 1FEWA 3F57A 1UK5A 4IE4A 1HNWT 1OEDC 2ODUA 2LM9A 1OEDA 5IUXA 4BJMA 4IE7A 4ASKA 5CA1E 3G06A 1J5WA 2LRLA 4OK0A 3UULA 4B3RT 4TN7B 2H7VC 3JAFA 3RX6A 5AQSB 4O8SA 5FVLA 3ZYKA 1HNZT 4KBMB 3ZMZB 2F4VT 3I9YA 3OKQA 4Z8XA 3CMLA 4CXWA 4EXTA 3UTKA 3RF1A 2I0MA 3MXZA 4WYVA 4EV6A 4H9PC 2K3WA 3I0QA 3AECA 1WFDA 4GOUA 3EVYA 4K0KT 4I43B 1KNRA 1HCIA 3SOLA 1ZEEA 4ZXLA 5HWYA 3FBLA 3AEAA 2CWOA 5KMGP 4IDPA 3NZPA 4I4TE 3VU7H 3RIAA 3PURA 2X68A 4UR9A 2LHRA 4B6XA 5HAXA 2BG9C 3AAIA 3O1IA 4IDZA 2AXDS 1CUNA 4NXMT 1T8BA 3KBUA 1MMDA 2X0YA 2NOXA 1S94A 2K48A 5DQWA 1D1BA 2XM1A 3MA9A 1HR0T 2V26A 2WS3A 3ZN1B 3BK9A 3PDYA 4DR5T 3V5UA 1G8XA 4QHOA 1N33T 3PUZF 4LFAT 3VKGA 2Q9QC 2CLYB 2QVAA 4ANJA 3X1DA 3K3NA 5C3JA 4PJJA 5LGTB 4GIWA 5FY0A 2H7OA 4GYSA 3KINB 2QGSA 3N2OA 4GK0E 3ZYMA 3ZT7A 3P4PA 4COFA 4X64T 1T72A 3UT5E 2K24A 1MNEA 3NVOA 2L9QA 4HFHA 3A5XA 3AE7A 3M65A 3FXDB 1M62A 4U33A 3ZMTB 2XQ3A 2DWGA 1XZYA 2LRKA 2V5DA 3C4XA 3DP7A 3KV6A 1WR6A 4IHJE 4IE6A 4M1PA 4YSXA 5HXEA 5JR9B 2NTXA 3N9NA 4A98A 2LOSA 2B76A 2CWYA 2WCAA 3K3OA 4IGUA 5CJ5A 2EHOC 4EEDA 1JNRA 3AXJB 1NEKA 2EHOA 3IA3A 4KUMB 4QXCB 2X9YA 4UVBB 5F8PA 2JMKA 2VKHA 4ZEYA 3AE9A 2FJDA 3I0OA 2CHOA 1IZNB 3PUSA 1U4QA 2RPAA 2W0GA 2NWBA 2IHR1 4QXBB 5DQVA 2J1DG 3ZJ1A 3CWZB 3H3MA 1YD8G 1UGOA 2KWHA 1HX8A 3UU6A 2V7LA 4UF0A 4HEAA 1BR0A 1IBMT 2CXLA 1HG2A 2BKPA 4IDQA 2A2FX 3QNUA 2YU2A 2HN1A 4UEMA 4LF8T 3SFDA 3VHLA 1US7B 4ISTA 3PV0F 2QA7A 1XNQT 3NRXA 3C4ZA 2BS2A 4G2AA 1JNZA 3AVRA 2NW8A 2CA5A 2ZM6T 3HKBE 3K8PC 1D0XA 3J9X1 4BAYB 5DJQC 1HTJF 3EUHA 4EB6E 2WWUA 1OXZA 4XBFB 4PK5A 3PUXF 4JLEA 1Z0PA 4AKIA 3CVRA 3VR9A 1IJ6A 4X1KE 1E2AA 1MNDA 3EABA 3MZKB 1MMAA 3CK6A 3PUWF 3AAEB 3QB5K 4HWCA 1Z8UA 2WP9A 2D2SA 3ETVA 2JQKA 2XQ8A 3PUQA 3SFEA 2D5UA 3PUVF 5JREA 4OYJA 1S35A 1WYBA 2W00A 5FL0A 4ILBA 3ZN0B 2XAGB 4HFCA 2WMNA 3UU5A 5C8YE 4O2BE 4JI2T 3FHNA 1O3XA 2CM0A 4EZ4A 5CA0E 2HH7A 5J2UE 3ZCJA 5JDGA 1D0YA 2Q9QD 4HKAA 2VL0A 4P1NA 4PJMA 5FKYA 4MHCA 4J2CA 3IEEA 3C64A 3K1SA 3KDSE 1SA0E 5AQRB 5LCYA 3JC6D 1T98A 3LK3B 3JCFA 3L8RA 3AE5A 3C50A 5CB4E 4ZI2C 5JTGA 1OEDE 2WBLA 1LVFA 3A7MA 3PUYF 4Q25A 3OYZA 2DLRA 2YEVC 3RIUC 5FL1A 3ZJ2A 3MJXA 3OPCA 1HS7A 1UUSA 3AXJA 2Y48B 3ETUA 4UVAB 5F3JA 5EK4A 4QKNA 3RC3A 2OV9A 2MOZA 2LT3A 2LSGA 2X51A 5HCMA 2WZIA 4PK4A 4YXDA 4PAGA 3AEGA 2JQ9A 4DBRA 4ZI2D 3MACA 2DNXA 3O1JA 5AQPB 3RQWA 2CMRA 2BS4A 2WMOA 3TLSA 4YT0A 1ZOYA 1LVKA 2H3RA 3LK2B 4X1YE 3O1HA 5AQKB 5LYJE 4HTEA 5M4YA 3E08A 2KWIB 3WAJA 2UXDT 2XAHB 1I6ZA 2H89A 3GWHA 5HXRA 2UXCT 2WQYA 4H9NC 2UUBT 2BZBA 4JUYA 3EDUA 5ABEA 1QUUA 4ILCA 3F2EA 2XASB 2XQYA 1MIWA 2YN6A 3ZC1A 4H9SE 3IF8B 3FZHB 5AQVB 4EZHA 4JI1T 4AKGA 4QX7B 1UCUA 1SHZC 2V7KA 4XZCA 2M6IA 1KFYA 3AE3A 5AQMB 3LDQB 2HN2A 1XDOA 5FP3A 2NW9A 3FB2A 3PE0A 2C5KT 2LEHA 3FZLB 2LLYA 5EK3A 4C91A 4EYUA 2JPFA 2LHNA 2PTFA 5AQTB 3UFEA 1YQ3A 2BS3A 3FBZA 4IT4A 4O4JE 4DV5T 3RIFA 4CN4A 2XAFB 1H7CA 5L2LA 5LA6E 1GQEA 3LJCA 3Q5WA 4LMJA 1WLXA 2VQET 1VCTA 2D9DA 3PJAA 1IBLT 5E0OA 2IMLA 2IDOB 2KMFA 3AA6B 3T1HT 1XMQT 2IIUA 4I0UA 4PFOA 1E1HB 1V9DA 2MYSA 2X0HA 2YKSA 1IJ5A 2XY8B 3LFMA 4O2AE 4PW8A 5L3GB 5JVDE 4ZI7E 5JDQA 2NTYA 3CQGB 2ODVA 4ZI3C 1CHUA 1XNRT 4CI3B 2FJEA 4JI3T 1LKXA 3R6NA 1OEDB 2LSIA 4PFPA 3NKZA 1U5PA 4LF4T 2BVMA 2I6HA 2WZHA 2XUEA 1MIYA 3TLTA 3FXEB 4CN1A 3H3AA 4MLKA 3W15B 2IUBA 3P4SA 2IAKA 5L3EB 4TNVA 4ZS2A 2H88A 1T7SA 2VKDA 3KV9A 4DV1T 2CEAA 3KVAA 4JI0T 2E2AA 3RIUA 3LSVA 2CRBA 4H63H 2X0LB 3AA7B 2LSJA 3IHRA 3BQIA 3I1AA
chains in the Genus database with same CATH topology
2P9BA 3NBXX 2N1GA 5JR9A 2MBGA 5JR9C 4CXYA 2W62A 5EZYE 3U78A 1HF8A 5JH7E 2V7JA 3JC6C 4ISSA 1ZV4X 4H9QC 3ZCIA 4UIGA 5FXXA 3KV4A 4IIJE 5IYZE 3GN5B 2KXPB 1B7TA 2RP4A 2WSSV 3WI3A 2L8KA 3D0TA 2JMHA 5L3BB 5DABA 4L9IA 2WM9A 4GYRA 3U3IA 2VL8A 3CPZA 5LHIB 3VKHA 3MK7C 3AA1B 5KDMC 4AKHA 3V5SA 3H37A 4UF0B 2ZMAA 5FXWA 4ADZA 4WNKA 1NAFA 1WRDA 3QC9A 5LHHB 3ZMVB 5LNKA 1LRZA 3E0ZA 2EHOB 4P0BA 3RYFE 4IE0A 2XAQB 3RYCE 3SWHA 4AQFA 5L3CB 2V1DB 1UX4A 2K5BB 2A3DA 2C0SA 2VKOA 3CQXC 4WBNE 4UV9B 3UUNA 2MTQA 5AFUL 2XHEB 3N9MA 2E9XC 5KX5E 2EHOD 4G63A 4WW0A 5LOVE 3RPUA 2DHRA 3I9WA 5LG4A 3OJAA 5L3FB 5HWXA 5J2TE 3EDVA 3ONXA 2UXXB 4U72A 2HPJA 3QUJA 1D1CA 4PJLA 3ANWB 3C98B 3MKDA 5JDFA 3RC8A 2V7IA 4DMVA 4UV8B 4DBQA 1BR2A 3N9QA 4H9RC 4X1IE 2X9HA 4HGAA 3N9PA 4YLHA 3E22E 4AI6A 3RYIE 2IC9A 2N2NA 3KFWX 3P7IA 2CXDA 3QK6A 2BDEA 2DI4A 4HE8A 3K3QC 2SPCA 1YW0A 3OBVE 4AXPA 4DMWA 4H9OC 2C5JA 5JDLA 2ZM8A 4I55E 1KNZA 4YJ2E 2KLQA 2ZM0A 3NZQA 4YHJA 5JQGE 2XAJB 2CCQA 2CXFA 1D1AA 4V1Av 4N78D 4TX5A 4FJOA 4DNDA 5ETWA 3ZYLA 4KMCA 4TV9E 2LJLA 5EK2A 5FYMA 3UUXB 5LJMA 4CXXA 2Q9QB 2LE8A 4TUYE 2V7MA 5H6QB 3CX8B 4YFSA 4QWNB 4E7SA 4K0UA 4AKRB 2VWAA 3KBTA 4EAHA 4XAXB 2NW7A 5LGNB 1HFAA 4UELA 2X9XA 3C51A 4MFRA 3L09A 4FI5A 2B1EA 4PK6A 5FXZA 2E9XA 2PG8A 4MBQA 1MMGA 1KK7A 3BQKA 2CE7A 1AJ3A 1FIOA 3UUMA 4HFVA 4BA9A 4X20E 4AQGA 2Q9QA 3CX6B 3F31A 4C90A 2JRKA 3N2GE 2M67A 5FNVE 3DTOA 5ADXL 2L3LA 3ESLA 5JRCB 1YKEB 4DO0A 3IBPA 2K9AA 4JEHB 4O4IE 4OFZA 4P0AA 3AVSA 4CI2B 3WAKA 5HYAA 3HR0A 2C5IT 1QSDA 4TZ4C 2VB6A 5JRCA 1ZKEA 4AKLA 4O4LE 5LBMA 4E7ZA 2VASA 5LGUB 2WAUA 2D0UA 1D0ZA 2JQQA 5H6RB 4ERRA 4F6RC 3DJBA 2OA5A 4MALA 3B13A 4OYKA 2LSYA 5LA6E 3CQCB 4EYYR 3ZEFB 3GN5A 5HXSA 5JDMA 4YJ3E 2KT9A 5JDHA 4UVCB 3O4XE 3LG7A 5TAOA 2VKJA 2LSKA 4TV8E 3LK42 3ZMUB 2NP9A 3AB3B 4ILUA 3KVBA 3LBXB 2Y6XA 4DVDA 4EIWA 1VOMA 4ZS3A 3RH3A 3CX7B 2X9WA 2D0TA 1Y64B 3N2KE 5LXTE 2E8IA 2PJQA 3T8OA 4GK5E 4UXNB 4BJNA 4A56A 5FY7A 1EZ3A 2YU1A 1BR4A 2UXNB 3N5LA 3ZMSB 5BMVE 2Z6EA 4PJNA 4KP3C 4JEUB 4CI1B 3S4UA 2BVLA 2KZ7B 1FMVA 5HXHA 4QX8B 2YK0A 1UX5A 4IE5A 3Q9DA 5FXVA 3RRWA 4P09A 3NRYA 3HKEE 1MIVA 2N9DA 3N9LA 3PUAA 4H63V 3PU8A 3TKLB 3LBXA 3R84B 2E9XB 4CQIA 2ZM2A 2ACXA 3B57A 3RKOA 4WBOA 2DCFA 3L3PA 2A72A 2YINA 2LOPA 5FMNA 5LBQB 4EOZB 4NUUA 2X67A 1FMWA 1WYCA 2XTLA 5HXCA 1X79A 2ES0A 5IHYA 2RA1A 3RRCA 2IC6A 1YKHB 4L0RA 3ZC0A 3AA0B 3BQLA 2CLYC 4AQFC 1ZHCA 3Q2MA 2IW5B 3GMIA 2PBIA 2JJ9A 4O4HE 4HN9A 3CKDA 3J7Yq 3Q5XA 1MMNA 5J1GA 4PNIA 3SRZA 2HPLA 3PU3A 3ZLIA 1G73A 3HI2A 3O9XA 2Y8DA 5LHGB 1NWMX 3HL6A 2I59A 5FY1A 3HKDE 4L5GA 3RYHE 4ZHQE 3P8CD 5LJNA 3PTRB 5JDNA 1HG5A 3SS1A 1BR1A 1VRBA 2GK9A 4ZI3D 4ZOLE 3ZPOA 3PUGA 3AAAB 2PFVA 2KINB 4OHFA 2VK9A 2ZLYA 5A1LA 1OWAA 4I50E 1IAPA 4NUVA 2W63A 3HA4A 3C4WA 3ANWA 2X66A 2E9XD 2DWKA 3OYXA 3HKCE 4QXHB 2G0UA 3KV5A 2KNDA 3N9OA 4CZZB 3GA8A 2W61A 5GONE 1FEWA 3F57A 4IE4A 2ODUA 2LM9A 4BJMA 4IE7A 4ASKA 5CA1E 4OK0A 3UULA 4TN7B 2H7VC 3RX6A 3ZYKA 4O8SA 4KBMB 3ZMZB 3I9YA 3OKQA 4Z8XA 3CMLA 4CXWA 4EXTA 3UTKA 3MXZA 4H9PC 3I0QA 4GOUA 3EVYA 4I43B 1HCIA 3SOLA 1ZEEA 5KMGP 5HWYA 3FBLA 2CWOA 3NZPA 4I4TE 3VU7H 3PURA 2X68A 2LHRA 4B6XA 5HAXA 3AAIA 3O1IA 4IDZA 1CUNA 3KBUA 1MMDA 2NOXA 1S94A 2K48A 5DQWA 1D1BA 3MA9A 2V26A 3ZN1B 3BK9A 3PDYA 3V5UA 1G8XA 4QHOA 2Q9QC 2CLYB 4ANJA 3K3NA 4PJJA 5LGTB 4GIWA 5FY0A 2H7OA 4GYSA 3KINB 2QGSA 3N2OA 4GK0E 3ZYMA 3UT5E 2K24A 1MNEA 2L9QA 3A5XA 3M65A 3ZMTB 3FXDB 2DWGA 3C4XA 3KV6A 4IHJE 3DP7A 4IE6A 1WR6A 4M1PA 5HXEA 5JR9B 2NTXA 3N9NA 2CWYA 2LOSA 3K3OA 4IGUA 2EHOC 4KUMB 2EHOA 4QXCB 2X9YA 5F8PA 2JMKA 2VKHA 4XBFB 3I0OA 3PUSA 1IZNB 4QXBB 1U4QA 2W0GA 5DQVA 2NWBA 2J1DG 3ZJ1A 3CWZB 1YD8G 2KWHA 1HX8A 2V7LA 4UF0A 4HEAA 1BR0A 2CXLA 1HG2A 4UEMA 3VHLA 2A2FX 5L3DB 2YU2A 1US7B 4ISTA 2QA7A 3NRXA 3C4ZA 4G2AA 3AVRA 2NW8A 2CA5A 3HKBE 3K8PC 1D0XA 3J9X1 4BAYB 5DJQC 1HTJF 3EUHA 4EB6E 2WWUA 1OXZA 4PK5A 4JLEA 1Z0PA 4AKIA 3CVRA 1IJ6A 4X1KE 1MNDA 3MZKB 1MMAA 3AAEB 4UVBB 5L3GB 3ETVA 2D2SA 3PUQA 5JREA 2D5UA 4OYJA 1S35A 1WYBA 2W00A 3ZN0B 5C8YE 2XAGB 2WMNA 4O2BE 3FHNA 1O3XA 2CM0A 4EZ4A 5CA0E 2HH7A 5J2UE 3ZCJA 5JDGA 1D0YA 2Q9QD 4HKAA 4PJMA 3VKGA 4MHCA 4J2CA 3IEEA 3C64A 3KDSE 5LP6E 1SA0E 5LCYA 3JC6D 1T98A 3LK3B 4ZI2C 3C50A 5CB4E 2WBLA 1LVFA 3OYZA 2DLRA 2YEVC 3ZJ2A 3MJXA 2Y48B 3ETUA 4UVAB 5F3JA 5EK4A 4QKNA 3RC3A 2MOZA 2LT3A 2LSGA 2X51A 4PK4A 4PAGA 4DBRA 4ZI2D 3MACA 2DNXA 3O1JA 2CMRA 2WMOA 2H3RA 1LVKA 3LK2B 4X1YE 5LYJE 3O1HA 5M4YA 4HTEA 3E08A 2KWIB 3WAJA 2XAHB 3GWHA 5HXRA 4H9NC 2BZBA 4JUYA 3EDUA 1QUUA 3F2EA 2XASB 2XQYA 1MIWA 3ZC1A 4H9SE 3IF8B 4EZHA 4AKGA 4QX7B 1UCUA 1SHZC 2V7KA 4XZCA 5FP3A 2NW9A 3FB2A 3PE0A 2C5KT 2LEHA 4EYUA 5EK3A 4C91A 2JPFA 2LHNA 3UFEA 3FBZA 4O4JE 2XAFB 1H7CA 5L2LA 1HS7A 3LJCA 3Q5WA 1WLXA 5E0OA 2KMFA 3AA6B 4PFOA 4U74A 1E1HB 1V9DA 2MYSA 3LFMA 1IJ5A 4PW8A 4O2AE 5JVDE 4ZI7E 5JDQA 2NTYA 3CQGB 2ODVA 4ZI3C 4CI3B 1LKXA 3R6NA 2LSIA 4PFPA 1U5PA 2BVMA 2XUEA 1MIYA 3FXEB 3H3AA 4MLKA 3W15B 2IAKA 5L3EB 4ZS2A 2VKDA 3KV9A 2CEAA 3KVAA 4H63H 2X0LB 3AA7B 2LSJA 3IHRA 3BQIA 3I1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CKD A;  3MXZ A;  3QK6 A;  4CQI A;  2MBG A;  2C5I T;  2X9X A;  1QSD A;  1IJ5 A;  4J2C A;  2G0U A;  2X9W A;  1ZKE A;  4FI5 A;  3FXD B;  2C5J A;  1LVF A;  2CA5 A;  3L3P A;  3QUJ A;  1LRZ A;  2XTL A;  4DND A;  3N5L A;  4B6X A;  1Z0P A;  4EYY R;  3CVR A;  3S4U A;  1IJ6 A;  3FXE B;  2X9Y A;  2C5K T;  2IC6 A;  4L0R A;  2K48 A;  2IC9 A;  1H7C A;  2KWH A;  3P7I A;  2KWI B;  3TKL B; 
#chains in the Genus database with same CATH topology
 2P9B A;  3UUB A;  2J62 A;  3NBX X;  4AIS A;  2N1G A;  5JR9 A;  2MBG A;  5JR9 C;  4CXY A;  2W62 A;  5EZY E;  3U78 A;  3VRB A;  1HF8 A;  5JH7 E;  2V7J A;  3JC6 C;  4ISS A;  1ZV4 X;  3AEF A;  4H9Q C;  3ZCI A;  4YY3 T;  2KSR A;  2XSB A;  4X62 T;  4DV7 T;  2VVN A;  2V6X A;  4IL4 A;  4UIG A;  5FXX A;  2V5C A;  2CPT A;  3KV4 A;  4IIJ E;  4QH1 A;  5IYZ E;  4GKK T;  3GN5 B;  3VRA A;  4IDN A;  2WDV A;  2KXP B;  4DR1 T;  1B7T A;  2RP4 A;  2WSS V;  1Y01 A;  3WI3 A;  4DUY T;  2L8K A;  3D0T A;  2JMH A;  5L3B B;  5DAB A;  1R8I A;  2BG9 A;  3P4Q A;  2WM9 A;  4GYR A;  4L9I A;  2XQ5 A;  3U3I A;  2VL8 A;  3PJA J;  4YTN A;  3CPZ A;  4KX6 A;  4TWD A;  5LHI B;  3VKH A;  1J1J A;  2E5V A;  4ILA A;  3MK7 C;  1M7K A;  4JBW F;  3AA1 B;  5HEO A;  5L4H A;  5KDM C;  4AKH A;  2XM2 A;  3H37 A;  3V5S A;  3T1Y T;  4UF0 B;  2ZMA A;  5ABF B;  4JI5 T;  2JQH A;  5FXW A;  4ADZ A;  4WNK A;  1NAF A;  1WRD A;  3QC9 A;  4YSY A;  5LHH B;  1IBK T;  3ZMV B;  5LNK A;  1LRZ A;  3E0Z A;  2EHO B;  4P0B A;  3RYF E;  4WZX A;  1XMO T;  4IE0 A;  4QH4 A;  2XAQ B;  3Q5E A;  3RYC E;  3SWH A;  4AQF A;  2V1D B;  4EEB A;  5L3C B;  4B3M T;  1UX4 A;  2K5B B;  1HX1 B;  2VUR A;  2A3D A;  1L0V A;  2C0S A;  1KNP A;  2VKO A;  1W9R A;  3CQX C;  4WBN E;  3ONL C;  4UV9 B;  3UUN A;  2MTQ A;  2CHN A;  4JI4 T;  2FBW A;  5AFU L;  2XHE B;  3N9M A;  1QLB A;  2FJB A;  2E9X C;  5KX5 E;  2XQA A;  2EHO D;  4G63 A;  4WW0 A;  5LOV E;  3AE2 A;  3RPU A;  2UU9 T;  2DHR A;  3UU8 A;  3I9W A;  5AQF B;  4B3T T;  5LG4 A;  3OJA A;  5L3F B;  1N32 T;  5HWX A;  5J2T E;  2XZE A;  3EDV A;  1KEY A;  3ONX A;  3QB5 A;  2UXX B;  4U72 A;  2HPJ A;  3QUJ A;  1D1C A;  4PJL A;  3ANW B;  3C98 B;  4U7Y A;  1WCR A;  3MKD A;  5JDF A;  3RGL A;  3RC8 A;  2V7I A;  4DMV A;  3OTO T;  3FZF B;  1ZP0 A;  2AE9 A;  4UV8 B;  4DND A;  4DBQ A;  4X66 T;  1BR2 A;  1VCS A;  2XQ7 A;  3N9Q A;  4H9R C;  4X1I E;  2X9H A;  4HGA A;  4IRE A;  5C2T A;  5CFB A;  2MAW A;  3N9P A;  4YLH A;  3E22 E;  4AI6 A;  3VR8 A;  3RYI E;  2IC9 A;  2N2N A;  2NR4 A;  4LFC T;  3RLF F;  3KFW X;  2QYW A;  4IL9 A;  3P4R A;  3P7I A;  3RI5 A;  2CXD A;  4Z90 A;  4LML A;  3QK6 A;  4JV5 T;  2BDE A;  1DU2 A;  2BG9 E;  2DI4 A;  4HE8 A;  3K3Q C;  2SPC A;  1YW0 A;  3OBV E;  4AXP A;  4DMW A;  4EGW A;  2UUC T;  4H9O C;  2C5J A;  5JDL A;  2ZM8 A;  4I55 E;  1KNZ A;  3P4W A;  4DV6 T;  4YJ2 E;  2KLQ A;  2ZM0 A;  3NZQ A;  4YHJ A;  4OX9 T;  5JQG E;  2XAJ B;  2CCQ A;  2CXF A;  1D1A A;  2YDQ A;  4N78 D;  4TX5 A;  4FJO A;  4TWF A;  4V1A v;  4AQY T;  5ETW A;  3ZYL A;  5CGM A;  5L4E A;  4KMC A;  4DID B;  4TV9 E;  2LJL A;  3ZST A;  2LM2 A;  3ZKR A;  5EK2 A;  4NPP A;  5AQQ B;  5FYM A;  3UUX B;  5ABH A;  5LJM A;  4TNW A;  4CXX A;  2Q9Q B;  2A9U A;  3M3Z B;  2LE8 A;  4TUY E;  4DR2 T;  2V7M A;  5H6Q B;  4ZZC A;  3CX8 B;  4U3C A;  1E7P A;  4QWN B;  4YFS A;  4K0U A;  4AKR B;  4E7S A;  4DR4 T;  4HWH A;  2VWA A;  3KBT A;  4EAH A;  4XAX B;  2NW7 A;  5LGN B;  2W2U A;  1HFA A;  4UEL A;  1N34 T;  2X9X A;  3C51 A;  4MFR A;  3L09 A;  3TLV A;  4FI5 A;  1W0B A;  3ZT5 A;  4LMK A;  2B1E A;  2JIW A;  2V8S V;  2BBH A;  4PK6 A;  5FXZ A;  2E9X A;  4U2Y A;  2PG8 A;  2XQ9 A;  4MBQ A;  2W67 A;  5AQH B;  1MMG A;  2W66 A;  4LF6 T;  1KK7 A;  3BQK A;  2CE7 A;  1AJ3 A;  3RKG A;  1FIO A;  3UUM A;  4HFV A;  5J0Z A;  4DR3 T;  3UQ4 A;  4U2Z A;  4BA9 A;  4X20 E;  4AQG A;  4DV3 T;  2Q9Q A;  4YHH T;  3CX6 B;  3F31 A;  4X5T A;  4C90 A;  5LMU T;  2JRK A;  3N2G E;  2M67 A;  2VQF T;  5FNV E;  3DTO A;  5ADX L;  2L3L A;  3ESL A;  2UXB T;  1YKE B;  5JRC B;  2V6Y A;  4DO0 A;  3IBP A;  2K9A A;  3FZK B;  3AE4 A;  4JEH B;  4O4I E;  4OFZ A;  1FJG T;  4P0A A;  2LKH A;  1SUM B;  3AVS A;  3WAK A;  2ACZ A;  4CI2 B;  5HYA A;  3HR0 A;  2C5I T;  1QSD A;  4TZ4 C;  2E5L T;  2VB6 A;  2XPK A;  2WWV A;  5JRC A;  1ZKE A;  2QRX A;  4AKL A;  1UUR A;  4O4L E;  5LBM A;  2VAS A;  5LB7 B;  2BG9 B;  4E7Z A;  2WAU A;  5LGU B;  2W4X A;  2D0U A;  3FZM B;  1D0Z A;  4KI0 F;  2XSA A;  2JQQ A;  4HFI A;  5H6R B;  4ERR A;  4F6R C;  4DUZ T;  3DJB A;  2OA5 A;  4MAL A;  3B13 A;  4OYK A;  2LSY A;  3QOF A;  3CQC B;  4HFE A;  3AE1 A;  3GN5 A;  5AQO B;  4EYY R;  3B5M A;  3ZEF B;  4IDO A;  5HXS A;  4DV2 T;  4HWF A;  5JDM A;  4YJ3 E;  2KT9 A;  2MPK A;  4CN6 A;  5JDH A;  4UVC B;  5AQG B;  3O4X E;  3LG7 A;  2BBJ A;  5TAO A;  5HEH A;  2VKJ A;  4Z91 A;  5LMN T;  4YTP A;  2LSK A;  4JI6 T;  4TV8 E;  3CIR A;  3LK4 2;  2NP9 A;  1X9B A;  3AB3 B;  4ILU A;  5HEG A;  3ZMU B;  3KVB A;  3LBX B;  2Y6X A;  3ZSS A;  4DVD A;  4EIW A;  1VOM A;  2XQ4 A;  3AEB A;  4ZS3 A;  3RQU A;  4YSZ A;  4KHP T;  2WDQ A;  3RH3 A;  3CX7 B;  3UQ7 A;  2VVS A;  2X9W A;  2D0T A;  1Y64 B;  3N2K E;  3ZT6 A;  2WY2 A;  4AIU A;  2E8I A;  5LXT E;  2PJQ A;  3T8O A;  4F8H A;  4GK5 E;  4UXN B;  4BJN A;  4A56 A;  4LFB T;  3NWI A;  5FY7 A;  1EZ3 A;  2YU1 A;  1BR4 A;  2UXN B;  3N5L A;  5HCJ A;  5HEU A;  2Z6E A;  4PJN A;  3ZMS B;  4KP3 C;  5BMV E;  1N36 T;  4JEU B;  3TLW A;  4CI1 B;  3S4U A;  5BR8 T;  4TWH A;  2BVL A;  2HHH T;  2KZ7 B;  1FMV A;  5HXH A;  4HFB A;  2UUA T;  2WDR A;  4QX8 B;  2YK0 A;  4JYA T;  3P50 A;  1UX5 A;  4IE5 A;  2R6G F;  3Q9D A;  5FXV A;  3RRW A;  4P09 A;  3NRY A;  3HKE E;  1MIV A;  2N9D A;  3N9L A;  3PUA A;  1W09 A;  4H63 V;  5AQI B;  5HEJ A;  1J5E T;  4JI7 T;  4U7I A;  3PU8 A;  3TKL B;  3UFG A;  5L47 A;  3LBX A;  2XQ6 A;  3OVU A;  2E9X B;  3R84 B;  4A97 A;  4HWD A;  4CQI A;  2ZM2 A;  4ZZB A;  5AQJ B;  3UU3 A;  1HNX T;  2ACX A;  3B57 A;  2WU5 A;  3ONJ A;  2BKN A;  3RKO A;  5FVK A;  4DR7 T;  4WBO A;  4QH5 A;  2DCF A;  3L3P A;  2A72 A;  2YIN A;  2LOP A;  3ABV A;  5AQN B;  5FMN A;  5LBQ B;  5ABG A;  4NUU A;  2X67 A;  4EOZ B;  4NXN T;  1FMW A;  1WYC A;  1YXR A;  3EHZ A;  2CBI A;  2XTL A;  2DL1 A;  5HXC A;  4LF7 T;  1X79 A;  2ES0 A;  1SE7 A;  4GKJ T;  2OLT A;  3UU4 A;  5IHY A;  2J4G A;  2RA1 A;  3EAM A;  2V6Y B;  4U31 A;  3RRC A;  2WB5 A;  2IC6 A;  1YKH B;  4L0R A;  4DV4 T;  3ZC0 A;  3AA0 B;  3AE6 A;  3BQL A;  2CLY C;  4AQF C;  1W0A A;  1ZHC A;  3AEE A;  3Q2M A;  2IW5 B;  5LG3 A;  2BKO A;  3JAE A;  3A8Y C;  2PBI A;  2JJ9 A;  3GMI A;  4HWI B;  4O4H E;  4HN9 A;  3CKD A;  3J7Y q;  3Q5X A;  2WU2 A;  1MMN A;  5J1G A;  4PNI A;  1KF6 A;  3SRZ A;  2HPL A;  3PU3 A;  3ZLI A;  2YDR A;  1G73 A;  4LF5 T;  3HI2 A;  4A5X A;  2XJ7 A;  3O9X A;  1XDP A;  2Y8D A;  5LHG B;  1NWM X;  5AQU B;  3JAD A;  3TLU A;  3HL6 A;  5F5W A;  4U74 A;  2YOE A;  4NIQ A;  1YQ4 A;  2I59 A;  5FY1 A;  3HKD E;  4L5G A;  1NEN A;  5LP6 E;  3RYH E;  4DV0 T;  3AED A;  4ZHQ E;  3P8C D;  4KHZ F;  5LJN A;  3PTR B;  5JDN A;  4DR6 T;  1HG5 A;  3SS1 A;  4YTM A;  1BR1 A;  4LF9 T;  3EI0 A;  1VRB A;  2GK9 A;  2J47 A;  4ZI3 D;  2FJA A;  4ZOL E;  5AQL B;  3ZPO A;  4JI8 T;  3PUG A;  3Q5D A;  2LKG A;  1WR0 A;  2PFV A;  2KIN B;  2FUP A;  3AAA B;  4OHF A;  5ABF A;  2CBJ A;  5KXJ A;  5L3D B;  1I94 T;  2VK9 A;  2ZLY A;  5A1L A;  1OWA A;  4I50 E;  2YDS A;  1IAP A;  4NUV A;  2W63 A;  3RHW A;  3HA4 A;  3C4W A;  3ANW A;  2X66 A;  4X65 T;  2E9X D;  2DWK A;  3OYX A;  3HKC E;  4QXH B;  2G0U A;  3KV5 A;  2KND A;  3N9O A;  4CZZ B;  3GA8 A;  3AE8 A;  5IWA T;  2M6B A;  4HFD A;  4B3S T;  1XWM A;  2W61 A;  3L39 A;  5GON E;  1FEW A;  3F57 A;  1UK5 A;  4IE4 A;  1HNW T;  1OED C;  2ODU A;  2LM9 A;  1OED A;  5IUX A;  4BJM A;  4IE7 A;  4ASK A;  5CA1 E;  3G06 A;  1J5W A;  2LRL A;  4OK0 A;  3UUL A;  4B3R T;  4TN7 B;  2H7V C;  3JAF A;  3RX6 A;  5AQS B;  4O8S A;  5FVL A;  3ZYK A;  1HNZ T;  4KBM B;  3ZMZ B;  2F4V T;  3I9Y A;  3OKQ A;  4Z8X A;  3CML A;  4CXW A;  4EXT A;  3UTK A;  3RF1 A;  2I0M A;  3MXZ A;  4WYV A;  4EV6 A;  4H9P C;  2K3W A;  3I0Q A;  3AEC A;  1WFD A;  4GOU A;  3EVY A;  4K0K T;  4I43 B;  1KNR A;  1HCI A;  3SOL A;  1ZEE A;  4ZXL A;  5HWY A;  3FBL A;  3AEA A;  2CWO A;  5KMG P;  4IDP A;  3NZP A;  4I4T E;  3VU7 H;  3RIA A;  3PUR A;  2X68 A;  4UR9 A;  2LHR A;  4B6X A;  5HAX A;  2BG9 C;  3AAI A;  3O1I A;  4IDZ A;  2AXD S;  1CUN A;  4NXM T;  1T8B A;  3KBU A;  1MMD A;  2X0Y A;  2NOX A;  1S94 A;  2K48 A;  5DQW A;  1D1B A;  2XM1 A;  3MA9 A;  1HR0 T;  2V26 A;  2WS3 A;  3ZN1 B;  3BK9 A;  3PDY A;  4DR5 T;  3V5U A;  1G8X A;  4QHO A;  1N33 T;  3PUZ F;  4LFA T;  3VKG A;  2Q9Q C;  2CLY B;  2QVA A;  4ANJ A;  3X1D A;  3K3N A;  5C3J A;  4PJJ A;  5LGT B;  4GIW A;  5FY0 A;  2H7O A;  4GYS A;  3KIN B;  2QGS A;  3N2O A;  4GK0 E;  3ZYM A;  3ZT7 A;  3P4P A;  4COF A;  4X64 T;  1T72 A;  3UT5 E;  2K24 A;  1MNE A;  3NVO A;  2L9Q A;  4HFH A;  3A5X A;  3AE7 A;  3M65 A;  3FXD B;  1M62 A;  4U33 A;  3ZMT B;  2XQ3 A;  2DWG A;  1XZY A;  2LRK A;  2V5D A;  3C4X A;  3DP7 A;  3KV6 A;  1WR6 A;  4IHJ E;  4IE6 A;  4M1P A;  4YSX A;  5HXE A;  5JR9 B;  2NTX A;  3N9N A;  4A98 A;  2LOS A;  2B76 A;  2CWY A;  2WCA A;  3K3O A;  4IGU A;  5CJ5 A;  2EHO C;  4EED A;  1JNR A;  3AXJ B;  1NEK A;  2EHO A;  3IA3 A;  4KUM B;  4QXC B;  2X9Y A;  4UVB B;  5F8P A;  2JMK A;  2VKH A;  4ZEY A;  3AE9 A;  2FJD A;  3I0O A;  2CHO A;  1IZN B;  3PUS A;  1U4Q A;  2RPA A;  2W0G A;  2NWB A;  2IHR 1;  4QXB B;  5DQV A;  2J1D G;  3ZJ1 A;  3CWZ B;  3H3M A;  1YD8 G;  1UGO A;  2KWH A;  1HX8 A;  3UU6 A;  2V7L A;  4UF0 A;  4HEA A;  1BR0 A;  1IBM T;  2CXL A;  1HG2 A;  2BKP A;  4IDQ A;  2A2F X;  3QNU A;  2YU2 A;  2HN1 A;  4UEM A;  4LF8 T;  3SFD A;  3VHL A;  1US7 B;  4IST A;  3PV0 F;  2QA7 A;  1XNQ T;  3NRX A;  3C4Z A;  2BS2 A;  4G2A A;  1JNZ A;  3AVR A;  2NW8 A;  2CA5 A;  2ZM6 T;  3HKB E;  3K8P C;  1D0X A;  3J9X 1;  4BAY B;  5DJQ C;  1HTJ F;  3EUH A;  4EB6 E;  2WWU A;  1OXZ A;  4XBF B;  4PK5 A;  3PUX F;  4JLE A;  1Z0P A;  4AKI A;  3CVR A;  3VR9 A;  1IJ6 A;  4X1K E;  1E2A A;  1MND A;  3EAB A;  3MZK B;  1MMA A;  3CK6 A;  3PUW F;  3AAE B;  3QB5 K;  4HWC A;  1Z8U A;  2WP9 A;  2D2S A;  3ETV A;  2JQK A;  2XQ8 A;  3PUQ A;  3SFE A;  2D5U A;  3PUV F;  5JRE A;  4OYJ A;  1S35 A;  1WYB A;  2W00 A;  5FL0 A;  4ILB A;  3ZN0 B;  2XAG B;  4HFC A;  2WMN A;  3UU5 A;  5C8Y E;  4O2B E;  4JI2 T;  3FHN A;  1O3X A;  2CM0 A;  4EZ4 A;  5CA0 E;  2HH7 A;  5J2U E;  3ZCJ A;  5JDG A;  1D0Y A;  2Q9Q D;  4HKA A;  2VL0 A;  4P1N A;  4PJM A;  5FKY A;  4MHC A;  4J2C A;  3IEE A;  3C64 A;  3K1S A;  3KDS E;  1SA0 E;  5AQR B;  5LCY A;  3JC6 D;  1T98 A;  3LK3 B;  3JCF A;  3L8R A;  3AE5 A;  3C50 A;  5CB4 E;  4ZI2 C;  5JTG A;  1OED E;  2WBL A;  1LVF A;  3A7M A;  3PUY F;  4Q25 A;  3OYZ A;  2DLR A;  2YEV C;  3RIU C;  5FL1 A;  3ZJ2 A;  3MJX A;  3OPC A;  1HS7 A;  1UUS A;  3AXJ A;  2Y48 B;  3ETU A;  4UVA B;  5F3J A;  5EK4 A;  4QKN A;  3RC3 A;  2OV9 A;  2MOZ A;  2LT3 A;  2LSG A;  2X51 A;  5HCM A;  2WZI A;  4PK4 A;  4YXD A;  4PAG A;  3AEG A;  2JQ9 A;  4DBR A;  4ZI2 D;  3MAC A;  2DNX A;  3O1J A;  5AQP B;  3RQW A;  2CMR A;  2BS4 A;  2WMO A;  3TLS A;  4YT0 A;  1ZOY A;  1LVK A;  2H3R A;  3LK2 B;  4X1Y E;  3O1H A;  5AQK B;  5LYJ E;  4HTE A;  5M4Y A;  3E08 A;  2KWI B;  3WAJ A;  2UXD T;  2XAH B;  1I6Z A;  2H89 A;  3GWH A;  5HXR A;  2UXC T;  2WQY A;  4H9N C;  2UUB T;  2BZB A;  4JUY A;  3EDU A;  5ABE A;  1QUU A;  4ILC A;  3F2E A;  2XAS B;  2XQY A;  1MIW A;  2YN6 A;  3ZC1 A;  4H9S E;  3IF8 B;  3FZH B;  5AQV B;  4EZH A;  4JI1 T;  4AKG A;  4QX7 B;  1UCU A;  1SHZ C;  2V7K A;  4XZC A;  2M6I A;  1KFY A;  3AE3 A;  5AQM B;  3LDQ B;  2HN2 A;  1XDO A;  5FP3 A;  2NW9 A;  3FB2 A;  3PE0 A;  2C5K T;  2LEH A;  3FZL B;  2LLY A;  5EK3 A;  4C91 A;  4EYU A;  2JPF A;  2LHN A;  2PTF A;  5AQT B;  3UFE A;  1YQ3 A;  2BS3 A;  3FBZ A;  4IT4 A;  4O4J E;  4DV5 T;  3RIF A;  4CN4 A;  2XAF B;  1H7C A;  5L2L A;  5LA6 E;  1GQE A;  3LJC A;  3Q5W A;  4LMJ A;  1WLX A;  2VQE T;  1VCT A;  2D9D A;  3PJA A;  1IBL T;  5E0O A;  2IML A;  2IDO B;  2KMF A;  3AA6 B;  3T1H T;  1XMQ T;  2IIU A;  4I0U A;  4PFO A;  1E1H B;  1V9D A;  2MYS A;  2X0H A;  2YKS A;  1IJ5 A;  2XY8 B;  3LFM A;  4O2A E;  4PW8 A;  5L3G B;  5JVD E;  4ZI7 E;  5JDQ A;  2NTY A;  3CQG B;  2ODV A;  4ZI3 C;  1CHU A;  1XNR T;  4CI3 B;  2FJE A;  4JI3 T;  1LKX A;  3R6N A;  1OED B;  2LSI A;  4PFP A;  3NKZ A;  1U5P A;  4LF4 T;  2BVM A;  2I6H A;  2WZH A;  2XUE A;  1MIY A;  3TLT A;  3FXE B;  4CN1 A;  3H3A A;  4MLK A;  3W15 B;  2IUB A;  3P4S A;  2IAK A;  5L3E B;  4TNV A;  4ZS2 A;  2H88 A;  1T7S A;  2VKD A;  3KV9 A;  4DV1 T;  2CEA A;  3KVA A;  4JI0 T;  2E2A A;  3RIU A;  3LSV A;  2CRB A;  4H63 H;  2X0L B;  3AA7 B;  2LSJ A;  3IHR A;  3BQI A;  3I1A A; 
#chains in the Genus database with same CATH homology
 2P9B A;  3NBX X;  2N1G A;  5JR9 A;  2MBG A;  5JR9 C;  4CXY A;  2W62 A;  5EZY E;  3U78 A;  1HF8 A;  5JH7 E;  2V7J A;  3JC6 C;  4ISS A;  1ZV4 X;  4H9Q C;  3ZCI A;  4UIG A;  5FXX A;  3KV4 A;  4IIJ E;  5IYZ E;  3GN5 B;  2KXP B;  1B7T A;  2RP4 A;  2WSS V;  3WI3 A;  2L8K A;  3D0T A;  2JMH A;  5L3B B;  5DAB A;  4L9I A;  2WM9 A;  4GYR A;  3U3I A;  2VL8 A;  3CPZ A;  5LHI B;  3VKH A;  3MK7 C;  3AA1 B;  5KDM C;  4AKH A;  3V5S A;  3H37 A;  4UF0 B;  2ZMA A;  5FXW A;  4ADZ A;  4WNK A;  1NAF A;  1WRD A;  3QC9 A;  5LHH B;  3ZMV B;  5LNK A;  1LRZ A;  3E0Z A;  2EHO B;  4P0B A;  3RYF E;  4IE0 A;  2XAQ B;  3RYC E;  3SWH A;  4AQF A;  5L3C B;  2V1D B;  1UX4 A;  2K5B B;  2A3D A;  2C0S A;  2VKO A;  3CQX C;  4WBN E;  4UV9 B;  3UUN A;  2MTQ A;  5AFU L;  2XHE B;  3N9M A;  2E9X C;  5KX5 E;  2EHO D;  4G63 A;  4WW0 A;  5LOV E;  3RPU A;  2DHR A;  3I9W A;  5LG4 A;  3OJA A;  5L3F B;  5HWX A;  5J2T E;  3EDV A;  3ONX A;  2UXX B;  4U72 A;  2HPJ A;  3QUJ A;  1D1C A;  4PJL A;  3ANW B;  3C98 B;  3MKD A;  5JDF A;  3RC8 A;  2V7I A;  4DMV A;  4UV8 B;  4DBQ A;  1BR2 A;  3N9Q A;  4H9R C;  4X1I E;  2X9H A;  4HGA A;  3N9P A;  4YLH A;  3E22 E;  4AI6 A;  3RYI E;  2IC9 A;  2N2N A;  3KFW X;  3P7I A;  2CXD A;  3QK6 A;  2BDE A;  2DI4 A;  4HE8 A;  3K3Q C;  2SPC A;  1YW0 A;  3OBV E;  4AXP A;  4DMW A;  4H9O C;  2C5J A;  5JDL A;  2ZM8 A;  4I55 E;  1KNZ A;  4YJ2 E;  2KLQ A;  2ZM0 A;  3NZQ A;  4YHJ A;  5JQG E;  2XAJ B;  2CCQ A;  2CXF A;  1D1A A;  4V1A v;  4N78 D;  4TX5 A;  4FJO A;  4DND A;  5ETW A;  3ZYL A;  4KMC A;  4TV9 E;  2LJL A;  5EK2 A;  5FYM A;  3UUX B;  5LJM A;  4CXX A;  2Q9Q B;  2LE8 A;  4TUY E;  2V7M A;  5H6Q B;  3CX8 B;  4YFS A;  4QWN B;  4E7S A;  4K0U A;  4AKR B;  2VWA A;  3KBT A;  4EAH A;  4XAX B;  2NW7 A;  5LGN B;  1HFA A;  4UEL A;  2X9X A;  3C51 A;  4MFR A;  3L09 A;  4FI5 A;  2B1E A;  4PK6 A;  5FXZ A;  2E9X A;  2PG8 A;  4MBQ A;  1MMG A;  1KK7 A;  3BQK A;  2CE7 A;  1AJ3 A;  1FIO A;  3UUM A;  4HFV A;  4BA9 A;  4X20 E;  4AQG A;  2Q9Q A;  3CX6 B;  3F31 A;  4C90 A;  2JRK A;  3N2G E;  2M67 A;  5FNV E;  3DTO A;  5ADX L;  2L3L A;  3ESL A;  5JRC B;  1YKE B;  4DO0 A;  3IBP A;  2K9A A;  4JEH B;  4O4I E;  4OFZ A;  4P0A A;  3AVS A;  4CI2 B;  3WAK A;  5HYA A;  3HR0 A;  2C5I T;  1QSD A;  4TZ4 C;  2VB6 A;  5JRC A;  1ZKE A;  4AKL A;  4O4L E;  5LBM A;  4E7Z A;  2VAS A;  5LGU B;  2WAU A;  2D0U A;  1D0Z A;  2JQQ A;  5H6R B;  4ERR A;  4F6R C;  3DJB A;  2OA5 A;  4MAL A;  3B13 A;  4OYK A;  2LSY A;  5LA6 E;  3CQC B;  4EYY R;  3ZEF B;  3GN5 A;  5HXS A;  5JDM A;  4YJ3 E;  2KT9 A;  5JDH A;  4UVC B;  3O4X E;  3LG7 A;  5TAO A;  2VKJ A;  2LSK A;  4TV8 E;  3LK4 2;  3ZMU B;  2NP9 A;  3AB3 B;  4ILU A;  3KVB A;  3LBX B;  2Y6X A;  4DVD A;  4EIW A;  1VOM A;  4ZS3 A;  3RH3 A;  3CX7 B;  2X9W A;  2D0T A;  1Y64 B;  3N2K E;  5LXT E;  2E8I A;  2PJQ A;  3T8O A;  4GK5 E;  4UXN B;  4BJN A;  4A56 A;  5FY7 A;  1EZ3 A;  2YU1 A;  1BR4 A;  2UXN B;  3N5L A;  3ZMS B;  5BMV E;  2Z6E A;  4PJN A;  4KP3 C;  4JEU B;  4CI1 B;  3S4U A;  2BVL A;  2KZ7 B;  1FMV A;  5HXH A;  4QX8 B;  2YK0 A;  1UX5 A;  4IE5 A;  3Q9D A;  5FXV A;  3RRW A;  4P09 A;  3NRY A;  3HKE E;  1MIV A;  2N9D A;  3N9L A;  3PUA A;  4H63 V;  3PU8 A;  3TKL B;  3LBX A;  3R84 B;  2E9X B;  4CQI A;  2ZM2 A;  2ACX A;  3B57 A;  3RKO A;  4WBO A;  2DCF A;  3L3P A;  2A72 A;  2YIN A;  2LOP A;  5FMN A;  5LBQ B;  4EOZ B;  4NUU A;  2X67 A;  1FMW A;  1WYC A;  2XTL A;  5HXC A;  1X79 A;  2ES0 A;  5IHY A;  2RA1 A;  3RRC A;  2IC6 A;  1YKH B;  4L0R A;  3ZC0 A;  3AA0 B;  3BQL A;  2CLY C;  4AQF C;  1ZHC A;  3Q2M A;  2IW5 B;  3GMI A;  2PBI A;  2JJ9 A;  4O4H E;  4HN9 A;  3CKD A;  3J7Y q;  3Q5X A;  1MMN A;  5J1G A;  4PNI A;  3SRZ A;  2HPL A;  3PU3 A;  3ZLI A;  1G73 A;  3HI2 A;  3O9X A;  2Y8D A;  5LHG B;  1NWM X;  3HL6 A;  2I59 A;  5FY1 A;  3HKD E;  4L5G A;  3RYH E;  4ZHQ E;  3P8C D;  5LJN A;  3PTR B;  5JDN A;  1HG5 A;  3SS1 A;  1BR1 A;  1VRB A;  2GK9 A;  4ZI3 D;  4ZOL E;  3ZPO A;  3PUG A;  3AAA B;  2PFV A;  2KIN B;  4OHF A;  2VK9 A;  2ZLY A;  5A1L A;  1OWA A;  4I50 E;  1IAP A;  4NUV A;  2W63 A;  3HA4 A;  3C4W A;  3ANW A;  2X66 A;  2E9X D;  2DWK A;  3OYX A;  3HKC E;  4QXH B;  2G0U A;  3KV5 A;  2KND A;  3N9O A;  4CZZ B;  3GA8 A;  2W61 A;  5GON E;  1FEW A;  3F57 A;  4IE4 A;  2ODU A;  2LM9 A;  4BJM A;  4IE7 A;  4ASK A;  5CA1 E;  4OK0 A;  3UUL A;  4TN7 B;  2H7V C;  3RX6 A;  3ZYK A;  4O8S A;  4KBM B;  3ZMZ B;  3I9Y A;  3OKQ A;  4Z8X A;  3CML A;  4CXW A;  4EXT A;  3UTK A;  3MXZ A;  4H9P C;  3I0Q A;  4GOU A;  3EVY A;  4I43 B;  1HCI A;  3SOL A;  1ZEE A;  5KMG P;  5HWY A;  3FBL A;  2CWO A;  3NZP A;  4I4T E;  3VU7 H;  3PUR A;  2X68 A;  2LHR A;  4B6X A;  5HAX A;  3AAI A;  3O1I A;  4IDZ A;  1CUN A;  3KBU A;  1MMD A;  2NOX A;  1S94 A;  2K48 A;  5DQW A;  1D1B A;  3MA9 A;  2V26 A;  3ZN1 B;  3BK9 A;  3PDY A;  3V5U A;  1G8X A;  4QHO A;  2Q9Q C;  2CLY B;  4ANJ A;  3K3N A;  4PJJ A;  5LGT B;  4GIW A;  5FY0 A;  2H7O A;  4GYS A;  3KIN B;  2QGS A;  3N2O A;  4GK0 E;  3ZYM A;  3UT5 E;  2K24 A;  1MNE A;  2L9Q A;  3A5X A;  3M65 A;  3ZMT B;  3FXD B;  2DWG A;  3C4X A;  3KV6 A;  4IHJ E;  3DP7 A;  4IE6 A;  1WR6 A;  4M1P A;  5HXE A;  5JR9 B;  2NTX A;  3N9N A;  2CWY A;  2LOS A;  3K3O A;  4IGU A;  2EHO C;  4KUM B;  2EHO A;  4QXC B;  2X9Y A;  5F8P A;  2JMK A;  2VKH A;  4XBF B;  3I0O A;  3PUS A;  1IZN B;  4QXB B;  1U4Q A;  2W0G A;  5DQV A;  2NWB A;  2J1D G;  3ZJ1 A;  3CWZ B;  1YD8 G;  2KWH A;  1HX8 A;  2V7L A;  4UF0 A;  4HEA A;  1BR0 A;  2CXL A;  1HG2 A;  4UEM A;  3VHL A;  2A2F X;  5L3D B;  2YU2 A;  1US7 B;  4IST A;  2QA7 A;  3NRX A;  3C4Z A;  4G2A A;  3AVR A;  2NW8 A;  2CA5 A;  3HKB E;  3K8P C;  1D0X A;  3J9X 1;  4BAY B;  5DJQ C;  1HTJ F;  3EUH A;  4EB6 E;  2WWU A;  1OXZ A;  4PK5 A;  4JLE A;  1Z0P A;  4AKI A;  3CVR A;  1IJ6 A;  4X1K E;  1MND A;  3MZK B;  1MMA A;  3AAE B;  4UVB B;  5L3G B;  3ETV A;  2D2S A;  3PUQ A;  5JRE A;  2D5U A;  4OYJ A;  1S35 A;  1WYB A;  2W00 A;  3ZN0 B;  5C8Y E;  2XAG B;  2WMN A;  4O2B E;  3FHN A;  1O3X A;  2CM0 A;  4EZ4 A;  5CA0 E;  2HH7 A;  5J2U E;  3ZCJ A;  5JDG A;  1D0Y A;  2Q9Q D;  4HKA A;  4PJM A;  3VKG A;  4MHC A;  4J2C A;  3IEE A;  3C64 A;  3KDS E;  5LP6 E;  1SA0 E;  5LCY A;  3JC6 D;  1T98 A;  3LK3 B;  4ZI2 C;  3C50 A;  5CB4 E;  2WBL A;  1LVF A;  3OYZ A;  2DLR A;  2YEV C;  3ZJ2 A;  3MJX A;  2Y48 B;  3ETU A;  4UVA B;  5F3J A;  5EK4 A;  4QKN A;  3RC3 A;  2MOZ A;  2LT3 A;  2LSG A;  2X51 A;  4PK4 A;  4PAG A;  4DBR A;  4ZI2 D;  3MAC A;  2DNX A;  3O1J A;  2CMR A;  2WMO A;  2H3R A;  1LVK A;  3LK2 B;  4X1Y E;  5LYJ E;  3O1H A;  5M4Y A;  4HTE A;  3E08 A;  2KWI B;  3WAJ A;  2XAH B;  3GWH A;  5HXR A;  4H9N C;  2BZB A;  4JUY A;  3EDU A;  1QUU A;  3F2E A;  2XAS B;  2XQY A;  1MIW A;  3ZC1 A;  4H9S E;  3IF8 B;  4EZH A;  4AKG A;  4QX7 B;  1UCU A;  1SHZ C;  2V7K A;  4XZC A;  5FP3 A;  2NW9 A;  3FB2 A;  3PE0 A;  2C5K T;  2LEH A;  4EYU A;  5EK3 A;  4C91 A;  2JPF A;  2LHN A;  3UFE A;  3FBZ A;  4O4J E;  2XAF B;  1H7C A;  5L2L A;  1HS7 A;  3LJC A;  3Q5W A;  1WLX A;  5E0O A;  2KMF A;  3AA6 B;  4PFO A;  4U74 A;  1E1H B;  1V9D A;  2MYS A;  3LFM A;  1IJ5 A;  4PW8 A;  4O2A E;  5JVD E;  4ZI7 E;  5JDQ A;  2NTY A;  3CQG B;  2ODV A;  4ZI3 C;  4CI3 B;  1LKX A;  3R6N A;  2LSI A;  4PFP A;  1U5P A;  2BVM A;  2XUE A;  1MIY A;  3FXE B;  3H3A A;  4MLK A;  3W15 B;  2IAK A;  5L3E B;  4ZS2 A;  2VKD A;  3KV9 A;  2CEA A;  3KVA A;  4H63 H;  2X0L B;  3AA7 B;  2LSJ A;  3IHR A;  3BQI A;  3I1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...