1H7CA

Human tubulin chaperone cofactor a
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
PRVRQIKIKTGVVRRLVKERVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUBULIN-SPECIFIC CHAPERONE A
publication title Three-Dimensional Structure of Human Tubulin Chaperone Cofactor A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02970 TBCA Tubulin binding cofactor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1h7cA00
2MBGA 2IC9A 4L0RA 1LVFA 4B6XA 2KWIB 1QSDA 2X9YA 3N5LA 2C5JA 2X9XA 3FXDB 1IJ5A 4DNDA 2C5KT 2G0UA 2KWHA 1IJ6A 2XTLA 3P7IA 1H7CA 4FI5A 3S4UA 4CQIA 2CA5A 3L3PA 4EYYR 3QK6A 3QUJA 3FXEB 3CVRA 1ZKEA 1LRZA 2K48A 3MXZA 2X9WA 3TKLB 3CKDA 2IC6A 2C5IT 1Z0PA 4J2CA
chains in the Genus database with same CATH superfamily
4YLHA 3ETUA 2VL8A 4GK5E 4DR2T 4ISTA 5JDFA 3EABA 4U74A 2MAWA 1XZYA 2B76A 1YKEB 5LP6E 3JC6C 4H9OC 2X9HA 3KINB 4PJMA 1WRDA 5EZYE 3AVRA 4CN1A 2UXXB 5IWAT 1T7SA 1E1HB 2K24A 3H37A 3RKGA 3X1DA 3I9YA 3RQWA 1FMWA 2DNXA 5CJ5A 2CCQA 2OA5A 4AKLA 2N9DA 4DV7T 4HFIA 4I50E 2D2SA 3CK6A 4DR4T 1S35A 2L8KA 5H6RB 4HFHA 4I55E 4H9SE 4TNWA 4CQIA 2J62A 3SWHA 3PUAA 1L0VA 3UU6A 3AE6A 3FZFB 4IDQA 4WYVA 3ZEFB 5L3EB 4L0RA 4UVAB 2XAFB 3L8RA 4UVBB 3RYCE 4ZZCA 4PFOA 2HHHT 2XSAA 2W0GA 1KNRA 3MZKB 3PUQA 4NXNT 3AAAB 3EAMA 3MXZA 3KV6A 4PJNA 2WS3A 4YXDA 3NKZA 4QXCB 2UUBT 4FJOA 2V7IA 3I0OA 4H9QC 1H7CA 2XQ4A 4IL4A 4HWCA 2VVSA 3C4WA 2V6YA 4JLEA 5HWXA 2OV9A 2BVLA 5AQUB 3ZYMA 1FEWA 2KWIB 5E0OA 3I1AA 5JDHA 2YDSA 4OX9T 3TLVA 2J4GA 3QB5A 3AEBA 1KK7A 4LMLA 3KDSE 1QUUA 5FXVA 4AKHA 4U31A 3RRWA 2R6GF 3RF1A 4DR3T 4ERRA 2YN6A 2Z6EA 4HWFA 3HKCE 2X51A 2NWBA 1UCUA 3PUWF 1YW0A 4HGAA 5LGUB 4QH5A 5IHYA 5AQTB 2CHNA 2IDOB 3ZMSB 3UFEA 2LT3A 3PDYA 4YTMA 4ADZA 2BBJA 3BQKA 1XNRT 5KMGP 4K0UA 4Z91A 2IC6A 4HFVA 3N2GE 2XQAA 4GKJT 4JI5T 4YHHT 4JI8T 4IT4A 4JI6T 4ANJA 1FJGT 2H88A 1UX4A 4PFPA 3CQXC 2FJBA 4TV9E 5LA6E 2UU9T 2Q9QC 3SOLA 4UIGA 5LG4A 4HWIB 4XZCA 2KZ7B 3MA9A 5CGMA 4TX5A 5AQMB 2BZBA 3AB3B 5AFUL 2DCFA 4KI0F 4AQYT 3C98B 2WQYA 4X62T 4DV1T 5F3JA 3AE9A 3A7MA 4MLKA 2VQET 2IUBA 4IL9A 4HWHA 2XAJB 4F6RC 2V1DB 1HNXT 2LRKA 4QWNB 5AQJB 2AXDS 2WSSV 4A97A 4U33A 1ZKEA 2QA7A 5J2TE 2K48A 3V5UA 5L3FB 3F57A 3R6NA 1S94A 5LJNA 3TLWA 2WCAA 3IEEA 4CI2B 1MIYA 1UUSA 2NP9A 3RRCA 1IBMT 5H6QB 4XAXB 2HPJA 5CFBA 1MMDA 3M65A 4EYYR 4TZ4C 1QLBA 2MOZA 2E9XC 3KFWX 2BG9A 2CXLA 2VB6A 4BAYB 2QVAA 3O1IA 4UELA 1HTJF 4QX7B 1WR0A 2LEHA 3P4RA 5JDQA 4AQFC 1T8BA 3U3IA 5FY1A 4HFEA 1G8XA 3WI3A 1J1JA 4GYRA 4DV3T 2ZM8A 2BBHA 4DV2T 3OTOT 2LOPA 2X68A 4JEUB 4TN7B 3PUSA 1US7B 3HKEE 4LFAT 3C4XA 2QRXA 2LJLA 2A2FX 3IBPA 2CBJA 2FBWA 2YDQA 5LG3A 1N36T 2W4XA 2WMNA 2WB5A 3RLFF 3BQIA 5FKYA 3C51A 3L39A 3DP7A 2E5VA 2VK9A 3DJBA 4TWFA 3QC9A 1B7TA 2BKPA 2NOXA 4O4IE 5JDNA 3BK9A 3J9X1 3TLSA 2F4VT 2A9UA 2L9QA 2JPFA 4LF6T 4EB6E 3HKDE 4DR5T 3J7Yq 1Y64B 3RX6A 5AQRB 2W63A 3LBXA 5DJQC 4P0AA 2N1GA 3PUZF 5C2TA 3LJCA 2W66A 4CN6A 2W61A 4EEDA 5L3BB 2FJAA 2WWUA 3C50A 4ZXLA 4PJJA 4YHJA 1WR6A 3AE7A 4E7ZA 2C5IT 3CX7B 4IDNA 2H3RA 2IC9A 2V8SV 1UK5A 4U3CA 2E9XB 2HN1A 3UT5E 1UGOA 2KT9A 3QOFA 2M67A 3AXJB 4LF8T 3B13A 3ESLA 4IE7A 4ILBA 4ZI3D 4C90A 2V7LA 3EI0A 3CPZA 4IDOA 3FB2A 4ILUA 4ZI2D 1UURA 1YD8G 3LK42 2OLTA 2WWVA 5LB7B 5JRCB 1VCTA 4ZI7E 2VL0A 1JNRA 3PE0A 4CI1B 2XQ3A 3SFDA 5LXTE 3UU8A 3KBUA 2WDQA 3G06A 1ZV4X 3KV4A 4HFBA 4EGWA 5HEJA 2VQFT 1R8IA 4JBWF 5LHIB 4EV6A 5AQSB 2XASB 2CBIA 3Q5WA 4P0BA 1OXZA 1W0AA 4OFZA 2IMLA 5BMVE 3K3NA 2XM1A 4QH1A 3LDQB 4QKNA 3FBLA 4B3MT 1D0XA 3PU3A 5L4EA 4JI4T 1BR4A 5L3GB 3ETVA 3PUVF 1UX5A 3RIFA 3ZMZB 3ANWB 4DV6T 4BJNA 2HN2A 3DTOA 4I4TE 4E7SA 2JQQA 2PG8A 2LHRA 1XWMA 1NEKA 3AE1A 2BVMA 3CIRA 4YTPA 3FZKB 2WZIA 4HTEA 4YJ3E 4KX6A 1KFYA 2YDRA 4IDZA 1HCIA 4KUMB 5KX5E 4X64T 3C64A 3KV9A 2X66A 3S4UA 2IIUA 4O4LE 3UUXB 1WYBA 4YFSA 3ZC1A 2V6YB 2PBIA 3RH3A 4DIDB 2MYSA 2JQHA 4YT0A 5ABFB 2NR4A 4IDPA 1HG5A 3H3MA 2VURA 3O1JA 2D0TA 4L5GA 3ANWA 1LRZA 1U4QA 5TAOA 4H9PC 4V1Av 3PU8A 3ZT6A 3CQCB 5HEHA 5LMUT 1Y01A 4X1IE 5LMNT 1E2AA 3GMIA 2LSKA 3ZMVB 4LF4T 3UUBA 3AE4A 4DUYT 2WDVA 2LM2A 1I6ZA 2BG9C 2CHOA 3AAEB 3UULA 3FXDB 3I0QA 2BG9E 4AKGA 1NWMX 3AA0B 3B57A 2XAGB 2KNDA 5ABFA 3L09A 3JCFA 3O1HA 4ILAA 1MMAA 3IA3A 3KBTA 3N9NA 1WFDA 2XAHB 1MIVA 1MMGA 3N2OA 2CA5A 3CQGB 4MHCA 2XPKA 4PK4A 3U78A 3N9OA 3T1HT 4BJMA 5JDGA 2XY8B 3RQUA 5FL1A 2X9YA 4HWDA 4JI7T 3K3OA 4YSXA 2DWGA 4IE5A 5C8YE 5EK3A 2BKOA 3NRYA 2H7VC 5L4HA 2BDEA 2GK9A 5HYAA 4B3RT 1HX1B 3LSVA 3NRXA 2L3LA 3H3AA 1N34T 3RIUC 3MJXA 4H63H 3OKQA 3P4WA 3AE3A 1KEYA 1ZOYA 5IYZE 3UU3A 1CUNA 3ZLIA 4CXXA 1NENA 3AA6B 3QNUA 3QK6A 1KNPA 4TWHA 4U7YA 1YKHB 5LJMA 4O2BE 5EK2A 4U2ZA 3UU5A 2XAQB 4EOZB 5HCMA 4HEAA 3JAFA 4ZOLE 2XJ7A 3ZMTB 4X5TA 4J2CA 2MBGA 2WZHA 2ES0A 2V7MA 2JIWA 3VHLA 2VKJA 5DQVA 2IAKA 4DBRA 2VVNA 5FYMA 2BG9B 3ONJA 4UF0A 1OEDA 2WBLA 2LOSA 3RC8A 3FZHB 4AXPA 4XBFB 5FY7A 3GN5B 3ZKRA 4ZHQE 2G0UA 2WDRA 4H63V 4TUYE 2JJ9A 4UEMA 3AEFA 2X0LB 1FIOA 2NW8A 4IGUA 2XQ9A 2WY2A 5LGNB 1J5ET 3PJAA 3T1YT 5LOVE 3ONLC 1N32T 4JI1T 4Z8XA 4LF5T 5LNKA 3GWHA 2HPLA 1D1BA 4YTNA 2CWOA 5JREA 3O9XA 3MK7C 2YKSA 3UUMA 3IHRA 2RPAA 3AE8A 4A5XA 4H9NC 2V5DA 4JI3T 4JYAT 4IREA 4DR7T 3AEEA 3OYXA 5HXRA 5J0ZA 3CX8B 2WU5A 2UXBT 2KINB 3Q5DA 3GN5A 1JNZA 4O4JE 3TKLB 4PK5A 1ZP0A 1D1AA 3JC6D 1MMNA 5JDLA 2MPKA 4A56A 4O4HE 4MBQA 1WYCA 5AQKB 4NUVA 1HNWT 2HH7A 3LBXB 5L3CB 4ILCA 2ZM2A 1HF8A 2XUEA 3VRBA 2D5UA 1AJ3A 3ZCJA 3Q5EA 2IW5B 3P4PA 4B3ST 3N5LA 2XQ7A 1GQEA 1MNDA 4G63A 1I94T 2CLYB 4GYSA 4OYJA 2RA1A 2M6IA 1Z8UA 2FJDA 2CXFA 3PUYF 4P1NA 2IHR1 1Z0PA 1V9DA 2XHEB 4QXHB 1MNEA 4WZXA 4EZ4A 3LK2B 3RIUA 3ZYLA 1FMVA 4HE8A 2KSRA 3RPUA 3N9QA 2RP4A 3EDUA 3ZCIA 5F5WA 5FXXA 2V7KA 4KHZF 4YJ2E 2LSIA 2XQ8A 2I0MA 2DLRA 4U2YA 4WW0A 1HNZT 3AVSA 4AKRB 4OHFA 3M3ZB 2P9BA 3PJAJ 4I43B 2QYWA 3AEDA 1SHZC 1T98A 3GA8A 2H7OA 2BKNA 4JUYA 3D0TA 2JQ9A 5JR9A 5BR8T 3K1SA 5JDMA 5AQLB 3WAKA 2UXCT 4CZZB 2MTQA 2CRBA 1NAFA 2LSGA 3ONXA 2JRKA 4X1KE 3EDVA 1M62A 4IIJE 2PFVA 4LFCT 3NWIA 2NW7A 1VRBA 4DO0A 2DWKA 4LF9T 3CMLA 2UUAT 4JV5T 2Y8DA 4ZS2A 3RYHE 3UU4A 2WM9A 3PV0F 1MIWA 5GONE 4WNKA 4DNDA 4U7IA 2UXNB 2WAUA 2LHNA 5LCYA 5C3JA 3W15B 5M4YA 4HFDA 4AKIA 1D0YA 1HS7A 1EZ3A 2KXPB 4EZHA 4L9IA 4G2AA 3JADA 2ACZA 5JTGA 2V7JA 4UVCB 3N9LA 1KF6A 2NTYA 2YK0A 5CA1E 1W0BA 4GOUA 2BS3A 4Z90A 3RYIE 4DMVA 1BR1A 5HXCA 5J2UE 2D0UA 5FVLA 4NIQA 4CN4A 3SRZA 3N9MA 1G73A 2CEAA 3EVYA 3ZT7A 2CMRA 3SFEA 3KV5A 3MKDA 4LF7T 2Q9QD 2XSBA 2EHOA 4X20E 4U72A 3AA7B 4DV5T 2CE7A 4DR6T 3FHNA 4B6XA 3E22E 5HXHA 2Y6XA 2K3WA 1VOMA 2LSYA 3IF8B 2W00A 4ZZBA 3OJAA 4X65T 3RKOA 3ZN1B 2YOEA 3VR8A 3K3QC 4CXYA 1XDOA 2LE8A 2X67A 3FBZA 4DBQA 3NZPA 3ZJ1A 2YU2A 3ZSTA 4DR1T 3OBVE 3ZMUB 1OEDC 1BR2A 5AQFB 3ZJ2A 3ZPOA 3Q5XA 2LLYA 2V6XA 1X79A 1WLXA 1OEDE 4QX8B 3WAJA 3HI2A 4MALA 5FNVE 2ZLYA 3FZLB 4EEBA 2I6HA 2YINA 1YQ3A 3VKHA 1CHUA 2UUCT 1W09A 5ABEA 2Y48B 4EYUA 2EHOD 2E9XD 5CB4E 4NXMT 4GKKT 2ZM0A 2KWHA 5HEUA 2X0HA 2D9DA 4JEHB 5AQVB 4PW8A 3P50A 4KHPT 4AISA 5LHHB 4HFCA 3AECA 3PTRB 4NPPA 2FUPA 5AQOB 3L3PA 2KLQA 2V5CA 2W2UA 4DMWA 3AEAA 2WP9A 2ODVA 5ABGA 1XDPA 3TLTA 1LVKA 4GK0E 5L3DB 5LBMA 3V5SA 5FP3A 5FVKA 4PK6A 2CXDA 4B3TT 5JH7E 3FZMB 1BR0A 3N9PA 3R84B 4BA9A 4ASKA 3RHWA 3Q9DA 1SA0E 3EUHA 4ZEYA 4YY3T 3LFMA 3RYFE 5FL0A 4YSYA 2LSJA 3AE5A 3PUXF 3ZYKA 4MFRA 2CWYA 3O4XE 1XNQT 1E7PA 4ZI3C 3A5XA 5JVDE 5HCJA 4ZI2C 3ABVA 2N2NA 3P4SA 2PTFA 2DL1A 4UF0B 1OEDB 4A98A 5JQGE 4Q25A 2CM0A 1J5WA 4O2AE 5AQHB 1IAPA 2VKDA 4IHJE 2QGSA 4PJLA 4AI6A 2WMOA 2FJEA 2XQYA 3I9WA 2W62A 1SE7A 3TLUA 1X9BA 4M1PA 4EIWA 4HKAA 3RIAA 2KMFA 2V26A 5DABA 1U5PA 3KVBA 2XQ6A 4H9RC 5JR9C 4UV9B 3AAIA 2K9AA 3NZQA 3QUJA 3JAEA 5FY0A 2YU1A 3AEGA 2CLYC 1LVFA 4KMCA 3ZSSA 3E08A 1OWAA 5HEOA 3LK3B 5HWYA 2NW9A 3UTKA 1XMOT 3HL6A 2WU2A 3AA1B 2LKHA 3EHZA 2XQ5A 5A1LA 1XMQT 3T8OA 2ZMAA 4KP3C 3VKGA 3PURA 3P8CD 5HXEA 3RC3A 2A72A 4QHOA 1D1CA 5F8PA 3HKBE 2AE9A 3E0ZA 5LBQB 2A3DA 5IUXA 2PJQA 1DU2A 4N78D 3B5MA 2VKHA 5AQQB 1N33T 2E8IA 1IBKT 4NUUA 5EK4A 2X9XA 1IJ5A 2CPTA 4ISSA 2XZEA 4LFBT 5HXSA 4CI3B 3RGLA 4C91A 3OPCA 2VKOA 3FXEB 1M7KA 4DUZT 2EHOC 2E5LT 1LKXA 2SPCA 4X66T 1QSDA 4CXWA 5J1GA 5AQPB 3LG7A 1IZNB 5HEGA 4FI5A 4IE4A 5ADXL 3PUGA 4TWDA 2E2AA 3N2KE 5FMNA 5JR9B 5L47A 4AIUA 1T72A 2C0SA 4WBOA 3P7IA 1O3XA 4K0KT 3AE2A 3ZN0B 5ETWA 2ODUA 4F8HA 2LM9A 4LMKA 4O8SA 2H89A 2W67A 2XM2A 2LRLA 3CX6B 2Q9QB 3VRAA 3NVOA 4EAHA 5ABHA 3SS1A 4X1YE 2BS4A 3UQ4A 3HR0A 4LMJA 2VWAA 3F2EA 5HAXA 2M6BA 2NTXA 4UR9A 5FXWA 1VCSA 3A8YC 4UV8B 1HFAA 2B1EA 3C4ZA 5LYJE 5AQIB 3OYZA 2JMKA 3CVRA 3OVUA 2VASA 5CA0E 1ZHCA 3K8PC 4OK0A 4DV0T 4HN9A 4COFA 2ACXA 4QXBB 4IE0A 5L2LA 2Q9QA 2LKGA 4TNVA 5KDMC 3VU7H 2X9WA 1ZEEA 1W9RA 4ZS3A 3Q2MA 5DQWA 1YXRA 2JQKA 1WCRA 3KVAA 2EHOB 2YEVC 5AQGB 5LGTB 5AQNB 4DVDA 2JMHA 4YSZA 1SUMB 5FXZA 1HR0T 3VR9A 4I0UA 2J47A 4TV8E 4PNIA 3CWZB 3QB5K 3RI5A 1KNZA 2C5JA 3ZC0A 3UQ7A 3MACA 1HX8A 2K5BB 4JI0T 3ZT5A 3UUNA 4IE6A 4EXTA 2DI4A 4AQGA 1D0ZA 1IBLT 3UFGA 1IJ6A 2BS2A 2UXDT 4P09A 1YQ4A 4GIWA 4WBNE 2I59A 4KBMB 5LHGB 4JI2T 2E9XA 3F31A 4DV4T 4QH4A 3AXJA 4UXNB 2ZM6T 2C5KT 4OYKA 3NBXX 3P4QA 2XTLA 3HA4A 4PAGA 5KXJA 2J1DG 4AQFA 1HG2A 5JRCA 3CKDA 2X0YA 3BQLA 2DHRA
chains in the Genus database with same CATH topology
4YLHA 3RYFE 2W63A 3ETUA 2VL8A 4GK5E 3LBXA 5LOVE 2LSJA 5DJQC 3ZYKA 4P0AA 4ISTA 4MFRA 2N1GA 2CWYA 3O4XE 4Z8XA 5JDFA 5LNKA 4ZI3C 3GWHA 4U74A 2HPLA 1D1BA 3A5XA 3LJCA 5JVDE 2CWOA 2W61A 5JREA 3O9XA 5L3BB 3MK7C 4ZI2C 2WWUA 1YKEB 3UUMA 3C50A 2N2NA 4PJJA 4YHJA 5LP6E 3IHRA 1WR6A 3JC6C 4H9OC 2X9HA 4H9NC 3KINB 4E7ZA 4UF0B 2C5IT 3CX7B 5JQGE 4PJMA 2H3RA 2IC9A 1WRDA 5EZYE 3AVRA 2CM0A 2E9XB 4O2AE 3UT5E 1IAPA 3OYXA 2UXXB 2KT9A 2M67A 5HXRA 1E1HB 2VKDA 2K24A 2QGSA 3CX8B 3H37A 4IHJE 4PJLA 3B13A 3ESLA 4IE7A 4ZI3D 2KINB 2WMOA 4AI6A 4C90A 3GN5A 2V7LA 2XQYA 3CPZA 3I9WA 2W62A 3I9YA 3FB2A 1FMWA 4ILUA 4O4JE 2DNXA 3TKLB 4ZI2D 2CCQA 4PK5A 4M1PA 2OA5A 1YD8G 1D1AA 3JC6D 3LK42 4AKLA 1MMNA 5JDLA 2N9DA 4I50E 4A56A 4EIWA 2D2SA 4HKAA 5JRCB 2KMFA 2V26A 4O4HE 1S35A 4ZI7E 4MBQA 5DABA 1WYCA 2L8KA 1U5PA 3KVBA 3PE0A 4I55E 5H6RB 4H9RC 4CI1B 4H9SE 4NUVA 5JR9C 4CQIA 5LXTE 2HH7A 4UV9B 3KBUA 3KV4A 3LBXB 1ZV4X 3AAIA 3SWHA 2K9AA 5L3CB 3NZQA 3PUAA 3QUJA 2ZM2A 1HF8A 2XUEA 5FY0A 2YU1A 2D5UA 1AJ3A 3ZCJA 2IW5B 3ZEFB 5L3EB 5LHIB 2CLYC 4L0RA 1LVFA 4UVAB 2XASB 2XAFB 3N5LA 3Q5WA 4UVBB 4P0BA 1OXZA 3RYCE 4KMCA 4OFZA 4PFOA 5BMVE 1MNDA 4G63A 2CLYB 3K3NA 4GYSA 3E08A 4OYJA 1OWAA 2W0GA 2RA1A 3MZKB 3PUQA 3LK3B 3AAAB 5HWYA 2NW9A 2CXFA 3UTKA 3MXZA 4QKNA 3HL6A 3KV6A 4PJNA 3AA1B 3FBLA 4QXCB 1Z0PA 1V9DA 2XHEB 4QXHB 1MNEA 4EZ4A 3LK2B 4FJOA 5A1LA 2V7IA 3ZYLA 1D0XA 1FMVA 4HE8A 3I0OA 3PU3A 3T8OA 1BR4A 4H9QC 1H7CA 3RPUA 3N9QA 5L3GB 2ZMAA 2RP4A 3C4WA 3ETVA 4KP3C 3VKGA 4JLEA 5HWXA 3EDUA 3PURA 3P8CD 5FXXA 1UX5A 2BVLA 2V7KA 3ZCIA 5HXEA 4YJ2E 3RC3A 2A72A 3ZYMA 4QHOA 3ZMZB 2LSIA 2DLRA 4WW0A 1D1CA 3AVSA 1FEWA 4AKRB 5F8PA 3ANWB 3HKBE 4OHFA 4BJNA 2P9BA 2KWIB 3DTOA 5E0OA 3I1AA 4I43B 3E0ZA 4I4TE 5JDHA 4E7SA 5LBQB 2JQQA 2A3DA 1SHZC 1T98A 3GA8A 2H7OA 2PJQA 4JUYA 2PG8A 2LHRA 3D0TA 4N78D 1KK7A 5JR9A 5JDMA 3KDSE 1QUUA 3WAKA 2BVMA 2VKHA 5FXVA 2E8IA 4CZZB 4AKHA 2MTQA 4HTEA 1NAFA 2LSGA 4YJ3E 3ONXA 3RRWA 2JRKA 4X1KE 3EDVA 4NUUA 5EK4A 2X9XA 1IJ5A 4ISSA 4IIJE 4ERRA 4IDZA 2PFVA 1HCIA 4KUMB 5KX5E 3C64A 2NW7A 5HXSA 3KV9A 1VRBA 2X66A 3S4UA 4CI3B 4C91A 4DO0A 2VKOA 2DWKA 4O4LE 3FXEB 2EHOC 2Z6EA 3CMLA 3UUXB 3HKCE 2Y8DA 1LKXA 1WYBA 2X51A 4YFSA 2SPCA 3ZC1A 2NWBA 1UCUA 4ZS2A 3RYHE 1YW0A 2PBIA 3RH3A 2WM9A 4HGAA 1QSDA 1MIWA 5GONE 4CXWA 5J1GA 2MYSA 4WNKA 4DNDA 3LG7A 2UXNB 1IZNB 5LGUB 5IHYA 1HG5A 2WAUA 2LHNA 4FI5A 5LCYA 3O1JA 3W15B 4IE4A 5ADXL 3ZMSB 3UFEA 5M4YA 2D0TA 2LT3A 3PDYA 4L5GA 4ADZA 4AKIA 3ANWA 3PUGA 3BQKA 1LRZA 3N2KE 1D0YA 5KMGP 1HS7A 4K0UA 1EZ3A 1U4QA 2IC6A 4HFVA 5FMNA 2KXPB 4H9PC 3N2GE 4V1Av 5TAOA 5JR9B 4L9IA 3PU8A 4G2AA 4EZHA 3CQCB 2V7JA 4UVCB 3N9LA 2YK0A 2NTYA 4X1IE 5CA1E 4GOUA 2C0SA 4ANJA 3GMIA 2LSKA 1UX4A 3ZMVB 3RYIE 4PFPA 3CQXC 4WBOA 3P7IA 1O3XA 4DMVA 4TV9E 1BR1A 5HXCA 5LA6E 2Q9QC 3SOLA 5J2UE 3ZN0B 4UIGA 2ODUA 5ETWA 5LG4A 2D0UA 2LM9A 4XZCA 2KZ7B 3MA9A 4O8SA 4TX5A 3SRZA 3CX6B 2Q9QB 3N9MA 4EAHA 2BZBA 1G73A 3AB3B 5AFUL 3AAEB 3SS1A 4X1YE 3UULA 2DCFA 3FXDB 2CEAA 3C98B 3I0QA 4AKGA 3EVYA 2CMRA 3HR0A 2VWAA 3KV5A 3MKDA 1NWMX 3AA0B 3F2EA 3B57A 5HAXA 2NTXA 2Q9QD 5F3JA 2XAGB 2KNDA 2EHOA 4X20E 5FXWA 4U72A 4MLKA 3AA7B 4UV8B 3L09A 2CE7A 3FHNA 1HFAA 2B1EA 3O1HA 4B6XA 3C4ZA 1MMAA 3KBTA 3N9NA 3E22E 2XAHB 5HXHA 2XAJB 2Y6XA 4F6RC 1MIVA 1MMGA 2V1DB 3N2OA 5LYJE 2CA5A 3CQGB 4MHCA 1VOMA 2LSYA 4QWNB 3IF8B 4PK4A 2W00A 2WSSV 3OYZA 3OJAA 3U78A 3N9OA 2JMKA 3CVRA 3RKOA 1ZKEA 2QA7A 3ZN1B 5J2TE 2K48A 3V5UA 5L3FB 3F57A 2VASA 3R6NA 1S94A 5LJNA 5CA0E 4BJMA 5JDGA 1ZHCA 3K3QC 3K8PC 3IEEA 4CXYA 4OK0A 4CI2B 1MIYA 2LE8A 2X67A 2X9YA 3FBZA 4HN9A 2NP9A 4DBQA 3RRCA 3K3OA 3NZPA 3ZJ1A 5H6QB 2YU2A 4XAXB 2HPJA 3OBVE 3ZMUB 2ACXA 2DWGA 4QXBB 4IE5A 4IE0A 5C8YE 1BR2A 1MMDA 5EK3A 3NRYA 2H7VC 3M65A 3ZJ2A 4EYYR 5L2LA 3ZPOA 2Q9QA 4TZ4C 3Q5XA 2BDEA 2MOZA 5KDMC 2GK9A 5HYAA 1X79A 3VU7H 1WLXA 2X9WA 2E9XC 1ZEEA 3NRXA 4QX8B 3KFWX 3WAJA 4ZS3A 3Q2MA 2L3LA 3HI2A 2VB6A 2CXLA 3H3AA 4MALA 5FNVE 4BAYB 5DQWA 3O1IA 4UELA 2ZLYA 3MJXA 4H63H 3KVAA 3OKQA 2EHOB 2YEVC 1HTJF 2YINA 4QX7B 2LEHA 5LGTB 4DVDA 5IYZE 1CUNA 5JDQA 3ZLIA 2JMHA 3VKHA 4CXXA 3AA6B 3QK6A 4AQFC 5FXZA 2Y48B 4TV8E 5FY1A 3U3IA 1YKHB 1G8XA 5LJMA 4EYUA 4O2BE 4PNIA 2EHOD 2E9XD 3WI3A 5EK2A 3CWZB 4GYRA 5CB4E 2ZM8A 1KNZA 2XAQB 4EOZB 2C5JA 2ZM0A 4HEAA 3ZC0A 2KWHA 3MACA 1HX8A 2K5BB 2LOPA 2X68A 4JEHB 4ZOLE 4JEUB 4PW8A 4TN7B 3PUSA 1US7B 3HKEE 3ZMTB 3C4XA 3UUNA 2LJLA 4IE6A 2A2FX 4EXTA 5LHHB 2DI4A 3IBPA 1D0ZA 4J2CA 2ES0A 3PTRB 2MBGA 4AQGA 2V7MA 3VHLA 2VKJA 5DQVA 2IAKA 4DBRA 1IJ6A 5FYMA 2WMNA 4P09A 4UF0A 3L3PA 3BQIA 2KLQA 3C51A 2WBLA 3DP7A 4GIWA 2VK9A 2LOSA 4DMWA 4WBNE 2I59A 4KBMB 3DJBA 2ODVA 5LHGB 3RC8A 2E9XA 4AXPA 3F31A 3QC9A 5FY7A 4XBFB 1B7TA 1LVKA 3GN5B 4GK0E 5LBMA 5L3DB 3V5SA 4UXNB 5FP3A 4ZHQE 4PK6A 2C5KT 4OYKA 2CXDA 2NOXA 4O4IE 5JDNA 2G0UA 3BK9A 3J9X1 3NBXX 2XTLA 4H63V 5JH7E 3HA4A 4TUYE 2JJ9A 4UEMA 1BR0A 2L9QA 3N9PA 2JPFA 3R84B 2X0LB 4PAGA 1FIOA 5JRCA 2J1DG 2NW8A 1HG2A 4IGUA 4AQFA 4BA9A 4ASKA 4EB6E 3HKDE 3CKDA 3J7Yq 3Q9DA 1SA0E 3EUHA 5LGNB 1Y64B 3RX6A 3BQLA 2DHRA 3LFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBG A;  2IC9 A;  4L0R A;  1LVF A;  4B6X A;  2KWI B;  1QSD A;  2X9Y A;  3N5L A;  2C5J A;  2X9X A;  3FXD B;  1IJ5 A;  4DND A;  2C5K T;  2G0U A;  2KWH A;  1IJ6 A;  2XTL A;  3P7I A;  1H7C A;  4FI5 A;  3S4U A;  4CQI A;  2CA5 A;  3L3P A;  4EYY R;  3QK6 A;  3QUJ A;  3FXE B;  3CVR A;  1ZKE A;  1LRZ A;  2K48 A;  3MXZ A;  2X9W A;  3TKL B;  3CKD A;  2IC6 A;  2C5I T;  1Z0P A;  4J2C A; 
#chains in the Genus database with same CATH topology
 4YLH A;  3ETU A;  2VL8 A;  4GK5 E;  4DR2 T;  4IST A;  5JDF A;  3EAB A;  4U74 A;  2MAW A;  1XZY A;  2B76 A;  1YKE B;  5LP6 E;  3JC6 C;  4H9O C;  2X9H A;  3KIN B;  4PJM A;  1WRD A;  5EZY E;  3AVR A;  4CN1 A;  2UXX B;  5IWA T;  1T7S A;  1E1H B;  2K24 A;  3H37 A;  3RKG A;  3X1D A;  3I9Y A;  3RQW A;  1FMW A;  2DNX A;  5CJ5 A;  2CCQ A;  2OA5 A;  4AKL A;  2N9D A;  4DV7 T;  4HFI A;  4I50 E;  2D2S A;  3CK6 A;  4DR4 T;  1S35 A;  2L8K A;  5H6R B;  4HFH A;  4I55 E;  4H9S E;  4TNW A;  4CQI A;  2J62 A;  3SWH A;  3PUA A;  1L0V A;  3UU6 A;  3AE6 A;  3FZF B;  4IDQ A;  4WYV A;  3ZEF B;  5L3E B;  4L0R A;  4UVA B;  2XAF B;  3L8R A;  4UVB B;  3RYC E;  4ZZC A;  4PFO A;  2HHH T;  2XSA A;  2W0G A;  1KNR A;  3MZK B;  3PUQ A;  4NXN T;  3AAA B;  3EAM A;  3MXZ A;  3KV6 A;  4PJN A;  2WS3 A;  4YXD A;  3NKZ A;  4QXC B;  2UUB T;  4FJO A;  2V7I A;  3I0O A;  4H9Q C;  1H7C A;  2XQ4 A;  4IL4 A;  4HWC A;  2VVS A;  3C4W A;  2V6Y A;  4JLE A;  5HWX A;  2OV9 A;  2BVL A;  5AQU B;  3ZYM A;  1FEW A;  2KWI B;  5E0O A;  3I1A A;  5JDH A;  2YDS A;  4OX9 T;  3TLV A;  2J4G A;  3QB5 A;  3AEB A;  1KK7 A;  4LML A;  3KDS E;  1QUU A;  5FXV A;  4AKH A;  4U31 A;  3RRW A;  2R6G F;  3RF1 A;  4DR3 T;  4ERR A;  2YN6 A;  2Z6E A;  4HWF A;  3HKC E;  2X51 A;  2NWB A;  1UCU A;  3PUW F;  1YW0 A;  4HGA A;  5LGU B;  4QH5 A;  5IHY A;  5AQT B;  2CHN A;  2IDO B;  3ZMS B;  3UFE A;  2LT3 A;  3PDY A;  4YTM A;  4ADZ A;  2BBJ A;  3BQK A;  1XNR T;  5KMG P;  4K0U A;  4Z91 A;  2IC6 A;  4HFV A;  3N2G E;  2XQA A;  4GKJ T;  4JI5 T;  4YHH T;  4JI8 T;  4IT4 A;  4JI6 T;  4ANJ A;  1FJG T;  2H88 A;  1UX4 A;  4PFP A;  3CQX C;  2FJB A;  4TV9 E;  5LA6 E;  2UU9 T;  2Q9Q C;  3SOL A;  4UIG A;  5LG4 A;  4HWI B;  4XZC A;  2KZ7 B;  3MA9 A;  5CGM A;  4TX5 A;  5AQM B;  2BZB A;  3AB3 B;  5AFU L;  2DCF A;  4KI0 F;  4AQY T;  3C98 B;  2WQY A;  4X62 T;  4DV1 T;  5F3J A;  3AE9 A;  3A7M A;  4MLK A;  2VQE T;  2IUB A;  4IL9 A;  4HWH A;  2XAJ B;  4F6R C;  2V1D B;  1HNX T;  2LRK A;  4QWN B;  5AQJ B;  2AXD S;  2WSS V;  4A97 A;  4U33 A;  1ZKE A;  2QA7 A;  5J2T E;  2K48 A;  3V5U A;  5L3F B;  3F57 A;  3R6N A;  1S94 A;  5LJN A;  3TLW A;  2WCA A;  3IEE A;  4CI2 B;  1MIY A;  1UUS A;  2NP9 A;  3RRC A;  1IBM T;  5H6Q B;  4XAX B;  2HPJ A;  5CFB A;  1MMD A;  3M65 A;  4EYY R;  4TZ4 C;  1QLB A;  2MOZ A;  2E9X C;  3KFW X;  2BG9 A;  2CXL A;  2VB6 A;  4BAY B;  2QVA A;  3O1I A;  4UEL A;  1HTJ F;  4QX7 B;  1WR0 A;  2LEH A;  3P4R A;  5JDQ A;  4AQF C;  1T8B A;  3U3I A;  5FY1 A;  4HFE A;  1G8X A;  3WI3 A;  1J1J A;  4GYR A;  4DV3 T;  2ZM8 A;  2BBH A;  4DV2 T;  3OTO T;  2LOP A;  2X68 A;  4JEU B;  4TN7 B;  3PUS A;  1US7 B;  3HKE E;  4LFA T;  3C4X A;  2QRX A;  2LJL A;  2A2F X;  3IBP A;  2CBJ A;  2FBW A;  2YDQ A;  5LG3 A;  1N36 T;  2W4X A;  2WMN A;  2WB5 A;  3RLF F;  3BQI A;  5FKY A;  3C51 A;  3L39 A;  3DP7 A;  2E5V A;  2VK9 A;  3DJB A;  4TWF A;  3QC9 A;  1B7T A;  2BKP A;  2NOX A;  4O4I E;  5JDN A;  3BK9 A;  3J9X 1;  3TLS A;  2F4V T;  2A9U A;  2L9Q A;  2JPF A;  4LF6 T;  4EB6 E;  3HKD E;  4DR5 T;  3J7Y q;  1Y64 B;  3RX6 A;  5AQR B;  2W63 A;  3LBX A;  5DJQ C;  4P0A A;  2N1G A;  3PUZ F;  5C2T A;  3LJC A;  2W66 A;  4CN6 A;  2W61 A;  4EED A;  5L3B B;  2FJA A;  2WWU A;  3C50 A;  4ZXL A;  4PJJ A;  4YHJ A;  1WR6 A;  3AE7 A;  4E7Z A;  2C5I T;  3CX7 B;  4IDN A;  2H3R A;  2IC9 A;  2V8S V;  1UK5 A;  4U3C A;  2E9X B;  2HN1 A;  3UT5 E;  1UGO A;  2KT9 A;  3QOF A;  2M67 A;  3AXJ B;  4LF8 T;  3B13 A;  3ESL A;  4IE7 A;  4ILB A;  4ZI3 D;  4C90 A;  2V7L A;  3EI0 A;  3CPZ A;  4IDO A;  3FB2 A;  4ILU A;  4ZI2 D;  1UUR A;  1YD8 G;  3LK4 2;  2OLT A;  2WWV A;  5LB7 B;  5JRC B;  1VCT A;  4ZI7 E;  2VL0 A;  1JNR A;  3PE0 A;  4CI1 B;  2XQ3 A;  3SFD A;  5LXT E;  3UU8 A;  3KBU A;  2WDQ A;  3G06 A;  1ZV4 X;  3KV4 A;  4HFB A;  4EGW A;  5HEJ A;  2VQF T;  1R8I A;  4JBW F;  5LHI B;  4EV6 A;  5AQS B;  2XAS B;  2CBI A;  3Q5W A;  4P0B A;  1OXZ A;  1W0A A;  4OFZ A;  2IML A;  5BMV E;  3K3N A;  2XM1 A;  4QH1 A;  3LDQ B;  4QKN A;  3FBL A;  4B3M T;  1D0X A;  3PU3 A;  5L4E A;  4JI4 T;  1BR4 A;  5L3G B;  3ETV A;  3PUV F;  1UX5 A;  3RIF A;  3ZMZ B;  3ANW B;  4DV6 T;  4BJN A;  2HN2 A;  3DTO A;  4I4T E;  4E7S A;  2JQQ A;  2PG8 A;  2LHR A;  1XWM A;  1NEK A;  3AE1 A;  2BVM A;  3CIR A;  4YTP A;  3FZK B;  2WZI A;  4HTE A;  4YJ3 E;  4KX6 A;  1KFY A;  2YDR A;  4IDZ A;  1HCI A;  4KUM B;  5KX5 E;  4X64 T;  3C64 A;  3KV9 A;  2X66 A;  3S4U A;  2IIU A;  4O4L E;  3UUX B;  1WYB A;  4YFS A;  3ZC1 A;  2V6Y B;  2PBI A;  3RH3 A;  4DID B;  2MYS A;  2JQH A;  4YT0 A;  5ABF B;  2NR4 A;  4IDP A;  1HG5 A;  3H3M A;  2VUR A;  3O1J A;  2D0T A;  4L5G A;  3ANW A;  1LRZ A;  1U4Q A;  5TAO A;  4H9P C;  4V1A v;  3PU8 A;  3ZT6 A;  3CQC B;  5HEH A;  5LMU T;  1Y01 A;  4X1I E;  5LMN T;  1E2A A;  3GMI A;  2LSK A;  3ZMV B;  4LF4 T;  3UUB A;  3AE4 A;  4DUY T;  2WDV A;  2LM2 A;  1I6Z A;  2BG9 C;  2CHO A;  3AAE B;  3UUL A;  3FXD B;  3I0Q A;  2BG9 E;  4AKG A;  1NWM X;  3AA0 B;  3B57 A;  2XAG B;  2KND A;  5ABF A;  3L09 A;  3JCF A;  3O1H A;  4ILA A;  1MMA A;  3IA3 A;  3KBT A;  3N9N A;  1WFD A;  2XAH B;  1MIV A;  1MMG A;  3N2O A;  2CA5 A;  3CQG B;  4MHC A;  2XPK A;  4PK4 A;  3U78 A;  3N9O A;  3T1H T;  4BJM A;  5JDG A;  2XY8 B;  3RQU A;  5FL1 A;  2X9Y A;  4HWD A;  4JI7 T;  3K3O A;  4YSX A;  2DWG A;  4IE5 A;  5C8Y E;  5EK3 A;  2BKO A;  3NRY A;  2H7V C;  5L4H A;  2BDE A;  2GK9 A;  5HYA A;  4B3R T;  1HX1 B;  3LSV A;  3NRX A;  2L3L A;  3H3A A;  1N34 T;  3RIU C;  3MJX A;  4H63 H;  3OKQ A;  3P4W A;  3AE3 A;  1KEY A;  1ZOY A;  5IYZ E;  3UU3 A;  1CUN A;  3ZLI A;  4CXX A;  1NEN A;  3AA6 B;  3QNU A;  3QK6 A;  1KNP A;  4TWH A;  4U7Y A;  1YKH B;  5LJM A;  4O2B E;  5EK2 A;  4U2Z A;  3UU5 A;  2XAQ B;  4EOZ B;  5HCM A;  4HEA A;  3JAF A;  4ZOL E;  2XJ7 A;  3ZMT B;  4X5T A;  4J2C A;  2MBG A;  2WZH A;  2ES0 A;  2V7M A;  2JIW A;  3VHL A;  2VKJ A;  5DQV A;  2IAK A;  4DBR A;  2VVN A;  5FYM A;  2BG9 B;  3ONJ A;  4UF0 A;  1OED A;  2WBL A;  2LOS A;  3RC8 A;  3FZH B;  4AXP A;  4XBF B;  5FY7 A;  3GN5 B;  3ZKR A;  4ZHQ E;  2G0U A;  2WDR A;  4H63 V;  4TUY E;  2JJ9 A;  4UEM A;  3AEF A;  2X0L B;  1FIO A;  2NW8 A;  4IGU A;  2XQ9 A;  2WY2 A;  5LGN B;  1J5E T;  3PJA A;  3T1Y T;  5LOV E;  3ONL C;  1N32 T;  4JI1 T;  4Z8X A;  4LF5 T;  5LNK A;  3GWH A;  2HPL A;  1D1B A;  4YTN A;  2CWO A;  5JRE A;  3O9X A;  3MK7 C;  2YKS A;  3UUM A;  3IHR A;  2RPA A;  3AE8 A;  4A5X A;  4H9N C;  2V5D A;  4JI3 T;  4JYA T;  4IRE A;  4DR7 T;  3AEE A;  3OYX A;  5HXR A;  5J0Z A;  3CX8 B;  2WU5 A;  2UXB T;  2KIN B;  3Q5D A;  3GN5 A;  1JNZ A;  4O4J E;  3TKL B;  4PK5 A;  1ZP0 A;  1D1A A;  3JC6 D;  1MMN A;  5JDL A;  2MPK A;  4A56 A;  4O4H E;  4MBQ A;  1WYC A;  5AQK B;  4NUV A;  1HNW T;  2HH7 A;  3LBX B;  5L3C B;  4ILC A;  2ZM2 A;  1HF8 A;  2XUE A;  3VRB A;  2D5U A;  1AJ3 A;  3ZCJ A;  3Q5E A;  2IW5 B;  3P4P A;  4B3S T;  3N5L A;  2XQ7 A;  1GQE A;  1MND A;  4G63 A;  1I94 T;  2CLY B;  4GYS A;  4OYJ A;  2RA1 A;  2M6I A;  1Z8U A;  2FJD A;  2CXF A;  3PUY F;  4P1N A;  2IHR 1;  1Z0P A;  1V9D A;  2XHE B;  4QXH B;  1MNE A;  4WZX A;  4EZ4 A;  3LK2 B;  3RIU A;  3ZYL A;  1FMV A;  4HE8 A;  2KSR A;  3RPU A;  3N9Q A;  2RP4 A;  3EDU A;  3ZCI A;  5F5W A;  5FXX A;  2V7K A;  4KHZ F;  4YJ2 E;  2LSI A;  2XQ8 A;  2I0M A;  2DLR A;  4U2Y A;  4WW0 A;  1HNZ T;  3AVS A;  4AKR B;  4OHF A;  3M3Z B;  2P9B A;  3PJA J;  4I43 B;  2QYW A;  3AED A;  1SHZ C;  1T98 A;  3GA8 A;  2H7O A;  2BKN A;  4JUY A;  3D0T A;  2JQ9 A;  5JR9 A;  5BR8 T;  3K1S A;  5JDM A;  5AQL B;  3WAK A;  2UXC T;  4CZZ B;  2MTQ A;  2CRB A;  1NAF A;  2LSG A;  3ONX A;  2JRK A;  4X1K E;  3EDV A;  1M62 A;  4IIJ E;  2PFV A;  4LFC T;  3NWI A;  2NW7 A;  1VRB A;  4DO0 A;  2DWK A;  4LF9 T;  3CML A;  2UUA T;  4JV5 T;  2Y8D A;  4ZS2 A;  3RYH E;  3UU4 A;  2WM9 A;  3PV0 F;  1MIW A;  5GON E;  4WNK A;  4DND A;  4U7I A;  2UXN B;  2WAU A;  2LHN A;  5LCY A;  5C3J A;  3W15 B;  5M4Y A;  4HFD A;  4AKI A;  1D0Y A;  1HS7 A;  1EZ3 A;  2KXP B;  4EZH A;  4L9I A;  4G2A A;  3JAD A;  2ACZ A;  5JTG A;  2V7J A;  4UVC B;  3N9L A;  1KF6 A;  2NTY A;  2YK0 A;  5CA1 E;  1W0B A;  4GOU A;  2BS3 A;  4Z90 A;  3RYI E;  4DMV A;  1BR1 A;  5HXC A;  5J2U E;  2D0U A;  5FVL A;  4NIQ A;  4CN4 A;  3SRZ A;  3N9M A;  1G73 A;  2CEA A;  3EVY A;  3ZT7 A;  2CMR A;  3SFE A;  3KV5 A;  3MKD A;  4LF7 T;  2Q9Q D;  2XSB A;  2EHO A;  4X20 E;  4U72 A;  3AA7 B;  4DV5 T;  2CE7 A;  4DR6 T;  3FHN A;  4B6X A;  3E22 E;  5HXH A;  2Y6X A;  2K3W A;  1VOM A;  2LSY A;  3IF8 B;  2W00 A;  4ZZB A;  3OJA A;  4X65 T;  3RKO A;  3ZN1 B;  2YOE A;  3VR8 A;  3K3Q C;  4CXY A;  1XDO A;  2LE8 A;  2X67 A;  3FBZ A;  4DBQ A;  3NZP A;  3ZJ1 A;  2YU2 A;  3ZST A;  4DR1 T;  3OBV E;  3ZMU B;  1OED C;  1BR2 A;  5AQF B;  3ZJ2 A;  3ZPO A;  3Q5X A;  2LLY A;  2V6X A;  1X79 A;  1WLX A;  1OED E;  4QX8 B;  3WAJ A;  3HI2 A;  4MAL A;  5FNV E;  2ZLY A;  3FZL B;  4EEB A;  2I6H A;  2YIN A;  1YQ3 A;  3VKH A;  1CHU A;  2UUC T;  1W09 A;  5ABE A;  2Y48 B;  4EYU A;  2EHO D;  2E9X D;  5CB4 E;  4NXM T;  4GKK T;  2ZM0 A;  2KWH A;  5HEU A;  2X0H A;  2D9D A;  4JEH B;  5AQV B;  4PW8 A;  3P50 A;  4KHP T;  4AIS A;  5LHH B;  4HFC A;  3AEC A;  3PTR B;  4NPP A;  2FUP A;  5AQO B;  3L3P A;  2KLQ A;  2V5C A;  2W2U A;  4DMW A;  3AEA A;  2WP9 A;  2ODV A;  5ABG A;  1XDP A;  3TLT A;  1LVK A;  4GK0 E;  5L3D B;  5LBM A;  3V5S A;  5FP3 A;  5FVK A;  4PK6 A;  2CXD A;  4B3T T;  5JH7 E;  3FZM B;  1BR0 A;  3N9P A;  3R84 B;  4BA9 A;  4ASK A;  3RHW A;  3Q9D A;  1SA0 E;  3EUH A;  4ZEY A;  4YY3 T;  3LFM A;  3RYF E;  5FL0 A;  4YSY A;  2LSJ A;  3AE5 A;  3PUX F;  3ZYK A;  4MFR A;  2CWY A;  3O4X E;  1XNQ T;  1E7P A;  4ZI3 C;  3A5X A;  5JVD E;  5HCJ A;  4ZI2 C;  3ABV A;  2N2N A;  3P4S A;  2PTF A;  2DL1 A;  4UF0 B;  1OED B;  4A98 A;  5JQG E;  4Q25 A;  2CM0 A;  1J5W A;  4O2A E;  5AQH B;  1IAP A;  2VKD A;  4IHJ E;  2QGS A;  4PJL A;  4AI6 A;  2WMO A;  2FJE A;  2XQY A;  3I9W A;  2W62 A;  1SE7 A;  3TLU A;  1X9B A;  4M1P A;  4EIW A;  4HKA A;  3RIA A;  2KMF A;  2V26 A;  5DAB A;  1U5P A;  3KVB A;  2XQ6 A;  4H9R C;  5JR9 C;  4UV9 B;  3AAI A;  2K9A A;  3NZQ A;  3QUJ A;  3JAE A;  5FY0 A;  2YU1 A;  3AEG A;  2CLY C;  1LVF A;  4KMC A;  3ZSS A;  3E08 A;  1OWA A;  5HEO A;  3LK3 B;  5HWY A;  2NW9 A;  3UTK A;  1XMO T;  3HL6 A;  2WU2 A;  3AA1 B;  2LKH A;  3EHZ A;  2XQ5 A;  5A1L A;  1XMQ T;  3T8O A;  2ZMA A;  4KP3 C;  3VKG A;  3PUR A;  3P8C D;  5HXE A;  3RC3 A;  2A72 A;  4QHO A;  1D1C A;  5F8P A;  3HKB E;  2AE9 A;  3E0Z A;  5LBQ B;  2A3D A;  5IUX A;  2PJQ A;  1DU2 A;  4N78 D;  3B5M A;  2VKH A;  5AQQ B;  1N33 T;  2E8I A;  1IBK T;  4NUU A;  5EK4 A;  2X9X A;  1IJ5 A;  2CPT A;  4ISS A;  2XZE A;  4LFB T;  5HXS A;  4CI3 B;  3RGL A;  4C91 A;  3OPC A;  2VKO A;  3FXE B;  1M7K A;  4DUZ T;  2EHO C;  2E5L T;  1LKX A;  2SPC A;  4X66 T;  1QSD A;  4CXW A;  5J1G A;  5AQP B;  3LG7 A;  1IZN B;  5HEG A;  4FI5 A;  4IE4 A;  5ADX L;  3PUG A;  4TWD A;  2E2A A;  3N2K E;  5FMN A;  5JR9 B;  5L47 A;  4AIU A;  1T72 A;  2C0S A;  4WBO A;  3P7I A;  1O3X A;  4K0K T;  3AE2 A;  3ZN0 B;  5ETW A;  2ODU A;  4F8H A;  2LM9 A;  4LMK A;  4O8S A;  2H89 A;  2W67 A;  2XM2 A;  2LRL A;  3CX6 B;  2Q9Q B;  3VRA A;  3NVO A;  4EAH A;  5ABH A;  3SS1 A;  4X1Y E;  2BS4 A;  3UQ4 A;  3HR0 A;  4LMJ A;  2VWA A;  3F2E A;  5HAX A;  2M6B A;  2NTX A;  4UR9 A;  5FXW A;  1VCS A;  3A8Y C;  4UV8 B;  1HFA A;  2B1E A;  3C4Z A;  5LYJ E;  5AQI B;  3OYZ A;  2JMK A;  3CVR A;  3OVU A;  2VAS A;  5CA0 E;  1ZHC A;  3K8P C;  4OK0 A;  4DV0 T;  4HN9 A;  4COF A;  2ACX A;  4QXB B;  4IE0 A;  5L2L A;  2Q9Q A;  2LKG A;  4TNV A;  5KDM C;  3VU7 H;  2X9W A;  1ZEE A;  1W9R A;  4ZS3 A;  3Q2M A;  5DQW A;  1YXR A;  2JQK A;  1WCR A;  3KVA A;  2EHO B;  2YEV C;  5AQG B;  5LGT B;  5AQN B;  4DVD A;  2JMH A;  4YSZ A;  1SUM B;  5FXZ A;  1HR0 T;  3VR9 A;  4I0U A;  2J47 A;  4TV8 E;  4PNI A;  3CWZ B;  3QB5 K;  3RI5 A;  1KNZ A;  2C5J A;  3ZC0 A;  3UQ7 A;  3MAC A;  1HX8 A;  2K5B B;  4JI0 T;  3ZT5 A;  3UUN A;  4IE6 A;  4EXT A;  2DI4 A;  4AQG A;  1D0Z A;  1IBL T;  3UFG A;  1IJ6 A;  2BS2 A;  2UXD T;  4P09 A;  1YQ4 A;  4GIW A;  4WBN E;  2I59 A;  4KBM B;  5LHG B;  4JI2 T;  2E9X A;  3F31 A;  4DV4 T;  4QH4 A;  3AXJ A;  4UXN B;  2ZM6 T;  2C5K T;  4OYK A;  3NBX X;  3P4Q A;  2XTL A;  3HA4 A;  4PAG A;  5KXJ A;  2J1D G;  4AQF A;  1HG2 A;  5JRC A;  3CKD A;  2X0Y A;  3BQL A;  2DHR A; 
#chains in the Genus database with same CATH homology
 4YLH A;  3RYF E;  2W63 A;  3ETU A;  2VL8 A;  4GK5 E;  3LBX A;  5LOV E;  2LSJ A;  5DJQ C;  3ZYK A;  4P0A A;  4IST A;  4MFR A;  2N1G A;  2CWY A;  3O4X E;  4Z8X A;  5JDF A;  5LNK A;  4ZI3 C;  3GWH A;  4U74 A;  2HPL A;  1D1B A;  3A5X A;  3LJC A;  5JVD E;  2CWO A;  2W61 A;  5JRE A;  3O9X A;  5L3B B;  3MK7 C;  4ZI2 C;  2WWU A;  1YKE B;  3UUM A;  3C50 A;  2N2N A;  4PJJ A;  4YHJ A;  5LP6 E;  3IHR A;  1WR6 A;  3JC6 C;  4H9O C;  2X9H A;  4H9N C;  3KIN B;  4E7Z A;  4UF0 B;  2C5I T;  3CX7 B;  5JQG E;  4PJM A;  2H3R A;  2IC9 A;  1WRD A;  5EZY E;  3AVR A;  2CM0 A;  2E9X B;  4O2A E;  3UT5 E;  1IAP A;  3OYX A;  2UXX B;  2KT9 A;  2M67 A;  5HXR A;  1E1H B;  2VKD A;  2K24 A;  2QGS A;  3CX8 B;  3H37 A;  4IHJ E;  4PJL A;  3B13 A;  3ESL A;  4IE7 A;  4ZI3 D;  2KIN B;  2WMO A;  4AI6 A;  4C90 A;  3GN5 A;  2V7L A;  2XQY A;  3CPZ A;  3I9W A;  2W62 A;  3I9Y A;  3FB2 A;  1FMW A;  4ILU A;  4O4J E;  2DNX A;  3TKL B;  4ZI2 D;  2CCQ A;  4PK5 A;  4M1P A;  2OA5 A;  1YD8 G;  1D1A A;  3JC6 D;  3LK4 2;  4AKL A;  1MMN A;  5JDL A;  2N9D A;  4I50 E;  4A56 A;  4EIW A;  2D2S A;  4HKA A;  5JRC B;  2KMF A;  2V26 A;  4O4H E;  1S35 A;  4ZI7 E;  4MBQ A;  5DAB A;  1WYC A;  2L8K A;  1U5P A;  3KVB A;  3PE0 A;  4I55 E;  5H6R B;  4H9R C;  4CI1 B;  4H9S E;  4NUV A;  5JR9 C;  4CQI A;  5LXT E;  2HH7 A;  4UV9 B;  3KBU A;  3KV4 A;  3LBX B;  1ZV4 X;  3AAI A;  3SWH A;  2K9A A;  5L3C B;  3NZQ A;  3PUA A;  3QUJ A;  2ZM2 A;  1HF8 A;  2XUE A;  5FY0 A;  2YU1 A;  2D5U A;  1AJ3 A;  3ZCJ A;  2IW5 B;  3ZEF B;  5L3E B;  5LHI B;  2CLY C;  4L0R A;  1LVF A;  4UVA B;  2XAS B;  2XAF B;  3N5L A;  3Q5W A;  4UVB B;  4P0B A;  1OXZ A;  3RYC E;  4KMC A;  4OFZ A;  4PFO A;  5BMV E;  1MND A;  4G63 A;  2CLY B;  3K3N A;  4GYS A;  3E08 A;  4OYJ A;  1OWA A;  2W0G A;  2RA1 A;  3MZK B;  3PUQ A;  3LK3 B;  3AAA B;  5HWY A;  2NW9 A;  2CXF A;  3UTK A;  3MXZ A;  4QKN A;  3HL6 A;  3KV6 A;  4PJN A;  3AA1 B;  3FBL A;  4QXC B;  1Z0P A;  1V9D A;  2XHE B;  4QXH B;  1MNE A;  4EZ4 A;  3LK2 B;  4FJO A;  5A1L A;  2V7I A;  3ZYL A;  1D0X A;  1FMV A;  4HE8 A;  3I0O A;  3PU3 A;  3T8O A;  1BR4 A;  4H9Q C;  1H7C A;  3RPU A;  3N9Q A;  5L3G B;  2ZMA A;  2RP4 A;  3C4W A;  3ETV A;  4KP3 C;  3VKG A;  4JLE A;  5HWX A;  3EDU A;  3PUR A;  3P8C D;  5FXX A;  1UX5 A;  2BVL A;  2V7K A;  3ZCI A;  5HXE A;  4YJ2 E;  3RC3 A;  2A72 A;  3ZYM A;  4QHO A;  3ZMZ B;  2LSI A;  2DLR A;  4WW0 A;  1D1C A;  3AVS A;  1FEW A;  4AKR B;  5F8P A;  3ANW B;  3HKB E;  4OHF A;  4BJN A;  2P9B A;  2KWI B;  3DTO A;  5E0O A;  3I1A A;  4I43 B;  3E0Z A;  4I4T E;  5JDH A;  4E7S A;  5LBQ B;  2JQQ A;  2A3D A;  1SHZ C;  1T98 A;  3GA8 A;  2H7O A;  2PJQ A;  4JUY A;  2PG8 A;  2LHR A;  3D0T A;  4N78 D;  1KK7 A;  5JR9 A;  5JDM A;  3KDS E;  1QUU A;  3WAK A;  2BVM A;  2VKH A;  5FXV A;  2E8I A;  4CZZ B;  4AKH A;  2MTQ A;  4HTE A;  1NAF A;  2LSG A;  4YJ3 E;  3ONX A;  3RRW A;  2JRK A;  4X1K E;  3EDV A;  4NUU A;  5EK4 A;  2X9X A;  1IJ5 A;  4ISS A;  4IIJ E;  4ERR A;  4IDZ A;  2PFV A;  1HCI A;  4KUM B;  5KX5 E;  3C64 A;  2NW7 A;  5HXS A;  3KV9 A;  1VRB A;  2X66 A;  3S4U A;  4CI3 B;  4C91 A;  4DO0 A;  2VKO A;  2DWK A;  4O4L E;  3FXE B;  2EHO C;  2Z6E A;  3CML A;  3UUX B;  3HKC E;  2Y8D A;  1LKX A;  1WYB A;  2X51 A;  4YFS A;  2SPC A;  3ZC1 A;  2NWB A;  1UCU A;  4ZS2 A;  3RYH E;  1YW0 A;  2PBI A;  3RH3 A;  2WM9 A;  4HGA A;  1QSD A;  1MIW A;  5GON E;  4CXW A;  5J1G A;  2MYS A;  4WNK A;  4DND A;  3LG7 A;  2UXN B;  1IZN B;  5LGU B;  5IHY A;  1HG5 A;  2WAU A;  2LHN A;  4FI5 A;  5LCY A;  3O1J A;  3W15 B;  4IE4 A;  5ADX L;  3ZMS B;  3UFE A;  5M4Y A;  2D0T A;  2LT3 A;  3PDY A;  4L5G A;  4ADZ A;  4AKI A;  3ANW A;  3PUG A;  3BQK A;  1LRZ A;  3N2K E;  1D0Y A;  5KMG P;  1HS7 A;  4K0U A;  1EZ3 A;  1U4Q A;  2IC6 A;  4HFV A;  5FMN A;  2KXP B;  4H9P C;  3N2G E;  4V1A v;  5TAO A;  5JR9 B;  4L9I A;  3PU8 A;  4G2A A;  4EZH A;  3CQC B;  2V7J A;  4UVC B;  3N9L A;  2YK0 A;  2NTY A;  4X1I E;  5CA1 E;  4GOU A;  2C0S A;  4ANJ A;  3GMI A;  2LSK A;  1UX4 A;  3ZMV B;  3RYI E;  4PFP A;  3CQX C;  4WBO A;  3P7I A;  1O3X A;  4DMV A;  4TV9 E;  1BR1 A;  5HXC A;  5LA6 E;  2Q9Q C;  3SOL A;  5J2U E;  3ZN0 B;  4UIG A;  2ODU A;  5ETW A;  5LG4 A;  2D0U A;  2LM9 A;  4XZC A;  2KZ7 B;  3MA9 A;  4O8S A;  4TX5 A;  3SRZ A;  3CX6 B;  2Q9Q B;  3N9M A;  4EAH A;  2BZB A;  1G73 A;  3AB3 B;  5AFU L;  3AAE B;  3SS1 A;  4X1Y E;  3UUL A;  2DCF A;  3FXD B;  2CEA A;  3C98 B;  3I0Q A;  4AKG A;  3EVY A;  2CMR A;  3HR0 A;  2VWA A;  3KV5 A;  3MKD A;  1NWM X;  3AA0 B;  3F2E A;  3B57 A;  5HAX A;  2NTX A;  2Q9Q D;  5F3J A;  2XAG B;  2KND A;  2EHO A;  4X20 E;  5FXW A;  4U72 A;  4MLK A;  3AA7 B;  4UV8 B;  3L09 A;  2CE7 A;  3FHN A;  1HFA A;  2B1E A;  3O1H A;  4B6X A;  3C4Z A;  1MMA A;  3KBT A;  3N9N A;  3E22 E;  2XAH B;  5HXH A;  2XAJ B;  2Y6X A;  4F6R C;  1MIV A;  1MMG A;  2V1D B;  3N2O A;  5LYJ E;  2CA5 A;  3CQG B;  4MHC A;  1VOM A;  2LSY A;  4QWN B;  3IF8 B;  4PK4 A;  2W00 A;  2WSS V;  3OYZ A;  3OJA A;  3U78 A;  3N9O A;  2JMK A;  3CVR A;  3RKO A;  1ZKE A;  2QA7 A;  3ZN1 B;  5J2T E;  2K48 A;  3V5U A;  5L3F B;  3F57 A;  2VAS A;  3R6N A;  1S94 A;  5LJN A;  5CA0 E;  4BJM A;  5JDG A;  1ZHC A;  3K3Q C;  3K8P C;  3IEE A;  4CXY A;  4OK0 A;  4CI2 B;  1MIY A;  2LE8 A;  2X67 A;  2X9Y A;  3FBZ A;  4HN9 A;  2NP9 A;  4DBQ A;  3RRC A;  3K3O A;  3NZP A;  3ZJ1 A;  5H6Q B;  2YU2 A;  4XAX B;  2HPJ A;  3OBV E;  3ZMU B;  2ACX A;  2DWG A;  4QXB B;  4IE5 A;  4IE0 A;  5C8Y E;  1BR2 A;  1MMD A;  5EK3 A;  3NRY A;  2H7V C;  3M65 A;  3ZJ2 A;  4EYY R;  5L2L A;  3ZPO A;  2Q9Q A;  4TZ4 C;  3Q5X A;  2BDE A;  2MOZ A;  5KDM C;  2GK9 A;  5HYA A;  1X79 A;  3VU7 H;  1WLX A;  2X9W A;  2E9X C;  1ZEE A;  3NRX A;  4QX8 B;  3KFW X;  3WAJ A;  4ZS3 A;  3Q2M A;  2L3L A;  3HI2 A;  2VB6 A;  2CXL A;  3H3A A;  4MAL A;  5FNV E;  4BAY B;  5DQW A;  3O1I A;  4UEL A;  2ZLY A;  3MJX A;  4H63 H;  3KVA A;  3OKQ A;  2EHO B;  2YEV C;  1HTJ F;  2YIN A;  4QX7 B;  2LEH A;  5LGT B;  4DVD A;  5IYZ E;  1CUN A;  5JDQ A;  3ZLI A;  2JMH A;  3VKH A;  4CXX A;  3AA6 B;  3QK6 A;  4AQF C;  5FXZ A;  2Y48 B;  4TV8 E;  5FY1 A;  3U3I A;  1YKH B;  1G8X A;  5LJM A;  4EYU A;  4O2B E;  4PNI A;  2EHO D;  2E9X D;  3WI3 A;  5EK2 A;  3CWZ B;  4GYR A;  5CB4 E;  2ZM8 A;  1KNZ A;  2XAQ B;  4EOZ B;  2C5J A;  2ZM0 A;  4HEA A;  3ZC0 A;  2KWH A;  3MAC A;  1HX8 A;  2K5B B;  2LOP A;  2X68 A;  4JEH B;  4ZOL E;  4JEU B;  4PW8 A;  4TN7 B;  3PUS A;  1US7 B;  3HKE E;  3ZMT B;  3C4X A;  3UUN A;  2LJL A;  4IE6 A;  2A2F X;  4EXT A;  5LHH B;  2DI4 A;  3IBP A;  1D0Z A;  4J2C A;  2ES0 A;  3PTR B;  2MBG A;  4AQG A;  2V7M A;  3VHL A;  2VKJ A;  5DQV A;  2IAK A;  4DBR A;  1IJ6 A;  5FYM A;  2WMN A;  4P09 A;  4UF0 A;  3L3P A;  3BQI A;  2KLQ A;  3C51 A;  2WBL A;  3DP7 A;  4GIW A;  2VK9 A;  2LOS A;  4DMW A;  4WBN E;  2I59 A;  4KBM B;  3DJB A;  2ODV A;  5LHG B;  3RC8 A;  2E9X A;  4AXP A;  3F31 A;  3QC9 A;  5FY7 A;  4XBF B;  1B7T A;  1LVK A;  3GN5 B;  4GK0 E;  5LBM A;  5L3D B;  3V5S A;  4UXN B;  5FP3 A;  4ZHQ E;  4PK6 A;  2C5K T;  4OYK A;  2CXD A;  2NOX A;  4O4I E;  5JDN A;  2G0U A;  3BK9 A;  3J9X 1;  3NBX X;  2XTL A;  4H63 V;  5JH7 E;  3HA4 A;  4TUY E;  2JJ9 A;  4UEM A;  1BR0 A;  2L9Q A;  3N9P A;  2JPF A;  3R84 B;  2X0L B;  4PAG A;  1FIO A;  5JRC A;  2J1D G;  2NW8 A;  1HG2 A;  4IGU A;  4AQF A;  4BA9 A;  4ASK A;  4EB6 E;  3HKD E;  3CKD A;  3J7Y q;  3Q9D A;  1SA0 E;  3EUH A;  5LGN B;  1Y64 B;  3RX6 A;  3BQL A;  2DHR A;  3LFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...