1H7CA

Human tubulin chaperone cofactor a
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
b'PRVRQIKIKTGVVRRLVKERVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUBULIN-SPECIFIC CHAPERONE A
molecule tags Chaperone
source organism Homo sapiens
publication title Three-Dimensional Structure of Human Tubulin Chaperone Cofactor A
pubmed doi rcsb
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02970 TBCA Tubulin binding cofactor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1h7cA00
2X9XA 2C5IT 1QSDA 3MXZA 1LRZA 2C5JA 1H7CA 3TKLB 2KWIB 3S4UA 3FXEB 4B6XA 2KWHA 2G0UA 4EYYR 3L3PA 2K48A 1Z0PA 1IJ5A 3QK6A 4DNDA 2CA5A 1LVFA 1IJ6A 3CVRA 2MBGA 4FI5A 2IC6A 3FXDB 1ZKEA 2XTLA 4CQIA 2X9YA 3P7IA 3N5LA 3CKDA 3QUJA 4J2CA 4L0RA 2C5KT 2IC9A 2X9WA
chains in the Genus database with same CATH superfamily
3OPCA 1KFYA 5J0ZA 2XJ7A 1U5PA 3Q5DA 5KDMC 4U74A 2KWHA 3VRAA 3GWHA 2BKOA 4HTEA 3F2EA 4GYSA 4UV9B 4GKJT 1Z0PA 4LMKA 2H88A 4EZHA 4WBOA 5F8PA 2LSIA 2YDRA 2EHOC 5FVKA 2WMOA 4L5GA 4O8SA 4HFEA 4YTPA 3UU8A 4YFSA 4WBNE 4DV3T 4ZEYA 2IDOB 5AQOB 2OLTA 3RH3A 3UU5A 3DTOA 4UVCB 5FXXA 4UXNB 2CWOA 4MBQA 4YLHA 4I43B 4LMJA 3GN5B 1BR1A 2N2NA 1NEKA 1XDPA 3HKBE 3IHRA 4PJLA 2XAGB 4UV8B 4ASKA 3SRZA 4A5XA 1W0BA 5TAOA 4DBQA 3AE5A 3P4WA 4PK4A 4J2CA 1HFAA 4QH5A 4B3TT 1MIWA 3NWIA 1D0ZA 4EAHA 3JCFA 4CI2B 3TKLB 3HKDE 4HFCA 1HS7A 2XZEA 5HEGA 3LK42 5HXSA 4ANJA 2H3RA 2YDSA 5LYJE 5KXJA 2W4XA 2UU9T 2LM9A 4U2ZA 2V1DB 4DR5T 2XASB 5FXWA 3OTOT 4XBFB 2V7KA 5L47A 4GK0E 1VCTA 5DQWA 4X65T 3ZMUB 2NW8A 3IF8B 4EB6E 2NOXA 1QUUA 1NAFA 2A72A 3JAEA 5ABEA 5HXRA 3TLVA 2A2FX 4U3CA 4P1NA 3ZCIA 3AEFA 2LE8A 2JMKA 2BKPA 2UXXB 2YEVC 3RX6A 3ZSTA 1OXZA 2AXDS 4UIGA 3ZLIA 3ZN0B 2NTXA 4QX7B 4YSXA 4TUYE 2QYWA 4DV6T 4DR3T 5FNVE 4TX5A 4CI3B 4DVDA 5LNKA 2W00A 4KHPT 3NZPA 1UX5A 4B3ST 5FVLA 5JQGE 4JLEA 1LRZA 3K3QC 5AQSB 1HNXT 4JBWF 3RYCE 4YT0A 4JI8T 1NENA 4X66T 1WYBA 3OVUA 3T1YT 1KNZA 2BDEA 1SHZC 3AE9A 1BR2A 2E5VA 1YQ4A 3FB2A 3PUQA 5DQVA 3KBTA 2V6XA 5LBQB 3SWHA 4C90A 3R6NA 3ANWB 2VKOA 1VCSA 2BZBA 2B1EA 4AKLA 3HA4A 1IJ6A 4AI6A 3ONJA 4IL9A 3W15B 3T1HT 3ZMTB 5JRCA 1D0XA 1ZP0A 3UUNA 3K8PC 3FZMB 2E9XD 5CJ5A 2JRKA 4COFA 5FXZA 2UUAT 5JDMA 3AECA 5JDHA 4QX8B 2V7JA 3CKDA 4EYUA 1OEDB 2YKSA 2V8SV 3AE2A 4YHJA 4Z8XA 3Q5XA 2VQET 3KV5A 3RQWA 4IE7A 2FBWA 2LSKA 2OV9A 4HWIB 2SPCA 4PAGA 2IAKA 3CK6A 2M67A 1OEDA 2K9AA 3ETUA 3Q5EA 4G2AA 3AAAB 4NUUA 4ZI3D 4AQYT 3J9X1 1XNRT 2RP4A 1ZEEA 2PG8A 2MPKA 3DP7A 5FXVA 3H3MA 4DR7T 2X68A 2CCQA 3E0ZA 4ILAA 4TNVA 4DO0A 4XAXB 3RYHE 5AFUL 2HN2A 3L39A 3CVRA 4ZS2A 2L9QA 4FI5A 1CUNA 1G73A 5F5WA 4F8HA 3N2KE 3NVOA 2Y48B 5IWAT 2H7VC 1KNRA 2XHEB 3B57A 4ILBA 4E7SA 4A98A 1WR0A 3C4XA 2E5LT 5AQKB 3I1AA 4O4IE 2CPTA 2HPJA 2BS2A 3EHZA 3MA9A 5H6RB 4H63V 4ILCA 3ZMZB 3C4WA 2QRXA 1FJGT 1V9DA 2Y6XA 3AAEB 2IUBA 2V5CA 3ZJ2A 3AEEA 3IBPA 4QXHB 3L3PA 5ADXL 1ZOYA 5L3BB 1I6ZA 4H9NC 2VVNA 4TWHA 4PJMA 4X64T 2XY8B 5LGUB 2CHNA 5HEOA 2A9UA 2WY2A 2CA5A 1HG5A 3PJAA 2K24A 2YK0A 2ZM8A 1LKXA 2XQ5A 3LFMA 3PE0A 4I55E 2ACZA 4JUYA 5AQTB 1IBLT 4DMWA 5JDNA 3OYXA 4IDOA 4LF7T 1I94T 4CXYA 1ZKEA 4U72A 3M3ZB 4PJNA 4HFBA 3BQKA 4BJMA 3AE4A 4ZI2C 3P7IA 5JDGA 4K0UA 3L09A 3RPUA 1UUSA 3M65A 2WZHA 3P50A 3TLWA 4P0AA 4QHOA 5FY1A 3ZPOA 2W63A 2LKHA 1AJ3A 3N9MA 4PNIA 3VU7H 5E0OA 1J5WA 2UXBT 2NP9A 4IHJE 4MHCA 4ZS3A 2F4VT 3UU6A 5ABFA 4OYJA 4DUZT 5CGMA 4KX6A 3I0QA 1FIOA 4O4JE 4U33A 4O4LE 3NRXA 4PK5A 4OX9T 1FMVA 4ILUA 4M1PA 2JQHA 2D5UA 4IIJE 2VQFT 4HWCA 5AQVB 4IE4A 4EV6A 3O9XA 3AVRA 3O1JA 5L2LA 4AKGA 1N32T 1XMOT 1YXRA 1VOMA 3I9WA 3HKCE 5AQGB 1OEDC 4TN7B 4N78D 3OJAA 5HEJA 1Y64B 1MIVA 3ZCJA 4U2YA 5CA0E 5LHGB 5JDLA 5HCMA 2LKGA 4X1YE 3UUMA 5JR9A 4YY3T 3PUSA 3CX7B 3UQ4A 2LRKA 4YSYA 4H9PC 5ABHA 4CN6A 2VASA 2X0YA 4GOUA 3C50A 1D1CA 3NKZA 1DU2A 3PUZF 4GK5E 2WBLA 1GQEA 4AQFC 2X9HA 2YOEA 3CX6B 3KDSE 4UVBB 3QK6A 5KX5E 4DV1T 4LFAT 3FHNA 3AA1B 2CM0A 3N9OA 5LHIB 2VK9A 4H9OC 2H89A 1YQ3A 2BKNA 4ZI7E 4JI0T 4YTMA 5FMNA 2XQ4A 2Y8DA 2W0GA 5LJNA 2WAUA 3UFEA 5J2UE 3A7MA 5CFBA 1KEYA 3PJAJ 4O4HE 5IHYA 1J1JA 2DLRA 4K0KT 1IZNB 1R8IA 4MLKA 4X5TA 5C2TA 1SUMB 5JDFA 2X67A 1XWMA 1X9BA 4H63H 1HX8A 3Q2MA 5EZYE 2VB6A 2Z6EA 3BK9A 3B5MA 4OK0A 4HKAA 4BA9A 2AE9A 3GMIA 2IIUA 1OWAA 2IC9A 5ETWA 4ZHQE 4DUYT 2W66A 5AQQB 3OBVE 1HG2A 4OFZA 3L8RA 4UELA 5FKYA 1T7SA 3RYIE 4YHHT 2HH7A 4EXTA 5AQFB 1XZYA 1MMGA 4QH1A 4U7YA 4TV8E 1IJ5A 2WZIA 4ZZBA 1WR6A 1SA0E 2W67A 3ZC1A 4AXPA 3WAJA 3AE3A 3ZC0A 2WQYA 1LVFA 3CIRA 3KBUA 4H9QC 4I4TE 2XUEA 3RIUA 3AEAA 2BBHA 4U7IA 5HCJA 2XM2A 2CRBA 3AE7A 4IDNA 3RLFF 3PUYF 3BQLA 4AKRB 4EEDA 4ZI2D 4GIWA 4DV7T 4ZXLA 4OYKA 4AISA 3AE6A 3OYZA 2BS4A 1LVKA 3RRCA 4GYRA 1HX1B 2JQQA 2NR4A 3U78A 3ZN1B 5LHHB 4C91A 4IDZA 1JNRA 1M62A 5LG4A 4Z90A 3LBXB 3AA7B 1CHUA 2WU5A 4GKKT 3SOLA 3WI3A 2YN6A 3CX8B 3LSVA 3RIUC 2M6IA 5L4EA 2OA5A 5JTGA 2EHOB 1HNWT 3I0OA 2I59A 2CXFA 3ZYLA 2Q9QC 2KT9A 3EAMA 3N9QA 4YTNA 4JI4T 3LBXA 2J47A 5ABGA 1ZHCA 2UUCT 4JI6T 1MMNA 3PTRB 3UUXB 5LBMA 5HXHA 5L3EB 2W62A 5FP3A 3HI2A 4HEAA 5M4YA 1W0AA 5CA1E 3AEBA 1E7PA 3C64A 3VR9A 3ZT5A 3LK3B 3F57A 3AB3B 1T72A 2XTLA 2PBIA 2VKHA 2JQKA 3CQXC 3ZMSB 5JR9C 1O3XA 3G06A 3CMLA 5HEUA 5JDQA 2CLYC 5JR9B 3ESLA 2FJAA 3MK7C 4UR9A 3TLTA 2PJQA 4JI1T 1HF8A 4Q25A 4IREA 3HR0A 5BR8T 2Q9QD 3FZLB 1T98A 3AE1A 5JVDE 4BJNA 4ZOLE 1HNZT 2K3WA 3UTKA 4E7ZA 2D0UA 2MAWA 4KP3C 5FY0A 5H6QB 4JI5T 3UFGA 3K3NA 3RIAA 4NPPA 5JREA 3AXJB 3KV9A 4IE6A 2MOZA 4HWFA 3N9PA 5FL0A 5L4HA 2V6YA 3QB5A 2R6GF 5FYMA 1MMAA 2QVAA 1QLBA 3RIFA 1N36T 4HFVA 5HYAA 5AQIB 2C0SA 4UVAB 5LOVE 2LLYA 3JC6D 3AXJA 4QH4A 2X0LB 3ONXA 2EHOA 3RYFE 3TLSA 3O1IA 1KNPA 4YXDA 5ABFB 4CZZB 4EGWA 3UULA 2WDVA 4DV4T 3RKOA 2BG9E 1UK5A 3RHWA 2MTQA 5HAXA 2HHHT 4AKHA 1W09A 3QOFA 2XAJB 5EK4A 4YJ2E 1MIYA 1UX4A 4IT4A 4UF0A 2BBJA 3BQIA 1HR0T 2J4GA 5AQRB 2V5DA 1Y01A 3ZKRA 2LRLA 4XZCA 3N5LA 1YD8G 4P09A 2LEHA 4DV0T 1E1HB 2XM1A 1E2AA 3NZQA 3P4QA 3FZFB 2UXCT 2WU2A 3ONLC 2W2UA 1QSDA 2PFVA 2ZLYA 3PUGA 2ZM6T 1M7KA 3V5UA 3N9LA 3F31A 2J62A 2VL0A 2NWBA 1B7TA 4YJ3E 3RRWA 1WRDA 2DWGA 1S35A 3EVYA 2ES0A 2E9XA 4DNDA 5AQLB 2XQ3A 1IAPA 4KBMB 4HE8A 3H3AA 4TV9E 3PDYA 4X1IE 3T8OA 1XMQT 3RC8A 1UGOA 2D9DA 2DI4A 4QWNB 2JQ9A 2LSYA 1WCRA 3Q9DA 3ZSSA 2ZMAA 3GA8A 4HFDA 2H7OA 2JPFA 2XQ9A 4LFCT 1YKHB 4I0UA 4JEHB 2D0TA 3U3IA 4TNWA 4ZZCA 4X1KE 4DV2T 4QKNA 2IHR1 3O1HA 1ZV4X 4HWDA 3VRBA 2NTYA 5LB7B 2UUBT 3AA0B 2WB5A 5DJQC 3LJCA 3O4XE 4HFHA 1UURA 4HN9A 2XAQB 4IE5A 1FMWA 4Z91A 4DMVA 3PUWF 4IL4A 3X1DA 2C5JA 3ZMVB 3AA6B 1BR4A 5AQMB 5FY7A 2VVSA 2XQAA 3FBZA 2LOPA 3C4ZA 3S4UA 2KZ7B 2EHOD 2K48A 2LJLA 4X20E 5HWYA 4DR2T 2ODUA 2YDQA 3NBXX 3FZKB 3MZKB 2JIWA 1HCIA 2N9DA 2CLYB 4PJJA 2WWUA 3VHLA 2XAHB 5BMVE 4DV5T 2X66A 2WSSV 5AQNB 2V7MA 3CQGB 4IGUA 1SE7A 4HGAA 2LM2A 2QGSA 4PFPA 2MBGA 4EZ4A 2IMLA 2LOSA 2KNDA 2E9XB 2Q9QA 2XAFB 3MJXA 3ETVA 4JV5T 4IDQA 3KV4A 2X9YA 3QC9A 1VRBA 4U31A 1D1BA 4LF8T 2LHRA 2WCAA 3AEDA 1D1AA 4NUVA 1Z8UA 2KSRA 2Q9QB 3R84B 4ADZA 3EDVA 2LSGA 3MACA 4UEMA 2BG9C 3IEEA 1MNDA 3AE8A 4IE0A 1IBMT 2L3LA 2C5KT 2BVMA 3DJBA 2G0UA 2XQYA 4L0RA 1WYCA 5HXCA 2V6YB 2C5IT 4WNKA 4LFBT 2E8IA 3IA3A 1OEDE 4HWHA 2KWIB 1US7B 2VURA 5J2TE 4F6RC 2CXLA 2E2AA 5LCYA 2LSJA 2RA1A 4CI1B 2V7IA 1D0YA 3LDQB 3ZJ1A 2FJEA 4HFIA 4PW8A 2ACXA 1T8BA 3ABVA 3C51A 4QXCB 1X79A 3VR8A 2A3DA 2ZM2A 4UF0B 4CN1A 5LJMA 2XQ6A 4OHFA 2DCFA 3E22E 3AEGA 4I50E 5EK3A 4X62T 4LF4T 2XQ7A 4AKIA 2WP9A 3FXDB 3P4SA 3PV0F 4PFOA 3UU3A 2CXDA 4CQIA 4WZXA 2HN1A 2I6HA 2BG9B 2D2SA 2NW9A 3ZT7A 5LG3A 5L3CB 5AQJB 3EI0A 3KFWX 4A97A 4O2BE 3PUVF 3SFDA 5LXTE 3NRYA 2BG9A 4TWFA 2CBJA 5AQPB 3H37A 2BS3A 2FJBA 2CHOA 4DR4T 5LMUT 4FJOA 3ZT6A 3FXEB 4DR1T 2LT3A 3PUAA 3N2GE 2FUPA 2K5BB 3A5XA 2UXDT 2WDRA 2YU1A 4KHZF 1J5ET 4ERRA 1XDOA 3FBLA 2HPLA 3PU3A 1XNQT 2XPKA 3KVBA 5JH7E 1FEWA 2CBIA 2L8KA 4QXBB 1IBKT 5AQHB 4G63A 4AQGA 5HWXA 3J7Yq 2PTFA 1NWMX 3KINB 2CMRA 5LMNT 1YKEB 1JNZA 3ZYMA 3SFEA 2BVLA 2DL1A 3RI5A 5LGTB 2QA7A 4JI3T 3EUHA 3P4RA 3K3OA 5LP6E 3P4PA 4LF9T 3QB5K 4JEUB 2X51A 4EOZB 3ZEFB 3V5SA 5L3FB 5L3GB 4JI7T 1MMDA 3E08A 3KVAA 2WMNA 1UCUA 3FZHB 1S94A 2YINA 3N9NA 3RF1A 2UXNB 2YU2A 3HKEE 3MKDA 5IYZE 3LG7A 5L3DB 4B3RT 2W61A 3CPZA 2X9WA 3LK2B 3A8YC 2VWAA 4TWDA 1H7CA 3K1SA 5KMGP 3PURA 3VKHA 2KXPB 1HTJF 4B6XA 2GK9A 4EIWA 1KF6A 2NW7A 2CWYA 3PU8A 1BR0A 2ODVA 3I9YA 3N2OA 4DIDB 4V1Av 1W9RA 5C8YE 3AAIA 3UQ7A 4YSZA 4WYVA 4BAYB 5DABA 2CEAA 4EEBA 4H9RC 2WS3A 2V7LA 4NIQA 5J1GA 2IW5B 3B13A 2WM9A 3VKGA 2E9XC 2N1GA 2IC6A 2VKJA 3RQUA 4ISSA 2LHNA 4MALA 2I0MA 3EABA 3P8CD 2XSBA 3RC3A 1EZ3A 5C3JA 2M6BA 4ZI3C 4CXWA 4CN4A 3WAKA 3KV6A 5EK2A 2MYSA 5A1LA 4LMLA 4A56A 5LGNB 5IUXA 4PK6A 1G8XA 5CB4E 5LA6E 4LF5T 1MNEA 2VL8A 3C98B 2JJ9A 3TLUA 4MFRA 3UU4A 4CXXA 4DR6T 2WDQA 3ZYKA 3D0TA 2KLQA 2X9XA 4TZ4C 3MXZA 2WWVA 3SS1A 2VKDA 5HEHA 2KINB 2B76A 2CE7A 3UUBA 4KUMB 5FL1A 4EYYR 1L0VA 3Q5WA 2FJDA 5HXEA 3OKQA 2DHRA 3JAFA 3QNUA 2ZM0A 1YW0A 1U4QA 1WFDA 2JMHA 3GN5A 1WLXA 5GONE 4L9IA 1KK7A 2KMFA 2DWKA 4WW0A 1N33T 4KMCA 2V26A 4LF6T 4H9SE 4KI0F 3ANWA 4AQFA 2RPAA 4JYAT 2X0HA 5F3JA 2J1DG 2P9BA 3EDUA 3JC6C 2XSAA 4ISTA 4AIUA 1N34T 2XQ8A 3AVSA 3HL6A 2DNXA 5AQUB 3RGLA 3JADA 3PUXF 3QUJA 3UT5E 3CQCB 5JRCB 3CWZB 4JI2T 4DBRA 4B3MT 4NXMT 4IDPA 3RKGA 4O2AE 4P0BA 4NXNT
chains in the Genus database with same CATH topology
1U5PA 5KDMC 4U74A 2KWHA 3GWHA 4HTEA 4UV9B 3F2EA 4GYSA 1Z0PA 4EZHA 4WBOA 5F8PA 2LSIA 2EHOC 2WMOA 4L5GA 4O8SA 4WBNE 4YFSA 3RH3A 3DTOA 4UVCB 5FXXA 4UXNB 2CWOA 4MBQA 4YLHA 4I43B 3GN5B 1BR1A 2N2NA 3HKBE 3IHRA 4PJLA 2XAGB 4UV8B 4ASKA 3SRZA 5TAOA 4DBQA 4PK4A 4J2CA 1HFAA 1MIWA 1D0ZA 4EAHA 4CI2B 3TKLB 3HKDE 1HS7A 3LK42 5HXSA 4ANJA 2H3RA 5LYJE 2LM9A 2V1DB 2XASB 5FXWA 4XBFB 2V7KA 4GK0E 5DQWA 3ZMUB 2NW8A 3IF8B 4EB6E 2NOXA 1QUUA 1NAFA 2A72A 5HXRA 2A2FX 3ZCIA 2LE8A 2JMKA 2UXXB 2YEVC 3RX6A 1OXZA 4UIGA 3ZLIA 3ZN0B 2NTXA 4QX7B 4TUYE 5FNVE 4TX5A 4CI3B 4DVDA 5LNKA 2W00A 3NZPA 1UX5A 5JQGE 4JLEA 1LRZA 3K3QC 3RYCE 1WYBA 1KNZA 2BDEA 1SHZC 1BR2A 3PUQA 3FB2A 5DQVA 3KBTA 5LBQB 3SWHA 4C90A 3R6NA 3ANWB 2VKOA 2BZBA 2B1EA 4AKLA 3HA4A 1IJ6A 4AI6A 3W15B 3ZMTB 5JRCA 1D0XA 3UUNA 3K8PC 2E9XD 2JRKA 5FXZA 5JDMA 5JDHA 4QX8B 2V7JA 3CKDA 4EYUA 4YHJA 4Z8XA 3Q5XA 3KV5A 4IE7A 2LSKA 2SPCA 4PAGA 2IAKA 4G2AA 2M67A 2K9AA 3ETUA 4NUUA 3AAAB 4ZI3D 3J9X1 2RP4A 1ZEEA 2PG8A 3DP7A 5FXVA 2X68A 2CCQA 3E0ZA 4DO0A 4XAXB 3RYHE 5AFUL 3CVRA 4ZS2A 2L9QA 4FI5A 1CUNA 1G73A 3N2KE 2Y48B 2H7VC 2XHEB 3B57A 4E7SA 3C4XA 3I1AA 4O4IE 2HPJA 3ZMZB 3MA9A 5H6RB 4H63V 3C4WA 1V9DA 2Y6XA 3AAEB 3ZJ2A 3IBPA 4QXHB 3L3PA 5ADXL 5L3BB 4H9NC 4PJMA 5LGUB 2CA5A 1HG5A 2K24A 2YK0A 2ZM8A 1LKXA 3PE0A 3LFMA 4I55E 4JUYA 4DMWA 5JDNA 3OYXA 4CXYA 1ZKEA 4U72A 4PJNA 3BQKA 4BJMA 4ZI2C 3P7IA 5JDGA 4K0UA 3L09A 3RPUA 3M65A 4P0AA 4QHOA 5FY1A 3ZPOA 2W63A 1AJ3A 3N9MA 4PNIA 3VU7H 5E0OA 2NP9A 4IHJE 4MHCA 4ZS3A 4OYJA 3I0QA 1FIOA 4O4JE 4O4LE 3NRXA 4PK5A 1FMVA 4ILUA 4M1PA 2D5UA 4IIJE 4IE4A 3O9XA 3AVRA 3O1JA 5L2LA 4AKGA 1VOMA 3I9WA 3HKCE 4TN7B 4N78D 3OJAA 1Y64B 1MIVA 3ZCJA 5CA0E 5LHGB 4X1YE 3UUMA 5JR9A 3PUSA 3CX7B 4H9PC 2VASA 4GOUA 3C50A 1D1CA 4GK5E 2WBLA 4AQFC 2X9HA 3CX6B 3KDSE 4UVBB 3QK6A 5KX5E 3FHNA 3AA1B 2CM0A 3N9OA 5LHIB 2VK9A 4H9OC 4ZI7E 5FMNA 5LJNA 2Y8DA 2W0GA 2WAUA 3UFEA 5J2UE 4O4HE 5IHYA 2DLRA 1IZNB 4MLKA 5JDFA 2X67A 4H63H 1HX8A 3Q2MA 5EZYE 2VB6A 2Z6EA 3BK9A 4OK0A 4HKAA 4BA9A 3GMIA 1OWAA 2IC9A 5ETWA 4ZHQE 3OBVE 1HG2A 4OFZA 4UELA 3RYIE 2HH7A 4EXTA 1MMGA 4TV8E 1IJ5A 1WR6A 1SA0E 3ZC1A 4AXPA 3WAJA 3ZC0A 1LVFA 4H9QC 3KBUA 4I4TE 2XUEA 4AKRB 3BQLA 4ZI2D 4GIWA 4OYKA 3OYZA 1LVKA 3RRCA 4GYRA 2JQQA 3U78A 3ZN1B 5LHHB 4C91A 4IDZA 5LG4A 3LBXB 3AA7B 3SOLA 3WI3A 3CX8B 2OA5A 2EHOB 3I0OA 2I59A 2CXFA 3ZYLA 2Q9QC 2KT9A 3N9QA 3LBXA 1ZHCA 1MMNA 3PTRB 3UUXB 5LBMA 5HXHA 5L3EB 2W62A 5FP3A 3HI2A 4HEAA 5M4YA 5CA1E 3C64A 3LK3B 3F57A 3AB3B 2XTLA 2PBIA 2VKHA 3CQXC 3ZMSB 5JR9C 1O3XA 5JDQA 3CMLA 5JR9B 2CLYC 3ESLA 3MK7C 2PJQA 1HF8A 3HR0A 2Q9QD 1T98A 5JVDE 4BJNA 4ZOLE 3UTKA 4E7ZA 2D0UA 4KP3C 5FY0A 5H6QB 3K3NA 5JREA 3KV9A 4IE6A 2MOZA 3N9PA 5FYMA 1MMAA 4HFVA 5HYAA 2C0SA 4UVAB 5LOVE 3JC6D 2X0LB 3ONXA 2EHOA 3RYFE 3O1IA 4CZZB 3UULA 3RKOA 2MTQA 5HAXA 4AKHA 4YJ2E 2XAJB 5EK4A 1MIYA 1UX4A 4UF0A 3BQIA 4XZCA 3N5LA 1YD8G 4P09A 2LEHA 1E1HB 3NZQA 1QSDA 2PFVA 2ZLYA 3PUGA 3V5UA 3N9LA 3F31A 2NWBA 1B7TA 4YJ3E 3RRWA 1WRDA 2DWGA 1S35A 3EVYA 2ES0A 2E9XA 4DNDA 1IAPA 4KBMB 4HE8A 3H3AA 4TV9E 3PDYA 4X1IE 3T8OA 3RC8A 2DI4A 4QWNB 2LSYA 3Q9DA 2ZMAA 3GA8A 2H7OA 2JPFA 1YKHB 4JEHB 2D0TA 3U3IA 4X1KE 4QKNA 3O1HA 1ZV4X 2NTYA 3AA0B 5DJQC 3LJCA 3O4XE 4HN9A 4IE5A 2XAQB 1FMWA 4DMVA 2C5JA 3ZMVB 3AA6B 1BR4A 5FY7A 3S4UA 3FBZA 2LOPA 3C4ZA 2KZ7B 2EHOD 2K48A 2LJLA 4X20E 5HWYA 2ODUA 3NBXX 3MZKB 4PJJA 1HCIA 2N9DA 2CLYB 3VHLA 2WWUA 5BMVE 2XAHB 2X66A 2WSSV 2V7MA 3CQGB 4IGUA 4HGAA 4PFPA 2QGSA 2MBGA 4EZ4A 3MJXA 2LOSA 2KNDA 2E9XB 2Q9QA 2XAFB 3ETVA 3KV4A 2X9YA 3QC9A 1VRBA 1D1BA 2LHRA 1D1AA 4NUVA 2Q9QB 3R84B 4ADZA 3EDVA 2LSGA 3MACA 4UEMA 3IEEA 1MNDA 4IE0A 2L3LA 3DJBA 2C5KT 2BVMA 2XQYA 2G0UA 4L0RA 1WYCA 5HXCA 2C5IT 4WNKA 2E8IA 2KWIB 1US7B 5J2TE 4F6RC 2CXLA 5LCYA 2LSJA 2RA1A 4CI1B 2V7IA 1D0YA 3ZJ1A 4PW8A 2ACXA 3C51A 4QXCB 1X79A 2A3DA 2ZM2A 4UF0B 5LJMA 4OHFA 2DCFA 3E22E 4I50E 5EK3A 4AKIA 3FXDB 4PFOA 2CXDA 4CQIA 2NW9A 2D2SA 5L3CB 3KFWX 4O2BE 5LXTE 3NRYA 3H37A 4FJOA 3FXEB 2LT3A 3PUAA 3N2GE 2K5BB 3A5XA 2YU1A 4ERRA 3FBLA 2HPLA 3PU3A 3KVBA 5JH7E 1FEWA 2L8KA 4QXBB 4G63A 4AQGA 5HWXA 3J7Yq 1NWMX 3KINB 2CMRA 1YKEB 3ZYMA 2BVLA 5LGTB 2QA7A 3EUHA 3K3OA 5LP6E 4JEUB 2X51A 4EOZB 3ZEFB 3V5SA 5L3FB 1MMDA 3E08A 3KVAA 2WMNA 1UCUA 3N9NA 1S94A 2YINA 5L3DB 2UXNB 2YU2A 3HKEE 3MKDA 5IYZE 3LG7A 2W61A 3CPZA 2X9WA 3LK2B 2VWAA 1H7CA 5KMGP 3PURA 3VKHA 2KXPB 1HTJF 4B6XA 2GK9A 4EIWA 2CWYA 2NW7A 3PU8A 1BR0A 2ODVA 3I9YA 3N2OA 5C8YE 4V1Av 3AAIA 4BAYB 5L3GB 5DABA 2CEAA 4H9RC 2V7LA 5J1GA 2IW5B 3B13A 2WM9A 3VKGA 2E9XC 2N1GA 2IC6A 2VKJA 4ISSA 2LHNA 4MALA 3P8CD 3RC3A 5JDLA 1EZ3A 4ZI3C 4CXWA 3WAKA 3KV6A 5EK2A 2MYSA 5A1LA 4A56A 5LGNB 4PK6A 1G8XA 5CB4E 5LA6E 1MNEA 2VL8A 3C98B 2JJ9A 4MFRA 4CXXA 3ZYKA 3D0TA 2KLQA 2X9XA 4TZ4C 3MXZA 3SS1A 2VKDA 2KINB 2CE7A 4KUMB 4EYYR 3Q5WA 5HXEA 3OKQA 2DHRA 2ZM0A 1YW0A 1U4QA 3GN5A 2JMHA 1WLXA 5GONE 4L9IA 1KK7A 2KMFA 2DWKA 4WW0A 4KMCA 2V26A 4H9SE 3ANWA 4AQFA 5F3JA 2J1DG 2P9BA 3EDUA 3JC6C 4ISTA 3AVSA 3HL6A 3UT5E 2DNXA 5JRCB 3QUJA 3CQCB 3CWZB 4DBRA 4O2AE 4P0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X9X A;  2C5I T;  1QSD A;  3MXZ A;  1LRZ A;  2C5J A;  1H7C A;  3TKL B;  2KWI B;  3S4U A;  3FXE B;  4B6X A;  2KWH A;  2G0U A;  4EYY R;  3L3P A;  2K48 A;  1Z0P A;  1IJ5 A;  3QK6 A;  4DND A;  2CA5 A;  1LVF A;  1IJ6 A;  3CVR A;  2MBG A;  4FI5 A;  2IC6 A;  3FXD B;  1ZKE A;  2XTL A;  4CQI A;  2X9Y A;  3P7I A;  3N5L A;  3CKD A;  3QUJ A;  4J2C A;  4L0R A;  2C5K T;  2IC9 A;  2X9W A; 
#chains in the Genus database with same CATH topology
 3OPC A;  1KFY A;  5J0Z A;  2XJ7 A;  1U5P A;  3Q5D A;  5KDM C;  4U74 A;  2KWH A;  3VRA A;  3GWH A;  2BKO A;  4HTE A;  3F2E A;  4GYS A;  4UV9 B;  4GKJ T;  1Z0P A;  4LMK A;  2H88 A;  4EZH A;  4WBO A;  5F8P A;  2LSI A;  2YDR A;  2EHO C;  5FVK A;  2WMO A;  4L5G A;  4O8S A;  4HFE A;  4YTP A;  3UU8 A;  4YFS A;  4WBN E;  4DV3 T;  4ZEY A;  2IDO B;  5AQO B;  2OLT A;  3RH3 A;  3UU5 A;  3DTO A;  4UVC B;  5FXX A;  4UXN B;  2CWO A;  4MBQ A;  4YLH A;  4I43 B;  4LMJ A;  3GN5 B;  1BR1 A;  2N2N A;  1NEK A;  1XDP A;  3HKB E;  3IHR A;  4PJL A;  2XAG B;  4UV8 B;  4ASK A;  3SRZ A;  4A5X A;  1W0B A;  5TAO A;  4DBQ A;  3AE5 A;  3P4W A;  4PK4 A;  4J2C A;  1HFA A;  4QH5 A;  4B3T T;  1MIW A;  3NWI A;  1D0Z A;  4EAH A;  3JCF A;  4CI2 B;  3TKL B;  3HKD E;  4HFC A;  1HS7 A;  2XZE A;  5HEG A;  3LK4 2;  5HXS A;  4ANJ A;  2H3R A;  2YDS A;  5LYJ E;  5KXJ A;  2W4X A;  2UU9 T;  2LM9 A;  4U2Z A;  2V1D B;  4DR5 T;  2XAS B;  5FXW A;  3OTO T;  4XBF B;  2V7K A;  5L47 A;  4GK0 E;  1VCT A;  5DQW A;  4X65 T;  3ZMU B;  2NW8 A;  3IF8 B;  4EB6 E;  2NOX A;  1QUU A;  1NAF A;  2A72 A;  3JAE A;  5ABE A;  5HXR A;  3TLV A;  2A2F X;  4U3C A;  4P1N A;  3ZCI A;  3AEF A;  2LE8 A;  2JMK A;  2BKP A;  2UXX B;  2YEV C;  3RX6 A;  3ZST A;  1OXZ A;  2AXD S;  4UIG A;  3ZLI A;  3ZN0 B;  2NTX A;  4QX7 B;  4YSX A;  4TUY E;  2QYW A;  4DV6 T;  4DR3 T;  5FNV E;  4TX5 A;  4CI3 B;  4DVD A;  5LNK A;  2W00 A;  4KHP T;  3NZP A;  1UX5 A;  4B3S T;  5FVL A;  5JQG E;  4JLE A;  1LRZ A;  3K3Q C;  5AQS B;  1HNX T;  4JBW F;  3RYC E;  4YT0 A;  4JI8 T;  1NEN A;  4X66 T;  1WYB A;  3OVU A;  3T1Y T;  1KNZ A;  2BDE A;  1SHZ C;  3AE9 A;  1BR2 A;  2E5V A;  1YQ4 A;  3FB2 A;  3PUQ A;  5DQV A;  3KBT A;  2V6X A;  5LBQ B;  3SWH A;  4C90 A;  3R6N A;  3ANW B;  2VKO A;  1VCS A;  2BZB A;  2B1E A;  4AKL A;  3HA4 A;  1IJ6 A;  4AI6 A;  3ONJ A;  4IL9 A;  3W15 B;  3T1H T;  3ZMT B;  5JRC A;  1D0X A;  1ZP0 A;  3UUN A;  3K8P C;  3FZM B;  2E9X D;  5CJ5 A;  2JRK A;  4COF A;  5FXZ A;  2UUA T;  5JDM A;  3AEC A;  5JDH A;  4QX8 B;  2V7J A;  3CKD A;  4EYU A;  1OED B;  2YKS A;  2V8S V;  3AE2 A;  4YHJ A;  4Z8X A;  3Q5X A;  2VQE T;  3KV5 A;  3RQW A;  4IE7 A;  2FBW A;  2LSK A;  2OV9 A;  4HWI B;  2SPC A;  4PAG A;  2IAK A;  3CK6 A;  2M67 A;  1OED A;  2K9A A;  3ETU A;  3Q5E A;  4G2A A;  3AAA B;  4NUU A;  4ZI3 D;  4AQY T;  3J9X 1;  1XNR T;  2RP4 A;  1ZEE A;  2PG8 A;  2MPK A;  3DP7 A;  5FXV A;  3H3M A;  4DR7 T;  2X68 A;  2CCQ A;  3E0Z A;  4ILA A;  4TNV A;  4DO0 A;  4XAX B;  3RYH E;  5AFU L;  2HN2 A;  3L39 A;  3CVR A;  4ZS2 A;  2L9Q A;  4FI5 A;  1CUN A;  1G73 A;  5F5W A;  4F8H A;  3N2K E;  3NVO A;  2Y48 B;  5IWA T;  2H7V C;  1KNR A;  2XHE B;  3B57 A;  4ILB A;  4E7S A;  4A98 A;  1WR0 A;  3C4X A;  2E5L T;  5AQK B;  3I1A A;  4O4I E;  2CPT A;  2HPJ A;  2BS2 A;  3EHZ A;  3MA9 A;  5H6R B;  4H63 V;  4ILC A;  3ZMZ B;  3C4W A;  2QRX A;  1FJG T;  1V9D A;  2Y6X A;  3AAE B;  2IUB A;  2V5C A;  3ZJ2 A;  3AEE A;  3IBP A;  4QXH B;  3L3P A;  5ADX L;  1ZOY A;  5L3B B;  1I6Z A;  4H9N C;  2VVN A;  4TWH A;  4PJM A;  4X64 T;  2XY8 B;  5LGU B;  2CHN A;  5HEO A;  2A9U A;  2WY2 A;  2CA5 A;  1HG5 A;  3PJA A;  2K24 A;  2YK0 A;  2ZM8 A;  1LKX A;  2XQ5 A;  3LFM A;  3PE0 A;  4I55 E;  2ACZ A;  4JUY A;  5AQT B;  1IBL T;  4DMW A;  5JDN A;  3OYX A;  4IDO A;  4LF7 T;  1I94 T;  4CXY A;  1ZKE A;  4U72 A;  3M3Z B;  4PJN A;  4HFB A;  3BQK A;  4BJM A;  3AE4 A;  4ZI2 C;  3P7I A;  5JDG A;  4K0U A;  3L09 A;  3RPU A;  1UUS A;  3M65 A;  2WZH A;  3P50 A;  3TLW A;  4P0A A;  4QHO A;  5FY1 A;  3ZPO A;  2W63 A;  2LKH A;  1AJ3 A;  3N9M A;  4PNI A;  3VU7 H;  5E0O A;  1J5W A;  2UXB T;  2NP9 A;  4IHJ E;  4MHC A;  4ZS3 A;  2F4V T;  3UU6 A;  5ABF A;  4OYJ A;  4DUZ T;  5CGM A;  4KX6 A;  3I0Q A;  1FIO A;  4O4J E;  4U33 A;  4O4L E;  3NRX A;  4PK5 A;  4OX9 T;  1FMV A;  4ILU A;  4M1P A;  2JQH A;  2D5U A;  4IIJ E;  2VQF T;  4HWC A;  5AQV B;  4IE4 A;  4EV6 A;  3O9X A;  3AVR A;  3O1J A;  5L2L A;  4AKG A;  1N32 T;  1XMO T;  1YXR A;  1VOM A;  3I9W A;  3HKC E;  5AQG B;  1OED C;  4TN7 B;  4N78 D;  3OJA A;  5HEJ A;  1Y64 B;  1MIV A;  3ZCJ A;  4U2Y A;  5CA0 E;  5LHG B;  5JDL A;  5HCM A;  2LKG A;  4X1Y E;  3UUM A;  5JR9 A;  4YY3 T;  3PUS A;  3CX7 B;  3UQ4 A;  2LRK A;  4YSY A;  4H9P C;  5ABH A;  4CN6 A;  2VAS A;  2X0Y A;  4GOU A;  3C50 A;  1D1C A;  3NKZ A;  1DU2 A;  3PUZ F;  4GK5 E;  2WBL A;  1GQE A;  4AQF C;  2X9H A;  2YOE A;  3CX6 B;  3KDS E;  4UVB B;  3QK6 A;  5KX5 E;  4DV1 T;  4LFA T;  3FHN A;  3AA1 B;  2CM0 A;  3N9O A;  5LHI B;  2VK9 A;  4H9O C;  2H89 A;  1YQ3 A;  2BKN A;  4ZI7 E;  4JI0 T;  4YTM A;  5FMN A;  2XQ4 A;  2Y8D A;  2W0G A;  5LJN A;  2WAU A;  3UFE A;  5J2U E;  3A7M A;  5CFB A;  1KEY A;  3PJA J;  4O4H E;  5IHY A;  1J1J A;  2DLR A;  4K0K T;  1IZN B;  1R8I A;  4MLK A;  4X5T A;  5C2T A;  1SUM B;  5JDF A;  2X67 A;  1XWM A;  1X9B A;  4H63 H;  1HX8 A;  3Q2M A;  5EZY E;  2VB6 A;  2Z6E A;  3BK9 A;  3B5M A;  4OK0 A;  4HKA A;  4BA9 A;  2AE9 A;  3GMI A;  2IIU A;  1OWA A;  2IC9 A;  5ETW A;  4ZHQ E;  4DUY T;  2W66 A;  5AQQ B;  3OBV E;  1HG2 A;  4OFZ A;  3L8R A;  4UEL A;  5FKY A;  1T7S A;  3RYI E;  4YHH T;  2HH7 A;  4EXT A;  5AQF B;  1XZY A;  1MMG A;  4QH1 A;  4U7Y A;  4TV8 E;  1IJ5 A;  2WZI A;  4ZZB A;  1WR6 A;  1SA0 E;  2W67 A;  3ZC1 A;  4AXP A;  3WAJ A;  3AE3 A;  3ZC0 A;  2WQY A;  1LVF A;  3CIR A;  3KBU A;  4H9Q C;  4I4T E;  2XUE A;  3RIU A;  3AEA A;  2BBH A;  4U7I A;  5HCJ A;  2XM2 A;  2CRB A;  3AE7 A;  4IDN A;  3RLF F;  3PUY F;  3BQL A;  4AKR B;  4EED A;  4ZI2 D;  4GIW A;  4DV7 T;  4ZXL A;  4OYK A;  4AIS A;  3AE6 A;  3OYZ A;  2BS4 A;  1LVK A;  3RRC A;  4GYR A;  1HX1 B;  2JQQ A;  2NR4 A;  3U78 A;  3ZN1 B;  5LHH B;  4C91 A;  4IDZ A;  1JNR A;  1M62 A;  5LG4 A;  4Z90 A;  3LBX B;  3AA7 B;  1CHU A;  2WU5 A;  4GKK T;  3SOL A;  3WI3 A;  2YN6 A;  3CX8 B;  3LSV A;  3RIU C;  2M6I A;  5L4E A;  2OA5 A;  5JTG A;  2EHO B;  1HNW T;  3I0O A;  2I59 A;  2CXF A;  3ZYL A;  2Q9Q C;  2KT9 A;  3EAM A;  3N9Q A;  4YTN A;  4JI4 T;  3LBX A;  2J47 A;  5ABG A;  1ZHC A;  2UUC T;  4JI6 T;  1MMN A;  3PTR B;  3UUX B;  5LBM A;  5HXH A;  5L3E B;  2W62 A;  5FP3 A;  3HI2 A;  4HEA A;  5M4Y A;  1W0A A;  5CA1 E;  3AEB A;  1E7P A;  3C64 A;  3VR9 A;  3ZT5 A;  3LK3 B;  3F57 A;  3AB3 B;  1T72 A;  2XTL A;  2PBI A;  2VKH A;  2JQK A;  3CQX C;  3ZMS B;  5JR9 C;  1O3X A;  3G06 A;  3CML A;  5HEU A;  5JDQ A;  2CLY C;  5JR9 B;  3ESL A;  2FJA A;  3MK7 C;  4UR9 A;  3TLT A;  2PJQ A;  4JI1 T;  1HF8 A;  4Q25 A;  4IRE A;  3HR0 A;  5BR8 T;  2Q9Q D;  3FZL B;  1T98 A;  3AE1 A;  5JVD E;  4BJN A;  4ZOL E;  1HNZ T;  2K3W A;  3UTK A;  4E7Z A;  2D0U A;  2MAW A;  4KP3 C;  5FY0 A;  5H6Q B;  4JI5 T;  3UFG A;  3K3N A;  3RIA A;  4NPP A;  5JRE A;  3AXJ B;  3KV9 A;  4IE6 A;  2MOZ A;  4HWF A;  3N9P A;  5FL0 A;  5L4H A;  2V6Y A;  3QB5 A;  2R6G F;  5FYM A;  1MMA A;  2QVA A;  1QLB A;  3RIF A;  1N36 T;  4HFV A;  5HYA A;  5AQI B;  2C0S A;  4UVA B;  5LOV E;  2LLY A;  3JC6 D;  3AXJ A;  4QH4 A;  2X0L B;  3ONX A;  2EHO A;  3RYF E;  3TLS A;  3O1I A;  1KNP A;  4YXD A;  5ABF B;  4CZZ B;  4EGW A;  3UUL A;  2WDV A;  4DV4 T;  3RKO A;  2BG9 E;  1UK5 A;  3RHW A;  2MTQ A;  5HAX A;  2HHH T;  4AKH A;  1W09 A;  3QOF A;  2XAJ B;  5EK4 A;  4YJ2 E;  1MIY A;  1UX4 A;  4IT4 A;  4UF0 A;  2BBJ A;  3BQI A;  1HR0 T;  2J4G A;  5AQR B;  2V5D A;  1Y01 A;  3ZKR A;  2LRL A;  4XZC A;  3N5L A;  1YD8 G;  4P09 A;  2LEH A;  4DV0 T;  1E1H B;  2XM1 A;  1E2A A;  3NZQ A;  3P4Q A;  3FZF B;  2UXC T;  2WU2 A;  3ONL C;  2W2U A;  1QSD A;  2PFV A;  2ZLY A;  3PUG A;  2ZM6 T;  1M7K A;  3V5U A;  3N9L A;  3F31 A;  2J62 A;  2VL0 A;  2NWB A;  1B7T A;  4YJ3 E;  3RRW A;  1WRD A;  2DWG A;  1S35 A;  3EVY A;  2ES0 A;  2E9X A;  4DND A;  5AQL B;  2XQ3 A;  1IAP A;  4KBM B;  4HE8 A;  3H3A A;  4TV9 E;  3PDY A;  4X1I E;  3T8O A;  1XMQ T;  3RC8 A;  1UGO A;  2D9D A;  2DI4 A;  4QWN B;  2JQ9 A;  2LSY A;  1WCR A;  3Q9D A;  3ZSS A;  2ZMA A;  3GA8 A;  4HFD A;  2H7O A;  2JPF A;  2XQ9 A;  4LFC T;  1YKH B;  4I0U A;  4JEH B;  2D0T A;  3U3I A;  4TNW A;  4ZZC A;  4X1K E;  4DV2 T;  4QKN A;  2IHR 1;  3O1H A;  1ZV4 X;  4HWD A;  3VRB A;  2NTY A;  5LB7 B;  2UUB T;  3AA0 B;  2WB5 A;  5DJQ C;  3LJC A;  3O4X E;  4HFH A;  1UUR A;  4HN9 A;  2XAQ B;  4IE5 A;  1FMW A;  4Z91 A;  4DMV A;  3PUW F;  4IL4 A;  3X1D A;  2C5J A;  3ZMV B;  3AA6 B;  1BR4 A;  5AQM B;  5FY7 A;  2VVS A;  2XQA A;  3FBZ A;  2LOP A;  3C4Z A;  3S4U A;  2KZ7 B;  2EHO D;  2K48 A;  2LJL A;  4X20 E;  5HWY A;  4DR2 T;  2ODU A;  2YDQ A;  3NBX X;  3FZK B;  3MZK B;  2JIW A;  1HCI A;  2N9D A;  2CLY B;  4PJJ A;  2WWU A;  3VHL A;  2XAH B;  5BMV E;  4DV5 T;  2X66 A;  2WSS V;  5AQN B;  2V7M A;  3CQG B;  4IGU A;  1SE7 A;  4HGA A;  2LM2 A;  2QGS A;  4PFP A;  2MBG A;  4EZ4 A;  2IML A;  2LOS A;  2KND A;  2E9X B;  2Q9Q A;  2XAF B;  3MJX A;  3ETV A;  4JV5 T;  4IDQ A;  3KV4 A;  2X9Y A;  3QC9 A;  1VRB A;  4U31 A;  1D1B A;  4LF8 T;  2LHR A;  2WCA A;  3AED A;  1D1A A;  4NUV A;  1Z8U A;  2KSR A;  2Q9Q B;  3R84 B;  4ADZ A;  3EDV A;  2LSG A;  3MAC A;  4UEM A;  2BG9 C;  3IEE A;  1MND A;  3AE8 A;  4IE0 A;  1IBM T;  2L3L A;  2C5K T;  2BVM A;  3DJB A;  2G0U A;  2XQY A;  4L0R A;  1WYC A;  5HXC A;  2V6Y B;  2C5I T;  4WNK A;  4LFB T;  2E8I A;  3IA3 A;  1OED E;  4HWH A;  2KWI B;  1US7 B;  2VUR A;  5J2T E;  4F6R C;  2CXL A;  2E2A A;  5LCY A;  2LSJ A;  2RA1 A;  4CI1 B;  2V7I A;  1D0Y A;  3LDQ B;  3ZJ1 A;  2FJE A;  4HFI A;  4PW8 A;  2ACX A;  1T8B A;  3ABV A;  3C51 A;  4QXC B;  1X79 A;  3VR8 A;  2A3D A;  2ZM2 A;  4UF0 B;  4CN1 A;  5LJM A;  2XQ6 A;  4OHF A;  2DCF A;  3E22 E;  3AEG A;  4I50 E;  5EK3 A;  4X62 T;  4LF4 T;  2XQ7 A;  4AKI A;  2WP9 A;  3FXD B;  3P4S A;  3PV0 F;  4PFO A;  3UU3 A;  2CXD A;  4CQI A;  4WZX A;  2HN1 A;  2I6H A;  2BG9 B;  2D2S A;  2NW9 A;  3ZT7 A;  5LG3 A;  5L3C B;  5AQJ B;  3EI0 A;  3KFW X;  4A97 A;  4O2B E;  3PUV F;  3SFD A;  5LXT E;  3NRY A;  2BG9 A;  4TWF A;  2CBJ A;  5AQP B;  3H37 A;  2BS3 A;  2FJB A;  2CHO A;  4DR4 T;  5LMU T;  4FJO A;  3ZT6 A;  3FXE B;  4DR1 T;  2LT3 A;  3PUA A;  3N2G E;  2FUP A;  2K5B B;  3A5X A;  2UXD T;  2WDR A;  2YU1 A;  4KHZ F;  1J5E T;  4ERR A;  1XDO A;  3FBL A;  2HPL A;  3PU3 A;  1XNQ T;  2XPK A;  3KVB A;  5JH7 E;  1FEW A;  2CBI A;  2L8K A;  4QXB B;  1IBK T;  5AQH B;  4G63 A;  4AQG A;  5HWX A;  3J7Y q;  2PTF A;  1NWM X;  3KIN B;  2CMR A;  5LMN T;  1YKE B;  1JNZ A;  3ZYM A;  3SFE A;  2BVL A;  2DL1 A;  3RI5 A;  5LGT B;  2QA7 A;  4JI3 T;  3EUH A;  3P4R A;  3K3O A;  5LP6 E;  3P4P A;  4LF9 T;  3QB5 K;  4JEU B;  2X51 A;  4EOZ B;  3ZEF B;  3V5S A;  5L3F B;  5L3G B;  4JI7 T;  1MMD A;  3E08 A;  3KVA A;  2WMN A;  1UCU A;  3FZH B;  1S94 A;  2YIN A;  3N9N A;  3RF1 A;  2UXN B;  2YU2 A;  3HKE E;  3MKD A;  5IYZ E;  3LG7 A;  5L3D B;  4B3R T;  2W61 A;  3CPZ A;  2X9W A;  3LK2 B;  3A8Y C;  2VWA A;  4TWD A;  1H7C A;  3K1S A;  5KMG P;  3PUR A;  3VKH A;  2KXP B;  1HTJ F;  4B6X A;  2GK9 A;  4EIW A;  1KF6 A;  2NW7 A;  2CWY A;  3PU8 A;  1BR0 A;  2ODV A;  3I9Y A;  3N2O A;  4DID B;  4V1A v;  1W9R A;  5C8Y E;  3AAI A;  3UQ7 A;  4YSZ A;  4WYV A;  4BAY B;  5DAB A;  2CEA A;  4EEB A;  4H9R C;  2WS3 A;  2V7L A;  4NIQ A;  5J1G A;  2IW5 B;  3B13 A;  2WM9 A;  3VKG A;  2E9X C;  2N1G A;  2IC6 A;  2VKJ A;  3RQU A;  4ISS A;  2LHN A;  4MAL A;  2I0M A;  3EAB A;  3P8C D;  2XSB A;  3RC3 A;  1EZ3 A;  5C3J A;  2M6B A;  4ZI3 C;  4CXW A;  4CN4 A;  3WAK A;  3KV6 A;  5EK2 A;  2MYS A;  5A1L A;  4LML A;  4A56 A;  5LGN B;  5IUX A;  4PK6 A;  1G8X A;  5CB4 E;  5LA6 E;  4LF5 T;  1MNE A;  2VL8 A;  3C98 B;  2JJ9 A;  3TLU A;  4MFR A;  3UU4 A;  4CXX A;  4DR6 T;  2WDQ A;  3ZYK A;  3D0T A;  2KLQ A;  2X9X A;  4TZ4 C;  3MXZ A;  2WWV A;  3SS1 A;  2VKD A;  5HEH A;  2KIN B;  2B76 A;  2CE7 A;  3UUB A;  4KUM B;  5FL1 A;  4EYY R;  1L0V A;  3Q5W A;  2FJD A;  5HXE A;  3OKQ A;  2DHR A;  3JAF A;  3QNU A;  2ZM0 A;  1YW0 A;  1U4Q A;  1WFD A;  2JMH A;  3GN5 A;  1WLX A;  5GON E;  4L9I A;  1KK7 A;  2KMF A;  2DWK A;  4WW0 A;  1N33 T;  4KMC A;  2V26 A;  4LF6 T;  4H9S E;  4KI0 F;  3ANW A;  4AQF A;  2RPA A;  4JYA T;  2X0H A;  5F3J A;  2J1D G;  2P9B A;  3EDU A;  3JC6 C;  2XSA A;  4IST A;  4AIU A;  1N34 T;  2XQ8 A;  3AVS A;  3HL6 A;  2DNX A;  5AQU B;  3RGL A;  3JAD A;  3PUX F;  3QUJ A;  3UT5 E;  3CQC B;  5JRC B;  3CWZ B;  4JI2 T;  4DBR A;  4B3M T;  4NXM T;  4IDP A;  3RKG A;  4O2A E;  4P0B A;  4NXN T; 
#chains in the Genus database with same CATH homology
 1U5P A;  5KDM C;  4U74 A;  2KWH A;  3GWH A;  4HTE A;  4UV9 B;  3F2E A;  4GYS A;  1Z0P A;  4EZH A;  4WBO A;  5F8P A;  2LSI A;  2EHO C;  2WMO A;  4L5G A;  4O8S A;  4WBN E;  4YFS A;  3RH3 A;  3DTO A;  4UVC B;  5FXX A;  4UXN B;  2CWO A;  4MBQ A;  4YLH A;  4I43 B;  3GN5 B;  1BR1 A;  2N2N A;  3HKB E;  3IHR A;  4PJL A;  2XAG B;  4UV8 B;  4ASK A;  3SRZ A;  5TAO A;  4DBQ A;  4PK4 A;  4J2C A;  1HFA A;  1MIW A;  1D0Z A;  4EAH A;  4CI2 B;  3TKL B;  3HKD E;  1HS7 A;  3LK4 2;  5HXS A;  4ANJ A;  2H3R A;  5LYJ E;  2LM9 A;  2V1D B;  2XAS B;  5FXW A;  4XBF B;  2V7K A;  4GK0 E;  5DQW A;  3ZMU B;  2NW8 A;  3IF8 B;  4EB6 E;  2NOX A;  1QUU A;  1NAF A;  2A72 A;  5HXR A;  2A2F X;  3ZCI A;  2LE8 A;  2JMK A;  2UXX B;  2YEV C;  3RX6 A;  1OXZ A;  4UIG A;  3ZLI A;  3ZN0 B;  2NTX A;  4QX7 B;  4TUY E;  5FNV E;  4TX5 A;  4CI3 B;  4DVD A;  5LNK A;  2W00 A;  3NZP A;  1UX5 A;  5JQG E;  4JLE A;  1LRZ A;  3K3Q C;  3RYC E;  1WYB A;  1KNZ A;  2BDE A;  1SHZ C;  1BR2 A;  3PUQ A;  3FB2 A;  5DQV A;  3KBT A;  5LBQ B;  3SWH A;  4C90 A;  3R6N A;  3ANW B;  2VKO A;  2BZB A;  2B1E A;  4AKL A;  3HA4 A;  1IJ6 A;  4AI6 A;  3W15 B;  3ZMT B;  5JRC A;  1D0X A;  3UUN A;  3K8P C;  2E9X D;  2JRK A;  5FXZ A;  5JDM A;  5JDH A;  4QX8 B;  2V7J A;  3CKD A;  4EYU A;  4YHJ A;  4Z8X A;  3Q5X A;  3KV5 A;  4IE7 A;  2LSK A;  2SPC A;  4PAG A;  2IAK A;  4G2A A;  2M67 A;  2K9A A;  3ETU A;  4NUU A;  3AAA B;  4ZI3 D;  3J9X 1;  2RP4 A;  1ZEE A;  2PG8 A;  3DP7 A;  5FXV A;  2X68 A;  2CCQ A;  3E0Z A;  4DO0 A;  4XAX B;  3RYH E;  5AFU L;  3CVR A;  4ZS2 A;  2L9Q A;  4FI5 A;  1CUN A;  1G73 A;  3N2K E;  2Y48 B;  2H7V C;  2XHE B;  3B57 A;  4E7S A;  3C4X A;  3I1A A;  4O4I E;  2HPJ A;  3ZMZ B;  3MA9 A;  5H6R B;  4H63 V;  3C4W A;  1V9D A;  2Y6X A;  3AAE B;  3ZJ2 A;  3IBP A;  4QXH B;  3L3P A;  5ADX L;  5L3B B;  4H9N C;  4PJM A;  5LGU B;  2CA5 A;  1HG5 A;  2K24 A;  2YK0 A;  2ZM8 A;  1LKX A;  3PE0 A;  3LFM A;  4I55 E;  4JUY A;  4DMW A;  5JDN A;  3OYX A;  4CXY A;  1ZKE A;  4U72 A;  4PJN A;  3BQK A;  4BJM A;  4ZI2 C;  3P7I A;  5JDG A;  4K0U A;  3L09 A;  3RPU A;  3M65 A;  4P0A A;  4QHO A;  5FY1 A;  3ZPO A;  2W63 A;  1AJ3 A;  3N9M A;  4PNI A;  3VU7 H;  5E0O A;  2NP9 A;  4IHJ E;  4MHC A;  4ZS3 A;  4OYJ A;  3I0Q A;  1FIO A;  4O4J E;  4O4L E;  3NRX A;  4PK5 A;  1FMV A;  4ILU A;  4M1P A;  2D5U A;  4IIJ E;  4IE4 A;  3O9X A;  3AVR A;  3O1J A;  5L2L A;  4AKG A;  1VOM A;  3I9W A;  3HKC E;  4TN7 B;  4N78 D;  3OJA A;  1Y64 B;  1MIV A;  3ZCJ A;  5CA0 E;  5LHG B;  4X1Y E;  3UUM A;  5JR9 A;  3PUS A;  3CX7 B;  4H9P C;  2VAS A;  4GOU A;  3C50 A;  1D1C A;  4GK5 E;  2WBL A;  4AQF C;  2X9H A;  3CX6 B;  3KDS E;  4UVB B;  3QK6 A;  5KX5 E;  3FHN A;  3AA1 B;  2CM0 A;  3N9O A;  5LHI B;  2VK9 A;  4H9O C;  4ZI7 E;  5FMN A;  5LJN A;  2Y8D A;  2W0G A;  2WAU A;  3UFE A;  5J2U E;  4O4H E;  5IHY A;  2DLR A;  1IZN B;  4MLK A;  5JDF A;  2X67 A;  4H63 H;  1HX8 A;  3Q2M A;  5EZY E;  2VB6 A;  2Z6E A;  3BK9 A;  4OK0 A;  4HKA A;  4BA9 A;  3GMI A;  1OWA A;  2IC9 A;  5ETW A;  4ZHQ E;  3OBV E;  1HG2 A;  4OFZ A;  4UEL A;  3RYI E;  2HH7 A;  4EXT A;  1MMG A;  4TV8 E;  1IJ5 A;  1WR6 A;  1SA0 E;  3ZC1 A;  4AXP A;  3WAJ A;  3ZC0 A;  1LVF A;  4H9Q C;  3KBU A;  4I4T E;  2XUE A;  4AKR B;  3BQL A;  4ZI2 D;  4GIW A;  4OYK A;  3OYZ A;  1LVK A;  3RRC A;  4GYR A;  2JQQ A;  3U78 A;  3ZN1 B;  5LHH B;  4C91 A;  4IDZ A;  5LG4 A;  3LBX B;  3AA7 B;  3SOL A;  3WI3 A;  3CX8 B;  2OA5 A;  2EHO B;  3I0O A;  2I59 A;  2CXF A;  3ZYL A;  2Q9Q C;  2KT9 A;  3N9Q A;  3LBX A;  1ZHC A;  1MMN A;  3PTR B;  3UUX B;  5LBM A;  5HXH A;  5L3E B;  2W62 A;  5FP3 A;  3HI2 A;  4HEA A;  5M4Y A;  5CA1 E;  3C64 A;  3LK3 B;  3F57 A;  3AB3 B;  2XTL A;  2PBI A;  2VKH A;  3CQX C;  3ZMS B;  5JR9 C;  1O3X A;  5JDQ A;  3CML A;  5JR9 B;  2CLY C;  3ESL A;  3MK7 C;  2PJQ A;  1HF8 A;  3HR0 A;  2Q9Q D;  1T98 A;  5JVD E;  4BJN A;  4ZOL E;  3UTK A;  4E7Z A;  2D0U A;  4KP3 C;  5FY0 A;  5H6Q B;  3K3N A;  5JRE A;  3KV9 A;  4IE6 A;  2MOZ A;  3N9P A;  5FYM A;  1MMA A;  4HFV A;  5HYA A;  2C0S A;  4UVA B;  5LOV E;  3JC6 D;  2X0L B;  3ONX A;  2EHO A;  3RYF E;  3O1I A;  4CZZ B;  3UUL A;  3RKO A;  2MTQ A;  5HAX A;  4AKH A;  4YJ2 E;  2XAJ B;  5EK4 A;  1MIY A;  1UX4 A;  4UF0 A;  3BQI A;  4XZC A;  3N5L A;  1YD8 G;  4P09 A;  2LEH A;  1E1H B;  3NZQ A;  1QSD A;  2PFV A;  2ZLY A;  3PUG A;  3V5U A;  3N9L A;  3F31 A;  2NWB A;  1B7T A;  4YJ3 E;  3RRW A;  1WRD A;  2DWG A;  1S35 A;  3EVY A;  2ES0 A;  2E9X A;  4DND A;  1IAP A;  4KBM B;  4HE8 A;  3H3A A;  4TV9 E;  3PDY A;  4X1I E;  3T8O A;  3RC8 A;  2DI4 A;  4QWN B;  2LSY A;  3Q9D A;  2ZMA A;  3GA8 A;  2H7O A;  2JPF A;  1YKH B;  4JEH B;  2D0T A;  3U3I A;  4X1K E;  4QKN A;  3O1H A;  1ZV4 X;  2NTY A;  3AA0 B;  5DJQ C;  3LJC A;  3O4X E;  4HN9 A;  4IE5 A;  2XAQ B;  1FMW A;  4DMV A;  2C5J A;  3ZMV B;  3AA6 B;  1BR4 A;  5FY7 A;  3S4U A;  3FBZ A;  2LOP A;  3C4Z A;  2KZ7 B;  2EHO D;  2K48 A;  2LJL A;  4X20 E;  5HWY A;  2ODU A;  3NBX X;  3MZK B;  4PJJ A;  1HCI A;  2N9D A;  2CLY B;  3VHL A;  2WWU A;  5BMV E;  2XAH B;  2X66 A;  2WSS V;  2V7M A;  3CQG B;  4IGU A;  4HGA A;  4PFP A;  2QGS A;  2MBG A;  4EZ4 A;  3MJX A;  2LOS A;  2KND A;  2E9X B;  2Q9Q A;  2XAF B;  3ETV A;  3KV4 A;  2X9Y A;  3QC9 A;  1VRB A;  1D1B A;  2LHR A;  1D1A A;  4NUV A;  2Q9Q B;  3R84 B;  4ADZ A;  3EDV A;  2LSG A;  3MAC A;  4UEM A;  3IEE A;  1MND A;  4IE0 A;  2L3L A;  3DJB A;  2C5K T;  2BVM A;  2XQY A;  2G0U A;  4L0R A;  1WYC A;  5HXC A;  2C5I T;  4WNK A;  2E8I A;  2KWI B;  1US7 B;  5J2T E;  4F6R C;  2CXL A;  5LCY A;  2LSJ A;  2RA1 A;  4CI1 B;  2V7I A;  1D0Y A;  3ZJ1 A;  4PW8 A;  2ACX A;  3C51 A;  4QXC B;  1X79 A;  2A3D A;  2ZM2 A;  4UF0 B;  5LJM A;  4OHF A;  2DCF A;  3E22 E;  4I50 E;  5EK3 A;  4AKI A;  3FXD B;  4PFO A;  2CXD A;  4CQI A;  2NW9 A;  2D2S A;  5L3C B;  3KFW X;  4O2B E;  5LXT E;  3NRY A;  3H37 A;  4FJO A;  3FXE B;  2LT3 A;  3PUA A;  3N2G E;  2K5B B;  3A5X A;  2YU1 A;  4ERR A;  3FBL A;  2HPL A;  3PU3 A;  3KVB A;  5JH7 E;  1FEW A;  2L8K A;  4QXB B;  4G63 A;  4AQG A;  5HWX A;  3J7Y q;  1NWM X;  3KIN B;  2CMR A;  1YKE B;  3ZYM A;  2BVL A;  5LGT B;  2QA7 A;  3EUH A;  3K3O A;  5LP6 E;  4JEU B;  2X51 A;  4EOZ B;  3ZEF B;  3V5S A;  5L3F B;  1MMD A;  3E08 A;  3KVA A;  2WMN A;  1UCU A;  3N9N A;  1S94 A;  2YIN A;  5L3D B;  2UXN B;  2YU2 A;  3HKE E;  3MKD A;  5IYZ E;  3LG7 A;  2W61 A;  3CPZ A;  2X9W A;  3LK2 B;  2VWA A;  1H7C A;  5KMG P;  3PUR A;  3VKH A;  2KXP B;  1HTJ F;  4B6X A;  2GK9 A;  4EIW A;  2CWY A;  2NW7 A;  3PU8 A;  1BR0 A;  2ODV A;  3I9Y A;  3N2O A;  5C8Y E;  4V1A v;  3AAI A;  4BAY B;  5L3G B;  5DAB A;  2CEA A;  4H9R C;  2V7L A;  5J1G A;  2IW5 B;  3B13 A;  2WM9 A;  3VKG A;  2E9X C;  2N1G A;  2IC6 A;  2VKJ A;  4ISS A;  2LHN A;  4MAL A;  3P8C D;  3RC3 A;  5JDL A;  1EZ3 A;  4ZI3 C;  4CXW A;  3WAK A;  3KV6 A;  5EK2 A;  2MYS A;  5A1L A;  4A56 A;  5LGN B;  4PK6 A;  1G8X A;  5CB4 E;  5LA6 E;  1MNE A;  2VL8 A;  3C98 B;  2JJ9 A;  4MFR A;  4CXX A;  3ZYK A;  3D0T A;  2KLQ A;  2X9X A;  4TZ4 C;  3MXZ A;  3SS1 A;  2VKD A;  2KIN B;  2CE7 A;  4KUM B;  4EYY R;  3Q5W A;  5HXE A;  3OKQ A;  2DHR A;  2ZM0 A;  1YW0 A;  1U4Q A;  3GN5 A;  2JMH A;  1WLX A;  5GON E;  4L9I A;  1KK7 A;  2KMF A;  2DWK A;  4WW0 A;  4KMC A;  2V26 A;  4H9S E;  3ANW A;  4AQF A;  5F3J A;  2J1D G;  2P9B A;  3EDU A;  3JC6 C;  4IST A;  3AVS A;  3HL6 A;  3UT5 E;  2DNX A;  5JRC B;  3QUJ A;  3CQC B;  3CWZ B;  4DBR A;  4O2A E;  4P0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...