1H7IA

Apolipoprotein e3 22kd fragment lys146gln mutant
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
140
structure length
140
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRQRLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E
publication title Apolipoprotein E3 22Kd Fragment Lys146Gln Mutant
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 66
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2001-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1h7iA00
1H7IA 1NFNA 1EQ1A 1B68A 1EA8A 1OR2A 3S84A 1YA9A 1AEPA 3R2PA 1GS9A 1NFOA 1LE4A 2KC3A 1LS4A 1BZ4A 1LPEA 1LE2A 1OR3A
chains in the Genus database with same CATH superfamily
2Q9BA 2WL8A 3SNHA 2PX3A 3U3FA 4U5BE 1NFNA 2G3VA 2HKVA 1QZXA 2XLMA 2P0NA 4JRZA 4CX9A 5DS5A 1NU9C 2VC9A 2XM0A 4IWBA 4N6CA 4RBNA 2CDQA 2ZD9A 2VCCA 4RDAA 3N0TA 3RQEA 3QZCA 4XEKA 2Q7RA 4EKWA 3POVA 2VH3A 3DI5A 2G62A 1Q0FA 3BEHA 1J8MF 2TMVP 3WG7C 2AP3A 3TULA 4OD4A 1M57C 3DZAA 2EPKX 3JZ0A 1AVOB 3K1IA 4G7OF 2ASRA 4IAQA 5EHHA 2A69F 2A6HF 2IM8A 1VTMP 5KYXB 5D91A 3DKAA 3AG3C 4QDLA 2OU6A 1LI7A 2QE9A 1Y6DA 2VB6A 2XLOA 4DRHB 2V3CC 2R25A 3N2ZB 4DVZA 1ORJA 1PV3A 4IJJA 3DXJF 2Q3TA 2E87A 4J7YA 2R7TA 4I44A 3QMKA 4U5HA 2OKUA 1Q0GA 2D5RB 5KYXA 3FXHA 1N1CA 1YYXA 3C8GB 4IB4A 2BE5F 5B1BC 1C02A 3CZ6A 3W4YA 2J9VA 5BQHA 1YDIA 3ZIBA 4G0HA 3PDMP 3SYNA 1F1MA 2WVNA 2WZLA 2RSEB 2DYRC 3M79A 4PJJA 4AX2A 1K05A 4I1MA 2IYLD 5EGYA 2J8WA 5A6BD 3HKKA 4W8PA 4N4WA 3B29A 3CQZA 1VOMA 2FAPB 3QW1A 5AGFA 256BA 2FGYA 1H6GA 1HY5A 1A0BA 3C8GA 3WAQA 2VASA 2C04A 2L9JA 3KKBA 3LLIA 4DJ9A 3EGDB 3BRJA 3M1CB 2R03A 1LI5A 4NTAA 1M2VB 5COGA 3JYHA 3DJUB 4G7ZF 1E84A 4OIPF 1D1CA 4JEBA 4OINF 3B0VC 2KQ9A 5F28E 4EBKA 2XL6A 2ICWG 2LFFA 3NKEA 4E18A 5GPGB 2DYSC 4BEJA 1VMAA 5JUAA 2YL7A 4A2NB 2A1DD 3DAFA 1TQGA 2XLEA 2HV6A 1TFKB 3EHMA 3PMRA 4K0DA 1OCZC 1TWAA 4ER9A 1T9KA 3IHUA 1A7DA 2NUPA 4Q4ZF 1ZHTA 1PCXA 3VF0A 3LEOA 2IXOA 2LCHA 2Y3HA 3UMKA 4D4XA 4KNVA 4YK5A 3FMSA 2WVQA 2ZPAA 1T01A 5E3CA 1O3UA 1BR4A 5AC5A 1U0BB 1XZQA 4CDAA 3EGXB 3HJCA 2V26A 2XLHA 4A4AA 2YRFA 4YWQA 2A0UA 5DS6A 1G5ZA 5CIVA 4CJGA 2B0HA 1M56C 2IXPA 4RD9A 2P6VA 1L7CA 4PJLA 5D92A 4ANJA 1GQAA 4E0IA 2Y3DA 1FMVA 4O79A 3IQTA 4WABA 3KPHA 2JX0A 3EGXA 3LESA 5KYWA 1G4US 2VCBA 2P1AA 2ZXPA 1B68A 3HLZA 3LNRA 1MQVA 4CDVA 2B0JA 1E83A 4XEFA 3W8IA 5B3IA 4IAOA 1WN0A 3K1HA 1RJ9A 1AUEA 1SMYF 2NG1A 2WZGA 4BJTA 2KC3A 4KNWA 2PX0A 3QW0A 4GEHA 4I1OB 1BR2A 3IQCA 2KW3C 3JRMO 5JRAA 4I3MA 1RMVA 5KYUB 3SP1A 3RVYA 2PP4A 1NBBA 2OOCA 2XLWA 4JJFA 4CS9A 1OR3A 2KNHA 2Z15A 3FOOA 3KYIA 3L34A 4FESA 3TD7A 4IARA 3UNGC 3RVZA 3B71A 4U5EE 3V5XA 2EINC 3DE9A 2R9RB 4QI0A 1ZW3A 4JCHA 5L3VA 2J7PA 2W45A 3DM9B 3QTHA 1OKKD 1YZCA 3O6XA 4D4NA 3S0XA 2QLAA 4CS7A 1ZHZA 4MTGA 2L6GA 2LP4A 3QVYA 2DGJA 4M63A 2R05A 4PK4A 1K40A 3GWNA 3ZDLA 5AC4A 1GS9A 2I8BA 3TJ6A 4OIOF 2YL1A 1YZAA 2EPNA 2A6EF 2XM4A 2P61A 3LEVA 4E7SA 5A6AA 2H8AA 2WZFA 3RF3A 3TOLA 2Y3BA 1QVXA 2WB7A 1BR1A 1UG7A 1MMGA 2NSFA 3AJMA 4P9FA 3CAXA 3EFOB 1VYIA 1OW8A 5L0IA 4JTCB 1HE9A 3A9CA 4PFPA 4MW8A 1SR2A 1TKNA 3GANA 1M6TA 4NTFA 1YLMA 3EFOA 4O7GA 2XLDA 4DXWA 3UGOA 4JIOA 3AOUA 4CIPA 3VYWA 4B6IA 4BJ6C 1HW2A 2R7SA 5F5FA 3HNJA 3T6JA 4CS8C 4JC7A 2EIMC 1HMDA 4JURI 4JW1A 3S28A 3L8IA 1MMNA 1OCRC 4YL0A 2MYSA 4IGGA 2PFDA 3Q7LA 4IRUA 2XL8A 4EHPA 3S27A 3C18A 5BQIA 3NMKA 3MYIA 2J9BA 3LS0A 4XTKA 2FFHA 4NC3A 1R4TA 3GORA 3M15A 2OEVA 2CCYA 3NYJA 3W2VA 3RW0A 3G4ZA 2I15A 1NU7D 3M4BA 1WOLA 3DE8A 3A11A 3SXMA 4XPYA 2MWQA 5L0GA 4CSAA 1VLSA 2MHRA 2OEXA 4CIHA 1Z7Qc 3JSZA 3SEOA 4W8KA 2OQMA 2Y69C 1ZHYA 3PHF2 3NYLA 2F22A 4G7HF 1ST6A 2EPLX 5L0JA 1OCOC 4L6RA 1FFTC 1A7VA 3KMIA 3GEEA 4BJ1A 2IOQA 4JVSA 1JPJA 1D0XA 4LDKA 2YLDA 3DWWA 1GGQA 4N06A 1XWJA 3CEXA 3C8ZA 3EJNA 4O6YA 4AL0A 5EK0A 1VYKA 4ONSA 3VAYA 4CS9C 4EBJA 3QVZA 1TWGA 3MFNA 4BJ5A 1A7EA 4JJGA 4XLNF 4C7OB 2XLVA 2J45A 1NSGB 3ZQVA 3U9JA 2D4UA 1A41A 3FVYA 2VCAA 3JCUQ 2QTVA 1MNDA 1UFBA 2YHSA 3EGDA 2Q9AA 2R7QA 1FFHA 2NPUA 1M2VA 1T6IA 4MNDA 4MVUA 3I5QA 1NFOA 3KH2A 2X51A 3U0CA 1WWPA 3B9QA 2OCCC 3B0UX 1Q0KA 3AG4C 2GA0A 2GWWA 5DVWA 1V4AA 2H7OA 3KYJA 4Z9JA 5A6KA 1OKKA 2R7VA 1LIHA 1OW6A 3F47A 3LJBA 2YLGA 2GDCA 3UR3C 2AU5A 2CGEA 2HSQA 4GQHA 2H7BA 4YL3A 3S29A 4KBLA 5JVEA 4YT8A 2QNLA 4YN0B 2ZXRA 3K33A 4JE9A 1ZU4A 1ZW2A 2OG2A 2J9UA 3GODA 3L1MA 4NY3A 4O6MA 4EBBA 1CPQA 3TQOA 3RQFA 2XL4A 3IEEA 2Q4FA 4U5DE 3NYMA 5CI8A 4Z9IA 3O39A 1G4WR 5TJ5E 2NUTB 2UUIA 3SXYA 1RKEB 5KYYB 1SZIA 1TWCA 1YA9A 1TWHA 1I5NA 3FAJA 3EZIA 3LUTB 3OA1A 1D1BA 1FMWA 4NCQA 5DQTA 4E17A 4P6IC 1Z5ZA 2HMQA 1HE1A 2LFDA 3JTLO 2JPUA 1OQCA 4C3BA 2YVKA 5JS5A 3K7DA 3E9VA 1MNEA 4EUKB 3MX3A 1Q0MA 3HNKA 1RKEA 1OW7A 2XS1A 3H65A 2W9YA 4MVSA 4CDYA 3ZTZA 2Q9CA 2NSGA 2M4EA 3K1IC 4MW3A 1LE2A 4O6NA 4XPXA 1NLXA 4JEAA 4U5CE 1VB5A 1SF8A 5T3TA 3LLKA 2J0XA 3W8HA 3G4XA 3U9MA 1GM5A 3W2WA 2IXNA 2CYDA 3C63A 4U5GA 5BUOA 1WASA 2R7UA 5IY5C 4LDRA 5KYUA 1TR2A 5KYNA 5L3QA 3JT1A 3AQBA 1ZU5A 4YT5A 2YZSA 1JMWA 2Q00A 3O55A 1AEPA 4H4KC 4GYTA 4LACB 1Q0DA 3ZSUA 4J7TA 4DBQA 4E7ZA 2PNOA 4MVZA 1E86A 2J0WA 2Y3GA 3U2MA 3ZWIA 4YJWA 4EWCA 3ABMC 2X0CA 2HMZA 3G50A 3US6A 1Z6AA 2LK4A 1MMAA 2RD9A 3L8JA 4J32B 1ZYRF 3GM1A 3ITFA 3OEOA 4JKVA 5F5HA 4C3DA 4PR9A 4CJOA 1YARO 2XRHA 1G8XA 4LLCA 3T6GB 1BDJB 1KNYA 1D0YA 4HFKB 1C03A 2A0BA 5E3AA 4P9TA 2A68F 3ZTMA 3E70C 1ORYA 3V5YA 1T6QA 5A6BA 4XLPF 4JTAB 1I4ZA 3C62A 3AGTA 1WTYA 2LIGA 3VM6A 4BJ5C 4F4BA 2CNWD 2R7XA 1DOVA 2ZXWC 3RQGA 4BEMJ 5B3SC 3U3BA 3ABKC 1Z63A 2YWAA 1M2OA 2HZ8A 4AE4B 1D1AA 5BQGA 2R7OA 4XQ1A 3T9OA 2PF4E 4YT2A 4NQFA 2EIKC 3UGPA 5L0CA 4Q5SF 1FTSA 3DM5A 4DVYP 3NRHA 1LPEA 3MYFA 4MTFA 2EILC 1QSPA 1Y4CA 1QPUA 3T4RA 3C7JA 1YYJA 3Q6NA 5JT4A 1JAFA 1JPNA 5E2QA 4AL1A 2LSEA 3RYLA 3ASNC 3EG9B 1ZHWA 1R5ID 3L0IA 4DOZA 3UMIA 2QY9A 3CSKA 3H2UA 2JD3A 2YEVA 4CBEA 3B0PA 1T6UA 2YQYA 1EA8A 5JLIA 4PACA 1OR2A 1OXBA 1NZEA 1RXQA 3SXZA 4YL1A 1FAPB 3ZC4A 3LNMB 4EIYA 3S90A 3K6BA 5COMA 2EPMX 2L81A 2QUPA 2WVOA 3EG9A 2XSEA 1QLEC 4MS2A 4DRIB 1OCCC 1NG1A 3ATPA 4KI2A 1XZPA 3S84A 2ZXOA 2J7PD 2HUJA 3EHNA 2HJ3A 3JRTA 1IZMA 1J8YF 3NG1A 1TFOB 4C3EA 1MMDA 3NDBB 3X2QC 1T5OA 2BC5A 3K66A 1FNTc 3S9OA 3GEHA 3TK0A 1H9TA 3AQCA 1H7IA 4FX5A 1OXKA 3PCVA 4ULWA 5JP7A 3UMHA 2KJGA 5DLJA 2OJED 3IQ5A 4E0HA 2ETSA 3FAPB 3O10A 4PJNA 1S7ZA 1VK5A 2YL0A 3GEIA 3HTKC 3Q7GA 4R32A 4ZLDA 2AVKA 1JRAA 2J9WA 3FHDA 1ZVZA 2IXMA 3LS1A 2IBFA 3U8PA 1LE4A 1PD1A 4JCZA 2EIJC 4K7BA 2O9XA 5COFA 3TJ5A 1CGNA 4WGZA 4C7OA 1LS4A 1ZZPA 4LERA 1Z23A 2HJMA 1CPRA 3DMDA 1BZ4A 4G78A 4LLEA 4U9DA 3V7OA 4DRJB 5JSLA 5L0HA 1K04A 1LVKA 3WHNA 3AGUA 3U2LA 3OWTA 4OIQF 5DQZA 1E85A 1VLTA 1V74B 2KSFA 3AG2C 4FWVA 2NUPB 4YT4A 2HV7A 2L7AA 2AWYA 2AWCA 3GWLA 3NMJA 5L0FA 2R7WA 3I4UA 1QQ3A 2BL2A 4QI2A 1IW7F 4BJ6A 4NTBA 4K1OA 1JOGA 3H2VA 3AG1C 4MVQA 3NMIA 4CS8A 2C03A 4WJ0A 3GM2A 3DD7A 5B1AC 2H7VC 3EPVA 3ZQYA 1S05A 3ZG1A 1YVIA 4U9EA 4XEVA 4H54A 1DOWA 1LS1A 3EH1A 5KYWB 2CNWA 2HS5A 2HSBA 3DAGA 5T3WA 1W2WA 2NUTA 5T1DB 3HNIA 1O87A 1E2XA 2W4MA 5KYYA 4PFOA 4XWJA 4BPMA 2UUHA 2LD6A 4ZLCA 2L6FA 3LAYA 3SXKA 2J46A 2KGOA 3R7CA 4MVRA 1RJ9B 4Q7CA 3KL4A 1RKCA 3V5ZA 5A69A 2XXAB 2GFHA 3FOPA 4MTOA 1BBHA 4Z9HA 4AK9A 4UDVA 5K0IA 1QKRA 4X0RA 3C8GD 5FZTA 1ZHXA 3IQ6A 2OJQA 1YAUO 3HNLA 2DI3A 3NKDA 3ASOC 3MLGA 1ORSC 3R2PA 2Y39A 4XPWA 3U8VA 3F46A 1U89A 3ABLC 3IPMO 1EI7A 4WGYA 2PBEA 4CSAC 2XXAA 3RKOF 3X1OA 1APCA 3DJNB 4ULVA 1RCPA 2L6HA 2XS8A 3Q6MA 4LDQA 1C17M 2KYHA 4MVOA 3RH3A 4FAPB 2EPOA 1WATA 2W4BA 5E33A 1I4YA 3GM3A 3TOMA 2GAQA 1KU2A 3JSEO 2R02A 4JZAA 4MVMA 4HE8D 1Z3IX 2CW0F 3RIPA 1PD0A 2YLIA 1LKXA 1V54C 2LQGA 3M4CA 3EH2A 4OD5A 1EQ1A 1KTMA 1U6HA 1CGOA 3JYYA 1YJGA 3ZVRA 4HEAJ 1LM3B 3WODF 1YA7O 4PJMA 5FCLA 2HFIA 1FR0A 4JTDB 2R7RA 2G3KA 3FDQA 5A6JA 3VRCA 2DB4A 5DS4A 3ECSA 5CI9A 1HW1A 1V55C 2M64A 2YL3A 1O5HA 1L3PA 3EZHA 1D0ZA 3RFYA 4OIRF 3EQLF 4MQ9F 3SZRA 4N6HA 5HV9A 5HSWA 3N24A 3J06A 2P7VA 4J30B 1SYQA 4KC9A 2YKZA 3T6BA 4HFFB 5L0DA 4U5FE 1HMOA 3I5PA 4BG0A 1CGME 1WGWA 3U5SA 4DBRA 1JR8A 1H9GA 3MBGA 1EKYA 4AE4A 2KK1A
chains in the Genus database with same CATH topology
1H7IA 1NFNA 1EQ1A 1B68A 1EA8A 1OR2A 3S84A 1YA9A 1AEPA 3R2PA 1GS9A 1NFOA 1LE4A 2KC3A 1LS4A 1BZ4A 1LPEA 1LE2A 1OR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7I A;  1NFN A;  1EQ1 A;  1B68 A;  1EA8 A;  1OR2 A;  3S84 A;  1YA9 A;  1AEP A;  3R2P A;  1GS9 A;  1NFO A;  1LE4 A;  2KC3 A;  1LS4 A;  1BZ4 A;  1LPE A;  1LE2 A;  1OR3 A; 
#chains in the Genus database with same CATH topology
 2Q9B A;  2WL8 A;  3SNH A;  2PX3 A;  3U3F A;  4U5B E;  1NFN A;  2G3V A;  2HKV A;  1QZX A;  2XLM A;  2P0N A;  4JRZ A;  4CX9 A;  5DS5 A;  1NU9 C;  2VC9 A;  2XM0 A;  4IWB A;  4N6C A;  4RBN A;  2CDQ A;  2ZD9 A;  2VCC A;  4RDA A;  3N0T A;  3RQE A;  3QZC A;  4XEK A;  2Q7R A;  4EKW A;  3POV A;  2VH3 A;  3DI5 A;  2G62 A;  1Q0F A;  3BEH A;  1J8M F;  2TMV P;  3WG7 C;  2AP3 A;  3TUL A;  4OD4 A;  1M57 C;  3DZA A;  2EPK X;  3JZ0 A;  1AVO B;  3K1I A;  4G7O F;  2ASR A;  4IAQ A;  5EHH A;  2A69 F;  2A6H F;  2IM8 A;  1VTM P;  5KYX B;  5D91 A;  3DKA A;  3AG3 C;  4QDL A;  2OU6 A;  1LI7 A;  2QE9 A;  1Y6D A;  2VB6 A;  2XLO A;  4DRH B;  2V3C C;  2R25 A;  3N2Z B;  4DVZ A;  1ORJ A;  1PV3 A;  4IJJ A;  3DXJ F;  2Q3T A;  2E87 A;  4J7Y A;  2R7T A;  4I44 A;  3QMK A;  4U5H A;  2OKU A;  1Q0G A;  2D5R B;  5KYX A;  3FXH A;  1N1C A;  1YYX A;  3C8G B;  4IB4 A;  2BE5 F;  5B1B C;  1C02 A;  3CZ6 A;  3W4Y A;  2J9V A;  5BQH A;  1YDI A;  3ZIB A;  4G0H A;  3PDM P;  3SYN A;  1F1M A;  2WVN A;  2WZL A;  2RSE B;  2DYR C;  3M79 A;  4PJJ A;  4AX2 A;  1K05 A;  4I1M A;  2IYL D;  5EGY A;  2J8W A;  5A6B D;  3HKK A;  4W8P A;  4N4W A;  3B29 A;  3CQZ A;  1VOM A;  2FAP B;  3QW1 A;  5AGF A;  256B A;  2FGY A;  1H6G A;  1HY5 A;  1A0B A;  3C8G A;  3WAQ A;  2VAS A;  2C04 A;  2L9J A;  3KKB A;  3LLI A;  4DJ9 A;  3EGD B;  3BRJ A;  3M1C B;  2R03 A;  1LI5 A;  4NTA A;  1M2V B;  5COG A;  3JYH A;  3DJU B;  4G7Z F;  1E84 A;  4OIP F;  1D1C A;  4JEB A;  4OIN F;  3B0V C;  2KQ9 A;  5F28 E;  4EBK A;  2XL6 A;  2ICW G;  2LFF A;  3NKE A;  4E18 A;  5GPG B;  2DYS C;  4BEJ A;  1VMA A;  5JUA A;  2YL7 A;  4A2N B;  2A1D D;  3DAF A;  1TQG A;  2XLE A;  2HV6 A;  1TFK B;  3EHM A;  3PMR A;  4K0D A;  1OCZ C;  1TWA A;  4ER9 A;  1T9K A;  3IHU A;  1A7D A;  2NUP A;  4Q4Z F;  1ZHT A;  1PCX A;  3VF0 A;  3LEO A;  2IXO A;  2LCH A;  2Y3H A;  3UMK A;  4D4X A;  4KNV A;  4YK5 A;  3FMS A;  2WVQ A;  2ZPA A;  1T01 A;  5E3C A;  1O3U A;  1BR4 A;  5AC5 A;  1U0B B;  1XZQ A;  4CDA A;  3EGX B;  3HJC A;  2V26 A;  2XLH A;  4A4A A;  2YRF A;  4YWQ A;  2A0U A;  5DS6 A;  1G5Z A;  5CIV A;  4CJG A;  2B0H A;  1M56 C;  2IXP A;  4RD9 A;  2P6V A;  1L7C A;  4PJL A;  5D92 A;  4ANJ A;  1GQA A;  4E0I A;  2Y3D A;  1FMV A;  4O79 A;  3IQT A;  4WAB A;  3KPH A;  2JX0 A;  3EGX A;  3LES A;  5KYW A;  1G4U S;  2VCB A;  2P1A A;  2ZXP A;  1B68 A;  3HLZ A;  3LNR A;  1MQV A;  4CDV A;  2B0J A;  1E83 A;  4XEF A;  3W8I A;  5B3I A;  4IAO A;  1WN0 A;  3K1H A;  1RJ9 A;  1AUE A;  1SMY F;  2NG1 A;  2WZG A;  4BJT A;  2KC3 A;  4KNW A;  2PX0 A;  3QW0 A;  4GEH A;  4I1O B;  1BR2 A;  3IQC A;  2KW3 C;  3JRM O;  5JRA A;  4I3M A;  1RMV A;  5KYU B;  3SP1 A;  3RVY A;  2PP4 A;  1NBB A;  2OOC A;  2XLW A;  4JJF A;  4CS9 A;  1OR3 A;  2KNH A;  2Z15 A;  3FOO A;  3KYI A;  3L34 A;  4FES A;  3TD7 A;  4IAR A;  3UNG C;  3RVZ A;  3B71 A;  4U5E E;  3V5X A;  2EIN C;  3DE9 A;  2R9R B;  4QI0 A;  1ZW3 A;  4JCH A;  5L3V A;  2J7P A;  2W45 A;  3DM9 B;  3QTH A;  1OKK D;  1YZC A;  3O6X A;  4D4N A;  3S0X A;  2QLA A;  4CS7 A;  1ZHZ A;  4MTG A;  2L6G A;  2LP4 A;  3QVY A;  2DGJ A;  4M63 A;  2R05 A;  4PK4 A;  1K40 A;  3GWN A;  3ZDL A;  5AC4 A;  1GS9 A;  2I8B A;  3TJ6 A;  4OIO F;  2YL1 A;  1YZA A;  2EPN A;  2A6E F;  2XM4 A;  2P61 A;  3LEV A;  4E7S A;  5A6A A;  2H8A A;  2WZF A;  3RF3 A;  3TOL A;  2Y3B A;  1QVX A;  2WB7 A;  1BR1 A;  1UG7 A;  1MMG A;  2NSF A;  3AJM A;  4P9F A;  3CAX A;  3EFO B;  1VYI A;  1OW8 A;  5L0I A;  4JTC B;  1HE9 A;  3A9C A;  4PFP A;  4MW8 A;  1SR2 A;  1TKN A;  3GAN A;  1M6T A;  4NTF A;  1YLM A;  3EFO A;  4O7G A;  2XLD A;  4DXW A;  3UGO A;  4JIO A;  3AOU A;  4CIP A;  3VYW A;  4B6I A;  4BJ6 C;  1HW2 A;  2R7S A;  5F5F A;  3HNJ A;  3T6J A;  4CS8 C;  4JC7 A;  2EIM C;  1HMD A;  4JUR I;  4JW1 A;  3S28 A;  3L8I A;  1MMN A;  1OCR C;  4YL0 A;  2MYS A;  4IGG A;  2PFD A;  3Q7L A;  4IRU A;  2XL8 A;  4EHP A;  3S27 A;  3C18 A;  5BQI A;  3NMK A;  3MYI A;  2J9B A;  3LS0 A;  4XTK A;  2FFH A;  4NC3 A;  1R4T A;  3GOR A;  3M15 A;  2OEV A;  2CCY A;  3NYJ A;  3W2V A;  3RW0 A;  3G4Z A;  2I15 A;  1NU7 D;  3M4B A;  1WOL A;  3DE8 A;  3A11 A;  3SXM A;  4XPY A;  2MWQ A;  5L0G A;  4CSA A;  1VLS A;  2MHR A;  2OEX A;  4CIH A;  1Z7Q c;  3JSZ A;  3SEO A;  4W8K A;  2OQM A;  2Y69 C;  1ZHY A;  3PHF 2;  3NYL A;  2F22 A;  4G7H F;  1ST6 A;  2EPL X;  5L0J A;  1OCO C;  4L6R A;  1FFT C;  1A7V A;  3KMI A;  3GEE A;  4BJ1 A;  2IOQ A;  4JVS A;  1JPJ A;  1D0X A;  4LDK A;  2YLD A;  3DWW A;  1GGQ A;  4N06 A;  1XWJ A;  3CEX A;  3C8Z A;  3EJN A;  4O6Y A;  4AL0 A;  5EK0 A;  1VYK A;  4ONS A;  3VAY A;  4CS9 C;  4EBJ A;  3QVZ A;  1TWG A;  3MFN A;  4BJ5 A;  1A7E A;  4JJG A;  4XLN F;  4C7O B;  2XLV A;  2J45 A;  1NSG B;  3ZQV A;  3U9J A;  2D4U A;  1A41 A;  3FVY A;  2VCA A;  3JCU Q;  2QTV A;  1MND A;  1UFB A;  2YHS A;  3EGD A;  2Q9A A;  2R7Q A;  1FFH A;  2NPU A;  1M2V A;  1T6I A;  4MND A;  4MVU A;  3I5Q A;  1NFO A;  3KH2 A;  2X51 A;  3U0C A;  1WWP A;  3B9Q A;  2OCC C;  3B0U X;  1Q0K A;  3AG4 C;  2GA0 A;  2GWW A;  5DVW A;  1V4A A;  2H7O A;  3KYJ A;  4Z9J A;  5A6K A;  1OKK A;  2R7V A;  1LIH A;  1OW6 A;  3F47 A;  3LJB A;  2YLG A;  2GDC A;  3UR3 C;  2AU5 A;  2CGE A;  2HSQ A;  4GQH A;  2H7B A;  4YL3 A;  3S29 A;  4KBL A;  5JVE A;  4YT8 A;  2QNL A;  4YN0 B;  2ZXR A;  3K33 A;  4JE9 A;  1ZU4 A;  1ZW2 A;  2OG2 A;  2J9U A;  3GOD A;  3L1M A;  4NY3 A;  4O6M A;  4EBB A;  1CPQ A;  3TQO A;  3RQF A;  2XL4 A;  3IEE A;  2Q4F A;  4U5D E;  3NYM A;  5CI8 A;  4Z9I A;  3O39 A;  1G4W R;  5TJ5 E;  2NUT B;  2UUI A;  3SXY A;  1RKE B;  5KYY B;  1SZI A;  1TWC A;  1YA9 A;  1TWH A;  1I5N A;  3FAJ A;  3EZI A;  3LUT B;  3OA1 A;  1D1B A;  1FMW A;  4NCQ A;  5DQT A;  4E17 A;  4P6I C;  1Z5Z A;  2HMQ A;  1HE1 A;  2LFD A;  3JTL O;  2JPU A;  1OQC A;  4C3B A;  2YVK A;  5JS5 A;  3K7D A;  3E9V A;  1MNE A;  4EUK B;  3MX3 A;  1Q0M A;  3HNK A;  1RKE A;  1OW7 A;  2XS1 A;  3H65 A;  2W9Y A;  4MVS A;  4CDY A;  3ZTZ A;  2Q9C A;  2NSG A;  2M4E A;  3K1I C;  4MW3 A;  1LE2 A;  4O6N A;  4XPX A;  1NLX A;  4JEA A;  4U5C E;  1VB5 A;  1SF8 A;  5T3T A;  3LLK A;  2J0X A;  3W8H A;  3G4X A;  3U9M A;  1GM5 A;  3W2W A;  2IXN A;  2CYD A;  3C63 A;  4U5G A;  5BUO A;  1WAS A;  2R7U A;  5IY5 C;  4LDR A;  5KYU A;  1TR2 A;  5KYN A;  5L3Q A;  3JT1 A;  3AQB A;  1ZU5 A;  4YT5 A;  2YZS A;  1JMW A;  2Q00 A;  3O55 A;  1AEP A;  4H4K C;  4GYT A;  4LAC B;  1Q0D A;  3ZSU A;  4J7T A;  4DBQ A;  4E7Z A;  2PNO A;  4MVZ A;  1E86 A;  2J0W A;  2Y3G A;  3U2M A;  3ZWI A;  4YJW A;  4EWC A;  3ABM C;  2X0C A;  2HMZ A;  3G50 A;  3US6 A;  1Z6A A;  2LK4 A;  1MMA A;  2RD9 A;  3L8J A;  4J32 B;  1ZYR F;  3GM1 A;  3ITF A;  3OEO A;  4JKV A;  5F5H A;  4C3D A;  4PR9 A;  4CJO A;  1YAR O;  2XRH A;  1G8X A;  4LLC A;  3T6G B;  1BDJ B;  1KNY A;  1D0Y A;  4HFK B;  1C03 A;  2A0B A;  5E3A A;  4P9T A;  2A68 F;  3ZTM A;  3E70 C;  1ORY A;  3V5Y A;  1T6Q A;  5A6B A;  4XLP F;  4JTA B;  1I4Z A;  3C62 A;  3AGT A;  1WTY A;  2LIG A;  3VM6 A;  4BJ5 C;  4F4B A;  2CNW D;  2R7X A;  1DOV A;  2ZXW C;  3RQG A;  4BEM J;  5B3S C;  3U3B A;  3ABK C;  1Z63 A;  2YWA A;  1M2O A;  2HZ8 A;  4AE4 B;  1D1A A;  5BQG A;  2R7O A;  4XQ1 A;  3T9O A;  2PF4 E;  4YT2 A;  4NQF A;  2EIK C;  3UGP A;  5L0C A;  4Q5S F;  1FTS A;  3DM5 A;  4DVY P;  3NRH A;  1LPE A;  3MYF A;  4MTF A;  2EIL C;  1QSP A;  1Y4C A;  1QPU A;  3T4R A;  3C7J A;  1YYJ A;  3Q6N A;  5JT4 A;  1JAF A;  1JPN A;  5E2Q A;  4AL1 A;  2LSE A;  3RYL A;  3ASN C;  3EG9 B;  1ZHW A;  1R5I D;  3L0I A;  4DOZ A;  3UMI A;  2QY9 A;  3CSK A;  3H2U A;  2JD3 A;  2YEV A;  4CBE A;  3B0P A;  1T6U A;  2YQY A;  1EA8 A;  5JLI A;  4PAC A;  1OR2 A;  1OXB A;  1NZE A;  1RXQ A;  3SXZ A;  4YL1 A;  1FAP B;  3ZC4 A;  3LNM B;  4EIY A;  3S90 A;  3K6B A;  5COM A;  2EPM X;  2L81 A;  2QUP A;  2WVO A;  3EG9 A;  2XSE A;  1QLE C;  4MS2 A;  4DRI B;  1OCC C;  1NG1 A;  3ATP A;  4KI2 A;  1XZP A;  3S84 A;  2ZXO A;  2J7P D;  2HUJ A;  3EHN A;  2HJ3 A;  3JRT A;  1IZM A;  1J8Y F;  3NG1 A;  1TFO B;  4C3E A;  1MMD A;  3NDB B;  3X2Q C;  1T5O A;  2BC5 A;  3K66 A;  1FNT c;  3S9O A;  3GEH A;  3TK0 A;  1H9T A;  3AQC A;  1H7I A;  4FX5 A;  1OXK A;  3PCV A;  4ULW A;  5JP7 A;  3UMH A;  2KJG A;  5DLJ A;  2OJE D;  3IQ5 A;  4E0H A;  2ETS A;  3FAP B;  3O10 A;  4PJN A;  1S7Z A;  1VK5 A;  2YL0 A;  3GEI A;  3HTK C;  3Q7G A;  4R32 A;  4ZLD A;  2AVK A;  1JRA A;  2J9W A;  3FHD A;  1ZVZ A;  2IXM A;  3LS1 A;  2IBF A;  3U8P A;  1LE4 A;  1PD1 A;  4JCZ A;  2EIJ C;  4K7B A;  2O9X A;  5COF A;  3TJ5 A;  1CGN A;  4WGZ A;  4C7O A;  1LS4 A;  1ZZP A;  4LER A;  1Z23 A;  2HJM A;  1CPR A;  3DMD A;  1BZ4 A;  4G78 A;  4LLE A;  4U9D A;  3V7O A;  4DRJ B;  5JSL A;  5L0H A;  1K04 A;  1LVK A;  3WHN A;  3AGU A;  3U2L A;  3OWT A;  4OIQ F;  5DQZ A;  1E85 A;  1VLT A;  1V74 B;  2KSF A;  3AG2 C;  4FWV A;  2NUP B;  4YT4 A;  2HV7 A;  2L7A A;  2AWY A;  2AWC A;  3GWL A;  3NMJ A;  5L0F A;  2R7W A;  3I4U A;  1QQ3 A;  2BL2 A;  4QI2 A;  1IW7 F;  4BJ6 A;  4NTB A;  4K1O A;  1JOG A;  3H2V A;  3AG1 C;  4MVQ A;  3NMI A;  4CS8 A;  2C03 A;  4WJ0 A;  3GM2 A;  3DD7 A;  5B1A C;  2H7V C;  3EPV A;  3ZQY A;  1S05 A;  3ZG1 A;  1YVI A;  4U9E A;  4XEV A;  4H54 A;  1DOW A;  1LS1 A;  3EH1 A;  5KYW B;  2CNW A;  2HS5 A;  2HSB A;  3DAG A;  5T3W A;  1W2W A;  2NUT A;  5T1D B;  3HNI A;  1O87 A;  1E2X A;  2W4M A;  5KYY A;  4PFO A;  4XWJ A;  4BPM A;  2UUH A;  2LD6 A;  4ZLC A;  2L6F A;  3LAY A;  3SXK A;  2J46 A;  2KGO A;  3R7C A;  4MVR A;  1RJ9 B;  4Q7C A;  3KL4 A;  1RKC A;  3V5Z A;  5A69 A;  2XXA B;  2GFH A;  3FOP A;  4MTO A;  1BBH A;  4Z9H A;  4AK9 A;  4UDV A;  5K0I A;  1QKR A;  4X0R A;  3C8G D;  5FZT A;  1ZHX A;  3IQ6 A;  2OJQ A;  1YAU O;  3HNL A;  2DI3 A;  3NKD A;  3ASO C;  3MLG A;  1ORS C;  3R2P A;  2Y39 A;  4XPW A;  3U8V A;  3F46 A;  1U89 A;  3ABL C;  3IPM O;  1EI7 A;  4WGY A;  2PBE A;  4CSA C;  2XXA A;  3RKO F;  3X1O A;  1APC A;  3DJN B;  4ULV A;  1RCP A;  2L6H A;  2XS8 A;  3Q6M A;  4LDQ A;  1C17 M;  2KYH A;  4MVO A;  3RH3 A;  4FAP B;  2EPO A;  1WAT A;  2W4B A;  5E33 A;  1I4Y A;  3GM3 A;  3TOM A;  2GAQ A;  1KU2 A;  3JSE O;  2R02 A;  4JZA A;  4MVM A;  4HE8 D;  1Z3I X;  2CW0 F;  3RIP A;  1PD0 A;  2YLI A;  1LKX A;  1V54 C;  2LQG A;  3M4C A;  3EH2 A;  4OD5 A;  1EQ1 A;  1KTM A;  1U6H A;  1CGO A;  3JYY A;  1YJG A;  3ZVR A;  4HEA J;  1LM3 B;  3WOD F;  1YA7 O;  4PJM A;  5FCL A;  2HFI A;  1FR0 A;  4JTD B;  2R7R A;  2G3K A;  3FDQ A;  5A6J A;  3VRC A;  2DB4 A;  5DS4 A;  3ECS A;  5CI9 A;  1HW1 A;  1V55 C;  2M64 A;  2YL3 A;  1O5H A;  1L3P A;  3EZH A;  1D0Z A;  3RFY A;  4OIR F;  3EQL F;  4MQ9 F;  3SZR A;  4N6H A;  5HV9 A;  5HSW A;  3N24 A;  3J06 A;  2P7V A;  4J30 B;  1SYQ A;  4KC9 A;  2YKZ A;  3T6B A;  4HFF B;  5L0D A;  4U5F E;  1HMO A;  3I5P A;  4BG0 A;  1CGM E;  1WGW A;  3U5S A;  4DBR A;  1JR8 A;  1H9G A;  3MBG A;  1EKY A;  4AE4 A;  2KK1 A; 
#chains in the Genus database with same CATH homology
 1H7I A;  1NFN A;  1EQ1 A;  1B68 A;  1EA8 A;  1OR2 A;  3S84 A;  1YA9 A;  1AEP A;  3R2P A;  1GS9 A;  1NFO A;  1LE4 A;  2KC3 A;  1LS4 A;  1BZ4 A;  1LPE A;  1LE2 A;  1OR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...