1H7IA

Apolipoprotein e3 22kd fragment lys146gln mutant
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
140
structure length
140
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRQRLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Apolipoprotein E3 22Kd Fragment Lys146Gln Mutant
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords APOLIPOPROTEIN E
total genus 66
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2001-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1h7iA00
1B68A 1NFOA 3R2PA 1OR3A 1BZ4A 1EQ1A 1H7IA 1LPEA 1LS4A 2KC3A 1YA9A 1AEPA 1LE4A 1GS9A 1LE2A 1NFNA 1OR2A 1EA8A 3S84A
chains in the Genus database with same CATH superfamily
2H7OA 3Q7GA 4BJ1A 2V3CC 1ZHWA 4EKWA 1S7ZA 1DOVA 2ASRA 2KC3A 3O10A 2YLGA 4PACA 1T6UA 1Q0KA 2GFHA 3EJNA 4PJLA 4CS7A 3NDBB 3S9OA 2AU5A 3T6GB 3U8VA 1ZU5A 1ZW2A 1GGQA 1NFNA 3GM1A 2XM4A 3IQTA 2OU6A 4J32B 4IGGA 1Z23A 4MVOA 3O39A 4PK4A 4U9EA 5E2QA 3ZWIA 2XL8A 4YK5A 5JUAA 5L0CA 2ZXWC 256BA 5BQGA 3RH3A 3ZG1A 4OIQF 3BEHA 1T6IA 2J46A 3I5QA 3TJ6A 2ZD9A 1MMAA 4AE4A 5HV9A 1D0ZA 2FGYA 3X1OA 4A2NB 3NKDA 3K1HA 2J0WA 3A11A 3ABMC 4GEHA 3F47A 1M57C 3JT1A 4O6MA 1YDIA 1VYKA 2C03A 2G3KA 1L7CA 3JSEO 4CDYA 3LESA 2R03A 3AOUA 4FWVA 1CGNA 3KKBA 2NUPB 4BEMJ 3UMIA 1ZZPA 3WHNA 1TKNA 2J0XA 2P7VA 2DYRC 1G4WR 1PD0A 1VLSA 3JTLO 1RJ9B 4U5EE 4MQ9F 4YT2A 5L0HA 4BPMA 1T9KA 3C8GA 2YHSA 4AE4B 4PJNA 4DVZA 3RVZA 2NG1A 2W9YA 3M79A 2KNHA 3HKKA 1OCOC 1PD1A 1A0BA 2GAQA 5DS6A 3L8JA 5JT4A 2YL1A 4CDAA 3RQGA 3EQLF 2OKUA 4O79A 4EWCA 2OOCA 1OCZC 2HFIA 4W8KA 1TWGA 4AX2A 4K7BA 3MX3A 1DOWA 2CDQA 1FFHA 4IAQA 4NTFA 5L0JA 4ER9A 2Q9CA 5KYWB 5AC4A 2HJ3A 5BQHA 1D1CA 1TFKB 1D0YA 2WB7A 3B9QA 1PCXA 3LEVA 1EI7A 2LD6A 1U6HA 2XS1A 4J30B 5JSLA 2W45A 4U5CE 4WGYA 3DAGA 1JPNA 3U3FA 1OKKD 2NSFA 2L6HA 5CIVA 1NBBA 3S90A 2KK1A 5F5FA 1J8YF 2ZXOA 3H2UA 1I5NA 4U5FE 3U2MA 1HMDA 2AWCA 2CGEA 4H4KC 4LDRA 5E3AA 3T4RA 5COMA 3HNIA 1ZHYA 2D4UA 1LVKA 1AVOB 1OW7A 2G3VA 1BR2A 1RKCA 1TQGA 3L0IA 1Z6AA 4U9DA 4Q5SF 3DI5A 2YL7A 1M6TA 3EFOA 3RKOF 2G62A 2KGOA 1H9GA 1LS1A 4Z9IA 3SYNA 3T9OA 1EKYA 4OIPF 4MTGA 3VF0A 2IXNA 1FMVA 4JE9A 4NCQA 4JIOA 3KPHA 4Q7CA 3RF3A 3UMHA 4CS8C 3EGXB 1RKEB 4EIYA 2L7AA 3EH2A 3RFYA 3NYMA 4MVQA 2W4MA 3U3BA 1N1CA 1NLXA 5T1DB 3ZTMA 1ZHTA 2XLOA 1Q0MA 2R7TA 3VYWA 4DRJB 1APCA 1H6GA 1QKRA 2ETSA 3ECSA 4IB4A 4NTBA 3ZTZA 3UGOA 1G5ZA 1MMGA 2YLIA 2GWWA 3AQCA 4D4XA 2Q4FA 3BRJA 3NRHA 3M4BA 3DM9B 2Q7RA 4YWQA 1VMAA 3SXZA 3U5SA 3DXJF 4JCHA 3EGXA 4MNDA 3QTHA 1MNDA 4DXWA 4KBLA 1HE1A 1AUEA 5CI8A 5L3QA 1E83A 1HW1A 3MBGA 4XWJA 3SP1A 1ORYA 2PP4A 2HUJA 3EPVA 3DMDA 1OXKA 3DJUB 3L1MA 4XTKA 4R32A 2HMQA 3SXMA 3TOMA 3X2QC 2VB6A 2Y3HA 4P9FA 1FMWA 2Y39A 2XL4A 2QTVA 4OIRF 3RIPA 4MTFA 1H9TA 3ZQVA 3F46A 1NG1A 3TD7A 4AK9A 2PNOA 2A0BA 1JR8A 3U2LA 3SZRA 5JRAA 2I8BA 3B71A 3DD7A 3JRTA 3QMKA 3PDMP 1SR2A 3M15A 1XZPA 4C7OA 2XLMA 3GANA 4HFFB 5AC5A 3LNRA 3QVZA 4GQHA 1HW2A 2CNWD 1O5HA 2V26A 1V54C 1MMDA 2XLDA 3O6XA 5EK0A 3UR3C 3ZDLA 4E0HA 5A6BA 3S27A 3K66A 4G0HA 3V5YA 2A6HF 5KYXA 4NTAA 2J9UA 2KJGA 3CSKA 1YA7O 3EZIA 3OEOA 1OR3A 4J7TA 3FAJA 4YJWA 1RKEA 3FHDA 1ZW3A 2XM0A 2Y3BA 5KYWA 4WGZA 4UDVA 2YQYA 4E0IA 5AGFA 3UMKA 4OD5A 5KYXB 4YT4A 4CBEA 1YYJA 2XLWA 3NYLA 1OW8A 2YZSA 2B0JA 1D0XA 1K40A 4E7ZA 1LPEA 4DJ9A 1U0BB 4YL3A 3MYFA 1ZYRF 2LSEA 4FESA 4XPWA 1V55C 4A4AA 1CGME 4XPYA 4E18A 4C7OB 4YL1A 3KMIA 3LNMB 4PJJA 2X0CA 3GWNA 4RBNA 5JLIA 2WVNA 3IHUA 1V4AA 1QPUA 3EG9A 1ORJA 4XEFA 2DYSC 5A6KA 1RMVA 1C03A 1U89A 1B68A 3RQFA 5IY5C 3T6BA 3AQBA 1I4ZA 3GWLA 3B0UX 2Y3GA 1R5ID 3SXYA 3W2VA 3Q7LA 5TJ5E 5DQZA 2EILC 1A7EA 4ULVA 2EPOA 2NUTA 3LS1A 3V5ZA 1CPRA 2XXAA 3DE9A 2J9WA 2H7BA 1Q0GA 2LFDA 3AG3C 4ANJA 2IXMA 2GDCA 4DRHB 3S29A 3ZIBA 1LM3B 3N2ZB 3MLGA 4ZLDA 3CZ6A 3EZHA 1WWPA 2YL3A 4BEJA 5GPGB 2J7PD 2IM8A 3K33A 5A6JA 4CS9C 3V7OA 1BDJB 3U9MA 2Y3DA 3ZSUA 5FCLA 1EA8A 1WGWA 4JRZA 4CSAC 1Q0FA 2IYLD 3G50A 2VCBA 4XEKA 1QVXA 2XRHA 1JAFA 1MMNA 1GM5A 4CX9A 3A9CA 1LI5A 1F1MA 2EPKX 4OIOF 3NMIA 4H54A 3G4XA 2HV6A 4N06A 3B0VC 1FAPB 3Q6MA 4KC9A 1T5OA 2VC9A 3FXHA 1E84A 4BJTA 3ABKC 2J9BA 2MHRA 3KYIA 3HJCA 4XEVA 1E85A 4I3MA 1FR0A 2F22A 3ITFA 3IQCA 1YAUO 3EH1A 2RSEB 2PFDA 2NUTB 3RVYA 4BJ6A 3VM6A 1VB5A 1G4US 4C3EA 3Q6NA 3B0PA 2PX0A 3EGDB 3EHMA 2R05A 1YZCA 3G4ZA 5E3CA 2P61A 2R02A 4CIPA 2WL8A 1XWJA 3ASNC 2I15A 1JRAA 3LLKA 2VCAA 5KYNA 4JJGA 1LIHA 3M4CA 3UGPA 2W4BA 2AVKA 3U8PA 5KYUA 5KYYB 2PF4E 4MW3A 3CEXA 2LP4A 3E9VA 4JURI 2J45A 4PFOA 1E2XA 4K1OA 3GODA 1IW7F 3AGUA 4HEAJ 4RD9A 5A6AA 3EHNA 3GM3A 4Z9HA 1BR4A 3O55A 4QI0A 2J8WA 3MYIA 5BUOA 4B6IA 4E7SA 2LCHA 2MYSA 2QNLA 4J7YA 2HV7A 2HS5A 1K05A 4U5BE 2BC5A 1EQ1A 4PFPA 3HTKC 3MFNA 4IJJA 3LS0A 1SF8A 4JVSA 2YRFA 3AG2C 1WOLA 1M56C 3HLZA 4CS8A 4D4NA 4EBJA 1W2WA 3PMRA 1RCPA 1BZ4A 2HZ8A 4EUKB 1QQ3A 5B1BC 2Y69C 1WASA 4M63A 2IBFA 3ABLC 4LACB 4JC7A 2EPLX 3TOLA 2OCCC 2OEVA 1M2VA 1IZMA 3N0TA 2Q9AA 3CQZA 1D1AA 2BE5F 2XL6A 4GYTA 3PCVA 3ZQYA 5T3WA 4G7OF 5K0IA 1NU9C 2JX0A 1I4YA 2WZLA 1M2OA 3TK0A 5D92A 3NMJA 1C17M 1LKXA 2XXAB 5DLJA 3JCUQ 3US6A 2ICWG 4Z9JA 2J9VA 3OA1A 3W8IA 2P0NA 4OD4A 4EHPA 3W2WA 1WATA 3IPMO 3JZ0A 3W4YA 4C3BA 4K0DA 4JTCB 5B1AC 3SXKA 2XLEA 4DBQA 3DM5A 3C62A 2WVQA 3H65A 3JRMO 1JOGA 5L0DA 1JPJA 2LK4A 1QSPA 1M2VB 4PJMA 1YLMA 2MWQA 3QW0A 2EINC 2JD3A 1HY5A 2ZXRA 2EPNA 2XS8A 3RW0A 1TFOB 4ZLCA 1VOMA 4O6NA 2CNWA 4KNWA 2IXOA 5A6BD 5HSWA 1KTMA 1SMYF 4XLPF 2QLAA 2OJQA 3S84A 3S28A 5COGA 4JTAB 3S0XA 2YKZA 4I1OB 4WJ0A 1Z7Qc 4JEAA 3QVYA 4YL0A 3TULA 1Q0DA 2L6FA 4RDAA 4JTDB 3LEOA 3K7DA 4IARA 2R7QA 2R7UA 2L6GA 1ZHZA 1ZVZA 2O9XA 2WZFA 4MVZA 4PR9A 4XLNF 3R7CA 4EBBA 3JSZA 3JYYA 3IEEA 3POVA 1SYQA 5E33A 1V74B 1VLTA 3KH2A 4N6CA 3K1IA 2R9RB 4CIHA 1NFOA 3SNHA 3PHF2 3UNGC 2OJED 2Q9BA 1PV3A 2EIMC 1ZHXA 4CJOA 5DS5A 1LE4A 4OINF 2ZXPA 3T6JA 5DQTA 1Y6DA 4DBRA 2EIJC 5EHHA 1YZAA 1ZU4A 4FX5A 3U0CA 4ULWA 4XPXA 4YN0B 1XZQA 3TQOA 2QE9A 3C7JA 3NMKA 5JVEA 4XQ1A 1NU7D 1QLEC 2R7XA 2J7PA 2FAPB 4KI2A 4NY3A 4I44A 3ATPA 3JYHA 1TWHA 2HSBA 1A7VA 1O3UA 3DE8A 1OXBA 4JJFA 1GS9A 3IQ5A 1TR2A 2GA0A 1KU2A 2YL0A 5KYYA 3I5PA 3WG7C 1UG7A 2Z15A 4WABA 3WODF 5L0IA 3HNLA 5A69A 2QUPA 1VYIA 3C8GB 2QY9A 4JCZA 1HE9A 1R4TA 4LDQA 5JS5A 1JMWA 2DI3A 4I1MA 2VCCA 3IQ6A 2A6EF 4MTOA 1C02A 4P6IC 4AL1A 4QI2A 3AG1C 4MS2A 1VK5A 1YJGA 4MVSA 3ASOC 3KYJA 1D1BA 2B0HA 4FAPB 1H7IA 1WN0A 4BJ6C 3C8GD 4LLEA 2PBEA 4NQFA 3FOOA 2IOQA 3U9JA 2LIGA 3C63A 4JKVA 2H7VC 3V5XA 3VAYA 4X0RA 1CGOA 4ONSA 4BG0A 3GORA 3LJBA 2EIKC 2UUIA 1AEPA 2UUHA 4MVRA 5T3TA 2R7OA 1NSGB 2A0UA 3FDQA 4MVUA 3RQEA 2P1AA 5JP7A 1HMOA 3E70C 1RXQA 1T6QA 2LFFA 3TJ5A 3B29A 4HE8D 2YEVA 3M1CB 3NKEA 1LI7A 1S05A 3R2PA 1RJ9A 3AJMA 4IWBA 4AL0A 4C3DA 4DOZA 4DVYP 2XLVA 2H8AA 3FAPB 3EFOB 4LLCA 2A68F 3GEIA 2R7RA 3DKAA 4L6RA 1OCRC 1Y4CA 2VASA 5L3VA 4NC3A 1O87A 1OW6A 2RD9A 3HNJA 1YYXA 1SZIA 4IRUA 5F5HA 5D91A 2EPMX 1MNEA 1QZXA 2M4EA 3FVYA 4BJ5C 2FFHA 4CS9A 5B3IA 5EGYA 1OKKA 3GEEA 3L8IA 3QW1A 4G7HF 2OQMA 4CSAA 4LERA 4U5DE 3VRCA 2R7WA 2ZPAA 3EG9B 5COFA 1TWCA 3N24A 5L0GA 1WTYA 4MVMA 3WAQA 4U5GA 5CI9A 2WZGA 1K04A 2PX3A 4HFKB 1Z5ZA 4N4WA 1T01A 3CAXA 3NG1A 5F28E 1OR2A 2YVKA 3FOPA 1FFTC 2XLHA 3QZCA 2NUPA 4JZAA 5L0FA 1A41A 2OG2A 2HSQA 4Q4ZF 4EBKA 3RYLA 3ZC4A 3K1IC 2P6VA 1L3PA 2R25A 2TMVP 2AP3A 2OEXA 1J8MF 3K6BA 4U5HA 1ORSC 5DVWA 2NPUA 1TWAA 4DRIB 3DZAA 4G78A 2XSEA 2HKVA 2NSGA 1OQCA 4G7ZF 2DB4A 2YLDA 3NYJA 1FTSA 1A7DA 3LLIA 1YA9A 3I4UA 2KYHA 4KNVA 4YT5A 4BJ5A 2R7SA 2CYDA 1E86A 3FMSA 4JW1A 1BBHA 2A1DD 1FNTc 1YVIA 2AWYA 3AGTA 1NZEA 4N6HA 4IAOA 2JPUA 3H2VA 1OCCC 2KSFA 3DAFA 1LE2A 2DGJA 2Q3TA 4CDVA 2Q00A 4QDLA 2A69F 2L81A 4MW8A 3DWWA 2L9JA 1LS4A 2HJMA 3EGDA 3W8HA 2BL2A 5FZTA 4CJGA 2VH3A 3GEHA 1MQVA 2IXPA 2CCYA 2D5RB 3L34A 4O7GA 5DS4A 2M64A 2WVOA 4O6YA 2LQGA 3KL4A 5BQIA 1GQAA 5B3SC 2R7VA 2C04A 1UFBA 3DJNB 4W8PA 4F4BA 3C18A 3LUTB 2X51A 2E87A 4JEBA 3GM2A 2KW3C 3OWTA 1BR1A 5KYUB 1Z63A 4LDKA 4P9TA 1ST6A 2HMZA 1YARO 3SEOA 3J06A 3ZVRA 3LAYA 3AG4C 1CPQA 2KQ9A 1VTMP 1KNYA 2YWAA 4E17A 1G8XA 2CW0F 4YT8A 3C8ZA 3HNKA 1Z3IX
chains in the Genus database with same CATH topology
1B68A 1NFOA 3R2PA 1OR3A 1BZ4A 1EQ1A 1H7IA 1LPEA 1LS4A 2KC3A 1YA9A 1AEPA 1LE4A 1GS9A 1LE2A 1NFNA 1OR2A 1EA8A 3S84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B68 A;  1NFO A;  3R2P A;  1OR3 A;  1BZ4 A;  1EQ1 A;  1H7I A;  1LPE A;  1LS4 A;  2KC3 A;  1YA9 A;  1AEP A;  1LE4 A;  1GS9 A;  1LE2 A;  1NFN A;  1OR2 A;  1EA8 A;  3S84 A; 
#chains in the Genus database with same CATH topology
 2H7O A;  3Q7G A;  4BJ1 A;  2V3C C;  1ZHW A;  4EKW A;  1S7Z A;  1DOV A;  2ASR A;  2KC3 A;  3O10 A;  2YLG A;  4PAC A;  1T6U A;  1Q0K A;  2GFH A;  3EJN A;  4PJL A;  4CS7 A;  3NDB B;  3S9O A;  2AU5 A;  3T6G B;  3U8V A;  1ZU5 A;  1ZW2 A;  1GGQ A;  1NFN A;  3GM1 A;  2XM4 A;  3IQT A;  2OU6 A;  4J32 B;  4IGG A;  1Z23 A;  4MVO A;  3O39 A;  4PK4 A;  4U9E A;  5E2Q A;  3ZWI A;  2XL8 A;  4YK5 A;  5JUA A;  5L0C A;  2ZXW C;  256B A;  5BQG A;  3RH3 A;  3ZG1 A;  4OIQ F;  3BEH A;  1T6I A;  2J46 A;  3I5Q A;  3TJ6 A;  2ZD9 A;  1MMA A;  4AE4 A;  5HV9 A;  1D0Z A;  2FGY A;  3X1O A;  4A2N B;  3NKD A;  3K1H A;  2J0W A;  3A11 A;  3ABM C;  4GEH A;  3F47 A;  1M57 C;  3JT1 A;  4O6M A;  1YDI A;  1VYK A;  2C03 A;  2G3K A;  1L7C A;  3JSE O;  4CDY A;  3LES A;  2R03 A;  3AOU A;  4FWV A;  1CGN A;  3KKB A;  2NUP B;  4BEM J;  3UMI A;  1ZZP A;  3WHN A;  1TKN A;  2J0X A;  2P7V A;  2DYR C;  1G4W R;  1PD0 A;  1VLS A;  3JTL O;  1RJ9 B;  4U5E E;  4MQ9 F;  4YT2 A;  5L0H A;  4BPM A;  1T9K A;  3C8G A;  2YHS A;  4AE4 B;  4PJN A;  4DVZ A;  3RVZ A;  2NG1 A;  2W9Y A;  3M79 A;  2KNH A;  3HKK A;  1OCO C;  1PD1 A;  1A0B A;  2GAQ A;  5DS6 A;  3L8J A;  5JT4 A;  2YL1 A;  4CDA A;  3RQG A;  3EQL F;  2OKU A;  4O79 A;  4EWC A;  2OOC A;  1OCZ C;  2HFI A;  4W8K A;  1TWG A;  4AX2 A;  4K7B A;  3MX3 A;  1DOW A;  2CDQ A;  1FFH A;  4IAQ A;  4NTF A;  5L0J A;  4ER9 A;  2Q9C A;  5KYW B;  5AC4 A;  2HJ3 A;  5BQH A;  1D1C A;  1TFK B;  1D0Y A;  2WB7 A;  3B9Q A;  1PCX A;  3LEV A;  1EI7 A;  2LD6 A;  1U6H A;  2XS1 A;  4J30 B;  5JSL A;  2W45 A;  4U5C E;  4WGY A;  3DAG A;  1JPN A;  3U3F A;  1OKK D;  2NSF A;  2L6H A;  5CIV A;  1NBB A;  3S90 A;  2KK1 A;  5F5F A;  1J8Y F;  2ZXO A;  3H2U A;  1I5N A;  4U5F E;  3U2M A;  1HMD A;  2AWC A;  2CGE A;  4H4K C;  4LDR A;  5E3A A;  3T4R A;  5COM A;  3HNI A;  1ZHY A;  2D4U A;  1LVK A;  1AVO B;  1OW7 A;  2G3V A;  1BR2 A;  1RKC A;  1TQG A;  3L0I A;  1Z6A A;  4U9D A;  4Q5S F;  3DI5 A;  2YL7 A;  1M6T A;  3EFO A;  3RKO F;  2G62 A;  2KGO A;  1H9G A;  1LS1 A;  4Z9I A;  3SYN A;  3T9O A;  1EKY A;  4OIP F;  4MTG A;  3VF0 A;  2IXN A;  1FMV A;  4JE9 A;  4NCQ A;  4JIO A;  3KPH A;  4Q7C A;  3RF3 A;  3UMH A;  4CS8 C;  3EGX B;  1RKE B;  4EIY A;  2L7A A;  3EH2 A;  3RFY A;  3NYM A;  4MVQ A;  2W4M A;  3U3B A;  1N1C A;  1NLX A;  5T1D B;  3ZTM A;  1ZHT A;  2XLO A;  1Q0M A;  2R7T A;  3VYW A;  4DRJ B;  1APC A;  1H6G A;  1QKR A;  2ETS A;  3ECS A;  4IB4 A;  4NTB A;  3ZTZ A;  3UGO A;  1G5Z A;  1MMG A;  2YLI A;  2GWW A;  3AQC A;  4D4X A;  2Q4F A;  3BRJ A;  3NRH A;  3M4B A;  3DM9 B;  2Q7R A;  4YWQ A;  1VMA A;  3SXZ A;  3U5S A;  3DXJ F;  4JCH A;  3EGX A;  4MND A;  3QTH A;  1MND A;  4DXW A;  4KBL A;  1HE1 A;  1AUE A;  5CI8 A;  5L3Q A;  1E83 A;  1HW1 A;  3MBG A;  4XWJ A;  3SP1 A;  1ORY A;  2PP4 A;  2HUJ A;  3EPV A;  3DMD A;  1OXK A;  3DJU B;  3L1M A;  4XTK A;  4R32 A;  2HMQ A;  3SXM A;  3TOM A;  3X2Q C;  2VB6 A;  2Y3H A;  4P9F A;  1FMW A;  2Y39 A;  2XL4 A;  2QTV A;  4OIR F;  3RIP A;  4MTF A;  1H9T A;  3ZQV A;  3F46 A;  1NG1 A;  3TD7 A;  4AK9 A;  2PNO A;  2A0B A;  1JR8 A;  3U2L A;  3SZR A;  5JRA A;  2I8B A;  3B71 A;  3DD7 A;  3JRT A;  3QMK A;  3PDM P;  1SR2 A;  3M15 A;  1XZP A;  4C7O A;  2XLM A;  3GAN A;  4HFF B;  5AC5 A;  3LNR A;  3QVZ A;  4GQH A;  1HW2 A;  2CNW D;  1O5H A;  2V26 A;  1V54 C;  1MMD A;  2XLD A;  3O6X A;  5EK0 A;  3UR3 C;  3ZDL A;  4E0H A;  5A6B A;  3S27 A;  3K66 A;  4G0H A;  3V5Y A;  2A6H F;  5KYX A;  4NTA A;  2J9U A;  2KJG A;  3CSK A;  1YA7 O;  3EZI A;  3OEO A;  1OR3 A;  4J7T A;  3FAJ A;  4YJW A;  1RKE A;  3FHD A;  1ZW3 A;  2XM0 A;  2Y3B A;  5KYW A;  4WGZ A;  4UDV A;  2YQY A;  4E0I A;  5AGF A;  3UMK A;  4OD5 A;  5KYX B;  4YT4 A;  4CBE A;  1YYJ A;  2XLW A;  3NYL A;  1OW8 A;  2YZS A;  2B0J A;  1D0X A;  1K40 A;  4E7Z A;  1LPE A;  4DJ9 A;  1U0B B;  4YL3 A;  3MYF A;  1ZYR F;  2LSE A;  4FES A;  4XPW A;  1V55 C;  4A4A A;  1CGM E;  4XPY A;  4E18 A;  4C7O B;  4YL1 A;  3KMI A;  3LNM B;  4PJJ A;  2X0C A;  3GWN A;  4RBN A;  5JLI A;  2WVN A;  3IHU A;  1V4A A;  1QPU A;  3EG9 A;  1ORJ A;  4XEF A;  2DYS C;  5A6K A;  1RMV A;  1C03 A;  1U89 A;  1B68 A;  3RQF A;  5IY5 C;  3T6B A;  3AQB A;  1I4Z A;  3GWL A;  3B0U X;  2Y3G A;  1R5I D;  3SXY A;  3W2V A;  3Q7L A;  5TJ5 E;  5DQZ A;  2EIL C;  1A7E A;  4ULV A;  2EPO A;  2NUT A;  3LS1 A;  3V5Z A;  1CPR A;  2XXA A;  3DE9 A;  2J9W A;  2H7B A;  1Q0G A;  2LFD A;  3AG3 C;  4ANJ A;  2IXM A;  2GDC A;  4DRH B;  3S29 A;  3ZIB A;  1LM3 B;  3N2Z B;  3MLG A;  4ZLD A;  3CZ6 A;  3EZH A;  1WWP A;  2YL3 A;  4BEJ A;  5GPG B;  2J7P D;  2IM8 A;  3K33 A;  5A6J A;  4CS9 C;  3V7O A;  1BDJ B;  3U9M A;  2Y3D A;  3ZSU A;  5FCL A;  1EA8 A;  1WGW A;  4JRZ A;  4CSA C;  1Q0F A;  2IYL D;  3G50 A;  2VCB A;  4XEK A;  1QVX A;  2XRH A;  1JAF A;  1MMN A;  1GM5 A;  4CX9 A;  3A9C A;  1LI5 A;  1F1M A;  2EPK X;  4OIO F;  3NMI A;  4H54 A;  3G4X A;  2HV6 A;  4N06 A;  3B0V C;  1FAP B;  3Q6M A;  4KC9 A;  1T5O A;  2VC9 A;  3FXH A;  1E84 A;  4BJT A;  3ABK C;  2J9B A;  2MHR A;  3KYI A;  3HJC A;  4XEV A;  1E85 A;  4I3M A;  1FR0 A;  2F22 A;  3ITF A;  3IQC A;  1YAU O;  3EH1 A;  2RSE B;  2PFD A;  2NUT B;  3RVY A;  4BJ6 A;  3VM6 A;  1VB5 A;  1G4U S;  4C3E A;  3Q6N A;  3B0P A;  2PX0 A;  3EGD B;  3EHM A;  2R05 A;  1YZC A;  3G4Z A;  5E3C A;  2P61 A;  2R02 A;  4CIP A;  2WL8 A;  1XWJ A;  3ASN C;  2I15 A;  1JRA A;  3LLK A;  2VCA A;  5KYN A;  4JJG A;  1LIH A;  3M4C A;  3UGP A;  2W4B A;  2AVK A;  3U8P A;  5KYU A;  5KYY B;  2PF4 E;  4MW3 A;  3CEX A;  2LP4 A;  3E9V A;  4JUR I;  2J45 A;  4PFO A;  1E2X A;  4K1O A;  3GOD A;  1IW7 F;  3AGU A;  4HEA J;  4RD9 A;  5A6A A;  3EHN A;  3GM3 A;  4Z9H A;  1BR4 A;  3O55 A;  4QI0 A;  2J8W A;  3MYI A;  5BUO A;  4B6I A;  4E7S A;  2LCH A;  2MYS A;  2QNL A;  4J7Y A;  2HV7 A;  2HS5 A;  1K05 A;  4U5B E;  2BC5 A;  1EQ1 A;  4PFP A;  3HTK C;  3MFN A;  4IJJ A;  3LS0 A;  1SF8 A;  4JVS A;  2YRF A;  3AG2 C;  1WOL A;  1M56 C;  3HLZ A;  4CS8 A;  4D4N A;  4EBJ A;  1W2W A;  3PMR A;  1RCP A;  1BZ4 A;  2HZ8 A;  4EUK B;  1QQ3 A;  5B1B C;  2Y69 C;  1WAS A;  4M63 A;  2IBF A;  3ABL C;  4LAC B;  4JC7 A;  2EPL X;  3TOL A;  2OCC C;  2OEV A;  1M2V A;  1IZM A;  3N0T A;  2Q9A A;  3CQZ A;  1D1A A;  2BE5 F;  2XL6 A;  4GYT A;  3PCV A;  3ZQY A;  5T3W A;  4G7O F;  5K0I A;  1NU9 C;  2JX0 A;  1I4Y A;  2WZL A;  1M2O A;  3TK0 A;  5D92 A;  3NMJ A;  1C17 M;  1LKX A;  2XXA B;  5DLJ A;  3JCU Q;  3US6 A;  2ICW G;  4Z9J A;  2J9V A;  3OA1 A;  3W8I A;  2P0N A;  4OD4 A;  4EHP A;  3W2W A;  1WAT A;  3IPM O;  3JZ0 A;  3W4Y A;  4C3B A;  4K0D A;  4JTC B;  5B1A C;  3SXK A;  2XLE A;  4DBQ A;  3DM5 A;  3C62 A;  2WVQ A;  3H65 A;  3JRM O;  1JOG A;  5L0D A;  1JPJ A;  2LK4 A;  1QSP A;  1M2V B;  4PJM A;  1YLM A;  2MWQ A;  3QW0 A;  2EIN C;  2JD3 A;  1HY5 A;  2ZXR A;  2EPN A;  2XS8 A;  3RW0 A;  1TFO B;  4ZLC A;  1VOM A;  4O6N A;  2CNW A;  4KNW A;  2IXO A;  5A6B D;  5HSW A;  1KTM A;  1SMY F;  4XLP F;  2QLA A;  2OJQ A;  3S84 A;  3S28 A;  5COG A;  4JTA B;  3S0X A;  2YKZ A;  4I1O B;  4WJ0 A;  1Z7Q c;  4JEA A;  3QVY A;  4YL0 A;  3TUL A;  1Q0D A;  2L6F A;  4RDA A;  4JTD B;  3LEO A;  3K7D A;  4IAR A;  2R7Q A;  2R7U A;  2L6G A;  1ZHZ A;  1ZVZ A;  2O9X A;  2WZF A;  4MVZ A;  4PR9 A;  4XLN F;  3R7C A;  4EBB A;  3JSZ A;  3JYY A;  3IEE A;  3POV A;  1SYQ A;  5E33 A;  1V74 B;  1VLT A;  3KH2 A;  4N6C A;  3K1I A;  2R9R B;  4CIH A;  1NFO A;  3SNH A;  3PHF 2;  3UNG C;  2OJE D;  2Q9B A;  1PV3 A;  2EIM C;  1ZHX A;  4CJO A;  5DS5 A;  1LE4 A;  4OIN F;  2ZXP A;  3T6J A;  5DQT A;  1Y6D A;  4DBR A;  2EIJ C;  5EHH A;  1YZA A;  1ZU4 A;  4FX5 A;  3U0C A;  4ULW A;  4XPX A;  4YN0 B;  1XZQ A;  3TQO A;  2QE9 A;  3C7J A;  3NMK A;  5JVE A;  4XQ1 A;  1NU7 D;  1QLE C;  2R7X A;  2J7P A;  2FAP B;  4KI2 A;  4NY3 A;  4I44 A;  3ATP A;  3JYH A;  1TWH A;  2HSB A;  1A7V A;  1O3U A;  3DE8 A;  1OXB A;  4JJF A;  1GS9 A;  3IQ5 A;  1TR2 A;  2GA0 A;  1KU2 A;  2YL0 A;  5KYY A;  3I5P A;  3WG7 C;  1UG7 A;  2Z15 A;  4WAB A;  3WOD F;  5L0I A;  3HNL A;  5A69 A;  2QUP A;  1VYI A;  3C8G B;  2QY9 A;  4JCZ A;  1HE9 A;  1R4T A;  4LDQ A;  5JS5 A;  1JMW A;  2DI3 A;  4I1M A;  2VCC A;  3IQ6 A;  2A6E F;  4MTO A;  1C02 A;  4P6I C;  4AL1 A;  4QI2 A;  3AG1 C;  4MS2 A;  1VK5 A;  1YJG A;  4MVS A;  3ASO C;  3KYJ A;  1D1B A;  2B0H A;  4FAP B;  1H7I A;  1WN0 A;  4BJ6 C;  3C8G D;  4LLE A;  2PBE A;  4NQF A;  3FOO A;  2IOQ A;  3U9J A;  2LIG A;  3C63 A;  4JKV A;  2H7V C;  3V5X A;  3VAY A;  4X0R A;  1CGO A;  4ONS A;  4BG0 A;  3GOR A;  3LJB A;  2EIK C;  2UUI A;  1AEP A;  2UUH A;  4MVR A;  5T3T A;  2R7O A;  1NSG B;  2A0U A;  3FDQ A;  4MVU A;  3RQE A;  2P1A A;  5JP7 A;  1HMO A;  3E70 C;  1RXQ A;  1T6Q A;  2LFF A;  3TJ5 A;  3B29 A;  4HE8 D;  2YEV A;  3M1C B;  3NKE A;  1LI7 A;  1S05 A;  3R2P A;  1RJ9 A;  3AJM A;  4IWB A;  4AL0 A;  4C3D A;  4DOZ A;  4DVY P;  2XLV A;  2H8A A;  3FAP B;  3EFO B;  4LLC A;  2A68 F;  3GEI A;  2R7R A;  3DKA A;  4L6R A;  1OCR C;  1Y4C A;  2VAS A;  5L3V A;  4NC3 A;  1O87 A;  1OW6 A;  2RD9 A;  3HNJ A;  1YYX A;  1SZI A;  4IRU A;  5F5H A;  5D91 A;  2EPM X;  1MNE A;  1QZX A;  2M4E A;  3FVY A;  4BJ5 C;  2FFH A;  4CS9 A;  5B3I A;  5EGY A;  1OKK A;  3GEE A;  3L8I A;  3QW1 A;  4G7H F;  2OQM A;  4CSA A;  4LER A;  4U5D E;  3VRC A;  2R7W A;  2ZPA A;  3EG9 B;  5COF A;  1TWC A;  3N24 A;  5L0G A;  1WTY A;  4MVM A;  3WAQ A;  4U5G A;  5CI9 A;  2WZG A;  1K04 A;  2PX3 A;  4HFK B;  1Z5Z A;  4N4W A;  1T01 A;  3CAX A;  3NG1 A;  5F28 E;  1OR2 A;  2YVK A;  3FOP A;  1FFT C;  2XLH A;  3QZC A;  2NUP A;  4JZA A;  5L0F A;  1A41 A;  2OG2 A;  2HSQ A;  4Q4Z F;  4EBK A;  3RYL A;  3ZC4 A;  3K1I C;  2P6V A;  1L3P A;  2R25 A;  2TMV P;  2AP3 A;  2OEX A;  1J8M F;  3K6B A;  4U5H A;  1ORS C;  5DVW A;  2NPU A;  1TWA A;  4DRI B;  3DZA A;  4G78 A;  2XSE A;  2HKV A;  2NSG A;  1OQC A;  4G7Z F;  2DB4 A;  2YLD A;  3NYJ A;  1FTS A;  1A7D A;  3LLI A;  1YA9 A;  3I4U A;  2KYH A;  4KNV A;  4YT5 A;  4BJ5 A;  2R7S A;  2CYD A;  1E86 A;  3FMS A;  4JW1 A;  1BBH A;  2A1D D;  1FNT c;  1YVI A;  2AWY A;  3AGT A;  1NZE A;  4N6H A;  4IAO A;  2JPU A;  3H2V A;  1OCC C;  2KSF A;  3DAF A;  1LE2 A;  2DGJ A;  2Q3T A;  4CDV A;  2Q00 A;  4QDL A;  2A69 F;  2L81 A;  4MW8 A;  3DWW A;  2L9J A;  1LS4 A;  2HJM A;  3EGD A;  3W8H A;  2BL2 A;  5FZT A;  4CJG A;  2VH3 A;  3GEH A;  1MQV A;  2IXP A;  2CCY A;  2D5R B;  3L34 A;  4O7G A;  5DS4 A;  2M64 A;  2WVO A;  4O6Y A;  2LQG A;  3KL4 A;  5BQI A;  1GQA A;  5B3S C;  2R7V A;  2C04 A;  1UFB A;  3DJN B;  4W8P A;  4F4B A;  3C18 A;  3LUT B;  2X51 A;  2E87 A;  4JEB A;  3GM2 A;  2KW3 C;  3OWT A;  1BR1 A;  5KYU B;  1Z63 A;  4LDK A;  4P9T A;  1ST6 A;  2HMZ A;  1YAR O;  3SEO A;  3J06 A;  3ZVR A;  3LAY A;  3AG4 C;  1CPQ A;  2KQ9 A;  1VTM P;  1KNY A;  2YWA A;  4E17 A;  1G8X A;  2CW0 F;  4YT8 A;  3C8Z A;  3HNK A;  1Z3I X; 
#chains in the Genus database with same CATH homology
 1B68 A;  1NFO A;  3R2P A;  1OR3 A;  1BZ4 A;  1EQ1 A;  1H7I A;  1LPE A;  1LS4 A;  2KC3 A;  1YA9 A;  1AEP A;  1LE4 A;  1GS9 A;  1LE2 A;  1NFN A;  1OR2 A;  1EA8 A;  3S84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...