1H7IA

Apolipoprotein e3 22kd fragment lys146gln mutant
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
140
structure length
140
Chain Sequence
b'GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRQRLLRDADDLQKRLAVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E
publication title Apolipoprotein E3 22Kd Fragment Lys146Gln Mutant
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 66
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2001-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1h7iA00
1OR2A 1GS9A 1YA9A 1LS4A 3R2PA 1NFNA 1LE4A 1EQ1A 1OR3A 1B68A 1NFOA 1AEPA 1LPEA 1EA8A 2KC3A 3S84A 1LE2A 1BZ4A 1H7IA
chains in the Genus database with same CATH superfamily
4KNVA 2HFIA 4PFPA 3T6GB 2Q00A 2JD3A 5HV9A 1VOMA 3QTHA 3FAJA 4OD5A 3EGXB 1PD1A 2ZXPA 2HSBA 5JS5A 256BA 5DS6A 1OCCC 1JR8A 3EGDB 1SZIA 2H7OA 3UNGC 1M2VA 4JE9A 4ER9A 1OCOC 1YDIA 4JCHA 1ST6A 3GEEA 2YL3A 3DZAA 3U0CA 2XLDA 3V5YA 1Q0FA 4NQFA 2B0HA 3DWWA 3GEIA 4W8PA 1AUEA 2LIGA 3NKDA 2HV7A 2IOQA 1YA7O 1QPUA 4PJJA 3ATPA 1ZU4A 4JEAA 1U89A 4MVMA 5COFA 4DVYP 2XXAB 5L0FA 4DRIB 5COGA 4JCZA 5KYXA 4EUKB 5A6JA 1FR0A 1I4ZA 4OINF 2OQMA 3DM9B 3C8GD 1VMAA 2WL8A 1YAUO 3AG3C 2R7TA 2YLDA 5DVWA 4LDQA 1Q0GA 2LK4A 2LSEA 3GM2A 1PD0A 3M79A 4CSAA 3U2MA 2P7VA 3JYYA 3F46A 1TR2A 4N6CA 2QTVA 3PHF2 1S7ZA 3ITFA 3MBGA 2ICWG 3GM3A 4YWQA 2R7UA 3NYJA 4ZLDA 2BL2A 2LD6A 1JPNA 1UFBA 1VLSA 4BJ6A 3VYWA 4P6IC 2AWYA 4EBBA 5DLJA 2WZGA 2A68F 3EH2A 3FHDA 3PCVA 2Q7RA 5JSLA 3LS1A 5T1DB 2LFFA 2O9XA 2UUIA 2KYHA 4JJFA 3SXMA 2R02A 3WHNA 4EHPA 3B0VC 1KNYA 3AGUA 4JRZA 2XLVA 4PFOA 3ABMC 4FESA 5DQTA 4IARA 4XLNF 2YLGA 1FMVA 3LLIA 1SF8A 1H6GA 1OKKA 2GAQA 1QZXA 2Y69C 5E3AA 3X2QC 2R7OA 4CX9A 1A7VA 3ASNC 3G4XA 4GYTA 4J7TA 4RBNA 3SZRA 1H9GA 4LDRA 3RF3A 3NMJA 1VYKA 1Z6AA 2YQYA 3AOUA 3JYHA 4OIRF 4MTFA 1RKEA 2WVQA 4ULVA 3LJBA 3F47A 4G78A 4JW1A 1HW2A 2WB7A 3Q7LA 1R4TA 3AGTA 4O6NA 4XPYA 2Q9AA 3US6A 3FOPA 1BR4A 3GWLA 2W4MA 4CJOA 2VCAA 4I3MA 5L0JA 1TWAA 4XTKA 4BJ1A 1OCRC 2EILC 1A7DA 1CPQA 1WASA 1YA9A 2YZSA 4J30B 4YT4A 3U9JA 4E7ZA 1EI7A 1XZQA 2KNHA 2R03A 2Q9BA 3RH3A 2L9JA 3U5SA 1HW1A 5A6AA 3EG9B 4IRUA 3M1CB 1D0YA 2L81A 5DQZA 1VLTA 1LM3B 1ZHWA 2A6HF 1C17M 2Z15A 3DKAA 2NSFA 4Z9JA 3SXKA 3NYLA 1D0XA 2J9WA 3JRMO 4YT5A 3DE8A 3M4BA 2PF4E 3GANA 5EHHA 4RD9A 1XZPA 2WVOA 3OWTA 4I1OB 1L7CA 4H4KC 1T01A 1OKKD 4CDYA 3RQGA 3E9VA 2J9BA 3L0IA 4W8KA 1RCPA 2A69F 4H54A 4EBJA 5L3QA 4C7OA 1HE1A 5F5HA 1YARO 3EFOA 1K05A 4YJWA 3SXYA 3TJ5A 3K1IA 3Q6MA 4PACA 5KYYA 4BEMJ 1VTMP 2A1DD 2Q9CA 4CIHA 4XQ1A 2R7SA 2RSEB 3RQEA 4MS2A 3KYIA 2G62A 4XPWA 1KU2A 2GWWA 1MQVA 3IEEA 5E33A 2UUHA 1YZCA 3E70C 1IW7F 3CAXA 1M2OA 1Y6DA 4JC7A 5JVEA 1FMWA 5A6BA 4U5DE 3RVZA 5IY5C 1FAPB 3KKBA 3ZC4A 4GEHA 1M57C 3GEHA 1LI7A 5TJ5E 1RKCA 1TFOB 2VH3A 1N1CA 2YL7A 3O10A 4PJLA 3V5XA 4CS7A 2C03A 3HJCA 2X51A 3L1MA 3KL4A 1K04A 2KSFA 1T6QA 4HFFB 2J8WA 4JURI 4IAQA 2EPNA 3U8VA 3VAYA 1SYQA 1QLEC 5AC4A 2ASRA 4AE4A 2W4BA 4PJMA 2XL8A 4ANJA 2TMVP 1SR2A 3B0UX 3NMIA 3QVZA 5CI8A 1GQAA 1D0ZA 1E2XA 1I5NA 1WATA 1D1BA 4K7BA 4YL3A 1FFHA 1ORYA 1H9TA 4BJ5A 4CS9A 1B68A 1FFTC 3T4RA 4I1MA 2R9RB 4ZLCA 2NPUA 1Y4CA 3C8ZA 4DBQA 3OEOA 1NZEA 3QMKA 3UMKA 3K7DA 4Q5SF 4XLPF 3I5QA 4IB4A 1CGOA 4JZAA 3ABLC 1Z23A 1ZW2A 3Q7GA 4DBRA 2AVKA 3KYJA 5A6BD 2ZXRA 2P61A 2V3CC 3JZ0A 1D1AA 1T6IA 4MVQA 4MW8A 2NUPB 1F1MA 1Z7Qc 5FZTA 4MNDA 2NUTA 4AK9A 5L3VA 5KYUB 3FDQA 4ONSA 3TOLA 1OW6A 3W2VA 3AG4C 4LLCA 4G7HF 1U0BB 3EHNA 3LS0A 4U5CE 1U6HA 3HTKC 5L0IA 1I4YA 3SYNA 5B3IA 2J9VA 3TJ6A 3EGXA 1J8YF 3W2WA 4G7ZF 2IXNA 3ECSA 2H7VC 3JSEO 3U3BA 4MQ9F 3U8PA 2EPKX 3EGDA 2OEVA 3L34A 3LLKA 4HFKB 4OD4A 4Z9IA 2MWQA 2DGJA 2GFHA 2XSEA 4MW3A 5L0GA 2J7PA 3CSKA 3G50A 1KTMA 3RYLA 2L6HA 1GGQA 5D92A 2OEXA 1LI5A 4N6HA 1QKRA 4KBLA 2MYSA 4FWVA 4U5HA 1LS1A 4CDVA 2AWCA 2I15A 1QSPA 3NMKA 3S27A 2QNLA 4J32B 1JOGA 3RVYA 3QW1A 4MVZA 2XXAA 2R7XA 2Y3GA 2XM0A 5BUOA 3ZIBA 2YKZA 3ZQYA 3M15A 1QQ3A 1RJ9B 1LIHA 3SXZA 4MVRA 3U9MA 5A69A 4MVSA 3HNKA 3V5ZA 2XLHA 3K1HA 3N24A 5L0CA 4CSAC 4N4WA 3LAYA 2ZXWC 4A2NB 2R7VA 4E18A 3U2LA 4U5FE 3VF0A 3AQCA 3SEOA 1JMWA 3MLGA 2X0CA 1S05A 2YEVA 3ZSUA 2HKVA 2IXOA 3GWNA 4BJ6C 5KYWB 2HV6A 4DRJB 1A0BA 3O6XA 1H7IA 5T3TA 5KYYB 3BRJA 2GDCA 2QLAA 2YLIA 4JTDB 1MMDA 3UGPA 2VCCA 3QW0A 1RMVA 2EPOA 3DE9A 3LNMB 1ZHYA 2D5RB 2EINC 2G3KA 2XM4A 2XRHA 2BE5F 3FOOA 4MVUA 2DYSC 1YLMA 2YHSA 1EKYA 5F5FA 1L3PA 4I44A 2J7PD 1XWJA 1O87A 2HJ3A 1ZVZA 4NTFA 1K40A 3UMIA 2B0JA 4DJ9A 5EK0A 2W9YA 4XEVA 4XWJA 4K0DA 3EPVA 3SNHA 4C3BA 3NDBB 4FAPB 3JT1A 3HKKA 2WZFA 1VK5A 3ZVRA 1PV3A 3O39A 2AU5A 1T6UA 2IBFA 2P6VA 1CGNA 1EA8A 2YRFA 3EJNA 3H65A 4JVSA 3DJUB 4G7OF 4RDAA 1ZYRF 5GPGB 1OQCA 2QY9A 4DXWA 1V4AA 1M6TA 2H7BA 3ABKC 3IHUA 2J9UA 1TQGA 4DOZA 2A0BA 1CGME 2NG1A 2XLWA 3K33A 4JTCB 2C04A 3CZ6A 2D4UA 3VM6A 3RKOF 4O79A 4U5BE 4C7OB 3FXHA 3I5PA 2FGYA 3KH2A 1NG1A 1TKNA 3FMSA 2PP4A 3MX3A 1JAFA 3HNLA 1J8MF 4M63A 4AX2A 4E0IA 3C8GB 2R7RA 1OR3A 4XPXA 2OJQA 2LP4A 3KMIA 3DD7A 3G4ZA 2CNWA 3ASOC 3NYMA 1NFOA 2ZPAA 3BEHA 4DRHB 1AVOB 2V26A 3EG9A 3S9OA 3ZWIA 1HY5A 2LCHA 2YL1A 3EH1A 4CS8A 3JTLO 1LKXA 2XL6A 4O6YA 2CDQA 4NTBA 3DAFA 2IXMA 4YT2A 4LLEA 1NU9C 4Z9HA 3L8IA 4CDAA 5L0HA 3AJMA 5BQHA 1OR2A 1E86A 1M2VB 4YT8A 3MYFA 3C63A 4D4XA 1BR2A 2IXPA 2A0UA 3K1IC 4NCQA 3VRCA 1WTYA 1MNEA 3N0TA 3T9OA 4OIQF 3EZHA 3EHMA 4A4AA 5JP7A 5F28E 1ZHTA 2LFDA 3K6BA 1BBHA 2GA0A 2HS5A 2PBEA 2VC9A 3FAPB 3B71A 4YK5A 2HZ8A 3IQ5A 2CCYA 4E17A 3V7OA 1SMYF 3B0PA 3H2UA 4JIOA 5JUAA 5KYXB 3IQCA 3SP1A 2PX3A 2NUTB 4JJGA 4BJTA 3TQOA 1OXBA 3OA1A 4ULWA 4CIPA 1BZ4A 2DYRC 3IPMO 4NTAA 4KC9A 2CNWD 4P9TA 1APCA 4XEKA 2XLEA 2OCCC 3B29A 4LDKA 1IZMA 4X0RA 1GS9A 1FTSA 4C3DA 5DS5A 3DXJF 4EBKA 1TFKB 2G3VA 5KYNA 1NSGB 1Q0MA 3NRHA 1M56C 1O5HA 1V54C 1LE4A 2EIKC 4C3EA 1OW8A 1T9KA 4D4NA 1Q0KA 1ZHZA 3LEVA 4NC3A 5D91A 5JLIA 3TULA 4KI2A 1D1CA 2QE9A 2ZXOA 4JTAB 5AGFA 1Q0DA 3NKEA 4BJ5C 5A6KA 2NSGA 4CS9C 1TWHA 2CGEA 3W8IA 2VASA 4DVZA 4U9DA 3ZG1A 1A41A 2DI3A 3LEOA 2R7QA 2HMZA 1G4US 2HSQA 2KQ9A 2YVKA 3A9CA 1YJGA 4G0HA 5B1BC 3S90A 4OIOF 3J06A 2FAPB 3B9QA 2E87A 1NBBA 2IM8A 3IQ6A 1G4WR 1OXKA 3T6BA 3C7JA 1Z5ZA 2OU6A 4U5EE 3WG7C 1LVKA 3C18A 4L6RA 1LS4A 3T6JA 3TOMA 4B6IA 3GORA 4E0HA 5EGYA 4QI2A 5E2QA 1HMOA 1RKEB 1Z3IX 2Q3TA 1RXQA 2YL0A 4GQHA 3S29A 2CW0F 3MFNA 1EQ1A 3CEXA 3I4UA 1T5OA 1WWPA 2NUPA 2VCBA 5E3CA 5KYUA 3AG1C 3A11A 3DJNB 2ETSA 2M64A 2RD9A 4LERA 5AC5A 2XLOA 2WZLA 4IWBA 4BG0A 1YYXA 4EWCA 3TK0A 3CQZA 4EKWA 2OG2A 2L7AA 2W45A 5K0IA 3AG2C 2EPMX 4AL0A 1JPJA 1QVXA 1WOLA 3JCUQ 2L6GA 3DAGA 3LNRA 3RIPA 2A6EF 3S28A 4OIPF 3RFYA 2ZD9A 1A7EA 3AQBA 4YN0B 2R7WA 5L0DA 2PNOA 3C62A 5CIVA 3HNJA 2KJGA 4U5GA 3ZQVA 3U3FA 3MYIA 3WAQA 3S0XA 2JPUA 3QVYA 4NY3A 2L6FA 3UMHA 4K1OA 3ZTMA 4WGZA 1E83A 2BC5A 4U9EA 4O7GA 2LQGA 3L8JA 4PR9A 5B1AC 1ORSC 2DB4A 4MTGA 4WGYA 4HEAJ 4BPMA 5DS4A 4EIYA 1R5ID 2KGOA 4UDVA 1LPEA 3EFOB 4FX5A 1WN0A 4CJGA 2Q4FA 2PFDA 1CPRA 3JSZA 1HE9A 1RJ9A 4MTOA 3Q6NA 2KK1A 3HLZA 1VYIA 3K66A 3POVA 2I8BA 4AL1A 3ZDLA 3HNIA 2HJMA 3TD7A 2Y3HA 2XS1A 2OOCA 2EPLX 1YVIA 1O3UA 2IYLD 2J0XA 4JEBA 3UR3C 2FFHA 1TWGA 3H2VA 4KNWA 1Z63A 5KYWA 3R2PA 4IAOA 4J7YA 1OCZC 2CYDA 1G5ZA 2XLMA 2YWAA 2HMQA 2KW3C 3FVYA 1MMGA 3QZCA 3RQFA 3W8HA 3DM5A 3NG1A 1JRAA 5FCLA 4Q4ZF 1BR1A 4WABA 3R7CA 5JRAA 4PJNA 1FNTc 1AEPA 4LACB 1ZHXA 4P9FA 3X1OA 1HMDA 2EIMC 3DMDA 4PK4A 2OJED 5JT4A 1ZU5A 1MMNA 1ZW3A 2J0WA 4QDLA 2EIJC 2PX0A 1UG7A 3O55A 4XEFA 5B3SC 2VB6A 4YL1A 3IQTA 2P1AA 4O6MA 2P0NA 3N2ZB 3JRTA 4R32A 1G8XA 2J46A 2Y3BA 4AE4B 1VB5A 3UGOA 2MHRA 1OW7A 4CBEA 1C03A 4F4BA 1E84A 1MMAA 5COMA 5BQGA 3EQLF 1ZZPA 1BDJB 2XS8A 4YL0A 2F22A 2QUPA 5CI9A 2JX0A 3LUTB 4IJJA 1NFNA 4N06A 1C02A 3GM1A 1WGWA 1TWCA 3KPHA 2R25A 3PDMP 2Y39A 4Q7CA 4WJ0A 2AP3A 5HSWA 1E85A 3DI5A 4HE8D 1YZAA 3EZIA 2H8AA 1ORJA 2M4EA 2WVNA 3GODA 2Y3DA 3LESA 1W2WA 3M4CA 4JKVA 4BEJA 1YYJA 1V55C 1MNDA 4IGGA 1GM5A 5T3WA 3C8GA 1DOWA 3ZTZA 1NLXA 4E7SA 1PCXA 2R05A 2KC3A 3WODF 3S84A 2J45A 1LE2A 3PMRA 2XL4A 4MVOA 4QI0A 4CS8C 2HUJA 1NU7D 2OKUA 3W4YA 1V74B 3RW0A 5BQIA 1DOVA
chains in the Genus database with same CATH topology
1OR2A 1GS9A 1YA9A 1LS4A 3R2PA 1NFNA 1LE4A 1EQ1A 1OR3A 1B68A 1NFOA 1AEPA 1LPEA 1EA8A 2KC3A 3S84A 1LE2A 1BZ4A 1H7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR2 A;  1GS9 A;  1YA9 A;  1LS4 A;  3R2P A;  1NFN A;  1LE4 A;  1EQ1 A;  1OR3 A;  1B68 A;  1NFO A;  1AEP A;  1LPE A;  1EA8 A;  2KC3 A;  3S84 A;  1LE2 A;  1BZ4 A;  1H7I A; 
#chains in the Genus database with same CATH topology
 4KNV A;  2HFI A;  4PFP A;  3T6G B;  2Q00 A;  2JD3 A;  5HV9 A;  1VOM A;  3QTH A;  3FAJ A;  4OD5 A;  3EGX B;  1PD1 A;  2ZXP A;  2HSB A;  5JS5 A;  256B A;  5DS6 A;  1OCC C;  1JR8 A;  3EGD B;  1SZI A;  2H7O A;  3UNG C;  1M2V A;  4JE9 A;  4ER9 A;  1OCO C;  1YDI A;  4JCH A;  1ST6 A;  3GEE A;  2YL3 A;  3DZA A;  3U0C A;  2XLD A;  3V5Y A;  1Q0F A;  4NQF A;  2B0H A;  3DWW A;  3GEI A;  4W8P A;  1AUE A;  2LIG A;  3NKD A;  2HV7 A;  2IOQ A;  1YA7 O;  1QPU A;  4PJJ A;  3ATP A;  1ZU4 A;  4JEA A;  1U89 A;  4MVM A;  5COF A;  4DVY P;  2XXA B;  5L0F A;  4DRI B;  5COG A;  4JCZ A;  5KYX A;  4EUK B;  5A6J A;  1FR0 A;  1I4Z A;  4OIN F;  2OQM A;  3DM9 B;  3C8G D;  1VMA A;  2WL8 A;  1YAU O;  3AG3 C;  2R7T A;  2YLD A;  5DVW A;  4LDQ A;  1Q0G A;  2LK4 A;  2LSE A;  3GM2 A;  1PD0 A;  3M79 A;  4CSA A;  3U2M A;  2P7V A;  3JYY A;  3F46 A;  1TR2 A;  4N6C A;  2QTV A;  3PHF 2;  1S7Z A;  3ITF A;  3MBG A;  2ICW G;  3GM3 A;  4YWQ A;  2R7U A;  3NYJ A;  4ZLD A;  2BL2 A;  2LD6 A;  1JPN A;  1UFB A;  1VLS A;  4BJ6 A;  3VYW A;  4P6I C;  2AWY A;  4EBB A;  5DLJ A;  2WZG A;  2A68 F;  3EH2 A;  3FHD A;  3PCV A;  2Q7R A;  5JSL A;  3LS1 A;  5T1D B;  2LFF A;  2O9X A;  2UUI A;  2KYH A;  4JJF A;  3SXM A;  2R02 A;  3WHN A;  4EHP A;  3B0V C;  1KNY A;  3AGU A;  4JRZ A;  2XLV A;  4PFO A;  3ABM C;  4FES A;  5DQT A;  4IAR A;  4XLN F;  2YLG A;  1FMV A;  3LLI A;  1SF8 A;  1H6G A;  1OKK A;  2GAQ A;  1QZX A;  2Y69 C;  5E3A A;  3X2Q C;  2R7O A;  4CX9 A;  1A7V A;  3ASN C;  3G4X A;  4GYT A;  4J7T A;  4RBN A;  3SZR A;  1H9G A;  4LDR A;  3RF3 A;  3NMJ A;  1VYK A;  1Z6A A;  2YQY A;  3AOU A;  3JYH A;  4OIR F;  4MTF A;  1RKE A;  2WVQ A;  4ULV A;  3LJB A;  3F47 A;  4G78 A;  4JW1 A;  1HW2 A;  2WB7 A;  3Q7L A;  1R4T A;  3AGT A;  4O6N A;  4XPY A;  2Q9A A;  3US6 A;  3FOP A;  1BR4 A;  3GWL A;  2W4M A;  4CJO A;  2VCA A;  4I3M A;  5L0J A;  1TWA A;  4XTK A;  4BJ1 A;  1OCR C;  2EIL C;  1A7D A;  1CPQ A;  1WAS A;  1YA9 A;  2YZS A;  4J30 B;  4YT4 A;  3U9J A;  4E7Z A;  1EI7 A;  1XZQ A;  2KNH A;  2R03 A;  2Q9B A;  3RH3 A;  2L9J A;  3U5S A;  1HW1 A;  5A6A A;  3EG9 B;  4IRU A;  3M1C B;  1D0Y A;  2L81 A;  5DQZ A;  1VLT A;  1LM3 B;  1ZHW A;  2A6H F;  1C17 M;  2Z15 A;  3DKA A;  2NSF A;  4Z9J A;  3SXK A;  3NYL A;  1D0X A;  2J9W A;  3JRM O;  4YT5 A;  3DE8 A;  3M4B A;  2PF4 E;  3GAN A;  5EHH A;  4RD9 A;  1XZP A;  2WVO A;  3OWT A;  4I1O B;  1L7C A;  4H4K C;  1T01 A;  1OKK D;  4CDY A;  3RQG A;  3E9V A;  2J9B A;  3L0I A;  4W8K A;  1RCP A;  2A69 F;  4H54 A;  4EBJ A;  5L3Q A;  4C7O A;  1HE1 A;  5F5H A;  1YAR O;  3EFO A;  1K05 A;  4YJW A;  3SXY A;  3TJ5 A;  3K1I A;  3Q6M A;  4PAC A;  5KYY A;  4BEM J;  1VTM P;  2A1D D;  2Q9C A;  4CIH A;  4XQ1 A;  2R7S A;  2RSE B;  3RQE A;  4MS2 A;  3KYI A;  2G62 A;  4XPW A;  1KU2 A;  2GWW A;  1MQV A;  3IEE A;  5E33 A;  2UUH A;  1YZC A;  3E70 C;  1IW7 F;  3CAX A;  1M2O A;  1Y6D A;  4JC7 A;  5JVE A;  1FMW A;  5A6B A;  4U5D E;  3RVZ A;  5IY5 C;  1FAP B;  3KKB A;  3ZC4 A;  4GEH A;  1M57 C;  3GEH A;  1LI7 A;  5TJ5 E;  1RKC A;  1TFO B;  2VH3 A;  1N1C A;  2YL7 A;  3O10 A;  4PJL A;  3V5X A;  4CS7 A;  2C03 A;  3HJC A;  2X51 A;  3L1M A;  3KL4 A;  1K04 A;  2KSF A;  1T6Q A;  4HFF B;  2J8W A;  4JUR I;  4IAQ A;  2EPN A;  3U8V A;  3VAY A;  1SYQ A;  1QLE C;  5AC4 A;  2ASR A;  4AE4 A;  2W4B A;  4PJM A;  2XL8 A;  4ANJ A;  2TMV P;  1SR2 A;  3B0U X;  3NMI A;  3QVZ A;  5CI8 A;  1GQA A;  1D0Z A;  1E2X A;  1I5N A;  1WAT A;  1D1B A;  4K7B A;  4YL3 A;  1FFH A;  1ORY A;  1H9T A;  4BJ5 A;  4CS9 A;  1B68 A;  1FFT C;  3T4R A;  4I1M A;  2R9R B;  4ZLC A;  2NPU A;  1Y4C A;  3C8Z A;  4DBQ A;  3OEO A;  1NZE A;  3QMK A;  3UMK A;  3K7D A;  4Q5S F;  4XLP F;  3I5Q A;  4IB4 A;  1CGO A;  4JZA A;  3ABL C;  1Z23 A;  1ZW2 A;  3Q7G A;  4DBR A;  2AVK A;  3KYJ A;  5A6B D;  2ZXR A;  2P61 A;  2V3C C;  3JZ0 A;  1D1A A;  1T6I A;  4MVQ A;  4MW8 A;  2NUP B;  1F1M A;  1Z7Q c;  5FZT A;  4MND A;  2NUT A;  4AK9 A;  5L3V A;  5KYU B;  3FDQ A;  4ONS A;  3TOL A;  1OW6 A;  3W2V A;  3AG4 C;  4LLC A;  4G7H F;  1U0B B;  3EHN A;  3LS0 A;  4U5C E;  1U6H A;  3HTK C;  5L0I A;  1I4Y A;  3SYN A;  5B3I A;  2J9V A;  3TJ6 A;  3EGX A;  1J8Y F;  3W2W A;  4G7Z F;  2IXN A;  3ECS A;  2H7V C;  3JSE O;  3U3B A;  4MQ9 F;  3U8P A;  2EPK X;  3EGD A;  2OEV A;  3L34 A;  3LLK A;  4HFK B;  4OD4 A;  4Z9I A;  2MWQ A;  2DGJ A;  2GFH A;  2XSE A;  4MW3 A;  5L0G A;  2J7P A;  3CSK A;  3G50 A;  1KTM A;  3RYL A;  2L6H A;  1GGQ A;  5D92 A;  2OEX A;  1LI5 A;  4N6H A;  1QKR A;  4KBL A;  2MYS A;  4FWV A;  4U5H A;  1LS1 A;  4CDV A;  2AWC A;  2I15 A;  1QSP A;  3NMK A;  3S27 A;  2QNL A;  4J32 B;  1JOG A;  3RVY A;  3QW1 A;  4MVZ A;  2XXA A;  2R7X A;  2Y3G A;  2XM0 A;  5BUO A;  3ZIB A;  2YKZ A;  3ZQY A;  3M15 A;  1QQ3 A;  1RJ9 B;  1LIH A;  3SXZ A;  4MVR A;  3U9M A;  5A69 A;  4MVS A;  3HNK A;  3V5Z A;  2XLH A;  3K1H A;  3N24 A;  5L0C A;  4CSA C;  4N4W A;  3LAY A;  2ZXW C;  4A2N B;  2R7V A;  4E18 A;  3U2L A;  4U5F E;  3VF0 A;  3AQC A;  3SEO A;  1JMW A;  3MLG A;  2X0C A;  1S05 A;  2YEV A;  3ZSU A;  2HKV A;  2IXO A;  3GWN A;  4BJ6 C;  5KYW B;  2HV6 A;  4DRJ B;  1A0B A;  3O6X A;  1H7I A;  5T3T A;  5KYY B;  3BRJ A;  2GDC A;  2QLA A;  2YLI A;  4JTD B;  1MMD A;  3UGP A;  2VCC A;  3QW0 A;  1RMV A;  2EPO A;  3DE9 A;  3LNM B;  1ZHY A;  2D5R B;  2EIN C;  2G3K A;  2XM4 A;  2XRH A;  2BE5 F;  3FOO A;  4MVU A;  2DYS C;  1YLM A;  2YHS A;  1EKY A;  5F5F A;  1L3P A;  4I44 A;  2J7P D;  1XWJ A;  1O87 A;  2HJ3 A;  1ZVZ A;  4NTF A;  1K40 A;  3UMI A;  2B0J A;  4DJ9 A;  5EK0 A;  2W9Y A;  4XEV A;  4XWJ A;  4K0D A;  3EPV A;  3SNH A;  4C3B A;  3NDB B;  4FAP B;  3JT1 A;  3HKK A;  2WZF A;  1VK5 A;  3ZVR A;  1PV3 A;  3O39 A;  2AU5 A;  1T6U A;  2IBF A;  2P6V A;  1CGN A;  1EA8 A;  2YRF A;  3EJN A;  3H65 A;  4JVS A;  3DJU B;  4G7O F;  4RDA A;  1ZYR F;  5GPG B;  1OQC A;  2QY9 A;  4DXW A;  1V4A A;  1M6T A;  2H7B A;  3ABK C;  3IHU A;  2J9U A;  1TQG A;  4DOZ A;  2A0B A;  1CGM E;  2NG1 A;  2XLW A;  3K33 A;  4JTC B;  2C04 A;  3CZ6 A;  2D4U A;  3VM6 A;  3RKO F;  4O79 A;  4U5B E;  4C7O B;  3FXH A;  3I5P A;  2FGY A;  3KH2 A;  1NG1 A;  1TKN A;  3FMS A;  2PP4 A;  3MX3 A;  1JAF A;  3HNL A;  1J8M F;  4M63 A;  4AX2 A;  4E0I A;  3C8G B;  2R7R A;  1OR3 A;  4XPX A;  2OJQ A;  2LP4 A;  3KMI A;  3DD7 A;  3G4Z A;  2CNW A;  3ASO C;  3NYM A;  1NFO A;  2ZPA A;  3BEH A;  4DRH B;  1AVO B;  2V26 A;  3EG9 A;  3S9O A;  3ZWI A;  1HY5 A;  2LCH A;  2YL1 A;  3EH1 A;  4CS8 A;  3JTL O;  1LKX A;  2XL6 A;  4O6Y A;  2CDQ A;  4NTB A;  3DAF A;  2IXM A;  4YT2 A;  4LLE A;  1NU9 C;  4Z9H A;  3L8I A;  4CDA A;  5L0H A;  3AJM A;  5BQH A;  1OR2 A;  1E86 A;  1M2V B;  4YT8 A;  3MYF A;  3C63 A;  4D4X A;  1BR2 A;  2IXP A;  2A0U A;  3K1I C;  4NCQ A;  3VRC A;  1WTY A;  1MNE A;  3N0T A;  3T9O A;  4OIQ F;  3EZH A;  3EHM A;  4A4A A;  5JP7 A;  5F28 E;  1ZHT A;  2LFD A;  3K6B A;  1BBH A;  2GA0 A;  2HS5 A;  2PBE A;  2VC9 A;  3FAP B;  3B71 A;  4YK5 A;  2HZ8 A;  3IQ5 A;  2CCY A;  4E17 A;  3V7O A;  1SMY F;  3B0P A;  3H2U A;  4JIO A;  5JUA A;  5KYX B;  3IQC A;  3SP1 A;  2PX3 A;  2NUT B;  4JJG A;  4BJT A;  3TQO A;  1OXB A;  3OA1 A;  4ULW A;  4CIP A;  1BZ4 A;  2DYR C;  3IPM O;  4NTA A;  4KC9 A;  2CNW D;  4P9T A;  1APC A;  4XEK A;  2XLE A;  2OCC C;  3B29 A;  4LDK A;  1IZM A;  4X0R A;  1GS9 A;  1FTS A;  4C3D A;  5DS5 A;  3DXJ F;  4EBK A;  1TFK B;  2G3V A;  5KYN A;  1NSG B;  1Q0M A;  3NRH A;  1M56 C;  1O5H A;  1V54 C;  1LE4 A;  2EIK C;  4C3E A;  1OW8 A;  1T9K A;  4D4N A;  1Q0K A;  1ZHZ A;  3LEV A;  4NC3 A;  5D91 A;  5JLI A;  3TUL A;  4KI2 A;  1D1C A;  2QE9 A;  2ZXO A;  4JTA B;  5AGF A;  1Q0D A;  3NKE A;  4BJ5 C;  5A6K A;  2NSG A;  4CS9 C;  1TWH A;  2CGE A;  3W8I A;  2VAS A;  4DVZ A;  4U9D A;  3ZG1 A;  1A41 A;  2DI3 A;  3LEO A;  2R7Q A;  2HMZ A;  1G4U S;  2HSQ A;  2KQ9 A;  2YVK A;  3A9C A;  1YJG A;  4G0H A;  5B1B C;  3S90 A;  4OIO F;  3J06 A;  2FAP B;  3B9Q A;  2E87 A;  1NBB A;  2IM8 A;  3IQ6 A;  1G4W R;  1OXK A;  3T6B A;  3C7J A;  1Z5Z A;  2OU6 A;  4U5E E;  3WG7 C;  1LVK A;  3C18 A;  4L6R A;  1LS4 A;  3T6J A;  3TOM A;  4B6I A;  3GOR A;  4E0H A;  5EGY A;  4QI2 A;  5E2Q A;  1HMO A;  1RKE B;  1Z3I X;  2Q3T A;  1RXQ A;  2YL0 A;  4GQH A;  3S29 A;  2CW0 F;  3MFN A;  1EQ1 A;  3CEX A;  3I4U A;  1T5O A;  1WWP A;  2NUP A;  2VCB A;  5E3C A;  5KYU A;  3AG1 C;  3A11 A;  3DJN B;  2ETS A;  2M64 A;  2RD9 A;  4LER A;  5AC5 A;  2XLO A;  2WZL A;  4IWB A;  4BG0 A;  1YYX A;  4EWC A;  3TK0 A;  3CQZ A;  4EKW A;  2OG2 A;  2L7A A;  2W45 A;  5K0I A;  3AG2 C;  2EPM X;  4AL0 A;  1JPJ A;  1QVX A;  1WOL A;  3JCU Q;  2L6G A;  3DAG A;  3LNR A;  3RIP A;  2A6E F;  3S28 A;  4OIP F;  3RFY A;  2ZD9 A;  1A7E A;  3AQB A;  4YN0 B;  2R7W A;  5L0D A;  2PNO A;  3C62 A;  5CIV A;  3HNJ A;  2KJG A;  4U5G A;  3ZQV A;  3U3F A;  3MYI A;  3WAQ A;  3S0X A;  2JPU A;  3QVY A;  4NY3 A;  2L6F A;  3UMH A;  4K1O A;  3ZTM A;  4WGZ A;  1E83 A;  2BC5 A;  4U9E A;  4O7G A;  2LQG A;  3L8J A;  4PR9 A;  5B1A C;  1ORS C;  2DB4 A;  4MTG A;  4WGY A;  4HEA J;  4BPM A;  5DS4 A;  4EIY A;  1R5I D;  2KGO A;  4UDV A;  1LPE A;  3EFO B;  4FX5 A;  1WN0 A;  4CJG A;  2Q4F A;  2PFD A;  1CPR A;  3JSZ A;  1HE9 A;  1RJ9 A;  4MTO A;  3Q6N A;  2KK1 A;  3HLZ A;  1VYI A;  3K66 A;  3POV A;  2I8B A;  4AL1 A;  3ZDL A;  3HNI A;  2HJM A;  3TD7 A;  2Y3H A;  2XS1 A;  2OOC A;  2EPL X;  1YVI A;  1O3U A;  2IYL D;  2J0X A;  4JEB A;  3UR3 C;  2FFH A;  1TWG A;  3H2V A;  4KNW A;  1Z63 A;  5KYW A;  3R2P A;  4IAO A;  4J7Y A;  1OCZ C;  2CYD A;  1G5Z A;  2XLM A;  2YWA A;  2HMQ A;  2KW3 C;  3FVY A;  1MMG A;  3QZC A;  3RQF A;  3W8H A;  3DM5 A;  3NG1 A;  1JRA A;  5FCL A;  4Q4Z F;  1BR1 A;  4WAB A;  3R7C A;  5JRA A;  4PJN A;  1FNT c;  1AEP A;  4LAC B;  1ZHX A;  4P9F A;  3X1O A;  1HMD A;  2EIM C;  3DMD A;  4PK4 A;  2OJE D;  5JT4 A;  1ZU5 A;  1MMN A;  1ZW3 A;  2J0W A;  4QDL A;  2EIJ C;  2PX0 A;  1UG7 A;  3O55 A;  4XEF A;  5B3S C;  2VB6 A;  4YL1 A;  3IQT A;  2P1A A;  4O6M A;  2P0N A;  3N2Z B;  3JRT A;  4R32 A;  1G8X A;  2J46 A;  2Y3B A;  4AE4 B;  1VB5 A;  3UGO A;  2MHR A;  1OW7 A;  4CBE A;  1C03 A;  4F4B A;  1E84 A;  1MMA A;  5COM A;  5BQG A;  3EQL F;  1ZZP A;  1BDJ B;  2XS8 A;  4YL0 A;  2F22 A;  2QUP A;  5CI9 A;  2JX0 A;  3LUT B;  4IJJ A;  1NFN A;  4N06 A;  1C02 A;  3GM1 A;  1WGW A;  1TWC A;  3KPH A;  2R25 A;  3PDM P;  2Y39 A;  4Q7C A;  4WJ0 A;  2AP3 A;  5HSW A;  1E85 A;  3DI5 A;  4HE8 D;  1YZA A;  3EZI A;  2H8A A;  1ORJ A;  2M4E A;  2WVN A;  3GOD A;  2Y3D A;  3LES A;  1W2W A;  3M4C A;  4JKV A;  4BEJ A;  1YYJ A;  1V55 C;  1MND A;  4IGG A;  1GM5 A;  5T3W A;  3C8G A;  1DOW A;  3ZTZ A;  1NLX A;  4E7S A;  1PCX A;  2R05 A;  2KC3 A;  3WOD F;  3S84 A;  2J45 A;  1LE2 A;  3PMR A;  2XL4 A;  4MVO A;  4QI0 A;  4CS8 C;  2HUJ A;  1NU7 D;  2OKU A;  3W4Y A;  1V74 B;  3RW0 A;  5BQI A;  1DOV A; 
#chains in the Genus database with same CATH homology
 1OR2 A;  1GS9 A;  1YA9 A;  1LS4 A;  3R2P A;  1NFN A;  1LE4 A;  1EQ1 A;  1OR3 A;  1B68 A;  1NFO A;  1AEP A;  1LPE A;  1EA8 A;  2KC3 A;  3S84 A;  1LE2 A;  1BZ4 A;  1H7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...