1H7VA

Rubredoxin from guillardia theta
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
60
structure length
60
Chain Sequence
MEIDEGKYECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSIKKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Solution structure of a zinc substituted eukaryotic rubredoxin from the cryptomonad alga Guillardia theta.
pubmed doi rcsb
source organism Guillardia theta
molecule tags Electron transport
total genus 4
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1h7vA00
1RB9A 1BQ8A 3MPSA 1YV1A 2VL6A 5IY0A 4AR4A 1R0JA 1C09A 1BE7A 2V3BB 1QCVA 3KYYA 3KYWA 1T9PA 1RYTA 1CAAA 4RXNA 1IRNA 1BRFA 1R0GA 1LKOA 2MS3A 1FHHA 3RYGA 6RXNA 1LKPA 2DSXA 2KN9A 4AR3A 8RXNA 1R0FA 3RZ6A 5AI3A 1ZRPA 1E8JA 3PZAA 7RXNA 3KYVA 1B2OA 1LTLA 2PVXA 2LCQA 1DX8A 1NNQA 2QL0A 1DVBA 2HR5A 4K9FA 1T9QA 3QVDA 2M4YA 1IROA 2GMGA 2KKDA 3PWFA 3KYXA 1QYBA 4YWMA 1JYBA 1BQ9A 4TPUA 1LKMA 1S24A 2PVEA 4AR6A 2K2DA 1R0HA 4AR5A 1T9OA 1SMUA 5AI2A 5RXNA 3SS2A 1B2JA 1YUZA 1B13A 2PYAA 1S30A 1YUXA 1FHMA 1YK5A 1RDGA 1RDVA 1SMWA 1VCXA 3KYUA 4YWLA 3A44A 1RWDA 4POGA 1BFYA 2RDVA 4ME3A 1H7VA 1YK4A 1IU5A 1SMMA 1CADA 1B71A 1R0IA 1IU6A 3RZTA 1S2ZA 4POFA
chains in the Genus database with same CATH superfamily
2A6ED 4AHZA 3GTPL 2VL6A 2M6OA 4V196 1BE7A 5C44L 4AI3A 3KYWA 1RYTA 4RXNA 3LPEB 1TWGL 1PZXA 2B63L 4Y52L 2JA8L 3RYGA 3K7AL 6RXNA 1LKPA 2KN9A 2E2HL 1QQTA 4A3BL 5GAHc 7RXNA 3KYVA 4JAFA 1NXGA 2PVXA 3HKZP 2XJUA 1NNQA 2XJSA 3GTOL 4A3LL 4AHXA 4C3HL 4B8CD 2NVYL 4A3IL 3H97A 4BBSL 2H12A 4G6BA 4A3JL 3JR7A 4A3DL 1P7PA 4AHWA 5EIOC 3H0GL 2JI1A 5MFPA 2WAQP 4YWMA 1LKMA 2XJRA 4AR6A 1R0HA 3S15L 4LHLA 1PFVA 1T9OA 2PPTA 3K35A 1TWCL 1SFOL 4X6AL 2A69D 5H1Sc 5GAEc 2JA6L 5C3EL 3GTQL 1VCXA 5MFZA 3PKIA 4A3FL 3S1QL 2EY4E 2PSMC 2NVQL 1BFYA 2CKAA 2AQCA 1K83L 2V0EA 4BY1L 2M6PA 5IP9L 1R0IA 2V0FA 2JA7L 3WWLA 3LWVB 5EINC 1RB9A 1I50L 2R92L 5IY0A 4AI0A 4AR4A 1R0JA 2C6AA 1C09A 3HAXC 3LWPB 3FKIL 1OWCA 3LWQB 4AI2A 3MQKB 3ZG6A 2PMZP 4ZN1B 3HJYB 4BBRL 8RXNA 5M5XL 4Y7NL 1TWFL 2CR8A 3B0AB 3RZ6A 1ZRPA 5K2ME 2Z3RB 3RZDL 1LTLA 3S2HL 2M4VA 2LCQA 5M5WL 1DVBA 2HR5A 1VZGA 4A93L 3MSUA 5GAGc 5C4JL 1NXEA 1IROA 2BE5D 2JI2A 2NVXL 3WWNB 3PL5A 5C4XL 2L0ZA 2NYDA 1ODHA 1VZHA 5DM61 3PWFA 2APOB 3PO2L 3PIP1 1QYBA 4XGHA 2WB1P 2K2DA 1RYQA 1SMUA 1I3QL 5RXNA 2XJPA 4U671 1B2JA 2VUML 1B13A 2ERSA 3HOVL 1IW7D 3S2DL 1RDVA 3RZOL 3A44A 3HOUL 1RWDA 1PFUA 3PKJA 2RDVA 5IP7L 4UY81 1YK4A 2E2JL 1B71A 1IU6A 5FJ8L 4JAGA 3HOWL 4C2M1 3NFPI 4POFA 2Y0SP 2AUSB 1F4LA 3MPSA 3P2AA 3S16L 3KYYA 3GTKL 3HOXL 1T9PA 1CAAA 1IRNA 5JVG1 1BRFA 1LKOA 4BY7L 2MS3A 3VPBE 2E2IL 2DSXA 2A68D 1R0FA 5AN9H 4C3IL 2O5JD 1E8JA 3PZAA 1B2OA 4ZN3B 5JVH1 3GTLL 1PFWA 4K9FA 1T9QA 3QVDA 2M4YA 2NVTL 2GMGA 2RFKB 3J7Y1 4TPUA 4E6YA 4JADA 1PFYA 3S1NL 3I4ML 3H3VM 2B5ID 4AR5A 4A3KL 4AYBP 5IYCL 3I4NL 3SS2A 2JA5L 2XJTA 1YUZA 2PYAA 1TWHL 4XXBB 1R9TL 3GTGL 4C3JL 4JAEA 1YK5A 1RDGA 5M3FL 2AYJA 3S1ML 3KYUA 4WFN1 5GADc 4TVMA 2YU9L 4A3EL 4ME3A 1H7VA 3LNLA 1IU5A 1SMMA 2CKCA 3H9BA 3RZTA 3HOZL 3M4OL 1S2ZA 4AHYA 1BQ8A 1YV1A 3IU3I 4QIWP 2V3BB 1QCVA 3QQCE 3S17L 4A3GL 3P8BA 3S1RL 1R0GA 1WJVA 1Z92B 2R7ZL 1FHHA 5M5YL 2ERJA 3B08B 4AR3A 3H9CA 4BXXL 3LWRB 5MGNA 3FDJA 5AI3A 2Z3QB 1OWBA 1DX8A 2QL0A 2XJVA 4GS7D 3PIO1 2ZIXA 3J7Z1 5MLC3 4LHNA 2A6HD 3H99A 1Y1VL 5FLML 2C6BA 2KKDA 3KYXA 3M3YL 3LWOB 1WCML 1BQ9A 1JYBA 5IYBL 1S24A 3CQZL 2PVEA 3GTML 2XJQA 5MF6A 3HOYL 3PO3L 1I6HL 5AI2A 3HJWB 2HVYC 1Y1WL 1S30A 1YUXA 2J9UB 1FHMA 1SMWA 1TWAL 4A3ML 4YWLA 3S14L 2R93L 4A3CL 5M3ML 4POGA 5IYDL 3GTJL 4AI1A 5DM71 1VZIA 1CADA 2JI3A
chains in the Genus database with same CATH topology
1RB9A 1BQ8A 2A6ED 4AHZA 3MPSA 3P2AA 1YV1A 2VL6A 5IY0A 2M6OA 3IU3I 4AI0A 4AR4A 1R0JA 4V196 2C6AA 1C09A 1BE7A 2V3BB 1QCVA 3KYYA 3QQCE 4AI3A 3KYWA 1T9PA 1RYTA 1CAAA 4RXNA 3LPEB 1OWCA 3P8BA 4AI2A 1IRNA 5JVG1 1BRFA 1R0GA 1WJVA 3ZG6A 1LKOA 1Z92B 2MS3A 1FHHA 3RYGA 3VPBE 6RXNA 2ERJA 3B08B 1LKPA 4ZN1B 2DSXA 2KN9A 2A68D 4AR3A 8RXNA 1R0FA 5AN9H 2CR8A 3B0AB 3RZ6A 5AI3A 5MGNA 1ZRPA 5K2ME 2O5JD 1E8JA 5GAHc 3PZAA 2Z3RB 7RXNA 2Z3QB 3KYVA 1B2OA 4JAFA 4ZN3B 1LTLA 1NXGA 1OWBA 2M4VA 2PVXA 2LCQA 2XJUA 5JVH1 1DX8A 1NNQA 2QL0A 1DVBA 2XJVA 4GS7D 2XJSA 2HR5A 3PIO1 1VZGA 2ZIXA 3MSUA 4AHXA 3J7Z1 5GAGc 4B8CD 4K9FA 1NXEA 1T9QA 3QVDA 2H12A 4G6BA 2M4YA 5MLC3 1IROA 2BE5D 2JI2A 4LHNA 3WWNB 2A6HD 2L0ZA 2NYDA 1ODHA 4AHWA 5EIOC 2JI1A 2GMGA 1VZHA 2C6BA 5DM61 5MFPA 3J7Y1 2KKDA 3PWFA 3KYXA 3PIP1 1QYBA 4YWMA 1BQ9A 1JYBA 4TPUA 4E6YA 1LKMA 4XGHA 1S24A 4JADA 2PVEA 2XJRA 4AR6A 2K2DA 1R0HA 1RYQA 2B5ID 4LHLA 4AR5A 2XJQA 5MF6A 1T9OA 1SMUA 2PPTA 3K35A 5AI2A 5RXNA 3SS2A 2XJPA 4U671 2XJTA 1B2JA 1YUZA 1B13A 2PYAA 1S30A 2ERSA 2A69D 4XXBB 1YUXA 2J9UB 5H1Sc 1FHMA 1IW7D 5GAEc 4JAEA 1YK5A 1RDGA 1RDVA 1SMWA 2AYJA 1VCXA 3KYUA 4WFN1 4YWLA 5MFZA 3A44A 3PKIA 2PSMC 5GADc 1RWDA 4TVMA 4POGA 1BFYA 2CKAA 3PKJA 2V0EA 2RDVA 4ME3A 1H7VA 2M6PA 4AI1A 3LNLA 1YK4A 4UY81 5DM71 1IU5A 1SMMA 1VZIA 1CADA 1B71A 1R0IA 2CKCA 1IU6A 2V0FA 2JI3A 4JAGA 3WWLA 3NFPI 3RZTA 1S2ZA 4AHYA 5EINC 4POFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RB9 A;  1BQ8 A;  3MPS A;  1YV1 A;  2VL6 A;  5IY0 A;  4AR4 A;  1R0J A;  1C09 A;  1BE7 A;  2V3B B;  1QCV A;  3KYY A;  3KYW A;  1T9P A;  1RYT A;  1CAA A;  4RXN A;  1IRN A;  1BRF A;  1R0G A;  1LKO A;  2MS3 A;  1FHH A;  3RYG A;  6RXN A;  1LKP A;  2DSX A;  2KN9 A;  4AR3 A;  8RXN A;  1R0F A;  3RZ6 A;  5AI3 A;  1ZRP A;  1E8J A;  3PZA A;  7RXN A;  3KYV A;  1B2O A;  1LTL A;  2PVX A;  2LCQ A;  1DX8 A;  1NNQ A;  2QL0 A;  1DVB A;  2HR5 A;  4K9F A;  1T9Q A;  3QVD A;  2M4Y A;  1IRO A;  2GMG A;  2KKD A;  3PWF A;  3KYX A;  1QYB A;  4YWM A;  1JYB A;  1BQ9 A;  4TPU A;  1LKM A;  1S24 A;  2PVE A;  4AR6 A;  2K2D A;  1R0H A;  4AR5 A;  1T9O A;  1SMU A;  5AI2 A;  5RXN A;  3SS2 A;  1B2J A;  1YUZ A;  1B13 A;  2PYA A;  1S30 A;  1YUX A;  1FHM A;  1YK5 A;  1RDG A;  1RDV A;  1SMW A;  1VCX A;  3KYU A;  4YWL A;  3A44 A;  1RWD A;  4POG A;  1BFY A;  2RDV A;  4ME3 A;  1H7V A;  1YK4 A;  1IU5 A;  1SMM A;  1CAD A;  1B71 A;  1R0I A;  1IU6 A;  3RZT A;  1S2Z A;  4POF A; 
#chains in the Genus database with same CATH topology
 2A6E D;  4AHZ A;  3GTP L;  2VL6 A;  2M6O A;  4V19 6;  1BE7 A;  5C44 L;  4AI3 A;  3KYW A;  1RYT A;  4RXN A;  3LPE B;  1TWG L;  1PZX A;  2B63 L;  4Y52 L;  2JA8 L;  3RYG A;  3K7A L;  6RXN A;  1LKP A;  2KN9 A;  2E2H L;  1QQT A;  4A3B L;  5GAH c;  7RXN A;  3KYV A;  4JAF A;  1NXG A;  2PVX A;  3HKZ P;  2XJU A;  1NNQ A;  2XJS A;  3GTO L;  4A3L L;  4AHX A;  4C3H L;  4B8C D;  2NVY L;  4A3I L;  3H97 A;  4BBS L;  2H12 A;  4G6B A;  4A3J L;  3JR7 A;  4A3D L;  1P7P A;  4AHW A;  5EIO C;  3H0G L;  2JI1 A;  5MFP A;  2WAQ P;  4YWM A;  1LKM A;  2XJR A;  4AR6 A;  1R0H A;  3S15 L;  4LHL A;  1PFV A;  1T9O A;  2PPT A;  3K35 A;  1TWC L;  1SFO L;  4X6A L;  2A69 D;  5H1S c;  5GAE c;  2JA6 L;  5C3E L;  3GTQ L;  1VCX A;  5MFZ A;  3PKI A;  4A3F L;  3S1Q L;  2EY4 E;  2PSM C;  2NVQ L;  1BFY A;  2CKA A;  2AQC A;  1K83 L;  2V0E A;  4BY1 L;  2M6P A;  5IP9 L;  1R0I A;  2V0F A;  2JA7 L;  3WWL A;  3LWV B;  5EIN C;  1RB9 A;  1I50 L;  2R92 L;  5IY0 A;  4AI0 A;  4AR4 A;  1R0J A;  2C6A A;  1C09 A;  3HAX C;  3LWP B;  3FKI L;  1OWC A;  3LWQ B;  4AI2 A;  3MQK B;  3ZG6 A;  2PMZ P;  4ZN1 B;  3HJY B;  4BBR L;  8RXN A;  5M5X L;  4Y7N L;  1TWF L;  2CR8 A;  3B0A B;  3RZ6 A;  1ZRP A;  5K2M E;  2Z3R B;  3RZD L;  1LTL A;  3S2H L;  2M4V A;  2LCQ A;  5M5W L;  1DVB A;  2HR5 A;  1VZG A;  4A93 L;  3MSU A;  5GAG c;  5C4J L;  1NXE A;  1IRO A;  2BE5 D;  2JI2 A;  2NVX L;  3WWN B;  3PL5 A;  5C4X L;  2L0Z A;  2NYD A;  1ODH A;  1VZH A;  5DM6 1;  3PWF A;  2APO B;  3PO2 L;  3PIP 1;  1QYB A;  4XGH A;  2WB1 P;  2K2D A;  1RYQ A;  1SMU A;  1I3Q L;  5RXN A;  2XJP A;  4U67 1;  1B2J A;  2VUM L;  1B13 A;  2ERS A;  3HOV L;  1IW7 D;  3S2D L;  1RDV A;  3RZO L;  3A44 A;  3HOU L;  1RWD A;  1PFU A;  3PKJ A;  2RDV A;  5IP7 L;  4UY8 1;  1YK4 A;  2E2J L;  1B71 A;  1IU6 A;  5FJ8 L;  4JAG A;  3HOW L;  4C2M 1;  3NFP I;  4POF A;  2Y0S P;  2AUS B;  1F4L A;  3MPS A;  3P2A A;  3S16 L;  3KYY A;  3GTK L;  3HOX L;  1T9P A;  1CAA A;  1IRN A;  5JVG 1;  1BRF A;  1LKO A;  4BY7 L;  2MS3 A;  3VPB E;  2E2I L;  2DSX A;  2A68 D;  1R0F A;  5AN9 H;  4C3I L;  2O5J D;  1E8J A;  3PZA A;  1B2O A;  4ZN3 B;  5JVH 1;  3GTL L;  1PFW A;  4K9F A;  1T9Q A;  3QVD A;  2M4Y A;  2NVT L;  2GMG A;  2RFK B;  3J7Y 1;  4TPU A;  4E6Y A;  4JAD A;  1PFY A;  3S1N L;  3I4M L;  3H3V M;  2B5I D;  4AR5 A;  4A3K L;  4AYB P;  5IYC L;  3I4N L;  3SS2 A;  2JA5 L;  2XJT A;  1YUZ A;  2PYA A;  1TWH L;  4XXB B;  1R9T L;  3GTG L;  4C3J L;  4JAE A;  1YK5 A;  1RDG A;  5M3F L;  2AYJ A;  3S1M L;  3KYU A;  4WFN 1;  5GAD c;  4TVM A;  2YU9 L;  4A3E L;  4ME3 A;  1H7V A;  3LNL A;  1IU5 A;  1SMM A;  2CKC A;  3H9B A;  3RZT A;  3HOZ L;  3M4O L;  1S2Z A;  4AHY A;  1BQ8 A;  1YV1 A;  3IU3 I;  4QIW P;  2V3B B;  1QCV A;  3QQC E;  3S17 L;  4A3G L;  3P8B A;  3S1R L;  1R0G A;  1WJV A;  1Z92 B;  2R7Z L;  1FHH A;  5M5Y L;  2ERJ A;  3B08 B;  4AR3 A;  3H9C A;  4BXX L;  3LWR B;  5MGN A;  3FDJ A;  5AI3 A;  2Z3Q B;  1OWB A;  1DX8 A;  2QL0 A;  2XJV A;  4GS7 D;  3PIO 1;  2ZIX A;  3J7Z 1;  5MLC 3;  4LHN A;  2A6H D;  3H99 A;  1Y1V L;  5FLM L;  2C6B A;  2KKD A;  3KYX A;  3M3Y L;  3LWO B;  1WCM L;  1BQ9 A;  1JYB A;  5IYB L;  1S24 A;  3CQZ L;  2PVE A;  3GTM L;  2XJQ A;  5MF6 A;  3HOY L;  3PO3 L;  1I6H L;  5AI2 A;  3HJW B;  2HVY C;  1Y1W L;  1S30 A;  1YUX A;  2J9U B;  1FHM A;  1SMW A;  1TWA L;  4A3M L;  4YWL A;  3S14 L;  2R93 L;  4A3C L;  5M3M L;  4POG A;  5IYD L;  3GTJ L;  4AI1 A;  5DM7 1;  1VZI A;  1CAD A;  2JI3 A; 
#chains in the Genus database with same CATH homology
 1RB9 A;  1BQ8 A;  2A6E D;  4AHZ A;  3MPS A;  3P2A A;  1YV1 A;  2VL6 A;  5IY0 A;  2M6O A;  3IU3 I;  4AI0 A;  4AR4 A;  1R0J A;  4V19 6;  2C6A A;  1C09 A;  1BE7 A;  2V3B B;  1QCV A;  3KYY A;  3QQC E;  4AI3 A;  3KYW A;  1T9P A;  1RYT A;  1CAA A;  4RXN A;  3LPE B;  1OWC A;  3P8B A;  4AI2 A;  1IRN A;  5JVG 1;  1BRF A;  1R0G A;  1WJV A;  3ZG6 A;  1LKO A;  1Z92 B;  2MS3 A;  1FHH A;  3RYG A;  3VPB E;  6RXN A;  2ERJ A;  3B08 B;  1LKP A;  4ZN1 B;  2DSX A;  2KN9 A;  2A68 D;  4AR3 A;  8RXN A;  1R0F A;  5AN9 H;  2CR8 A;  3B0A B;  3RZ6 A;  5AI3 A;  5MGN A;  1ZRP A;  5K2M E;  2O5J D;  1E8J A;  5GAH c;  3PZA A;  2Z3R B;  7RXN A;  2Z3Q B;  3KYV A;  1B2O A;  4JAF A;  4ZN3 B;  1LTL A;  1NXG A;  1OWB A;  2M4V A;  2PVX A;  2LCQ A;  2XJU A;  5JVH 1;  1DX8 A;  1NNQ A;  2QL0 A;  1DVB A;  2XJV A;  4GS7 D;  2XJS A;  2HR5 A;  3PIO 1;  1VZG A;  2ZIX A;  3MSU A;  4AHX A;  3J7Z 1;  5GAG c;  4B8C D;  4K9F A;  1NXE A;  1T9Q A;  3QVD A;  2H12 A;  4G6B A;  2M4Y A;  5MLC 3;  1IRO A;  2BE5 D;  2JI2 A;  4LHN A;  3WWN B;  2A6H D;  2L0Z A;  2NYD A;  1ODH A;  4AHW A;  5EIO C;  2JI1 A;  2GMG A;  1VZH A;  2C6B A;  5DM6 1;  5MFP A;  3J7Y 1;  2KKD A;  3PWF A;  3KYX A;  3PIP 1;  1QYB A;  4YWM A;  1BQ9 A;  1JYB A;  4TPU A;  4E6Y A;  1LKM A;  4XGH A;  1S24 A;  4JAD A;  2PVE A;  2XJR A;  4AR6 A;  2K2D A;  1R0H A;  1RYQ A;  2B5I D;  4LHL A;  4AR5 A;  2XJQ A;  5MF6 A;  1T9O A;  1SMU A;  2PPT A;  3K35 A;  5AI2 A;  5RXN A;  3SS2 A;  2XJP A;  4U67 1;  2XJT A;  1B2J A;  1YUZ A;  1B13 A;  2PYA A;  1S30 A;  2ERS A;  2A69 D;  4XXB B;  1YUX A;  2J9U B;  5H1S c;  1FHM A;  1IW7 D;  5GAE c;  4JAE A;  1YK5 A;  1RDG A;  1RDV A;  1SMW A;  2AYJ A;  1VCX A;  3KYU A;  4WFN 1;  4YWL A;  5MFZ A;  3A44 A;  3PKI A;  2PSM C;  5GAD c;  1RWD A;  4TVM A;  4POG A;  1BFY A;  2CKA A;  3PKJ A;  2V0E A;  2RDV A;  4ME3 A;  1H7V A;  2M6P A;  4AI1 A;  3LNL A;  1YK4 A;  4UY8 1;  5DM7 1;  1IU5 A;  1SMM A;  1VZI A;  1CAD A;  1B71 A;  1R0I A;  2CKC A;  1IU6 A;  2V0F A;  2JI3 A;  4JAG A;  3WWL A;  3NFP I;  3RZT A;  1S2Z A;  4AHY A;  5EIN C;  4POF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...