1H85A

Ferredoxin:nadp+ reductase mutant with val 136 replaced by leu (v136l)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPLGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE
publication title Role of a Cluster of Hydrophobic Residues Near the Fad Cofactor in Anabaena Pcc 7119 Ferredoxin-Nadp+ Reductase for Optimal Complex Formation and Electron Transfer to Ferredoxin
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1h85A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1h85A02
4YAWA 1XE1A 1XB2A 3CPWB 2CNDA 2PLFA 1VQ8B 3AGQA 3AVWA 3W2GA 1JB9A 3VMFA 4C43A 2DCUA 3CCLB 1QFYA 3I56B 1YJ9B 2BF4A 1E62A 3B8HA 1BX0A 1D8TA 2OK8A 4LBYA 2DETA 2DERA 1NJID 1QG0A 2AHOA 2E1RA 4P6VF 1FDRA 1QUFA 1QGAA 4YALA 5JBQA 3B82A 3AVVA 4PC3A 4YHBA 1EP1B 2QDXA 1ELOA 4B4DA 3VNVA 3QFCA 1M1KD 2C78A 1VQ7B 3FPKA 1QFJA 1SM4A 3LVBA 1EWYA 2J7KA 1CNFA 2CRVA 4LBVA 5H59A 1VQ9B 4TMXA 4RD0A 2R6HA 4PC6A 1H85A 1AIPA 4B3XA 4J0QA 1KK3A 2BGIA 4IW3B 1OB5A 1F20A 2PIAA 1EFTA 3CMEB 1OB2A 4R71A 4RD3A 1TTTA 1OGIA 1G7TA 4EH1A 2ZITA 5GV8A 3W2IA 3W5UA 3LO8A 3ZC3A 2GPJA 1YI2B 5TV2A 3I55B 1ZM2A 4AF6A 2EIXA 3CXCB 1S0UA 1KD1D 3W5VA 1R5BA 2QTZA 1KJZA 3AVUA 4G1BA 3OZWA 2OTJB 3JQRA 3LYUA 3SJZA 2HCJB 4K1XA 3U6KA 1GR1A 1GO2A 1CNEA 3QE2A 2RC6A 3OJWA 3CCMB 1TLLA 3AVTA 1R5OA 3WXMA 4N3NA 2VZLA 1GVHA 4RJLA 3I1FA 4TMVA 1GAWA 1TUIA 3U2QA 3U6BA 4TMZA 4N3GA 5TY0A 1W87A 1IJEA 4DQLA 1BJKA 2HMAA 1Q86D 2XNJA 4LBZA 4HE6A 1W34A 3J81k 4RCYA 2EFGA 4Y7CA 1VQPB 4ACAA 3CC2B 3CD6B 1KC8D 3WYAA 1EFUA 1JA0A 4M53A 4DQKA 4FWTA 2BSAA 2QMUA 3PENA 2VNJA 1WDTA 1SKQA 1VQLB 4TMTA 2C77A 4FN5A 4PC2A 3MCAA 4H9GA 3VNUA 3MHPA 4ZV4A 4B43A 3WBJA 2X3UA 1VQNB 1DDIA 2FX3A 1DG1G 3B78A 4U9UA 3CMAB 3JQQA 1K9MD 1I7PA 2QA4B 3CC4B 4RCZA 1OGJA 5FA6A 3VO1A 4Y9RA 1FNCA 1N8RD 3WNCA 1QX4A 1EXMA 2VYQA 1D1NA 4PC1A 1K73D 1NDHA 1GJRA 4QFMA 2BMWA 2DY1A 4G5GA 4ZCMA 2B7CA 1FNBA 4P3YA 1QFZA 1G7CA 5HXBA 1VQKB 3CCJB 1K8AD 4ACBA 4RD2A 1EP3B 3ZBTA 1DDGA 1E63A 4QHYA 2PMDA 2XNCA 4M2LA 3V76A 1M90D 2QEXB 1B23P 2VNHA 1YJNB 4LBWA 3OW2B 2QN6A 1FRNA 5TR9A 3ZZTA 1KQSB 3P26A 2BGJA 1Q7YD 3CRZA 1N0VC 1R5NA 3MMPA 1GAQA 1KK2A 4B47A 1JA1A 3WBKA 3CB4A 4M0LA 1KK0A 1W2BB 2YWFA 1HA3A 4MYTA 1J9ZA 1Q81D 1UMKA 1B2RA 1W35A 4ZCLA 1FNDA 1EFCA 3G4SB 4B44A 4C0SA 1TVCA 3CCSB 1F60A 1QUEA 1QGZA 1QGYA 4Y9UA 1S72B 3ES9A 1FNMA 1U2RA 3QFTA 2YWEA 3JQPA 1IJFA 1G7RA 4Q7JB 1ZM4A 1KTVA 1YJWB 3CC7B 2BN4A 4YAUA 1VQ6B 4WQMA 3ZBUA 1D2EA 4M4SA 5GV7A 3P27A 3CCQB 1ZUNB 3CCVB 2NPFA 3AVYA 4NBSA 2BVNA 2XEXA 4TN1A 1JNYA 4UAJA 1QH0A 2HDNB 5H5JA 3A1FA 4B48A 5KSWB 2YWHA 3WY9A 1VQMB 2OK7A 3VO2A 1IB0A 1KRHA 1QVGB 5AN9A 3QFSA 1YHQB 1A8PA 4TMWA 3ZZUA 1N0UA 3QFRA 3E20A 1G7SA 4NCNA 2VNKA 3WNBA 2QTLA 3G6EB 4YAOA 3CCUB 4ZGQB 2OTLB 4M1KA 1VQOB 1VQ5B 4RD6A 1CQXA 5THXA 4RD1A 1Q82D 2BM0A 3OJXA 1EP2B 3FJOA 4RD4A 3OZVA 3LRXA 2BM1A 3QSYA 1BX1A 1KK1A 2RC5A 3ZZ0A 4BPRA 4G1VA 3E1YE 5EMNA 2BV3A 4PGOA 2B5OA 3WNDA 3OZUA 4FK8A 4AF7A 4AC9A 1VQ4B 4PC7A 2YWGA 3W5HA 1AMOA 1DARA 1BQEA 3W2EA 3AVXA 4YAFA 1ZM3A 2BPOA 4ZGNB 1YITB 2B7BA 1QVFB 1ZM9A 1E64A 2DEUA 1H42A 3CCRB 4MYUA 3CCEB 4HE5A 3AGPA 3W2HA 3G71B 2VNIA 3W2FA 4ZCIA 4F7DA 5DSZA 1JJ2B 1YIJB 1FRQA 4LC0A 2D74A 2GQFA 3CW2A
chains in the Genus database with same CATH superfamily
3N3BC 1XYGA 3FRJA 4QIHA 2YXLA 1XE1A 5HJ7A 1F8FA 1T9ZA 3L0YA 1RMYA 4HQKA 4KAXA 3PDIA 2C2MA 1E1KA 1XDUA 4UULA 5I5GA 5CCDA 2X0RA 2DBZA 1UDBA 4LY0A 3TZCA 2Y1FA 1TJ4A 5LBIA 5B6JA 1QGUA 1JRLA 2J3EA 5KWVA 1P4GA 2QRQA 4KKXB 2EW1A 4ITRC 4OXIA 2QX4A 1JGTA 1TOAA 1NUQA 4M0MA 2R25B 2GPAA 1YBMA 1GKYA 3GEBA 2BEWA 3UJ8A 4BMYA 3ETEA 4DRXA 4O4JF 3CCLB 3MWDB 3KYCB 1T26A 3H13A 1QHGA 4MVJH 1DAEA 4C6HA 4JT8A 3O74A 1UKVY 2VDKB 3D3WA 3UK0A 1BX0A 4IH1A 1SCKA 1C7RA 1CE8A 3D8SA 4DGSA 3OJLA 1T2NA 4RELA 1ADJA 3TMYA 1KY2A 2OAEA 5H3LA 1JQJC 1XEAA 1BVRA 2Q5EA 4IH9A 2I54A 4KPUB 3LH5A 2ZZEA 3EWNA 4E08A 3U7GA 4YO8A 4XIFA 1PLJA 2C8JA 3NBFA 4L50A 3MZ0A 3ZVNA 2PS9A 1XJQA 3PFGA 4KG7A 4H4EA 4CMIA 2ZPUA 4PO9A 4FXUA 3SS7X 3K70B 2VDJA 2IIVA 5LMUB 4GZ6A 3ZJYA 4KACA 2PSSA 4ILKA 4AMYA 2RH8A 4ZC8A 4L3OA 1CJSA 4RBNA 4MAAA 5EKSA 3I09A 2C97A 3EIEA 5BOVA 5A6SB 2MMGA 2PUCA 3E4DA 3UJAA 1E4YA 3PPWA 4IVRA 2D0PB 1EBBA 1L4KA 4NCJA 5TQ0B 5L4NA 2NV2B 1WXWA 2GJ8A 4JYAB 4QDJA 4Y6QA 2DLNA 1MVNA 2P1ZA 1XEXA 1RP7A 2IY9A 2J7KA 3HCNA 3ET4A 4RPCA 1Z47A 2ZT6A 3Q3EA 1CJMA 4HSEA 3K1ZA 3WYGA 2FUCA 2O1SA 1L3CA 3E61A 1XPRA 1NQWA 3HWWA 1E3SA 1TRKA 3P2IA 4D4MA 3AI1A 1D0IA 1GPUA 4LUCA 2G0AA 2JA2A 2WTEA 4FINA 5HZGA 2QBYA 4DR1B 3CRW1 3B85A 3EXIA 3ZJ5A 4S1WA 3DPIA 1JHYA 3K5PA 2TMKA 5A3QA 3TZLA 2PMFA 2FCRA 5CX1A 5DS0A 1UJBA 4EITA 4TN5A 5HF9A 3AKCA 2GK7A 5JR3A 5JOQA 1PFVA 3WA6A 4BNYA 1L4GA 3SZ3A 2O3RA 2ZREA 1E1LA 2O5RA 3IIKA 1M6WA 1CHNA 1PYGA 1TM4E 4AQ7A 3UOWA 3H04A 5L3QA 1FE8A 1NU6A 4YRDA 3NS7A 1J1UA 1NKTA 3OMWA 4ZXFA 2UVQA 5CNKA 3N6XA 5B4TA 4YT4A 4IX1A 4X1KA 2ORIA 4KXFB 1G2QA 3GFFA 3N59A 3AU9A 3S2GA 1FSGA 2OCBA 3BBLA 2JAUA 1PF7E 3FHLA 1ZAKA 2QTZA 3UWDA 4AP9A 2AZXA 5IJWA 4F06A 1MT0A 2DPLA 3SKXA 2W4QA 3OZWA 1YJ5A 4HGNA 4HWGA 4MS3B 3ZE0B 2XCLA 1SIUA 4N65A 1DXYA 2ST1A 2VJLA 3IPRA 2RHRA 3LYUA 4QXPA 3WP1B 4FB5A 2ZXHA 3NONA 2AMLA 4GOND 2MYUA 2HCJB 4ZHQA 4C7KA 2F7SA 4K88A 4GQNA 1QYVA 3QU4A 1N0WA 1O2DA 5H16A 3KTDA 3CNEA 4WA8A 3C3CA 1G17A 2QP4A 3DOUA 1QE3A 2QLMA 3FB1A 3KKEA 1K5DA 1X92A 2JIOA 1I7QB 1G64A 1NFFA 1OWMA 3WWPA 4EJSC 5CNIA 3FKJA 3H87A 3JALA 1JTEA 4UXHA 1P1RA 2VWHA 1X14A 3U44B 4O4LF 4DYDA 3R3XA 3PFCA 3STXA 1SIWA 4G9GA 1NW7A 1FP1D 5IHPA 3UMFA 4N5MA 5C9ZA 1GHTA 4ZKDA 2UYGA 4J3NA 3SC4A 2WG0A 2LW7A 2ZBGA 2Q27A 3NC4A 3TBFA 2BGGA 5AJHA 4N3GA 3EK2A 4OK3A 5CP8A 3O8CA 1NXSA 4GOJA 3G2OA 1EFDN 2QVLA 3B1WA 1F38A 2QYOA 2HAEA 4LJ7A 1JSRA 5DRTA 4WW0A 5IEBA 4HDCA 4TKVA 2E5LB 1O96B 5LIPA 3B51X 4FC7A 4GP6A 4QGGA 1T5HX 3JVEA 4A8JA 4RCYA 2CMGA 4UU1A 4X24A 2C9BA 1FS6A 3DM5A 4B3JA 2XY4A 1YIOA 3G5UA 4KB5A 5DE3A 2VDRB 4EELA 2ALJA 3GEPA 5MGNA 4HEJA 4HXFB 3HHEA 2CMKA 2HDOA 3IKMB 1C1DB 4IWYA 5TVGA 5ALKA 1P73A 5EIEA 1O97D 1PFUA 3MUFA 5FBHA 2FQYA 1XNHA 1S7GA 2GCPA 4IMIB 4MR8B 3ETJA 5DYIA 2GBPA 3EDQA 6GPBA 1XTUA 1X94A 2C8LA 2I5PO 2J7PA 5I7OA 1XZQA 4IDGA 4LDPA 1ZD8A 3KTAA 3O8OA 2P91A 1L1EA 3FSGD 4NBLA 1UFOA 4P08A 3W9SA 1V7CA 2LCQA 4EGQA 2XTMA 3NTLA 1E9EA 3S2EA 1RYEA 2LE0A 4K1LA 1YQQA 4KMSA 1K2VN 1W75A 2AL7A 4F6LA 1RPAA 5I7VA 3BCSA 4MMXB 4QWMA 5HKAA 3E84A 4NH0A 4U7HA 1J42A 1OA0A 1Z38A 4XYGA 1LC0A 3CY6A 4P0QB 1S2NA 4M1WA 1RLJA 2RB5A 1XZHA 721PA 5TLSA 5MF6A 1BKDR 3NDRA 4KKUA 4UAVA 2JK1A 1HM5A 2P9JA 3Q15C 2ZCUA 3QVKA 5KYUA 2GJPA 4C4PA 5JCXA 3QVJA 2OM6A 1II0A 1EZ4A 1L8LA 3AFHA 3BMOB 4QQFA 2RFLA 2YJ4A 2QP3A 2BI8A 2ZRJA 3DULA 4ZCSA 5L4SA 5D3MB 1L4LA 1Y8CA 2K7ZA 3L8ZA 1TLFA 3BXGA 1TA4A 4L27A 4F6RA 4ND5A 4BGEA 2J0UB 1HYBA 2AFHB 3U7QA 4B4WA 2YV4A 3IE0A 5BWCA 5KTMA 3ZV6A 4CV1A 3G2MA 2D2EA 3ZV7A 1JWBB 1F1BA 1U31A 3QITA 1ONNA 2J67A 3LHSA 4M9ZA 4X61A 1A9XB 1UPAA 2GILA 2IOHA 4K9PA 4FYYA 3W6NA 3H9NA 4KVFA 2ZJYA 3A37A 3NDJA 1AVTA 4PAWA 4X8MA 5LN1A 1P7ZA 3FB4A 4YBZA 1Q22A 3RRXA 3HKBA 2CMHA 4G0OA 3L4KA 3MTBA 3QUAA 4FONA 1HRDA 3A7DA 4EPXA 1ZN7A 2BMWA 7ADHA 4GVLA 3PITA 1KTIA 4MB0A 3HLTA 1PK8A 2HLPA 1SHLA 3GYGA 5CYOA 3W1EA 3FNEA 4HAYA 4LJKA 3WRVA 2C5GA 3OG9A 1PGJA 4Q4JB 2BYTA 2V0GA 4NE7A 3VPGA 4PEVA 4AKSA 1Y1SA 1DDGA 3EOZA 4O4IB 3RGGA 1E63A 5HS6A 3GPLA 1WQ4A 3GFTA 2B78A 3BIFA 5AOVA 4P53A 1EFRD 5EI5A 1H8HD 1FP4A 2L42A 1B23P 2NN3C 3AETB 3ZWAA 4R7GA 3Q72A 4MS4B 3FF1A 5D86A 1A7UA 1Y6ZA 3IJ5A 1EFVB 3QF7A 5K3DA 4YJKA 3RIMA 2P2GA 1QB7A 4BB0A 1NW3A 1O6GA 3UV6A 2XUZA 2H85A 3UK7A 1V71A 3AEXA 3LL4A 3HB0A 4FMPA 3B7WA 4Y2UA 2QE6A 3ZW7A 1GDHA 3BE6A 3ERCA 4HAIA 2JI8A 3KOYA 1HT0A 1UBRS 4EUHA 3GLHA 1ZMXA 3CRZA 1QRSA 3L2OB 4ZAWA 2XB6A 3RVLA 2RGGA 5CFZA 4OHRA 1ZSNA 2AEFA 3HAGA 1CY2A 5HBGA 2VNAA 3GJ6A 4U2EA 3BTVA 4PGGA 3BQJA 4J49A 3CIOA 4LRUA 3UK1A 1IAVA 2IXFA 2W6ID 1CS4C 2CVQA 1M74A 1P2DA 2O2EA 1EPUA 1EHIA 4KWEA 3BT7A 2X7JA 2Z57A 2O59A 1PBNA 1YASA 1QO7A 4HH3C 3BIJA 4KAJA 4L16A 4EDFA 4FNAA 1RI5A 1RYBA 2ERXA 2Z8YA 3OLXA 4ETMA 3QU9A 2R2AA 2WLSA 2J31A 3BB1A 1WBBA 2ZWIA 3NKLA 5KSPA 2VIIA 1FSPA 1YXMA 4P7FA 1B2RA 1F4VA 2P3QA 5EMJA 5KTNA 4E51A 4YRPA 2PG3A 4DV1B 1R3UA 1PJ6A 5CX4A 4BNGA 4EA6A 3HYLA 4D3XA 3JWEA 1P72A 2FUEA 2Q2OA 4REQA 3RH0A 2XBMA 4C88A 1QYXA 2OD9A 4DV4B 3EGOA 1CQPA 5DH9A 3T3HA 4COOA 4L02A 3AY6A 3L9WA 3G1UA 3ISJA 4X3OA 2AOWA 2E9SA 4JYMA 2ZIAA 4MUEA 3HU2A 3U37A 2BBTA 2A9JA 4CKEB 3PIDA 3I2KA 2P3LA 2QLBA 1NVAA 3U4IA 2B35A 2IS4A 1MX3A 1JLSA 1CY0A 4J29A 3GIWA 2UZ1A 4ZYUA 5P8WA 4KJXA 2X9GA 4MW0A 3BTOA 4OLJA 1F48A 3QX3A 4G5OA 1G5QA 1D3AA 1OLXA 3LK6A 2IEBA 1NRKA 1ZHHA 2ZUSA 5LLSA 3UUWA 5AW8A 5JJ5A 4BGVA 2DWUA 1XYYA 2C3UA 3KJNA 4O4JA 3BF8A 1KZ9A 1LEHA 1Z4IA 4R2LA 5CW2A 1K06A 4G5HA 2VOEA 3EH1A 4WVLA 3ZQKA 1U7TA 1UXHA 3GH3A 3NHFA 1QIFA 4BMZA 2QAGA 3CCQB 1TA0A 4YT2A 3CCVB 1UDAA 2NO4A 2ZYDA 2ZUTA 4ER7A 5I7UA 121PA 3DWGA 3LUGA 3ND9A 4QOSA 1KJ9A 1SOMA 4WNAB 2FEOA 4LF5B 3E9DA 1IY0A 4XH9B 2E55A 1HI9A 3QWBA 5EYPA 3UXHA 3ZU2A 3KJQA 1JR4A 2I1LA 2BFBB 3T4UA 2Z8ZA 3VU1A 2NZ8A 2NX2A 4KYIB 3SHFA 3TQRA 4HLUC 5C37A 1M2NA 5D8DA 3SYMA 1RM3A 5CT4A 3LGAA 1KI6A 3GLQA 4DUGA 1IXZA 3TMAA 1I8TA 2DM6A 2HNBA 2X1LA 5KYYB 3O8DA 3T5AA 4FEEA 5GQSA 3TKAA 1VFPA 4B80A 2UZAA 1HBJA 4MQ6A 2XTJA 2GEBA 3BJMA 1E60A 1HG1A 1I1QB 3ZLTA 1NBIA 1NYRA 5AM0A 3VDXA 1SXJD 5JLJA 3CH6A 4YEDA 5AUOB 3HE3A 4LK2A 4O29A 3DDZX 1Y1PA 3H84A 5FBQB 3ZV3A 4I08A 4MUAA 1KZLA 4I9FA 1FUEA 1OR8A 2RGEA 5FLEX 1E0JA 1L9KA 4F8YA 1T8YA 5FHQA 3TLGB 3TLKA 4FNGA 3GQBB 3ROXA 1H3NA 1KYWA 3W77A 3GP5A 2F59A 3ZJ4A 1LNSA 4ZGQB 2OTLB 4I4TB 3SYTA 3TD6A 1GADO 2DTXA 2R1VB 1WUTA 3CHYA 1EESA 5A4MS 2Z3ZA 2DH6A 2XAUA 5F33A 3WP0A 1NXPA 3PVCA 4B0OA 5JJCA 3HCDA 4WN9B 1VJSA 3NBMA 3LU1A 3Q6IA 2X0NA 2ZU0C 5JI2E 5EC8A 1T0HB 1Z0JA 4RD1A 1JEOA 2VJQA 2W83A 2Z3WA 1A97A 3U31A 3LTEA 3OJXA 4OPOA 4DYHA 5C46F 2ZM6B 1QAOA 3H5LA 2J6HA 3CEMA 3DHVA 4Q3LA 1L5GB 3KJZA 2C54A 1FVOA 3FGPA 1YZ3A 2BP7A 4IUCS 2J32A 4YAIA 1RAGA 3NWBA 2ANCA 4E13A 2OGWA 1WZNA 1NQOA 3DT8A 4V24A 4DMCA 1MAHA 1BDIA 1XTKA 9GPBA 2I6UA 2GZ1A 3FZEA 1SCQA 2MINB 5DXJA 5JTTA 1V6AA 1MC5A 4L2IB 5ALSA 1OASA 1HMYA 2J9ZB 2WYOA 4HPWA 4ZVQA 2IWHA 3T5BA 4YCNA 4N12A 3HDVA 4QJBA 5ECYA 2UXDB 2WYHA 2H1RA 2CDBA 5CXXA 1NNI1 1KYIA 5DHFA 1AKMA 4C0JA 4L4RA 2YWGA 2M32A 3MFYA 1HTWA 1ESEA 4GX1A 3WRXC 3AOEC 3Q2KA 3IVRA 4QPJC 2AD5A 3LC1O 2OZEA 4PINA 1ZM3A 2BUAA 3Q3IA 1UPXA 4QPNA 1KEEB 2CCJA 8AT1A 1U94A 4ZGNB 2FHSA 1DOAA 1LRJA 2GN2A 3R2JA 3PNOA 3DBLA 4N0DA 1XDBA 3WLSA 3T7JA 1D2NA 2Z08A 4LFCB 5CDUA 5JNRA 3QQ5A 3M6VA 1W25A 3QYJA 2PM8A 1DAMA 3BMQB 5IPFA 3C3WA 3CCRB 3JQFC 1MPTA 2BELA 4IV8A 4XGIA 2EZUA 4BFLA 3V6MA 3AL2A 4LAFA 5DIFA 4RMIA 1UJ6A 4ARAA 3OQIB 4UPVA 2ZTGA 3HADA 1CZUA 5HMMA 4B4OA 4O4LA 1Z0IA 1SKMA 1LVGA 3AEUA 3OCCA 4X92A 3EWSA 4GUAA 2VNIA 3AUTA 5KDLA 5TS3A 4GE0A 1XJCA 5EHGA 2GAIA 1YIJB 4Z6KA 3UO8B 1SB9A 2VQSA 4I4CA 3W8DA 4B34A 3OU6A 4C7VA 1MXFA 1M2EA 1PR1A 3G6KA 2JFWA 4CLRB 4LJ6A 4R3NA 1YZGA 3QMWA 1SBTA 2BFEA 3Q3GE 2CXOA 2ACWA 3HKCA 4XEUA 3DBHB 3T5PA 3RYHA 4EA9A 5KQSA 1HYGA 1MTOA 3BY1A 3SIWA 1NZFA 1FUYB 3X1WA 3KKMA 4DZRA 3JQAB 4J07A 2PAAA 3NALA 5IKMA 3R5FA 5IZCC 2GYUA 1XF9A 1ORWA 3O2NA 1NNLA 1EUQA 4MB6A 5CJPA 5BN5B 1RNLA 4XCVA 4P5EA 3TVTA 2FZ4A 2SCUB 4C43A 2OQ2A 2VF2A 3C3BA 5HF5A 2OD7A 3C70A 4CQLB 1NY5A 5C5EA 2YQ5A 2EFJA 2IY8A 2QT1A 3GW8A 3QNMA 3I56B 1DIOB 1JSCA 1YJAA 2B1GA 2XNHA 4WZZA 5CJJA 1G2PA 1QRDA 3BSWA 2IOYA 3LNCA 2OK8A 4GNRA 5JCPA 2HIHA 4KXUA 4MKFA 1BKSB 2P3SA 1JJFA 2OCPA 2PRYA 1YQDA 4QO7A 5ISMA 3CW8X 4UUQA 3UMSA 5CIWA 3KAKA 4HAXA 1L9XA 1E5VA 2FN3A 2H2AA 3SXUB 4JJFA 3D7RA 1JEQA 1KR2A 1WD7A 3BH6A 4KDFA 1KNQA 3ZU3A 3B38A 5FBVB 2PLAA 4YHBA 3AR8A 1J2RA 1T4CB 1IYZA 2OYSA 3GLHE 3O8BA 1WMEA 3G0DA 4I46A 4NESA 3TTTA 1ZNXA 1YAJA 2QV0A 3C5VA 3VZSA 2QI9F 2D5BA 1L5ZA 1SKUA 4TSKA 1V9LA 3LHDA 4EVRA 2OP1A 2PVPA 3O2SB 2XYQA 4G5RA 2HNKA 2C78A 2CJWB 4P1ZA 1PSZA 2ZSKA 4FX5A 3WK8A 1NE7A 1I0IA 1M6VA 2JL1A 4A73A 4CG3A 2X1HA 3EVBA 5NULA 5EXEA 4DSUA 3V5NA 2I4RA 4CF5A 3RSGA 1WL8A 4I0WB 3TRJA 4ZN6A 5BSXA 3EODA 3TSZA 4ZZ0A 4DS3A 3PTZA 2XUHA 3J81A 3A4MA 1ONSA 2B69A 2O2ZA 4PWZA 1DWQA 1G6Q1 2L2QA 5DBHX 3HLKA 5TQ2A 1ULTA 4K2AA 5GJWC 5A8AA 3DHYA 4G0XA 4M0FA 3K0AA 1HQKA 2OBMA 3CISA 2MYTA 3C1UA 5CK5A 4I9NA 3QEBZ 1N57A 2AMVA 1JHQA 5M3BA 4ARZA 4JZKA 3DCIA 3RASA 3PXXA 3C48A 1MABA 1IXRC 1SY7A 4UOZA 2C2ZA 2ZB8A 4XLHA 1S8OA 2CF6A 4OLFA 4JX8A 4H0NA 1LTHR 1IQRA 4PANA 2QE7D 1JHZA 2X9QA 4PGHA 4AO8A 3KT3A 1WKVA 5F4MA 3GY0A 4MZXA 5K99A 3ASUA 1ZUNA 4QVAA 2QV7A 1EJ0A 3DZFA 5M5BA 1UR5A 1JEDA 3BWBA 2QJTA 3PHGA 5SZHB 4YCCA 5IZ4A 3GAZA 2FLKA 2J48A 4RHUA 4X8OA 3WKEA 5KYXA 1C9EA 1V1JA 3HJHA 3FPGA 3M6IA 3NYIA 2A3RA 4G0PA 221PA 3FWPA 3W1VA 5ITSA 3KXKA 1J33A 2REXB 3BGSA 3P0RA 3PEUA 3W5CA 2F43A 1O89A 3ZJTA 1Y9ZA 1WMBA 3IMCA 2WP8J 3LY8A 1GV0A 1ZL2A 2JCGA 4D4LA 2HF2A 1SEVA 4LHVA 4BQIA 1Y7PA 2BEKA 3TB4A 4LYAA 1Q12A 5AM2A 3TF5A 2NU7B 2GT1A 4WZ6A 4WY8A 5AICA 5AVZA 2ZRDA 3VKFA 2N0SA 2W2TA 1WU8A 1QYIA 4RY2A 4ZIRA 2W2PA 1Q0SA 4K87A 3B7GA 4B2YA 4C6TA 1WEKA 4UJ5A 2VJIA 4XVRA 5EGNA 1TQ2A 4Z4FA 4B31A 3X1MA 1X74A 3CG4A 4UXIA 4BB9A 2TMYA 1CFZA 1SCUB 3MMNA 4E32A 5AJVB 3BULA 1QKIA 1Q11A 2P4QA 2VZLA 2PZAA 3R0QA 4C9BA 2PCLA 1NJFA 1J5PA 2OORC 3VZPA 3NRJA 4JLPA 4BBPA 4RF5A 3T3DA 1Q1QA 3ZI4A 4URZR 2RGNA 4M1ZA 3N0WA 1KEPA 4U0JA 1HRKA 1ZONA 3WHLA 4DBLC 1ST3A 2JBAB 1V5VA 1XSEA 3OEWA 4MWZA 3WL7A 5AI4A 4R3UC 3VV3A 1VI6A 4M0KA 3IQGX 1AH2A 1PHRA 3IULA 1W6UA 1GARA 1CUBA 1PVOA 5HUHA 1TT5A 2QUBA 2V4MA 4CL2A 5C7OO 4LF9B 2D06A 4PLTA 4ZO8A 1PTJC 3PJEA 4EUEA 2JC3A 5IDWA 2XCSB 4QVIA 1TADA 3N2LA 3VSCA 2EFGA 2O0HA 1IM2A 1JJIA 1ZL0A 3RU9A 5BMOA 2GZSA 1UZAA 3QX9A 4Z1MD 4HTAA 5HCIA 3NTVA 2W6MA 5A7GA 1M2KA 4CMHA 1EVKA 3K15A 2V7UA 2QRZA 4MQ5A 4FMDB 2C1ZA 1ZXBA 2QPLA 4JYCA 4R1QA 5DK4A 5IYZB 1Z0ZA 4GR4A 2Q5LA 2ZBFA 1ZDMA 4LTNA 4WAUA 1PUXA 1U4NA 2JPDA 3BBPA 3NHZA 2PNJA 3TECE 4RGYA 2DR0A 3E2IA 3MWEB 4MV3A 5LA6B 4ABYA 4YNBA 4ZU3A 4HB2A 4JHLA 3KDAA 4ED9A 4FD3A 3RQSA 5KWEA 1SJ9A 3V7WA 2HB6A 4E15A 3HXOA 4Z51A 3V42A 1PQYA 1XR3A 3Q3JB 4JSTA 5FF9A 1ZVJA 4EO4A 3KJXA 3AEQA 3JVIA 1ZU5A 4EZBA 2HF7A 2ZL6A 4OMCA 3G05A 4Z4QA 1Y37A 5DTQA 3SC2A 1BFDA 1E6LA 4DLTA 1UBFA 5KTKA 2LPMA 2X3UA 1RPTA 1RJEA 2GEVA 3OZTA 3O7WA 4MYRA 5E9WA 2A9RA 1EU1A 2R6JA 2ZJ6A 3NHYA 2I6GA 3QPUA 4CHGA 1Z4QA 4JC5A 4BQFA 3LPAA 5IBPA 1XT6A 4FMCB 4IEFB 1UADA 4E33A 4QG3A 3IXMA 5LC1A 3GR6A 5M7EA 1AD2A 1NLYA 1P1HA 2XGSA 2R6R1 4RJIA 2ZSUA 3DL7A 4OBBA 1PLKA 3DV0A 1JR3A 1U1DA 1V2HE 2VRCA 3KBOA 1PSDA 2Y0BA 3E53A 3YASA 4NBNA 5BQ3A 4HI0E 5CDFE 1RT9A 1ZNZA 2JGRA 1P0PA 2D7JA 1HLDA 4FFBA 1FK8A 1NUAA 4TLBA 4X7FA 2JZCA 3QEKA 5ICCA 1R0YA 3JQ8A 3PNBA 1H3FA 5E3IA 1E2PA 4KI7A 2JAXA 5JNTA 2QT0A 3A70A 4L07A 3VO1A 4Y9RA 1R4AA 2FOIA 3NJRA 3QVGA 1XTPA 3V8MA 2WK1A 4TVOA 1EA7A 3IEIA 2FSVA 3A6KA 2J33A 2GB4A 1U8ZA 1QC5B 3ZD6A 1K0UA 4B3HA 5E1OA 4P12A 1QZUA 3MWFA 5C8YF 1RQLA 1K6MA 3AIOA 1V7PC 1XGKA 3IL2A 1BYUA 2WA2A 4FCVA 4BO2A 3JWHA 4N8EA 5KNLA 4TZKA 3PUZA 3RVJA 2DY1A 5G4LA 3EIWA 1NR7A 4J0EA 1E9RA 3LUFA 4LY3A 2C99A 5CLLA 3MK31 2AI1A 1QRUA 2RBGA 1AKVA 1DBSA 4UBIA 3MGAA 2I2XB 3ZOKA 3QMVA 4ACBA 3F4KA 3OE7A 2IPNA 4PZLA 1P45A 2V9ZA 2CN1A 2A9PA 3CBGA 3N5CA 4F9GA 3TLZA 1YJCA 2ZM5A 2J30A 2KHZA 1NT2A 2HZBA 4NRDA 3MUOA 4C4OA 1J7JA 4OGFA 2XNCA 3UPTA 1M90D 2VNHA 2O0LA 3GZ4A 5TMPA 4H4CA 1GTSA 2PZMA 5GY7A 4D0SA 4OXYA 3A3KA 2FMFA 3OAAA 2V55B 3ROZA 2YH2A 2YIJA 3G8DA 3QLUA 3KSAC 5F4OA 5F2EA 5IT0A 2QTBA 4ZI5A 5DNYB 3W3AD 4DJDC 4BEVA 1ZK4A 4XVUA 4DJ5X 2FN9A 3P9ZA 4BLTA 5D3QA 4UQLA 3ABQB 1RWNA 3FUTA 3FWKA 4B3TB 4BKUA 3ISTA 4V0LA 2HA7A 5JRDS 1BXZA 4K05A 3RO7A 3KZOA 2GEJA 1JYEA 2QPOA 3OLQA 3WYBA 1KK2A 1WM1A 2VQ3A 3QXXA 4P0PB 1E9VA 1V4BA 2II6A 1YVUA 3GLKA 3EWAA 1F8XA 1HQDA 4JKYA 2G6TA 1JPNA 3DFMA 1QTRA 1SBQA 2W11A 3H3FA 3JYNA 4TS9A 3M6WA 3ZN2A 3ZCSA 4I1SA 1Y6GA 4LDJA 9ABPA 1M8PA 1MO2A 1R10A 1MMFB 1OQAA 1A9SA 4Q21A 4XYLA 2GJKA 3PNKA 2CUNA 4BC0A 4EX7A 4P7KA 3C14C 3ZTTA 1QH8B 5FV4A 2YXEA 1YO6A 2B4YA 4OL9A 4U7TB 1EWKA 1H9BA 3ONFA 4C0SA 2C0QA 1CJTC 1S96A 4DR7B 1T2EA 3GRCA 3ZD7A 1BX3A 1ZCZA 3VOTA 1JVSA 1XU9A 1NM5C 2VHYA 3UC5A 4PO8A 3ZCRA 1PUJA 1X2BA 1ACMA 3C3KA 3AR9A 3G9UA 3E5RA 4QOHA 4ZARA 4HAOA 4MO9A 4BN0A 3MJ4A 3JU4A 4GOKA 1IY1A 4URYR 3JQPA 2CVZA 3FNFA 5G02A 1IJFA 3VH2A 5I45A 1ZK1A 4FFRA 1VECA 4IO0A 3C7TA 3Q88A 4OVKA 4W1QA 4CM7A 1D2EA 3CKYA 2ARKA 4M88A 2KM1A 2CT8A 1I6LA 4Q39A 1OX4A 3IPXA 1QIGA 2AYZA 2ESRA 3LQYA 4NU0A 3UPUA 2RCYA 4CLDA 3IV6A 3DAHA 3ZHBA 5JS8A 4FI3F 1Z5NA 2ZAOA 1VMAA 1L7RA 5HXAA 1TMGE 2C2OA 4WZBA 3SSAA 4F1JA 5BYKA 2YASA 2VJKA 4J9VA 2XQGA 2XQIA 3X1ZA 2QUAA 2YVUA 3JQBC 1OI7A 5F98A 2AE1A 1YE5A 3W6PA 4WOPA 2JZNA 2AH5A 3EC2A 2WMNB 3T52A 4YCSA 4JP2A 1NZDA 3PUHA 1XA0A 3MJCA 2HLDD 1HE8B 1CIPA 1ETHA 2PAFA 5HTKA 4GI2A 5BSMA 1JIJA 2UDPA 2DFLA 4Q34A 3VUFA 3DDOA 4EWLA 3U7FB 1INLA 1DXQA 2W93A 3I42A 5MFPA 1C9MA 2Y1GA 1MJGM 1U0HC 4WFKA 1L3IA 3A2MA 4AQDA 2JIZA 5F23A 5JAOA 3FTQA 3TRIA 4ID3A 5ALMA 3I23A 1JQKA 1AQNA 1O7JA 5K3BA 4PYKA 1ZUWA 4QTZA 3WZMA 1KC3A 2ZYUX 4JI2B 4DC0A 4YRNA 2WYWA 4BYGA 1GZVA 1Z4NA 3EZXA 5I7EA 3UJHA 3WDLA 1XEWY 3THYB 2C3MA 4W5QA 4IJQA 4QPZA 2B21A 4F4JA 1HC7A 4ILEA 2W2KB 4JJGA 1HURA 1UKEA 2GN1A 3GUYA 3Q0EA 3ZVLA 2H51A 2XHEA 3IJEB 5AW0A 4YAOA 4O2AF 4EG5A 4K6GA 4PFJA 5BSEA 1L4UA 1ZG3A 1ZAYA 2V3CC 4YQYA 3GZNB 3VNAA 4V2UA 1TUEA 2HLHA 3ETDA 4HH0A 3KJHA 4W9NA 3V7YA 1E94E 2DUJA 4AS3A 1Z0KA 2O48X 3M4NA 3M33A 2NSJA 4ZTZB 3EGVA 3ZDXB 1UK7A 3CEHA 1JI0A 3ADCA 4FT2A 2IA5A 1OMOA 1WPQA 2XDQB 4DREA 2O2DA 1IM5A 3BILA 1GKLA 2DJ5A 1D04A 1R88A 3C4VA 4IIJB 4DNPA 1M73E 4YBRA 4ESOA 1EZZA 2YW2A 3JZAA 4X63A 5KOJB 3N75A 1UDWA 4OQZA 3W4JA 4JUDX 4N18A 5F7OA 1MEEA 2RH5A 3WYEA 2X86A 2X8BA 4WCFB 1K7YA 3WGMA 4BRWA 1V0JA 1XBTA 3WQZA 1VCNA 3MWYW 2KB0A 4ZVLA 2B8WA 5FUXA 5J1TB 5K2OA 2ZAIA 3VPAA 1BX1A 1P60A 5CH3A 3VRHA 3QKIA 2RC5A 1H0RA 1WDLA 3SSMA 1HT3A 2XOKD 3QQPA 2VDVE 1Y6JA 4PHCA 2YDYA 4LNHA 5LP6F 3V4RA 1SIBE 1A88A 2GYVA 2NPOA 3TG8A 3PHJA 1OKKA 1Z26A 4YRQA 1QCYA 1TK9A 3AF4A 4RU1A 3LUDA 3LG2A 5JE8A 3PX7A 3WNDA 3GEDA 4WTOA 1N4AA 1SPBS 3EIHA 5BWMA 2R1TB 4XJSA 5DM70 3UEOA 4YLYA 2OHVA 4XA8A 2XUGA 4TX1A 4CIWA 1ABFA 5KYNA 4ZYYA 7YASA 1QV6A 2BONA 1B15A 2NU6B 4KPGA 1T10A 3I5YA 3GJZA 3AWIA 3RUDA 3T9CA 2XSZA 2F17A 4CF4A 2JIMA 1RJWA 1N3BA 1V6SA 2XAAA 4LZZA 4AJPA 3FDJA 4GR9A 5H0IA 2PSEA 3FFTA 2VK2A 1JR3E 4G07A 4QBIA 2O8BB 1UJCA 2ONYA 1BDBA 1XWFA 2I34A 2Q9BA 3CCEB 1RI1A 4E0FA 5FA8A 1SNYA 3HYRA 5IC5A 9LDBA 1XJ0A 2VSQA 5B7QA 2RG1A 2VP5A 3HCEA 3CSSA 4RXUA 5EMLA 5B3KA 3VR6A 1T1GA 1TK2A 1TL7C 2IUEA 3AWDA 1MBZA 4UU7A 1Z2DA 4OQLA 4EUSA 4DDTA 2R84A 2F8LA 3FMOB 4F7DA 1AY0A 2ZUVA 2NO0A 4PYQA 3S40A 2WF5A 3NXKA 3D6FA 4Q9NA 4HB0A 1PFWA 3W6ZA 2XMSA 1R9JA 2B92A 3CW2A 2NUBA 1YKGA 1A8HA 1EDZA 4JUFA 1GT6A 5AK0A 3IKJA 1PQWA 3MILA 3N8GA 5EIWA 4K9NA 4EKDA 1RKVA 1T6NA 3KM0A 3OF3A 3U4AA 1Z0FA 2I2BA 5G0WA 4AQYB 1USGA 3WQQA 3KD2A 1N9ZA 2PRSA 2WABA 4LZOA 3K4HA 2AUNA 4MP6A 4MUKA 3NANA 4LIPD 1N77A 1H2XA 4EMSA 1VHEA 1HEIA 2H4JA 3AM4A 4BTEA 3R7BA 2VBVA 3M5WA 3ZY5A 2OWEA 3FSEA 3FPJA 4PR3A 3DWEX 2X19A 1SUPA 1RWOA 3KTOA 5F78A 4MYSA 1I9CA 2XB4A 3STHA 5JXIA 4MJ7A 5HNKA 3QOWA 3ANYB 4F9FA 4RSRA 1YC2A 1U3GA 1NATA 2OCKA 1WRBA 5BT9A 1JECA 3IIIA 5BT8A 1PJ5A 2FR8C 5FJIA 5KVSA 1T6ZA 1DRVA 1KI7A 2X2OA 2BEUA 1CLEA 1NXWA 4YALA 2GHQA 1UBMS 3ZLBA 5L6MB 4TLAA 4W5OA 3D6NB 4BFZA 4DVGA 4RPLA 3QMMA 4X1YA 4UTOA 1TUBB 2QVYX 2VT7A 3EBPA 1VA5A 4TOIA 1NQTA 1GWNA 5DX0A 5B3JC 2GHIA 2IHUA 4TLLB 4WE3A 1JMYA 3PZBA 4G4SP 4Y1RB 1P6UA 3WGTA 3CURA 1R9NA 1LSOA 2C59A 3AZPA 4IMRA 5IM5A 5BOSA 4QUIA 4EJFA 2IVZA 3M0EA 2CDNA 2G80A 1R00A 4OQQA 2FQXA 1OT5A 3JQDA 3LQ4A 1ULUA 1PJ3A 3ZDFA 4QT0A 2V9CA 5CM9C 3ZZ1A 4LHEA 2CKMA 3A9TA 3ECSA 4KQGA 1EWYA 4NTZA 4R5HA 1JXOA 2ONKA 4JBXA 5EZQA 3PHIA 1CNFA 2JEZA 3JWPA 2O8DA 1PNTA 1T36A 2PGOA 3TNFA 3MAGA 1JLHA 2COUA 3JAMA 4ZO7A 2FPUA 4HX9A 4M9QA 2F1LA 3Q41A 4TMXA 3HBMA 3S29A 4MUFA 4PBSA 3ZBPA 1GZDA 3SCZA 4PN7A 4FU0A 1EJBA 1C3OB 2PJUA 3IP9A 5C8YA 1OLUA 2ZB4A 2HFJA 3F4LA 4BFTA 4KBFA 1Z73A 1TT7A 7MDHA 2LTAA 1X86B 2G06A 6ADHA 3G23A 4ZDIA 1GQQA 3NTOA 1ZN2A 1U2DA 2OBTA 1Z0AA 4U7WA 5BMVF 3MTDA 2PIAA 3GGSA 3Q7IA 3GPIA 2BMVA 3IEPA 2AEMA 1MDBA 2FPPB 4RXTA 5J4VA 2PUBA 5EKTA 2H5LA 1TM5E 3OQ6A 4L95C 5IYRA 1G1MA 1PJZA 1YQ9A 3QLTA 1H4TA 4RANA 4NC9A 2PS1A 3CU5A 4EI8A 4YRSA 2XNDA 4PZDA 5E9AA 1PO7A 4AS2A 2D3NA 1F6BA 1LV8A 1NBOA 4JB2A 3L93A 1I01A 3I55B 1G66A 4QYWA 1ZM2A 3S7ZA 3CM0A 5FQOA 1HFKA 4DKJA 2OCYC 4HDMA 4LYDA 2G4VA 3QUSA 4WZBE 4P92A 2J3DA 4DT1B 3NDBB 1IPEA 5B4VA 2HC9A 1W0CA 2IZ0A 3TKLA 2DP4E 4WECA 3PQ7A 4P5PA 3V9PA 3SQWA 1ZD3A 2CFCA 2IEYA 3RSSA 1JPUA 3TXAA 3QYFA 1UD6A 1NKSA 2VBFA 4HPXB 4X6LA 5LJLA 4JBLA 3BYZA 4LY6A 3VNSA 3PIRA 4ZQIA 1SKBA 2Q1WA 1TAHA 4CTKA 5H4GA 3EGXA 2OXRA 4MCHA 3WJ2A 4WLFA 4IOMA 1BYIA 5D1NA 1YQWA 2PSDA 1HQYE 1I30A 5BR1A 3SEFA 3SZGA 3T3OA 1BHSA 2AD1A 2O2JA 2OCIA 2PANA 2V7VA 4IOJA 3LQQA 5GPBA 1KY3A 2IYZA 4RA9A 1MENA 2V7QD 3KXPA 5FCDA 3MTQA 1JAZA 3T5MA 2MSNA 2W71A 3SJUA 5CCXA 1E66A 2BGUA 2GF2A 2XMQA 1ENYA 4N3NA 2KWIA 4K5QA 4KLNA 4YUVA 4YRMA 3T1TA 4BS9A 4PHHA 4D3ZA 1P3DA 3IVAA 4X97A 1GAWA 3TTYA 2Z58A 1GPH1 1AZLA 2DPXA 4A8PA 1UL1X 4QHTA 3U6BA 1M8GA 3M5DA 2C20A 3VU3A 4MIEA 2Z3VA 4DLZA 1OE0A 3NBKA 1LBHA 2HRRA 4MRSA 1LDMA 3LZDA 4WBNF 1AGXA 1O94D 2ZYTX 1W85B 2HMAA 3ZXYA 4MEAA 5A4DA 3OIWA 5THKA 1UJ4A 1MVLA 4NATA 3TW6A 4CR7A 2BRUC 2QG9A 1I4DD 2Z1DA 3GLTA 2BR5A 4V0NA 5L40A 1G8AA 3TQFA 4FFNA 4A0QA 2OAGA 5B57C 1OFIA 3LDFA 1TC1A 1QYCA 1B00A 3AHDA 1MOQA 2FPWA 3B1ZA 4KUEA 4LXXA 5LUAA 5IUJC 2JIBA 2F8SA 1P9RA 2A1IA 3NTQA 3P9SA 4HX5A 2JAPA 4IUBS 3FVQA 1G3RA 2MCFA 3VZCA 4L85A 3B3AA 1ID1A 2CD9A 4OI2A 3O73A 5FWXA 1DEHA 3KKQA 5FB3A 1TJPB 4H1WA 4M6WA 5JLAA 2LIVA 3F90A 3GLGA 4N9QA 2QYSA 3KQHA 3MOGA 5AI5A 5DW3A 3PC8C 4IDDA 2GLTA 1C8LA 2LZJA 2ZZGA 2C4NA 3ITKA 3JTEA 5JXJA 4BFSA 1NJ5A 4U9HS 4N9WA 3GPBA 3OLVA 5T3UA 3TLMA 2WAOA 3PT5A 3IMFA 3ZCXA 1TJ3A 3CKKA 3IE2A 1GYRA 2H9AA 5FOSA 2EHDA 3EVFA 1COWA 5FNVB 3RRMA 1F4PA 3HP4A 1VQNB 2G76A 4MUBA 1PW7A 1M76A 1O6ZA 2NO7A 1DJOA 1BXRA 3H7AA 3NFYA 4H3KB 2XXBA 1DIHA 4HDRA 4W63A 4B3SB 4TROA 4BX2A 1KDTA 4M0DA 4LNUA 1WOPA 1Y4AE 2XMCA 4ARUA 1W52X 1NIPA 1MX9A 3F1KA 3G68A 3L8DA 3NDPA 4QDTA 3REOA 3CINA 4EO7A 1NRWA 3BMCB 2JGMA 4ZU6X 2E7ZA 3D59A 1EUYA 4JKOA 2G3YA 2EL7A 2WYVA 4KU4A 1W9XA 3GOHA 1QSGA 4NABA 3WKCA 3KQNA 3THWB 4ESHA 2E4XA 3CW9A 1YSCA 4PN3A 4ZVRA 3VJKA 1XAJA 4ZA2A 3MEQA 3DT9A 3ODPA 4X60A 1JJBA 1TCCA 4C4SA 4MNTA 3K20A 1Y1RA 2X8WA 4KQ9A 4LECA 4OBXA 3WQRA 1XRNA 2UYCA 1U0LA 1QX4A 2EWVA 2MSDB 2YFHA 2WVGA 4O2AA 3AM1A 4W99A 3WIDA 2PGNA 4KFTA 1PS9A 3IMGA 4DJFC 5DMXA 5BRAA 3HB1A 1A72A 1LCIA 1UQUA 1V11A 3DKVA 3FLAA 2QU8A 5H68A 4O2RA 4QBFA 1N1EA 5JS7A 3E5MA 5KNBH 5KU1A 4ZCTA 1DAKA 1YS1X 5TF4A 1CULC 1ZD1A 2GZAA 5M29A 3LWZA 2VYNA 1N32B 2RAPA 4D8VA 3WYNA 2ZZNA 1NF8A 1Z6YA 3FYUC 3SYKA 1XQ1A 4EGAA 2EWWA 5KWJA 3DPUA 2B8TA 5H83A 3WJAA 2NZVG 4QQKA 5IRCD 4FYKA 1U0SY 3BXOA 4CGZA 3WLPA 3VHXA 4M1TA 4H15A 1VPVA 1QCZA 3INNA 3W7BA 1NFQA 2VDMB 3Q8XB 4FDUA 2B82A 2QEQA 5A7HA 5AVJA 3SR4A 4IDAA 2ODNA 3AI7A 4NZZA 2NVUB 3MAAC 1XIVA 4P3IA 1L7NA 3O82A 1VSUA 5LP6A 2C94A 2BFMA 3DP9A 4LX8A 3VPDA 3X43A 4PZ9A 1HLPA 2CD7A 3UJ9A 2VBCA 1IY9A 2OM2A 2YVQA 4KUGA 4MKXA 4MMYB 4QPPA 3MIIA 4P58A 1GN9A 1YL7A 2V8BA 1IXSB 2DBYA 3RYIA 4ND8B 1PR0A 4UNRA 4N3AA 3AESA 3AY3A 4PBRA 4TL8A 3ZZTA 1RLOA 3ME5A 3OHMA 5COQA 3ZHOA 5BSGA 1KC1A 1WXFA 4P4SA 3P26A 2Y77A 5I9LA 1C0PA 3I52A 1NOKA 5TQVA 4LF4B 2QM8A 2GUWA 3DTVA 4R7ZA 2IEZA 1W88B 1T2VA 3INRA 1F0KA 2N1MA 4L6IA 3JD1A 3PGXA 3JQGA 5A3SA 3TNYA 3OZEA 4B47A 1KI9A 3C8ZA 2CZQA 3T12A 2C7GA 1NVUQ 1KU0A 4RA6A 5JH7F 2RH9B 3UUGA 2AOUA 2A1TR 2ZRPA 4MIYA 5AKGA 3X1DA 4AZ0A 5KSZA 3TN7A 2PFKA 3U4MA 4R0MA 1BROA 5KC8A 1QB8A 4K40A 5HFNA 3NWPA 2FDCA 1W35A 3I3OA 3L0SA 3ZLVA 1Z7GA 2VBUA 3BFVA 4BFWA 3SLDA 1IOWA 2CMFA 1H0KA 2QUHA 3GT3A 4P33A 1VLHA 2CLKB 3B7PA 1WSAA 2CLCX 3INTA 1SA0B 4B44A 1V6CA 4HEA1 5E1BA 4LZJA 5SYMA 5CURA 4DCSA 1VB5A 4P0TA 2P6PA 2ZRQA 1E96A 2CXNA 2PX3A 5I47A 3R9XB 1PFGA 3TPCA 2MMCA 4HGQA 4RVUA 2P6RA 4IXNA 1RIIA 1Q74A 3NIFB 3QFTA 4QHSA 4FILA 2AV6A 2Z2XA 4JUBA 1B14A 4NZ9A 2SKDA 4D79A 4JL5A 4K9KA 5F2OA 4JLJA 1ZKMA 4OJNA 2BN4A 3OPNA 3GOQA 3RGWS 2NZXA 3VR3D 4Y6PA 2BMFA 1NG9A 5DNDA 1OXKB 2AKEA 2XKBA 4K6KA 3MYYA 4NENB 2ZZMA 1CY8A 2I4MA 4JS0A 1N08A 2F4NA 1A9OA 1NBAA 1SULA 2GZMA 1NBHA 5D87A 4NBSA 2H4YA 1AQUA 1IZ8A 3QVOA 4CCAA 1MG0A 2IU6A 3KV3O 2PZKA 2DWPA 1ZIDA 4YMIA 3CLSC 5G0UA 3ZUPA 5A4KA 3KQVA 1OFTA 4MW6A 5J23A 2YY7A 3HYTA 5FFFA 4HD8A 2BTQA 4J1NA 4BFUA 3SX2A 3CZQA 1NTOA 1N07A 5CCBA 2GD0A 3KKLA 4XONA 3DKKA 4AMZA 3AG5A 5U4QA 4ERNA 3NXSA 4QULA 2LXNA 4RJKA 4PYJA 5B5SA 5JNLA 1F0NA 3EXHA 1KRHA 1AMUA 3L0OA 3ASPA 5AN9A 1EUZA 4U6NA 5KJ1A 4BL5A 3KHKA 1G9SA 3P9QA 4ND2A 1NMYA 1Q14A 1NB9A 2FSHA 2VJYA 3C8MA 3QFRA 2FPGB 4J7XA 4ZRNA 1JN0A 1ORDA 1YDHA 4NCNA 4Y2JA 5LDGA 1YR2A 3PWTA 4Y6LA 1LVUA 1XVIA 2QTLA 1OFUX 1EM6A 1ZD9A 2Z1NA 3LCJA 3MBKA 1X1CA 3V2UA 4ER3A 1GGMA 4GECA 4KQKA 4MI9A 4F84A 3MWGA 2E4AA 2BDTA 2C7RA 3WGJA 2AT1A 4JBWA 3N8DA 4H08A 1TJ5A 3ED5A 3ETCA 2X6XA 4EGSA 2W2XA 1QG2A 3GXOA 3PLNA 3A6ZA 4XDGA 2AQHA 3USZA 1NMQA 2RHDA 3U4GA 2C9DA 4PAGA 3SEAA 3JYHA 4X91A 3PT9A 1ZZGA 4DNFA 2BUBA 5EXXA 1RLUA 3P9CA 5IABA 1BHJA 3VC3A 2WAXA 3PEEA 1VBKA 2FWJA 4RDHA 4AJ2A 5BMVA 4GNKA 4D97A 2R1ZA 4EKNB 1N5KA 1XHLA 3LUBA 3ONWA 4Z54A 3F73A 1LPPA 2IZZA 5GVRA 1Q0LA 4B3FX 1AF4A 5AW2A 1N7IA 4FMBB 2QENA 4Y0VA 4YWJA 5K0TA 1AJEA 2VPIA 2B7LA 3QF4A 5G40A 5IYQA 4NARA 4DDVA 4QUBA 2OFPA 4O59O 1UBOS 3PEVA 1BG6A 2ZPTX 5KO2A 1I4LD 1XYVA 1FPQA 3GLGE 2ATVA 2SECE 5C7LO 3HJUA 4QUDA 4UBMA 1G16A 2GJ4A 3QWIA 1ACJA 4JIMA 1SBZA 4ZEVA 5SY6A 2W43A 3ODGA 5AW1A 4BVBA 1DUSA 8ABPA 2R60A 3BL5A 1H9AA 4X41A 4WA7A 4H7HA 4WKCA 5IAKA 3HUFA 1J0XO 2O9JA 4OTZA 1O03A 4X3CA 3R76A 4GZ5A 5ALGA 2XB2A 5GZ3A 3AUXA 3H11B 3U3RA 4HMPA 3N3AC 4FFPA 1CK4A 4FEYA 1NWCA 4V39A 4WT7A 1EFPB 2H4FA 1GILA 4CM1A 3MMSA 4LHWA 1U9ZA 1DG3A 2XNKA 3F3KA 4GT1A 4BIMA 2JLXA 3RC8A 1RKXA 1Y1QA 5CYGA 2Y67A 4F5ZA 3WADA 5KB3A 1GG5A 1SVIA 3NIGB 1ODSA 3IP1A 4MVJI 1F8GA 3JASA 4J0CA 1QIMA 1SD2A 4LTDA 4B4KA 3UA4A 2I33A 1JBEA 1GU1A 2AJCA 3FPCA 1VCOA 2UUAB 3AGPA 1E5LA 4AN0A 4LVNA 3EEFA 4C04A 1VG8A 1U7HA 1SXGA 5TT1A 4J90A 5IKOA 2ZWVA 4NDNE 4RHTA 2ZI5A 1SD5A 4M99A 2GO7A 4IVPA 5C1PA 1FRQA 2OQRA 1QK5A 1MP0A 4DJAA 4A8JC 1VM6A 3IQXA 2I22A 4WBNA 2CNWA 4ZHSA 4XUEA 5EXDA 1YRLA 3E48A 4LPKA 3CPHA 1E2IA 1RMTA 3I2FA 1K6EA 1UKCA 2BSXA 2YVLA 5IUNC 2GI4A 4CCYA 3AEYA 1GDDA 3B1XA 3TIGA 1J07A 4AWBA 5JNVA 1M75A 2I6XA 1UWKA 2CVFA 4MRVA 4NKRA 4WESB 4XSVA 4UNNA 3VR0A 2R7LA 3BFJA 4QD3A 3HN6A 4TUYB 4KLAA 5LCXA 3AVWA 3ZY2A 1DAOA 4J1QA 2EFCB 2CLFB 1E6MA 1YVDA 3L6RA 2XE6A 3VYUB 4PX3A 3ZVRA 1P1FA 3HU1A 2ZRKA 2YHBA 1FLDA 1UXKA 2HDWA 3KD3A 3WIOA 3O2JA 4YUYA 3SEJA 4PCVA 3J80A 1FDSA 1GT91 2JHAA 1P44A 2BH9A 3MT8A 1YB1A 1P2VA 4R1TA 1C2YA 2B0JA 5CW1A 4ND6A 1EK2A 1A8SA 2I80A 3N74A 4MVJD 2PD3A 2Y0DA 3WB9A 2NLOA 3RREA 2WG2A 1QG0A 1DEKA 2BKLA 5F1PA 2PFGA 3D5EA 3JQ7A 3RVOA 1B0AA 2O7QA 3BMNA 1G59A 1MQAA 1N3IA 5A62A 3EVZA 3GCGA 2XHZA 1CDZA 1ZH0A 2FUG6 2PKYX 3KEGA 5JRZA 3CUEF 1NRXA 4WDRA 3F8SA 4U02A 5IAAA 3AJDA 4FHFA 3IAS6 3Q4GA 3TEMA 1KEZA 5JQGF 1USUA 2OZLB 2GDJA 5BSYA 3DHWC 3IVMA 4HAVA 4WMLA 3T1HB 4YVFA 3ZWPA 3PF8A 5D00A 4KK4A 3QJGA 4HZIA 3O8QB 3FPAA 4YV0A 4D56A 2CHVA 4O3FA 3CSUA 4E5NA 2ANBA 1J0DA 2E4UA 4DB2A 1TQ6A 1U1GA 2V5UA 3W9BA 2PUGA 1JW9B 4HGRA 1IWPB 3OIGA 1XQVA 2OHGA 2WIJA 3HEAA 2QUZA 4K7JA 2O2IA 4AM8A 1BEUB 1DHTA 4FQ8A 5AKJA 4EJSB 1YL6A 3ZWMA 2F90A 3UW1A 3FUVA 5B1SA 3W2TA 4D9IA 4Q0MA 5C1DA 4EI7A 4KRFA 2C4MA 4JB0A 4YMHA 3NLLA 2DG2A 4FTWA 5AKLA 2J7PD 4WOBA 2A0WA 4E5UA 4GXTA 3CN7A 3FHOA 2BC9A 4UATA 2AJDA 1T3GA 4JR0A 1N4DA 3ACDA 3H83A 2YJNA 1NXOA 3MWJA 1TD1A 1GKIA 2AR0A 1FJHA 4B7AA 1WNFA 4QNMA 4J75A 3L41A 2H4HA 2W2OA 3E3MA 3H8JA 4UARA 5IK2D 2PZ8A 4UHDA 3KR9A 1G2OA 1KSJA 1ZEJA 2JH3A 1DL5A 3JPYA 4HQ0A 4KWTA 2DKFA 4ZVNA 3VR2A 5HGXA 2V74B 1TQ4A 2ZCVA 4PLPA 1DDOA 4IGIA 2D59A 4BQOA 2HFKA 1UPTA 3GFRA 4XE5A 4XGQA 3DMNA 3EF0A 2GD1O 4OPSA 5GV8A 4HGPA 5DTEA 1B76A 3RWMB 5AXDA 4D9NA 2HJVA 1KP2A 4RPDA 3STYA 1YI2B 1U7DA 5TV2A 3ML1A 5A0FA 3I2YX 3H1FA 2YWXA 4UVHA 3ZY3A 4ZGWA 1TQ8A 4G0VA 1FUKA 1ABEA 2O3TA 3GRUA 3M1IA 1KRXA 5CVUA 5D6NA 3HVIA 4MPDA 2LR0A 4NJMB 1N9GA 1T4BA 2A67A 5HP4A 1H8ED 4WLOA 4EZEA 2JLUA 3NU1A 4RM0A 2I7TA 4WKBA 2HMUA 1JZTA 1O87A 2GJRA 3A4YA 3S7TA 5EKUA 1P33A 3QE3A 3UT5B 4EGCB 1YFJA 4F1KA 4I1PA 4UEJA 1OIVA 1QOQB 3QU2A 2PUEA 2I6SA 1UXIA 3O4HA 1U3WA 2J6IA 2PGJA 3T94A 2J4CA 4J1TA 5KAPA 3DMRA 3LQRA 1IAQA 1KBOA 1RXIA 1AUPA 2BJVA 2E48A 4EBFA 1I5RA 5LU8A 4P6YA 2Z6UA 3W04A 1H1DA 2DSTA 1D9ZA 2I4LA 3CGWA 3DWFA 3ZDBA 3HEMA 2QN9A 1U5BA 2DMRA 2C5LA 4L08A 5K3FA 3MCVA 2O0JA 4MV4A 1SFRA 4CQJA 5A5DA 1J90A 4X45A 5JAIA 5JH7A 2EX4A 1YE3A 2HV8A 2NPIA 5E3JA 2C3OA 2LZ0A 3AF1A 4CLOB 4M0UA 3UF0A 2ZOSA 4INPA 1VKJA 5BUZA 5C31A 4J43A 4WUVA 1K7EB 3F6EX 3O4GA 3EGEA 3UTDA 1XZKA 4JA2A 1OY1A 4U8GA 1J5XA 2HTEA 1JQ5A 3I73A 4B6SA 1TK3A 4XQEA 4I5DA 4M46A 3CFYA 1PT7A 2JAHA 2JVJA 2Y92A 1SVMA 1R6VA 1XTRA 1X1DA 4ZAFA 2VPZA 3Q1KA 2J0SA 5B53A 3RAEC 4RV4A 4FFVA 2XB9A 3U60B 2GR9A 1SKYE 2P9FA 1M3SA 1XRJA 3KOOA 1ICIA 3PQ4A 4OUKX 5T6BA 2DPGA 5D7BA 3C6XA 5JJLA 1TQHA 3R7WA 3U09A 3EB9A 4XQ9A 2PUDA 4OHWA 3UKJA 2QRVA 5AHWA 4BVAA 4YQFA 2FSIA 3ISXA 1YUBA 5DVZA 4WZKA 2I4NA 2W6JD 2AR9A 4Q12A 3P2JA 1YRAA 2H1VA 4JJIA 5C8ZA 4CF7A 2GCIA 3F2IA 2QAGC 1CZHA 1DJPA 1V3UA 3EOAI 1JA0A 3REQA 2BZSA 3BFXA 3U0VA 2NIPA 3C41J 4YRLA 1LBIA 3LRPA 3M70A 2VNJA 2VA8A 1K4MA 3BGVA 3H2BA 3HU5A 4ZDJA 1UD3A 4R2HA 2XV1A 3E58A 5FR1A 5L7YA 3TCXB 3WK5A 3WMEA 1IEXA 4DR4B 3D1VA 4H16A 4DXDA 2DKNA 3KB2A 1YMVA 5CA0B 1K92A 1RE1A 4XDHA 4ZV4A 2R5NA 1WPCA 1RP1A 4TKOB 1EUDA 4UVGA 4LDZA 5KYGA 2NYUA 3A9UA 4K03A 2HQSA 5BVGB 3P9YA 1WV0A 2YFYA 4UHFA 3O90A 1QLJA 3ADOA 1P9WA 3IGFA 1TU4A 3QBTA 4EKGA 4GMDA 4GS5A 2IH4A 4Q19A 2QL6A 1ZR2A 1CDDA 1JKXA 3CMAB 3C1OA 4RPIA 1X1EA 3EX7C 3EZ7A 3NGLA 4TTQA 1OI4A 3EGCA 5J9FA 3VR1A 5HHTA 5BR8B 3UVEA 4O3MA 3LYAA 3EIQA 5ALFA 4OUDA 1DTWB 1UIMA 2Y8EA 4R9VA 3TQIA 3RM3A 4I3FA 3GN1A 5HOQA 4REMA 2AB0A 1JJ7A 1NX9A 3KC2A 4BN5A 5JAHA 5JMTA 1D1QA 2EAUA 3H1EA 4XGRA 4BKQA 1KYTA 3NAZA 4NSNA 4I1VA 1BEEA 1K9VF 2P2CA 1BOFA 1TIKA 3HRHA 1J9GA 3MQ2A 4FZ3A 3QVXA 4GPEA 2QL5A 5PGMA 4AUKA 2JLWA 4NCHA 3LOUA 1ODCA 1KMHA 2J3HA 4AX8A 1WULS 2JRCA 2PH5A 5F2KA 3VAYA 4G0NA 3ESYA 2ZR0A 4ALJA 2V7EA 4LK3A 4E6PA 2HPVA 2NYRA 3RC3A 2BZ1A 1IQ0A 4PRZA 3RHFA 1VKNA 2W6NA 4OH7A 2RHMA 3DP7A 4S1PA 1A7AA 3KR1A 1BOOA 4N7BA 4KAFA 1K3UB 3HSYA 1J2EA 4UBJA 2VH2A 5FNZA 5CG1A 1SXJB 5HXBA 3ONUA 1GQOA 1E9SA 1JV2B 1NJGA 4UMEA 2ZBEA 2NU9B 4BDTA 1M2OA 2OOSA 3A6FA 1D1PA 3MFQA 3QI7A 1Z25A 1R37A 1D2MA 2DBRA 1XFOA 1FDWA 3LO5A 1SZPA 4RVOA 4AIRA 4EFLA 1RBYA 4WPGA 1Z29A 1QE5A 2PTGA 1XQXA 1GPBA 2IPAB 4MVXA 5B55A 3ZCUA 2CL5A 3R6WA 3ROFA 5CB8A 7REQA 2ZIGA 2NP7A 1VLLA 1BXKA 2AFVA 1ISSA 3GDGA 4NS1A 3GP3A 5LQCA 3WLNA 4AMUA 2AI2A 1MV5A 1L7PA 2YXNA 1W7AA 4L28A 5FOTA 3DR5A 4CFSA 2C5FA 5FL7A 3LMKA 2O57A 3M2TA 4BNHA 3U4QA 4PY2A 2NXCA 3RJTA 4TTJA 5J58A 1T0UA 1UMBB 4OF4A 3I9MA 1QF9A 4E09A 4HQNA 4BJ5A 3HDJA 3PGKA 4QLOA 4PZZA 4D5EA 1B41A 4AXBA 1L5RA 2BE9A 1NJ6A 1JJVA 2FX2A 3N0TA 2OUKA 4BLRA 4JROA 1XTIA 3WJ7A 4WKOA 3IP5A 4UNIA 5ITWA 1X39A 4AWAA 2MSWA 1RLMA 5K0NA 3K8QA 3ZHYA 1MFPA 5K4AA 4AKTA 3LPDA 2N75A 3PPYA 1ORHA 3GRFA 2AF4C 1XZJA 4NZPA 1TAUA 3ASVA 4NX2A 1P0MA 2AOVA 1O4VA 3BVPA 4FSDA 3QEAZ 3G6WA 4UCXA 2FF7A 3OTWA 2YYAA 4LHYA 5ALQA 5FUYA 3H3JA 5HIIA 4ZGBA 4TZTA 2CXHA 3ONEA 1AUVA 1RM4A 2O06A 1KP3A 4O2LA 1ZUD1 4EHJA 4DV3B 1P91A 1QGZA 4KW7A 5GIOE 4LJSA 4RY0A 4AMGA 3AL0C 4RPGA 4U8HA 3S2FA 3E70C 1U7XA 1OBVA 1N2HA 3CNOA 1TYDE 4TTAA 1N2SA 5ILOA 4NMLA 3ZQUA 3SFTA 4M76B 5H9WA 3LM8A 4Q7JB 3P0HA 4M1QA 2E37A 5G1OA 2PR7A 1ZM4A 4WK0B 4CIXA 2FGKA 4CV3A 1K5PA 4OD0A 5HIJA 1M34A 4C5BA 4ASUA 2FZGA 3GB9A 2BLNA 5FULA 1FQKA 5GV7A 2YN2A 2IBMA 2WE8A 2OCDA 1XAHA 1JFLA 2GCNA 5FBKA 5FPPA 3V1KA 3VVMA 1UEXC 4XPIA 2V6FA 1SCIA 2V6GA 4KQMA 4U5QA 3OQJA 1O5OA 1TYEB 4JR2A 4MEJA 5HGJA 2PGAA 4MQFB 3KLMX 4V38A 2RE8A 4ZMSA 3OZRA 5T64A 3VNRA 5FO1A 1FYWA 4DTIA 4XLZA 4NZMA 3R3VA 4Y8VA 2DPMA 3A1FA 3DZIA 3FMIA 3JD3A 3VDNB 3SOZA 2W22A 1U81A 1YGPA 2GK6A 4WJLA 5JQGA 1ECFA 1H1TA 1XXHB 2F48A 3HNPA 2D0DA 1JIXA 1RMQA 2ZUEA 3UM9A 4IIBA 3RYTC 3TZQA 3PEWA 3D4NA 4E3WA 5ALNA 1PD1A 5ARBA 3BWDD 1CR1A 4NJEA 1D1SA 1PGOA 4LGMA 4RK0A 1YHQB 3UFXA 5A5GA 4D9CA 4TMWA 1DX4A 4BNXA 1HGXA 2FW6A 4JJZA 5ICSA 1GFSA 1GUAA 4I1RA 4XDZA 2Q4TA 2REQB 1Z34A 3V8PA 1BDMA 1E4EB 4BEWA 5IJXA 5FTJA 1RHRA 3EGWA 1V3TA 3CVYA 3ELUA 2A4KA 3MTAA 3L79A 4Y2YA 3CVXA 4TWAA 1DEAA 3CLUC 5COAA 2AI3A 2DF8A 5AK6A 1ACLA 1QTNA 1J39A 1QS0B 5CT5A 1NF2A 3FIJA 2VTBB 3IAXA 1VJGA 4GVXA 4O33A 1MH9A 4BV3A 3O21A 4LXIA 4YIHA 1UD8A 2FSPA 2Z2JA 4LRYA 4CUJA 1R15A 4R98A 1EVIA 1NX6A 4KH0A 3LY5A 3QFHA 3RKSA 1K3FA 4OK5A 2A5GA 2FVXA 3PFIA 1XNGA 4TVSA 1Q7CA 4ZEXA 1ZD5A 3HV0A 3N0VA 3T0GA 4YMWA 4IJMA 1JBQA 4O6VA 3A2KA 4TRRA 3WL8A 3ZIAD 4MGYR 4EQZA 4PPFA 1CV2A 5IT5A 3FJOA 1XVLA 3HI6A 3LUAA 2GREA 4ON9A 1DQYA 2DCMA 2L82A 3E1GA 3Q85A 2XZOA 3D0RA 3FW1A 4ZVTA 5J3OA 4BHTA 4EB6B 3FPHA 3E35A 1EG7A 4ZPJA 4K6FA 1XMPA 4UCQA 4QTTB 1JKFA 2ODAA 2BI7A 5GZ6A 4S04A 1SUAA 2JIQA 4RS3A 1NZJA 3A11A 3MA0A 2Y1KA 5E4JA 3ZS9A 2CZGA 4BZXA 4CKWA 4F3KA 1YVPA 2IH5A 1S2DA 1LWOA 1R8YA 3G0BA 3TXYA 5ALDA 4FK8A 2ISSD 1WV1A 4AC9A 4TSRA 2AX3A 3AUFA 1V5FA 2HPAA 3WKDA 4XR6A 3CKMA 2R5WA 4QTXA 4FE7A 1WCXA 2AMFA 1GUYA 1IUKA 4UEWA 1CRZA 5TQ0A 1E98A 3CLUD 2XZPA 2ZYRA 2AG8A 3EFOB 3ROGA 5BSKA 3RTEA 5A2QA 3FM9A 1WY5A 2VA9A 4KXQA 1QVFB 3JYLA 4ZZ3A 3K1JA 5JT1A 3EULA 2IRWA 2I7DA 2QN7A 3ZHRA 2KJQA 2XLCA 1NURA 4IFEA 3FZGA 4LE1A 1S3IA 3MGCA 1NVBA 1R5JA 1ZI9A 3IV7A 3L01A 3DE4X 4GPTA 3TAXA 1YRBA 5JSZB 1G8KA 2CXQA 3QXCA 4GM0A 4LRTB 2OAP1 4M7PA 4OGGA 4P86A 4ZT7A 3BC1A 3ZWQA 3G8CA 1R6XA 2RGNC 3IXLA 1TA9A 5CLQA 3L1VA 1WIWA 4NAVA 3JS5A 2A6PA 2J45A 1PT6A 2X22A 2I3DA 3WMXA 4FGJA 3UHFA 4YHHB 3N1UA 5AXAA 2QYTA 3RS5A 5AVWA 2PN1A 3IDOA 1AO0A 2UZ3A 4KAAA 1T3HA 1WS6A 1O0BA 1L0BA 2PCJA 1ELOA 1OJLA 1KH3A 4LC0A 2JI9A 1OPXA 1ECJA 1GCAA 2L17A 2W2MA 2Y9MB 3OTGA 4MW4A 4GPAA 4OA5A 1O6CA 4ZRDA 3J7AC 4C0KA 7MHTA 2P2SA 4G6IA 2WFAA 1G0NA 2P78A 2IITA 4JFRA 4OPVA 4B3BA 3UCFA 5ICGA 1MIOB 1JU3A 5KQMA 4OHVA 1LV7A 1ZA1A 1VHQA 5ELXA 1ZJYA 2VQDA 1MEOA 3Q0TA 4I99A 1NMEA 2QAIA 4A9AA 3PCXA 3EDOA 1NQVA 2CFRA 3IBYA 1M6NA 4OLHA 1QDEA 8ADHA 3SVLA 1YACA 3IEKA 3H9UA 3TQOA 4X7PA 2CC2A 4MQEB 3RC9A 4BO4A 4D74A 4BLUA 1IN1A 1RJDA 2XUFA 4MS3A 1E62A 4Q9IA 1GQ2A 2HBZA 4DCNA 2J6CA 4TRNA 3CYFA 1CVLA 2IFTA 5K8IA 5FWYB 5KKAA 3TFWA 1DCFA 1X7YA 9ATCA 3BQ9A 1J70A 1NJID 3NIDB 4RORA 3QVUA 3WJ1A 3WMFA 4L9RA 3QX8A 4DVJA 3HXKA 3LVQE 3FA2A 1QGAA 4OXNA 2ZW9A 4OCZA 3A6JA 2R1UA 5HS4A 4YTEA 1K98A 1T5DX 4XM0A 5JDCC 3ORQA 3S8MA 4GYJA 1DBWA 2W8ZA 4PBTA 4Y2TA 4YAJA 3JD4A 1E3ZA 3U44A 3FMPB 1D0VA 5FD8A 3GVJA 3Q6QA 4ZI3A 3ZS8A 4UUBA 3FNIA 1GRVA 3UQYS 5DBEX 2XKAA 1KO8A 4X94A 5E9JA 3OOCA 3DXFA 3O2QB 4ZJZA 1I24A 3JZDA 1SIOA 4PYOA 4TMYA 4AY6A 1N2ZA 1OTHA 5IASA 3QXSA 2Z6BD 3M5PA 2M6LA 1R16A 3ZVMA 2IP2A 3ICOA 3VVBA 1C41A 5J47A 3T3EA 1SWVA 5JWOA 2H1LA 3I9JA 2GLXA 4X1OA 2FSVC 5CT9A 1CJUC 3DEIA 4YGXB 1CJKC 4FJ1A 1V16B 4WSOA 4QBGB 3SN6A 4NXNB 3SZUA 4Z53A 5T8KA 4S3MA 3EQZA 5CA1B 4HRYA 1AQYA 5FWDA 4TYNA 2HWWA 4B6RA 4M7OA 4ETIA 4PC6A 2FZKA 1LNZA 1T4DA 1YI0A 1VIMA 2WAMA 1B74A 2PDAA 5SYNA 3OICA 1VSQA 3AT1A 2ATIA 5BSWA 2HF8A 2H16A 4HVTA 1UWCA 1XLTA 2PYDA 2Q6VA 3EDRA 3WHPA 3LLSA 4CWAA 3A1EA 4ZXPA 2EBFX 4W8GA 4WEOA 1Q16A 3QENA 4RETA 3GG2A 4H7KA 1NBMD 5B6PA 3NAQA 1KDVA 4NE9A 3NHMA 2J6BA 1M34E 1RWXA 3ND6A 1U8AA 1G7TA 1AX9A 1XMOB 3L3BA 2OHIA 3MOIA 1NR5A 4MWCA 1C0IA 1CEXA 3DFFA 3MG9A 3GJSA 3KFVA 1CD5A 2OTCA 2AWNA 4BNZA 1G42A 4GLBA 3AEKA 1AM4D 1JR3D 3G8BA 3GT4A 3QLUC 2AR7A 4QTYA 4GW3A 4P36A 2E3JA 1SC1A 2A33A 2C8KA 2PWBA 4ZRMA 4CZ2A 4N39A 1G4UR 1DU4A 1JXQA 1V3QE 3D0OA 3TRHA 4GRAA 4FCCA 1DPFA 3OJCA 1XMSA 1XZNA 3N87A 3L8YA 2OTJB 4OHOA 4LQCA 2HCBA 5D84A 3TOVA 3PHBE 3S81A 3GVHA 1NYLA 1W4BA 2APJA 2HXGA 4WZAB 4C2AA 4YT5A 1HE5A 3IT3A 5ELLA 2OXEA 3LRTA 2VJBA 1C8KA 5EAIA 1QQ6A 2G1PA 1K4YA 2NUPA 1T8RA 3UATA 3VAAA 5IN4A 3PKIA 3WL3A 2V8OA 4JJ8A 1NTRA 3B3FA 2C5EA 4H1VA 5DI3B 5EN4A 1A9XA 2JLVA 1KQPA 4M37A 3TOXA 1AB6A 2B1RA 2JASA 4FYHA 3PYLA 1DO2A 4IUYA 1J97A 1EDEA 1A4UA 2QGNA 2EF1A 1YZUA 4LOKA 4PGMA 2WEKA 4E1AA 2D5IA 3O3CA 5AOCA 1JUDA 3VR4A 1ADBA 2DQSA 1PDVA 2GBLA 1PZGA 3OE7D 5C34B 2FW0A 1W48A 2I2FA 2XQVA 3QBJA 1WLSA 4G36A 1OROA 2J1LA 3Q6NA 3T7DA 1JLLA 1M1XB 2F1RA 4MRMA 4B6GA 1E2UA 1K8QA 1JI3A 2HQRA 2IODA 1SB8A 1ZI6A 2BHSA 2C03A 3BHNA 3NV9A 5CMLA 4AVZA 2OMKA 2FTKE 3E9QA 4O02B 1VIVA 1T25A 1GSOA 2GVNA 1WPRA 1Y9JA 3BGIA 4S1TA 4E5DA 3C3JA 3U4HA 4MVYA 1FYVA 3DAFA 2DHRA 3N2YA 2BFDB 3PDWA 4UCWA 3QXGA 3TIFA 5AUPB 3U81A 3BG5A 3WV5A 4R1PA 1FJ2A 1J4AA 2QTHA 2P8SA 4OJQA 3SAJA 3EQ7A 3ZCPA 4YRCA 1FZTA 4J2HA 4CXMA 4H18A 4EFNA 2J41A 1UXJA 3CC2B 3CD6B 4CTNA 4A4DA 4DDWA 4ZO9A 1G9TA 1EWTA 3FETA 2UXCB 3PUXA 4Q7QA 1W0KA 1GNPA 1OX6A 3A1TA 1NW8A 2CXXA 3GQVA 4NPCA 4XD2A 3NHKA 4L76A 5B1HA 1XVTA 1GPJA 3UIEA 4C07A 2Q5FA 4RDIA 1TKBA 1UBHS 4XKJA 3WGHA 1AG9A 5CDGA 4JOSA 3IUPA 3NVAA 3G49A 3M49A 3F8TA 4Y2HA 3KQWA 4PQYA 1PJSA 4F3CA 3IVCA 5CXUA 4EQ6B 3ICQB 1QANA 1YK0A 2O8EB 3VPSA 3RFCA 4CLHA 3OCVA 4NAHA 4I81A 3QPAA 4EI9A 1N6NA 2WF6A 2QI9C 3WQSB 3F97A 4GXRA 1UPCA 4TPKA 1NP7A 3H65A 1Q19A 6Q21A 4LV5B 1PZMA 3H5IA 1AQJA 1HH4A 5K8TA 1LI4A 4BZZA 3S8YA 1NHGA 1U2ZA 2NV4A 4QX6A 4JI0B 3QYPA 4HYTA 5EJ4A 1FP7A 1D4FA 1IVNA 1E7MA 3E03A 2K5UA 1EXNA 3LVFO 3MPUA 4P4LA 3WOVA 5BN4A 3ZDCA 4TKUB 2W4IA 3K0CA 3B6IA 4IOLA 5IM4F 3QM1A 1HSOA 4F46A 4NMWA 3SJPA 5AHKA 3GFVA 5AQ1A 3KUKA 1CFJA 3BKXA 3CUKA 3ANXA 4I1YA 1Q91A 3KVNA 1W5FA 1Y3BE 1C50A 1Z68A 3JVDA 1TU0A 1YE8A 3STVA 1MW9X 3ZDDA 3SQOA 4CKEA 4ARCA 3CRVA 1Z2AA 4Z86A 2C4KA 5EEHA 4W9NC 1S9DA 4YJ2B 3Q8LA 1FLVA 4H6PA 3C97A 5IKPA 3T1QA 1TMYA 1QBGA 5K3OA 3OKPA 3KYDB 3FNGA 4KSYA 3C3AA 5IYZF 3QLEA 1MGOA 1JILA 4F2WA 1R8QA 2FQWA 2VZ9A 3LFHA 3AKDA 1U0EA 2OV6A 4YP5A 5JCZA 1GAXA 3O1HB 3X1XA 5AIAA 3DXZA 3ZWNA 5C0OE 2NSYA 4MZDA 4KN5A 5JU6A 2VDOB 3SE0A 5JW6A 4NV0A 1QK3A 1VQKB 3PC2A 1K8AD 3FDIA 1KVUA 2X13A 1Q3HA 1YJBA 3AHJA 1IM8A 1SXHA 2VFAA 4G41A 5DHUA 1XL1A 3SD7A 1EWVA 4QUJA 5TGZA 5G3YA 1N6PA 4XN3A 2VUHB 1DKUA 1RAHA 4IEEA 2AN1A 4M54A 4Q6WA 4US0R 5FH9A 4OLBA 1LDBA 1M5UA 4RSGA 5J4KA 2IIQA 1XRLA 1BCSB 4E4TA 3OHSX 4FMCF 2ETVA 2OPHA 1I36A 3OW2B 1DFIA 2I8CA 1KETA 4KE9A 1AV7A 4NYIQ 1IY8A 4GKBA 3AFGA 3CN9A 5TR9A 1XMVA 5I3CA 3OQOA 1IBSA 5KWSA 3ZH9B 1NLUA 3PP8A 1FFAA 2O3UA 4GLJA 1N2BA 3DKPA 3LT0A 4RQUA 1QORA 4ZVUA 5L3ZA 2OO5A 1HOXA 3AF3A 4TV8B 5EMHA 2YNMA 3TI7A 1M6YA 4CKXA 2YV1A 1V26A 2JGNA 4ZI7B 5JS1A 4CM8B 1UKYA 1PFKA 2H1WA 4UHEA 1WXQA 1U0BB 2MWMA 3W5DA 4A1OA 4CIAA 2LCFA 1TVMA 4F97A 2EDAA 1C5KA 2JBWA 2ZBPA 4NNPA 3OKAA 1XQ6A 3FPPA 3FTNA 1JA1A 4XWKA 4JQYA 3JAKB 1VE3A 4RWZA 3CB4A 4LSMA 3ADBA 4IL5A 1ORRA 4MR7B 4HH1A 4I1OA 1J9ZA 4U7GA 1Q81D 3ZNPA 3NC1C 1JX6A 4YASA 1FXWF 3S1SA 2XA1A 1ZLYA 3KVYA 4GRIA 2LP4Y 5TVKA 3RCBA 1EX1A 2QR3A 4D4IA 2QS9A 4WWHA 2DBVO 2EXXA 4ZCLA 1MJ5A 1QHFA 1RJ9A 1UBGA 3V8NA 4A10A 4AFNA 5A3RA 5CBPB 3BN3A 1QV9A 1G18A 2IF2A 1MO4A 4Q4HA 3S5UA 1XA4A 4EYKA 3JYOA 5KHLB 3I6MA 3PD0A 4J16A 4WDQA 4YXFA 1OKKD 1MC4A 1SG9A 1FTSA 2A0YA 2EZ4A 3C3YA 1PGPA 1QAQA 2K4MA 2ZUWA 4AJEA 1OYYA 4FX2A 2K6GA 4JB8A 2XBLA 4UTNA 1W94A 2H4ZA 2MINA 2VHUA 1QONA 3ND7A 3ONVA 4P3XA 5E2BA 4DPMA 1E69A 4EHLA 3CVWA 4L2IA 1ZLXA 2OHHA 5HDBB 1JSXA 2G08A 2NO1A 4HWTA 5CAEB 5CIQA 3P2OA 5I9BA 1FFYA 2CNNA 4E12A 3DG9A 3VU9B 1U0JA 1T8UA 1QQTA 1JPVA 3RSFA 5L51A 1N2JA 2QM0A 3H0CA 4NYJQ 4DLXA 4P3OA 1RKQA 1SVSA 3H2SA 4QEKA 3DBIA 1FL9A 3MRSA 2Q21A 3MT0A 1WOOA 4JLVA 3E0XA 4TL6A 5A4FS 3ANLA 3M34A 3ANSA 1CUAA 3O6VA 1QIIA 5FHRA 1ZSVA 3S28A 4E5SA 1ZNYA 2B94A 3I04A 1JQAA 3ENKA 3R5KA 1V0EA 2A8YA 3H16A 3PPVA 3HS3A 5LZ9A 2IYSA 4DMGA 4UOEA 4RZUA 4CI0B 4BKRA 2P68A 4LSWA 3HVUA 2WYIA 3KQMA 2JJMA 5D2CA 4ID9A 3OQIA 4D8WA 3EQ9A 4YPFA 4HVCA 4FD2A 4P2GA 2X58A 1JHRA 3UJBA 4E30A 2LUOA 2YY5A 3E3NA 3WDKA 4A6EA 3SLGA 2M98A 4CMGA 5KYTA 3RFTA 2WJIA 3GGPA 2PMBA 3BMXA 1TTQB 4RZSA 3TS1A 4C6SA 4CEIA 2FG7C 4MCIA 1H94A 4CDNA 1SXPA 1DO0A 2Y99A 3MJTA 4MV5A 2R00A 3H1PA 2A78A 5A05A 1EGMB 2R6CA 2UKDA 2ZSAA 3BXHA 2R9VA 2XMRA 4W82A 1CUSA 2XCIA 3P9PA 5LQSA 4MDFA 2A58A 4HR7A 3AU8A 3KT6A 4KCGA 4M86A 1EHYA 4BZQA 1MC1A 2Z6VA 5AFSA 1VLJA 1JQEA 4M9XA 3HCWA 4M1KA 5BN5A 3DL2A 1T2FA 4UPEA 4W4TA 1IFXA 1VKRA 2SCUA 4IKPA 1Y5RA 2W8BB 4HBGA 4CQLA 1FSSA 2VC2B 1U2DC 1SHJA 2XWBF 3FTEA 4HZUB 3L77A 2BAGA 4AP5A 4FNMA 1GG8A 5DISB 2WUFA 3PJDA 1T4MA 4O1HA 5CD1A 1FTGA 4AUEA 1XC7A 1L5SA 5DLQC 5IYPA 2H1IA 3HWX1 1G0OA 4NV1A 1YJQA 2Q4EA 5EGSA 1ILEA 3ROTA 2VRWA 2WU0A 2LKCA 3WRYA 1YIDA 5KIAA 1SXIA 2OCXA 2Q4DA 2QXTA 2O07A 1P18A 5HE8A 3SXUA 1KK1A 4G5YA 3ZZNA 1FFXB 1X7GA 2JJ1D 5DM0A 2I7VA 3ELWA 3GRRA 3KU1A 1Q95A 2DFNA 3TBKA 4OGKA 4GZLA 3C4QA 1RAAA 1CBUA 1T4CA 5TPWA 3JARB 3TLEA 3VISA 5L8VA 1I7DA 2B5OA 2NT3A 2NT4A