1H85A

Ferredoxin:nadp+ reductase mutant with val 136 replaced by leu (v136l)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPLGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE
publication title Role of a Cluster of Hydrophobic Residues Near the Fad Cofactor in Anabaena Pcc 7119 Ferredoxin-Nadp+ Reductase for Optimal Complex Formation and Electron Transfer to Ferredoxin
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1h85A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1h85A02
3CD6B 3ZC3A 3OW2B 3LYUA 1QUEA 5H59A 4B44A 4RD6A 1JJ2B 2BSAA 3CCEB 1W34A 2BPOA 3JQPA 2HCJB 4Y9UA 1G7SA 3CMEB 4PC2A 4B48A 2R6HA 4Q7JB 3OZUA 1G7RA 2GPJA 1R5OA 2PMDA 4MYUA 4FN5A 3WYAA 2QDXA 4R71A 1VQLB 1DDGA 1VQOB 1YHQB 2B5OA 4YAUA 4B47A 4ZGNB 1Q86D 1E62A 2VNHA 4EH1A 3CC7B 3W2GA 4ZV4A 3ES9A 1E63A 4MYTA 3B8HA 1F20A 4LBZA 3W2HA 4IW3B 4B43A 1KK3A 1ZM3A 2OK7A 1E64A 4NBSA 2J7KA 5H5JA 4B3XA 2XNJA 4RD0A 4ZCMA 1QUFA 4U9UA 3PENA 4DQLA 2DCUA 2BGIA 2YWGA 1WDTA 3QE2A 3JQRA 3WNBA 1KC8D 1OB5A 1IB0A 2HDNB 4WQMA 2RC6A 1BX1A 1VQPB 5TV2A 5JBQA 3U6KA 1B2RA 1GAQA 1QG0A 3QSYA 3U6BA 1KTVA 3CCUB 4C43A 1VQ5B 1EFTA 4TMXA 1HA3A 2YWEA 3MHPA 1W87A 4Y9RA 1GVHA 1OGJA 1VQMB 1YI2B 1DDIA 3CC4B 1J9ZA 1R5BA 2AHOA 1ZM9A 3OJWA 5HXBA 3I55B 1U2RA 1BX0A 4LBVA 1VQ8B 1YJ9B 4TN1A 1JA0A 1TVCA 3B78A 3CCRB 2C78A 1EFUA 1F60A 3CCVB 3ZBTA 1IJEA 3ZZUA 3AVXA 1FDRA 4FK8A 2CRVA 2QTLA 2XEXA 1XB2A 2B7CA 1KRHA 4LBYA 3ZBUA 1EFCA 2E1RA 3MMPA 4G5GA 3U2QA 2BVNA 3CRZA 4RD4A 1VQKB 1TLLA 4QHYA 4RD1A 4AF6A 1GAWA 3WBKA 5KSWB 1H42A 5GV8A 4B4DA 2PLFA 2GQFA 4YAOA 1AIPA 1QFYA 4J0QA 1QFJA 2BGJA 3B82A 4RD3A 1KK0A 2DETA 1NJID 3AVVA 3VO2A 1EP3B 3LO8A 1JB9A 3CW2A 3CCQB 1D8TA 3FPKA 2VNKA 1GR1A 1OB2A 1Q81D 2QN6A 3WNDA 4H9GA 1CNEA 1N0VC 4AF7A 4LBWA 4Y7CA 1EP1B 3G4SB 1QGAA 1FRNA 3MCAA 5FA6A 3LRXA 3WNCA 3P26A 2EIXA 1CNFA 2XNCA 1KK2A 5TY0A 3CC2B 2BMWA 3AVWA 1M90D 3JQQA 1QFZA 1QGZA 3E1YE 1FNDA 2YWFA 4BPRA 1OGIA 1KJZA 1KQSB 1G7CA 2FX3A 4ZGQB 1SKQA 2VNJA 1S72B 1VQ4B 2DERA 3WBJA 1XE1A 3E20A 4N3GA 2VYQA 4G1VA 1FNCA 2ZITA 4PC6A 1VQ7B 4RCYA 1QX4A 3LVBA 5AN9A 1K9MD 3J81k 2BM1A 3CCSB 1ZM4A 1QVGB 2OK8A 3AVUA 1W2BB 3CB4A 1QH0A 2B7BA 2RC5A 1VQ9B 3AVYA 1W35A 1B23P 1YJWB 2BN4A 1TUIA 1D2EA 3G71B 3OJXA 3VO1A 3QFCA 2OTLB 1FNBA 4YHBA 3SJZA 3OZVA 1R5NA 3W2FA 5TR9A 4M2LA 4M1KA 1A8PA 1QVFB 4AC9A 2QMUA 3W2EA 2VNIA 4M53A 3CCLB 1EWYA 3QFTA 4RJLA 3W5VA 4ZCLA 4K1XA 1VQNB 2QTZA 2BV3A 1K8AD 4ACAA 3I1FA 2NPFA 1EXMA 2BM0A 3W5UA 1KK1A 3OZWA 3WY9A 4NCNA 1JA1A 4TMWA 3CCJB 1ZUNB 4ZCIA 1CQXA 1N0UA 2VZLA 3A1FA 3WXMA 3I56B 3QFRA 2QA4B 3CXCB 4PGOA 1DARA 3ZZTA 1YIJB 1BJKA 3AGPA 4TMVA 1NDHA 4DQKA 4G1BA 3CMAB 3W5HA 1M1KD 1QGYA 2BF4A 4M0LA 4HE5A 2YWHA 4F7DA 2DY1A 5EMNA 1ZM2A 5DSZA 4LC0A 1FRQA 4RCZA 1BQEA 2HMAA 4YAFA 4QFMA 1VQ6B 1Q82D 3VMFA 1GO2A 1TTTA 1H85A 3AGQA 2DEUA 4PC3A 5THXA 4TMTA 1S0UA 4UAJA 3QFSA 2EFGA 2CNDA 4PC7A 4FWTA 2D74A 1DG1G 2QEXB 3AVTA 3CCMB 4C0SA 1Q7YD 1SM4A 3P27A 4RD2A 2C77A 3VNUA 1FNMA 3W2IA 1YJNB 4YAWA 2X3UA 1N8RD 3CPWB 3ZZ0A 1IJFA 1KD1D 1D1NA 4TMZA 1AMOA 4ACBA 5GV7A 4HE6A 1GJRA 1ELOA 1JNYA 4M4SA 4YALA 1YITB 3G6EB 1UMKA 1K73D 1G7TA 3FJOA 4PC1A 3V76A 4P6VF 3VNVA 1I7PA 2OTJB 4N3NA 4P3YA 1EP2B 2PIAA
chains in the Genus database with same CATH superfamily
3PCXA 4HKTA 2LWIA 2ZJ7A 3HA7A 1B6TA 1O5OA 2SHKA 3HKDB 4KWIA 3H9UA 4MRVA 4OY3A 2VJKA 4H6PA 4KQGA 4WINA 1FJGB 3R20A 1MH1A 1W59A 3GELA 4IF4A 4K9OA 1EFKA 4I4TA 5H02A 3RSLA 4IXTA 2C3YA 1GDHA 4ITRC 2OQ2A 5AXAA 1OX6A 2E4ZA 4WL0A 2I2CA 2XMSA 1RKBA 3EODA 2EEZA 1P2VA 1F4VA 2HCJB 1QFSA 1RXYA 1ZU4A 4QOFA 3RW9A 4H7FA 3TZCA 3BMXA 3M34A 3IOMA 3KVYA 2C54A 5AUQA 4I14A 1NQ5A 2VF8A 1BD4A 2JNWA 4YIHA 2PL3A 5BXQC 3RQSA 4Q7JB 1DX6A 1YH3A 2XT0A 2PUFA 4GR9A 4LYYA 1J8YF 2GPJA 2H1VA 3U5TA 1MTZA 1Z37A 2IYSA 4GI5A 3DBHB 4IV8A 4P26A 1TA0A 3ADKA 3DCIA 1ISPA 3K09C 3QBJA 2V7PA 3H7AA 4KC0A 3WYAA 4PXSA 1E1LA 4BVKA 4LY0A 5AI8A 2ANCA 3SBOA 3MCTA 4RE6A 1LY1A 4LJ7A 5C31A 4KNYA 3OF5A 1IM8A 2XVXA 2PE3A 4XOPA 1YFZA 2A1UB 3AP1A 5IX8A 2N0SA 1BG6A 2NXCA 3OCVA 2OFPA 4AJNA 2C7GA 2HI0A 4EA8A 4F6CA 1P74A 1NXPA 1GN9A 1AHHA 4MPJA 3VR3A 3UGJA 3C39A 3GLIE 1R9MA 4QREA 4TS4A 1QQ5A 1R0WA 2V8OA 2VJMA 3U16A 3RYIB 5ESWA 1A97A 1IHOA 3TGPA 4M0CA 3MVEA 5HRUA 1S2MA 2B4KA 5CLQA 3CIFA 3HXLA 1R6DA 3AB3A 1CJVC 4BIMA 4MVXA 1UZUA 3HDHA 3P0IA 3QOYA 1GNRA 4J43A 2HRZA 4W9NA 4ZVPA 4B79A 3ZU6A 5TPWB 1PN3A 3PI7A 1DBVO 1M33A 3HXQA 2QD5A 4BX2A 4X61A 3A9SA 4FKBA 1FFAA 4V02A 4NBSA 2UVDA 1T6ZA 2FUG6 4EG5A 2RHRA 3A9WA 1Y5MA 3CLRD 2R8OA 5JSKA 1UANA 1T4CB 3BQ9A 2R00A 2ZK7A 1WXQA 4QD3A 4CYMA 4Z7OB 3KB1A 4HWOA 3GLKA 2VCEA 3HR8A 2NM0A 2JFXA 2X5XA 3JD3A 5T3YA 1IOLA 2AFRA 3VSCA 3R6KA 3IEIA 1U0LA 1P7PA 1LDGA 1T8WA 2XB6A 2P9TA 3WL6A 3GJRA 4JFRA 3TFWA 5F1OA 5BWMA 1XZGA 1S3GA 2ZUBA 3QMVA 4KN9S 5EP1A 3IELA 1XZPA 2O5EA 2WJWA 4KXXA 4RTKA 5GONF 1COZA 3IPLA 3UMSA 3FCCA 4QEZA 1KEEA 1MN6A 421PA 2I1LA 3D64A 3DJYA 4F5WA 1V96A 3Q8KA 1ZNWA 3CZAA 721PA 3RAEC 3CJQA 1ZGAA 1ACMA 2G4CA 3KPWA 4YJFA 3U6KA 2G9NA 2QV0A 3TO5A 3P71T 5IPFA 4Q03A 3WWPA 1QGOA 3DFZA 3WC4A 3COVA 1M76A 4G4JA 4LCEA 1RFLA 4W8OA 3V2UA 4E4YA 1RHKA 1XKTA 3U6BA 4FFSA 1T0JB 1BGVA 2FFAA 3SDBA 4ZXPA 3EFHA 2BL4A 3U40A 3KSDO 4WW0A 1CZRA 2BI4A 2Q49A 3DXZA 3RYCA 3O74A 3MUOA 1NN3A 2PV0A 4OM8A 2NQ2C 2OM2A 5CYGA 5B3LA 4FOOA 2AE1A 2WM9B 4F4DA 2HHJA 2OZVA 2Y9PB 2YNMA 4KXWA 1A5BB 3G89A 1FU8A 2ZRMA 3HKEA 2ABWA 1TZBA 1QIJA 1XRLA 4BDSA 1GSHA 3MS2A 2AX3A 3D0KA 2QTVA 3HXKA 1KYIA 3K2QA 1O95D 3LBAA 5FB3A 3TMKA 3ZH9B 1UWVA 2OYSA 3LF1A 3FSEA 2D13A 1SBCA 4LJSA 2I3DA 3DV2A 5E4YA 3VPSA 4ZJZA 3CVUA 1FRVA 1DOAA 3HYTA 3ZY2A 2ZL7A 2RARA 3ASYA 3KEQA 2AHOA 4NC9A 3M4ZA 2E48A 4PQGA 1H4SA 3TKYA 4V0SA 3ISXA 5CFZA 1WUYA 3LM8A 3SYLA 3NPMA 1W0KD 4J4TA 3L4JA 4E32A 5LXTB 4QYIB 3ZY4A 5C5IA 2ZR7A 1FSZA 4QUEA 5HK9A 4IGIA 5L40A 2LIVA 4F4IA 2WUDA 4IIHA 2QX6A 5KQSA 2CC2A 1S1MA 5EJ5A 4BMYA 1S9HA 2AI2A 1DB3A 3CRVA 4XEHA 5KYYB 1J6UA 3WWDA 5AVXA 3F9CA 4ZARA 1Q1BA 1XF9A 2XJ4A 1GPLA 2G9VA 3MW8A 1HX7A 4M1ZA 2IS4A 4DK1A 1V5GA 2FK8A 3CLUC 1GNQA 2H9IA 4KXLA 5INTA 1PR6A 3C3YA 4P34A 3FHOA 4J0CA 2QP4A 1RHUA 3TW8B 3TUZC 5IM4F 3BRWD 4ZYYA 3DT6A 3PB3A 4G7XA 1WMAA 1ECLA 1KP3A 4HXFB 3FI9A 3FKQA 4Y2HA 3A2NA 4ID3A 3K70C 1HNWB 3HJCA 3N5CA 3HUEA 3COWA 4HDRA 4OSEA 3ZWPA 1E94E 4WN9B 5K51A 4YRSA 2HSDA 1SKUA 3FDZB 3T52A 3VPHA 4OK6A 2UVQA 4HRVA 3CX4A 4NABA 3W1EA 2XBUA 1F5SA 1G8HA 3E15A 3F2VA 3GZTB 4IVNA 3P2IA 3ND6A 4I50B 1DJQA 4JMPA 2D4HA 4MPRA 3OCUA 3P0FA 1TX4B 1TQ6A 1ZK4A 2BFAA 3CC8A 3JSAA 1KY3A 1X7YB 2JGMA 4G67A 1OBVA 3IVRA 3R75A 3KU4A 1Y3DE 4K6FA 1EEHA 5KVSA 3QKUA 4FDTA 4MV8A 1VJGA 4U3JA 1INLA 3H9JA 3L01A 3TLGB 3HB9A 4GZ6A 3AVVA 1YONA 5IXSA 3KS9A 2AZMA 2RAVA 4BLUA 1JQ3A 3IUMA 2IHBA 4M76B 4C0QC 1LJLA 3OY7A 3GLGB 3DAFA 3B1FA 1Z8DA 1KOLA 4DUYB 3R5FA 3IESA 2ZAMA 4UVIA 1VP9A 3WP0A 2VNSA 3F6BX 1G0OA 4MRNA 1A1VA 5KNDA 1WBDA 3GGCA 1E3QA 3QPAA 4JP3A 3QPBA 4ERXA 1WXIA 3BE4A 2AQ8A 5HE8A 5DX8A 5F98A 1P7YA 2QOEA 2R44A 2H18A 5HNKA 1GLGA 1W85A 2GJAA 2ZJ1A 3PNPA 4MVJG 3EB9A 1DHTA 4QDOA 1EK6A 1Q91A 1Z0UA 5HYVA 1Z29A 5D86A 1T13A 3U9SA 2F1OA 2A86A 2CFRA 2PYIA 1CF9A 5EMJA 3T9CA 4EA6A 1IJKA 1CQPA 1OX4B 2CVZA 2OLKA 2K4MA 3TNFA 2QTMA 1X7XB 3A1WA 3X2EA 1CUCA 1X1CA 1YT5A 4HWKA 5PNTA 3K0BA 8LDHA 4KP7A 2VHEA 2IEIA 1CJUC 2CHGA 1VB5A 3CLVA 2VPIA 2UUCB 1DIOB 1NY6A 1SU7A 1EE9A 3AEZA 2H0AA 2PH7A 2X2OA 4AO7A 2R8ZA 2ZVQX 3S2IA 3VQTA 1H2BA 4ZREA 2Z2YA 5DSXA 3CSDA 5EJMA 5E6RA 3AY7A 2JFBA 3QVWA 4NHOA 3DXYA 3ESRA 3C98A 1LDEA 1JKMA 4DK0A 1J99A 1CUWA 1FQWA 3DAOA 3GRZA 1M2VB 3R3JA 3FWYA 5IP5A 3NM4A 3SLDA 1K6JA 5G1PA 4ENUA 1Z4IA 1HE8B 2C9DA 2GN0A 4YT4A 1ECBA 1MAAA 1SUIA 3RIMA 1OAAA 1RC1A 2LR0A 1RT9A 1QGZA 2RIRA 3H7IA 1WHTA 1Y9AA 2XTAA 5G3YA 3KQUA 3SHFA 2ZI4A 3EARA 3HN6A 2HF2A 1OASA 2PUWA 5BVGB 2YV4A 3PXAA 4K9KA 4M1EA 3E9DA 2IHKA 3NCHA 3EMBA 4F3RA 2MMGA 2K6GA 2BFBA 5LUBA 3CZRA 7ADHA 1BXGB 4EYEA 2HWUA 3UN1A 3VR0A 2QLMA 1MLDA 1V8FA 2IHTA 3PKIA 5KIAA 1K5PA 4GVXA 4RSMA 1QHHA 1WP6A 1P60A 1T8UA 2P2GA 1LPAB 4ZOLF 5TEWA 3RRBA 3I9OA 3Q88A 4CDGA 1W96A 1K6MA 3NDIA 1YVPA 1IBCA 4INAA 4MQBA 3MXOA 4P98A 1KFKB 3GIWA 1K0FA 2RI0A 4BFSA 4ZI2A 5JAMA 5L4SA 4D8XA 1NN5A 2OKGA 3EA0A 4JSYA 3N05A 3CUKA 3G05A 2P62A 3FJYA 2PANA 4FMDB 4QUKA 4E7OA 4KPYA 1Z0IA 3B6IA 2HBQA 4NICA 4MAFA 1TK2A 5FLYA 1NTRA 4YCJA 3QELA 3EEQA 2R4UA 1UKEA 1ORWA 2EZTA 2OLEA 3NORA 5CBPB 2ACEA 1OT5A 3V3TA 5JC8A 3B5JA 1DBRA 1EX6A 3KYDA 4ZC8A 2AC4A 2XUKA 5AVSA 1NG9A 2AJTA 1QH0A 5F5XA 4FWIB 3KLMX 5M3BA 2VVTA 3OU2A 1I01A 3BSSA 1E5XA 1W35A 2A4MA 2HPZA 3DA8A 3OFKA 1TYCA 3OAAA 2IDKA 1UT6A 3B38A 3EA5A 2V7EA 1JEQA 3FKSD 2B82A 4GKBA 1QQ6A 2P5SA 3CEPB 3CJRA 2PZGA 2Q3BA 1FC0A 2VDWB 3ACCA 1CC1S 1UC4B 3UJBA 4CQLB 4D6PA 1MW8X 3ANTA 4FD3A 4JQYA 1YS9A 1N7JA 4IILA 1NW3A 1GA1A 5KQMA 1N2BA 4YROA 2C95A 3DV0A 1BU8A 1GGEA 1KZGB 2I29A 2WSLA 3GJZA 3KLOA 1RBMA 4FOTA 3RFTA 3ZV4A 3B6KA 2EXXA 2JIRA 5A89A 1Z88A 3H1PA 4M98A 4NCXA 4NU6A 3E2IA 4OM7A 1THMA 1IMJA 2RH8A 4I1UA 1U99A 4BNFA 5LQJA 2JLZA 4IIXA 4Q00A 1VMKA 5IAOA 2VTKA 4GI7A 2VWQA 2P9CA 4RGYA 5IS2A 2IYVA 3O0DA 4D44A 1SXGA 1YUNA 2YYYA 121PA 3TEJA 3SVLA 3UPDA 2DTDA 2OZLB 4CL8A 4K03A 1Q3KA 3J80A 5DYNA 3A6GA 3FVVA 4MV7A 2BV3A 1WM1A 1GPJA 4W8GA 1OE0A 1YULA 2CL7X 1IG3A 2A0UA 3OPQA 5IC4A 3A1PA 2X9QA 4FQ7A 4QTTB 3DUWA 4MICA 3SY8A 2ZU6A 4PYJA 3ADDA 2YWBA 1M0SA 4G0OA 4P9SA 4YJ2F 1FUIA 1U5CA 3HCPA 3DHVA 2QQFA 3QA3E 4FE3A 3O5AA 1V5EA 5LOVF 4XKJA 2IIQA 1SXJB 4Z4IA 1R4NB 2CXRA 1G60A 4B6JA 1QBKC 3NG1A 3T5PA 1T0BA 2ZFUA 3A10A 4AICA 1W49A 3L0YA 1YRHA 3G2LA 1DIBA 1US8B 4DLPA 3CINA 2VZLA 2DYIA 2JIBA 3HA5A 3PGLA 1WDMA 1UOPA 1N2XA 1DXQA 3ED5A 4Z54A 1N5IA 2IPXA 4IS2A 8MHTA 1RIFA 2J46A 4PQYA 3UPTA 4ZAYA 1PJ7A 2HLDA 2F9LA 3AL2A 1NDHA 3CZQA 4URVR 4O2AB 5M7EA 4LJAA 3D3WA 4CF7A 3ZI0A 3I42A 3K0HA 1MD9A 1SOVA 2XMCA 3L93A 4GGMX 3A58B 4Y2VA 4FCCA 1EVEA 2C9OA 5E1DA 3Q3HA 5G4KB 1DUIA 1EGHA 1YR7A 3VI4B 4AS2A 3PFIA 4AKGA 2FUKA 3K4HA 3GLUA 2WM3A 1VL6A 2OBBA 2PZJA 5ALIA 1SHUX 2EBFX 3D4PA 4FMPA 3EH1A 4Z99A 4LC0A 2Q2WA 2QG6A 2BYTA 1UXHA 5FV7A 4QRIA 1I36A 1SXJD 3MTQA 1M0TA 1S8FA 5LBTA 1VJDA 1NVEA 2G4LA 1JAHA 3FCUB 5F73A 4N0DA 2FF7A 3G6WA 2W00A 2GRJA 4G1MB 3I23A 4OQLA 3VZQA 4OHOA 1D3AA 3GVHA 3QKRA 2SBTA 3DB1A 4H4CA 5IF3A 3VHQA 4HHEA 2JEYA 4OQNA 5KO2A 3U5ZB 2VJIA 3IQGX 3AR8A 1V1MB 3VZDA 4KREA 4L4ZA 4KV7A 5JD4A 3A2LA 1WAMA 2PZLA 3V1KA 5JDCA 1RLJA 4BFCA 4C4RA 2C98A 4U2CA 4DNRB 2W9XA 4CVNA 1OXMA 1FS5A 2O2EA 4CFYA 3G1WA 1Z2CA 2GBCA 3LL7A 3NWJA 3UCFA 3QTBA 3UAZA 5IKMA 3ZHXA 1Z4OA 3K53A 4HPJB 3FTFA 3VISA 3P27A 4ASUD 1X9GA 2VJAA 4V39A 5REQB 3RUCA 4DOMA 2O52A 2CBXA 1N8RD 3P4YA 1X1DA 2C2BA 1JHVA 2YJGA 3I4FA 4HNQA 3H4IA 2UDPA 4OVKA 3U3RA 1NUTA 2GDJA 2D7CA 4GE0A 4HK4A 4MV6A 3AEQA 1LKZA 1M2KA 1GKKA 1VECA 1ELOA 2CB0A 2FSSA 2INGX 4N01A 1NJ5A 3EAGA 4V0ME 5F1KA 5BYBA 4ZCRA 3EGWA 3G6EB 1XLUA 3EFBA 1A3CA 1PJSA 1PKVA 1K73D 3M6WA 3C8UA 4D96A 4M6WA 4FFWA 3COZA 4QDZA 3EGXB 4ZQFA 2BKAA 2Y05A 2XYQA 2LBPA 2HM7A 3O90A 1P5FA 1WDWB 4O4HA 1RXSA 4N3NA 2NUTB 4ARZB 1VJRA 4E30A 4KDEA 3H83A 4MKRA 1L7OA 1XEWX 4ZYWA 5K9ZA 2G4VA 4KN5A 5BYKA 3EOAI 2VT2A 2AL7A 5B3JC 2NV4A 1ZC3A 2H29A 2J9GA 1N5DA 4D02A 5DHAA 4DABA 1MKYA 2E1PA 1O6GA 2AGVA 1ULAA 1F9EA 4DLYA 1GL7A 1NL3A 3VNBA 1K66A 5JXGA 2WPNA 3OWHA 4ZVLA 2X0NA 2ENWA 2QI9C 5ABPA 2VRNA 4UD2A 1M7GA 5A88A 1R0SA 4KXNA 3STVA 1WPXA 3IILA 4MAAA 3K09A 2YINC 5KPJA 1ULHA 2RK4A 4F4UA 3G5UA 2NVWA 2R7NA 4F84A 4HGPA 1QVAA 1EB9A 2WMOB 4GPD1 1JLKA 1ZITA 2B3DA 4IXWA 1ZMXA 2D0OB 4OYYA 5DB4A 2P6MA 3FCEA 4TKVA 5D3KA 4DBLC 1T5EA 1JBEA 3PUZA 1P9RA 4IUCS 4EKIA 4Q7MB 4ALMA 5LLDA 2ZTMA 4U7PB 1N4AA 3MN1A 1LBEA 3NGLA 5L4LA 1GYPA 4YRGA 4HI0E 2J6HA 4X1YB 1EAMA 2ECPA 3G82C 2G8LA 2AN5A 4KG7A 4K9LA 4XQCA 5KPDA 1Z26A 1O6BA 4XWYA 4AY5A 1O4WA 2C2XA 2PS0A 4N3CA 4PYIA 4BEBA 5KKCA 3OU7A 1XMIA 4ND3A 2Y4OA 4EAAA 3ZIAA 4ND7A 5CLLA 4LEIA 3JR7A 1B16A 2R65A 2BW0A 3VVCA 4MPDA 3ONWA 3ORFA 3V00A 4CM1A 2DH6A 5AQ1A 4B09A 1YV9A 1NI4A 1RHRA 1RLTA 1MHPA 1XDGA 5ECDA 3N7AA 3G0HA 3KHUA 1CY2A 1OC4A 1UDBA 4RX1A 3HUFA 2MR5A 3EN0A 3OQOA 3ZQKA 4BLSA 1I13A 4B6OA 3R5TA 2NTJA 2NZVG 4QO8A 3IKMB 1H1DA 5K09A 3L4EA 3TNLA 1IWBB 4JROA 3TAHA 2B78A 3GGDA 3NTUA 2HA3A 1GQFA 4ATNA 2ZROA 3DEAA 2CW5A 2JLAA 4RACA 3CVWA 3ZNQA 1UAGA 2O8BB 1CIPA 4X1KA 2DCUA 3IDQA 4R01A 5BMVA 1JMVA 2C94A 1IJBA 2NU9A 3MMSA 1JDNA 1Q2XA 4CU2A 4ZZ0A 5JS1A 4RU1A 5IVHA 2QB5A 1ANKA 4AZ3B 5CT4A 1HC7A 4P2GA 2PR2A 3F96A 4WQMA 2WHEA 1FUKA 1WOSA 1F2TA 1C0PA 1S8NA 2EQ5A 3NONA 2GREA 4BLOA 5I7SA 4CF6A 3DXFA 5EWLA 1SAYA 2HIHA 3SLNA 4ZYLA 2NU7A 3B1YA 1ESNA 1XAGA 4Y2JA 1XROA 3A4MA 5U1PA 3K73O 2MIIA 1XZJA 1JG7A 2FJPA 1JR4A 4K9PA 4MO2A 3AK4A 3X43A 2WHXA 2I4IA 3KJQA 4UOZA 2JGEA 3FPEA 1E2FA 1SC6A 3L84A 1E1CB 5FLEX 3PEYA 3QKIA 1E77A 1KTVA 2A9KA 4IZHA 1E5TA 4WN3A 4XJVA 3UG7A 3ZK7A 2FXIA 3MWGA 3YASA 3KUDA 3TS1A 3GJTA 2AFHE 2R8BA 3WL5A 2IZ0A 1KH3A 1XOIA 3NOXA 1VHJA 2VUIB 2NSLA 3P8ZA 4E88A 2CT8A 2W6JA 1FLVA 2O2JA 1QE3A 1FMTA 4HVCA 4PCUA 3HCRA 3VDQA 2D1SA 4NZZA 1E0AA 3EXEB 2YWDA 3LT2A 3W78A 3ND7A 4AM8A 4JUBA 1Z33A 2UZ0A 2V4ZA 4LJRA 1XZMA 3A2MA 3V8VA 1K63A 4YRBA 4EG4A 1EKXA 2Q5OA 1NVMB 4HNVA 2VDOB 4X0EA 3OJWA 4MROA 1QG4A 3GOQA 3NZEA 1YS6A 3AERB 3TDKA 3UOAB 4RDKA 1N4DA 1Q12A 1V2HE 3W4IA 3WKDA 2OV2A 4GBMA 1K89A 2FP4A 5BN4B 3ZWCA 1YDWA 2Q9AA 3U56A 2PAAA 1T0UA 2QTCA 3C1OA 4V3BA 2H1OA 2IPLA 1OBHA 5SZIA 2WZBA 4OHZA 5IYZF 1RWWA 1U8YA 4OOEA 3B78A 2IYPA 2NX2A 2ZEJA 2WKSA 2B37A 4X1OA 5FTMA 3ZVRA 1P72A 3O4JA 4CG3A 4PG8A 3AUKA 1NR5A 2E4YA 1V16A 5JZMA 4QC2A 3IQDB 3TLXA 1KJYA 1LDMA 1FDRA 1NX9A 2B21A 3O95A 4OAQA 2ZT7A 2YXLA 1P62B 4U9IS 2BAGA 4D0NA 3LFTA 4P81A 1VI6A 1ZRSA 4YFYA 3S7ZA 1B0UA 3P9CA 1T4BA 2Q7DA 3W90A 1U2GA 3WB2A 5AW8A 1A5ZA 4G0PA 4JB3A 5JNUA 1ORDA 1P2DA 2OB2A 2FMFA 1ESEA 4HFJA 1Y1KE 2WAAA 3HPRA 3S2SA 3UW1A 3BH0A 4DAOA 4JGGA 1K8RA 4LISA 4W1SA 3BH6A 1DKOA 3B3JA 4KK3A 4KN6A 3RYFA 2BVNA 3LVQE 2W22A 3GJ4A 4R8VA 2HV9A 4P3NA 5ITVA 3DEYX 5D85A 4AG6A 1YA4A 3FYUC 4F92B 3HTXA 2TS1A 1A7JA 3BULA 1FLAA 5EIXA 1LQ2A 2ES4A 3HSKA 5AK5A 2Y1OA 3IPAA 3MGGA 3HL0A 3P9IA 4ND2A 3L0OA 1E79A 4XYGA 1J9EA 3H8SA 1XEWY 2CXHA 4RXUA 1ZHOA 3WRVA 1ZKDA 2VHWA 1M1YB 2YZ2A 1Q1AA 4RENA 2XOKA 3DOEA 4X41A 4YMVA 3UBTA 5EMMA 3GDFA 4AMGA 1G21B 4MW0A 1L8LA 3ENNA 2IPAB 1JVSA 4E5DA 1I32A 4HQNA 5TVKA 4BMOB 2P77A 1YBVA 1QF7A 2DETA 2XLCA 2FHPA 3BE5A 4GZ3A 3VO2A 1K7SN 4R7ZA 4E5KA 1EP3B 1GL3A 3ESYA 3EVAA 5JZVA 2YHUA 3EPJA 2A14A 4OU4A 3SIRA 3ITDA 4EITA 4EENA 3MOIA 4Z4VA 1C0EA 3SXUA 2ZJ5A 2WFLA 5KINB 1VC2A 4WKCA 3HHPA 2HHAA 4WNIA 1N3YA 1YZLA 2YV3A 2FZ4A 4R7TA 1HG0A 2PUBA 1SCBA 3M6FA 1IVSA 2Y93A 3ONUA 3RSHA 1EVLA 1SRQA 3UK0A 2CZGA 1XTZA 2D2XA 2NXJA 3ZQUA 3SHWA 1RJ9B 2O2XA 1C7ZA 3QVMA 1OB2A 2IXAA 4NFLA 1O6FA 2GVDC 3X1JA 3OZAA 3GUYA 4DLRA 2A5DA 2P1DA 3I3SR 1NNUA 4M0FA 1NLUA 3LNNA 4B2LA 2TMYA 2B2NA 3EIWA 4PCVA 1UBOS 4QTYA 4Z53A 2YVUA 5LP6A 2EGHA 3GAAA 2X9NA 1D9XA 4TWAA 4GMXA 1HGXA 5CU7A 5HZHA 1AA6A 2BHSA 2AN3A 1M1YE 3CLRC 5BXYA 4DIUA 3R8CA 3IE0A 4G4SP 4OFZA 5WRFA 3M5PA 1GGKA 2EKQA 5EHNA 1SVMA 4BC0A 4BEVA 5F23A 2C9MA 4UU8A 1II9A 5AM4A 1QZTA 3R24A 4YAKA 4RTSA 3OCWA 3KTDA 1CUYA 1VJ1A 3R7WA 4ZO4A 1S2GA 4KXFB 1QH1B 3OQIA 3OEHA 4D92A 3HB0A 2VR1A 2D0IA 3PTLA 5ALOA 2QUHA 3ZW7A 3DB2A 3E8SA 3F6PA 5BWBA 3KXDA 4KO2S 4XGQA 5G0SA 2YWFA 3I8XA 3K6RA 4DGQA 3DUFB 3FZYA 2BKLA 1E1YA 4JKOA 4YRPA 2XWPA 3LDAA 1PFKA 2O1SA 3KXIA 3KT6A 4BV8A 1PZEA 2ACKA 3D7SA 3CF0A 4E3ZA 1WSWA 2C31A 2BF7A 2SKDA 1HY3A 3KL2A 1VA4A 2P40A 1LA2A 3CRMA 3Q6IA 3NEPX 2O57A 4OHBA 4BVAA 1T1JA 3LT0A 4RA6A 3KFXA 1V8BA 1AZSC 1E1KA 4MW4A 2YN0A 1NQTA 2Q5JA 1AF4A 3OIVA 4C5BA 1MNQA 3H2HA 4EB6A 4QIHA 3ZCRA 3HJGA 4TSFD 2O6LA 5K7SA 5KQGA 1SWWA 1RWPA 4XB1A 2V6BA 4UVEA 1E2PA 1KMIY 4BFYA 4OLBA 4AJEA 1PWZA 2YL2A 1GCGA 1QYRA 3FNBA 4LV5B 1DBIA 3EWIA 4UU0A 5JMOA 1L4NA 2NTNA 2IYXA 1QHYA 3TQCA 1Y6QA 3OMWA 3SC2A 4F9GA 4D8VA 3Q8WA 4TV9A 4GWKA 4GDMA 1DAKA 3IR7A 3W8RA 4UBNA 4UTRA 3R41A 2I78A 4UMEA 3TINA 1YJ8A 2C9CA 4RFLA 3VAYA 4Q7QA 2XB8A 3F4BA 3BY2A 1O95C 1QZZA 3F46A 4YRTA 1KR2A 3FNEA 4LXGA 2EFEB 3JAKB 4P7KA 3MD0A 4XARA 1UKVY 2YN2A 4N0MA 4N0PA 4Q3AA 3EF0A 4DFDA 2ERYA 3NETA 2QYTA 4DLUA 4B84A 4PG5A 3R3SA 3FUCA 5FLXA 4MUEA 4KR9A 2FUEA 2XQJA 3LOQA 2GK3A 1BFKA 2CL6X 2Q4RA 3TN7A 4ZOQI 1I5OA 3CKLA 2A35A 2JIOA 4D3YA 1B93A 4OBWA 2ZZMA 4KSBA 2CBZA 3PPYA 1MABB 1SOMA 1Q7CA 1GUZA 1TVMA 5F9HA 1CVIA 4AJ1A 1AHPA 3T7TA 3LQFA 1ZGZA 4BMVA 5JW6A 5ALKA 2IV2X 2FGJA 5FEUA 1T8TA 1UPTA 1AO0A 4YMWA 1GXSB 4M53A 3G2IA 4X66B 3BYZA 4Z4UA 1Y4AE 5JSZB 2FCRA 4OQQA 1KO8A 2XKAA 1WL8A 5J2TA 1E9AA 5ALTA 4RGVA 5H70A 2DZDA 4AAYA 4JY7A 1DAMA 2IBMA 1OUMA 4P82A 2Q28A 1RKUA 3FVWA 3KXKA 4FFLA 3SQLA 2ZJBA 2A5YB 1OZHA 4GOLD 2ASEA 1JF8A 2XQFA 3C3CA 4IJKA 3ILVA 5K4HA 1UWCA 1PEAA 4P0PB 5L8VA 2EU8A 1Y6RA 1I0IA 1DKMA 2B69A 2PMCA 3H19A 4DEVA 3HBMA 1N2EA 2GCOB 2NUPA 1BEEA 1SCNE 3K92A 3LE8A 1I24A 3AFMA 3KWFA 4OFWA 5AIAA 2P75A 1M3SA 2VJBA 1L3IA 3HLYA 1GT91 3N8GA 4YGYA 1FFBA 1V4NA 5DNAA 3SS9X 1OKKD 1TRKA 4JUCA 1E2NA 2WTUA 1HSZA 2OXFA 2LD4A 2XOEA 4Z4RA 4MGEA 4RQBA 2ACWA 4DADA 2FZGA 3TCNA 1RTTA 3ZDFA 2QA4B 4A8JB 3AV3A 1THZA 3PFBA 3EISA 2F43A 4GAEA 4D9NA 5LKAA 1ADYA 2IXGA 3CVOA 1U8FO 4HNAA 1DO8A 2Z56A 4ZHQB 4AJ2A 4HZUA 4QGHA 3DEIA 2UYGA 2J67A 2QRGA 4RZXA 1TB4A 1QFMA 1GP2A 2DF8A 4N18A 1NVBA 4EBBA 5JASA 1IUPA 3MB8A 3CN7A 2BDUA 1OROA 2ID8A 2PJZA 4RIGA 1E1RD 4Z9XA 1JSZA 2RB4A 3EQ7A 4NCJA 3V5NA 2D5BA 1MAHA 2H8GA 3IJRA 5FWAA 1KY2A 1DWPA 3PRHA 5ADWA 1EBBA 2QX7A 2XUQA 5LVAA 2BR3A 1JVNA 5JS7A 1XMOB 4AXXA 4W5TA 2RK6A 3NBUA 4CT0A 5SV2A 4IWNA 3EEIA 3WGUA 2D8AA 4TYQA 1FSFA 3KQSA 1B6SA 1RRKA 4UTPA 2YUIA 2CUNA 1UM8A 1CSEE 3JQCA 5L46A 3VU3A 2JFPA 3I37X 1YIDA 1Z7EA 2QRNA 4CJXA 3KTFA 1SXQA 3B70A 3A1TA 1QS0B 4G26A 3MCVA 1WOPA 3BWEA 4FXPA 5B30A 3SVTA 1EGQA 3F0TA 5BNZA 1WNFA 2ONCA 1JPUA 2QIPA 3OT4A 4L8YA 1GILA 1NSYA 1J70A 2Q0XA 1EZ1A 2JPDA 2OV6A 2Q1TA 3DZCA 2ZT8A 3SOZA 5IJZA 1Q16A 1U2PA 4WUVA 1RFGE 1W88A 2VDLB 4NOJA 3E53A 2CKMA 3BRQA 1E2DA 4DR1B 1SPXA 4GSKA 4BE7B 4LYAA 4GECA 1SVKA 1FFXB 1NM5C 1ZVKA 4JWKA 4KMRA 4P4TA 4E2XA 5CG2A 4BGDA 1T3LA 4I66A 2AD5A 2NZYA 1RLOA 3S81A 2Y1DA 1FNMA 4NENA 5TARA 1ZUNA 5FUWA 1BN6A 3I4LA 1I2AA 1OTXA 2NW6A 5DMHA 5KAPA 4GRIA 3U7EB 2W8BA 3W77A 2FXVA 1KD1D 1FMFA 1D1NA 2ISQA 2RH5A 1X8JA 2VUUA 2BFMA 2JI6A 3E05A 3BBPA 1Y3AA 3I3OA 3QOFA 4RVSA 5CX1A 1MZVA 2FUNB 2ZSBA 1HQDA 4P86A 4URXR 3KJXA 4MR9B 4WZTA 3P9RA 2PD3A 1XWIA 3SPXA 1DKPA 4PN3A 3H2KA 1QIFA 1Y7PA 2FR8A 1CYEA 1KEWA 1Z2DA 2DQYA 1KGSA 1G7TA 2DOGA 4QU9A 4D9HA 3JQGA 3IKTA 5KHLB 5IMSA 1VSQA 5EG5A 2Z04A 5JQGF 4K2HA 1LSJA 3DDNA 1K75A 3L05A 3TOVA 1STOA 4DXHA 4LZAA 3IQEA 2QN3A 1R8QA 3TKAA 4V2IA 1JEJA 2VF2A 4TYYA 5K6RA 3L49A 4LUCA 4B48A 4DSAA 4V3CA 3K0CA 3KX2A 4GG1A 2GLTA 3CR7A 3JQAA 4J9UE 4NAUA 2O8FA 1G8GA 4MYSA 2IT1A 4LFAB 1SVUA 4GMFA 2F4VB 1U0EA 1SQ0A 3L4SO 2BFFA 3AKYA 3FOBA 4FZRA 4WNYA 1J25A 1TU3A 2YQ5A 4L74A 3FR8A 4XDGA 4MHTA 3UFXA 5C1BA 1H94A 4W5JA 2FVYA 2HMTA 3JASA 5C8YF 3JQPA 4EZEA 4EJSB 4FWBA 3S5JA 1MB3A 1C3LA 4M9XA 4A6EA 2B2XA 1K7XB 3QEBZ 4MJ7A 5DH9A 4OUDA 4BTLA 3AZPA 5JISA 1QTRA 2EVWX 1NVGA 1XQVA 1YC5A 1W30A 2OBFA 3F74A 4LGCA 4N03A 5J23A 4M1TA 1H2XA 5IDVA 4EJ0A 2AJ8A 3I2HA 1R6TA 2ZE5A 1M2GA 2QVGA 4XPIA 1J06A 4K87A 4QG3A 3PQ2A 4DUGD 2HQ1A 5JU6A 1OYOA 2J0EA 2YJTD 3D2BA 5HCUA 3DBLB 1YL5A 1JTEA 3E9ZA 1POXA 2AF3C 4MRAA 2EZ8A 2YWCA 4WASA 4CIXA 1OWPA 1JKJB 1B1CA 1J97A 3UJ7A 5IVKA 4ZODA 1QIEA 3SJUA 3C7KA 3NHZA 3CNEA 2YWJA 3NIBA 2HU5A 1UWKA 2QVYX 1KETA 2YUTA 4WWVA 1ZD4A 3VHXB 1PG0A 4I55A 4EGSA 2QN2A 1P9WA 3KKZA 2H63A 2X41A 3U9LA 1PR0A 3HH8A 1PIWA 4JNKA 7REQB 1BSVA 4DMUB 5CM9C 1IN5A 1RQNA 2VNHA 1YRLA 2GO7A 4GYKA 4UULA 1WXDA 4EKNB 4LSMA 1G8KA 4MCAA 4U0KA 3ZCPA 4ZV4A 1GKUB 1Z62A 3ISTA 3EZXA 2FLVA 4TMFA 3GHHA 2VHYA 3SF8B 3CF4A 5A9SA 2WD8A 3IPXA 4BZXA 2RHDA 3RTDA 2XTNA 3CEHA 3Q0IA 1P0FA 3PA1A 3ELBA 2AZXA 2XT9A 1E5QA 3RYHA 4FI3F 3BRSA 5E6SB 3U4QB 1KDPA 1OI7A 3KKPA 4MS4B 4PR0A 2VBCA 3H4VA 5L9AA 2J7KA 1AKUA 1BVYF 4TV8F 5H1YA 2RHWA 4REOA 3R9KA 3RFFA 1EX1A 3H5TA 4F60A 2IBSA 1UT5A 4LJ9A 4BAGA 4M0PA 4DCCA 1IONA 2ETVA 4GEKA 4B85A 1GPMA 5IT9A 1W52X 4HP8A 1IH8A 5CLGA 3WG9A 4OI2A 3DZ8A 4QOJA 3HMQA 4ZPJA 3HKCA 4FPXA 5A3SA 2D7DA 3LT1A 3IC5A 5GPBA 4IHJF 4HJRA 2I3AA 3V8NA 3M9LA 1T15A 5I7AA 2HMUA 1UIRA 1W46A 1YGYA 3EUWA 1P5HA 1GYRA 5AJVB 1HE2A 1YZNA 4YMSA 5FADA 2A58A 1NMSA 4PHTA 4QA9A 3L7JA 4CV0A 2O2CA 5THKA 2BOVA 4ML3A 2JGDB 1XXHA 2HDNB 3M0EA 4P38A 5EZYB 2PUGA 1L4YA 5FBVB 3MTBA 2AH5A 3B8EA 1C9DB 5FNZA 1L7RA 1U1FA 3WKCA 2DUMA 2ZTLA 5CTAA 1HL3A 2GZAA 3OG9A 1URPA 3KJEA 4NPCA 5JMPA 2YRFA 3FOWA 4COKA 3Q3GE 4BASA 2ZWVA 4ZP1A 5IKEA 5G0VA 4XYEA 1UP4A 3E18A 4JD5A 3TLYA 2GD6A 3DLHA 1PDVA 1TZKA 2CFCA 3R7NA 2WSYB 1SXJC 5F4JA 3EWSA 5EEHA 2ICAA 2Z43A 2J5RA 1B26A 3BD6A 5FTLA 3O4VA 1VTKA 4CKBA 3JU3A 1M2OA 1J7JA 2VIIA 5DHSA 2QZ4A 2ECKA 4K9SA 5F33A 2IZ6A 5B4VA 1ZMRA 3UMYA 2VAWA 3I01A 3O3MB 1PEYA 4N49A 1N5LA 3TBKA 4I5DA 1GVHA 4QAQA 4P25A 3RS2A 4FLMA 2A1TR 3BEOA 4HO1X 3U4AA 4MI1A 2W2KB 1HMPA 3LX5A 1RRPA 4DDTA 2FDXA 1E8DA 3PXEA 4D45A 3T1OA 5BSVA 2B5WA 4IGKA 4IDEA 3KALA 3N2LA 4QGAA 3V1YA 4TWZA 1GRRA 3ZWYA 5BQFA 2Q8QA 3OFSA 4N6GA 1D0SA 2RJ3A 1CUDA 3FPPA 1V4BA 1ZHFA 3TSAA 3U3KA 1H2EA 4YCLA 1K27A 1PJ8A 3QNWA 4KACA 5JYBA 3P52A 1GUFA 3G9ZA 2I2WA 1AMUA 3DOJA 4HGZA 4R8KA 2OYCA 4OO3A 3A06A 4RZIA 4ENSA 2WKWA 3WNVA 3ZU2A 3AVXA 2RGEA 1ATZA 1HMYA 1LRKA 3IAAA 3OIYA 4M54A 2DGDA 2O48X 5D3MB 5H81A 5TF4A 3T9EA 4UBOA 5DLYA 1CUJA 4V0LA 4KB5A 1TEHA 2GN1A 3ZWWA 3L9WA 2D1FA 2EKDA 3IALA 4W4TA 4AUMA 4QXOA 2ID7A 3CF4G 4EG6A 2O0KA 1KI6A 3CXRA 3LY5A 4HH4A 3G9XA 3DFIA 1U2ZA 2OO5A 1W2GA 1WXEA 4CN9A 2XQGA 2DBQA 3GC6A 3I04A 3CRZA 4DWJA 3Q6QA 3U3XA 5HZGA 1V2GA 5DBIA 2QRKA 1S4QA 1MOPA 2ZJOA 2GUWA 3FYUA 3Q3AA 5DK4A 3BJMA 4QLOA 3W6UA 4C01A 2F00A 3IKVA 3QYPA 2WFAA 3GLSA 4H15A 4HUQB 3NUGA 2J9ZB 3PFNA 4NBWA 2ODPA 1PL7A 4PZCA 4R3UC 4A8PA 3CTAA 2VL7A 4KQKA 3C14C 3G0GA 4Q1DA 1JZTA 2OL4A 1MO6A 2GRAA 1GCUA 3D4OA 5IEBA 4LFBB 4OI1A 2G0AA 5AVOA 5BW5A 1SBNE 2W6NA 3FFTA 2J41A 3DDZX 1ODSA 3BMQB 4PX9A 2CNOA 3B82A 1XF1A 2ZT6A 4J9VA 2PLWA 1DFGA 3TZEA 3AT1A 4GMGA 1F4PA 2H0RA 2VHUA 2FPRA 5AHOA 3GLIA 3ZHSA 5HOEA 2I76A 1UEJA 2Z2XA 1I80A 1BROA 3H2BA 3PQ5A 4IYJA 4ER3A 2PBZA 2ZI5A 1SVLA 2A1IA 3AL0C 5A1JA 1GLVA 2I80A 5ALQA 4FD2A 2I66A 3LG2A 2PUJA 1NUHA 1XRRA 3HKDA 1T9ZA 4KQIA 5D7NA 4CN8A 3KVRA 4RF5A 1AO3A 1DKNA 3OEED 2X0IA 3EOBI 4YXWD 3FPKA 1QHFA 4BQQA 3H9EO 3EWAA 3ETJA 4R84A 4JV5B 4OV6B 4P3OA 1Z2NX 4RADA 2GJSA 4V0NA 1MW9X 1PT6A 3O8QB 2QN6A 1Z0AA 1IWOA 1J8FA 1OXKB 2C2WA 3AHCA 3FNRA 3PR3A 1CNEA 1CS0B 4HB3A 2BT4A 4HL6A 2NSJA 3ZHRA 2CWWA 3ENQA 4YI5A 1KZLA 3D4IA 3ZBPA 2H17A 1CZKA 1PJ4A 2CSXA 4WLNA 2QLJA 2JKYA 5BNFA 1CJBA 3LQ6A 1ENOA 1UM9B 3T12A 3BC9A 2HLNA 3LX8A 5BSMA 3TQTA 2G04A 3DBHA 4FBGA 4HLNA 4B6FA 4FB5A 1SEPA 3EASA 1MAUA 3SKBA 1W2HA 1UP7A 2JD1A 2YV1A 4Q1FA 1VYTA 1ZAKA 2CZCA 3VOSA 1NE7A 1JSLA 4EZBA 1KQFA 1ZSNA 1ENYA 4C6SA 1RPJA 4EVRA 1RMQA 4BLTA 2JJ8A 4IFEA 4P54A 3EGCA 2WB4A 3B13B 1JAYA 3QFHA 4Q9LA 3CONA 4U00A 4AZVA 1T8SA 2PUCA 2Z5FA 2NZ2A 4IFTA 3G68A 3D5TA 3U7QB 3BCRA 4QECA 2QBYB 5TY0A 1OJ7A 1QQTA 4PZ0A 5C8DA 5CPBA 3AVWA 2OBSA 3ROEA 1EG7A 3WGHA 3E23A 1RAAA 2Q5CA 2IL1A 4FR5A 3W9SA 1NJ1A 1M6NA 1JILA 1OWOA 4UUPA 4TQAA 1W4AA 2ODAA 5BQ3A 1QHXA 2ZS7A 5DCUA 3VAAA 4E6PA 1DE0A 3Q8MA 1Y5IA 3KSMA 3K1YA 3TDNA 4H7DA 3SWWA 5TPWA 4I8DA 1HRDA 1G3QA 1OLXB 2BTQB 1TCVA 3DLAA 3THOA 2AEMA 2FSGA 3Q0TA 3MJCA 3FNGA 3RBVA 2VWPA 3L1HA 3HACA 4MV4A 1EUYA 2D2EA 5HDBB 2W0MA 5KWIA 2GA9A 2Q62A 3B3FA 3QIVA 1T4CA 1XSEA 1WV1A 2BFOA 2WWGA 4X8HA 1FP4B 2Y77A 3IHKA 2V3WA 2IIPA 2KI5A 3RANA 2DUJA 4L3VA 1O9BA 1UL1X 1OVMA 4GWGA 1V5FA 4ZXFA 5BO5A 5I45A 2OBLA 2XTJA 3VX4A 1JXOA 4HZIA 4GKKB 3PC7A 4X91A 4A2WA 4S05A 3RARA 1ZM4A 1VP3A 5L3SA 1USGA 2ZTSA 4RCVA 1CDOA 3GNSA 1C7JA 3REFA 1Q0SA 1IIRA 4ZEXA 2MWMA 1NAHA 2JLXA 4ZV9A 2ID9A 4B4OA 3EGEA 1R2QA 2H4JA 3BDVA 4FOLA 3PUIA 1YVDA 4LDRA 2DBYA 5T5QA 3TB6A 5A0FA 2NPOA 2OGWA 3QU9A 2GBFA 4MULA 4ARIA 3GUHA 4X45A 4J2HA 4FDUA 1FCJA 4BWYA 1GU1A 4L4YA 2CVFA 3X2SA 5C8XA 1BCRB 2H2DA 4OLFA 4XZ3A 3IERA 2ZS9A 2IH2A 1E3ZA 1J9GA 3BGVA 2GJKA 4HWTA 2Q99A 3KNZA 4JB0A 4TKUB 4U2KA 5H82A 3BM5A 5J59A 3T5BA 4TS9A 4A5SA 4B8WA 1E20A 621PA 3TW6A 1QRRA 5C46F 5TR9A 3CB2A 4K6OA 4ZU3A 1QAOA 2Q7XA 4F2GA 4G5RA 1NJSA 4YEDA 2F1HA 1ULZA 1AUPA 1GKLA 2ZL6A 2HHHB 2HQSA 4G09A 1L4EA 5CDSA 3FTEA 1NVAA 4J03A 2G80A 5IUKC 3VR4D 1RWNA 1SGWA 4BO8A 1ETUA 2X0JA 4FILA 2JJYA 4WWHA 3CCLB 1Q11A 2VYFA 2ZYUX 2H7CA 1L4HA 1MQ8B 1XZHA 1QGED 4WUTA 3QBTA 2B0CA 3AUSA 3EIUA 4KBYA 4RJLA 5C81A 4DLTA 2R96A 3BRWA 3EIQA 3HCOA 2ZW9A 3LCJA 4CMIA 2XRZA 4QPNA 2REOA 3ZWKA 3S8MA 1UAAA 2VK2A 1NU6A 4ZYUA 4PSVA 5EVJA 3IVGA 2Q45A 2FPPB 2ZYVX 1HPLA 3DAYA 3G2PA 4KCGA 4PSKA 1DCFA 4L5BA 1JKFA 3MJEA 4WNAB 5K0ZA 3GSIA 2X8LA 1XVLA 4QYIA 5KOJB 1U31A 2ZDGA 3BZUA 2YASA 3M9XA 1AKVA 3A0RB 5K2OA 2KHZA 2BELA 5JIBA 1TYDE 3TOXA 2ZJAA 4LHWA 4TMWA 5JSYA 2GPYA 2BZ1A 2NQ8A 1LWOA 1Q0PA 4I6EA 1XZKA 2VZ0A 5KYYA 4QXAA 4MI9A 1D07A 3WRWA 1F51E 3TOCA 1H1TA 4MKHA 3WGOA 3PJEA 4RZUA 1BYIA 1XYYA 1RMTA 3THSA 2VAXA 4QWMA 1VSVA 4LYGA 4EHKA 4XCXA 1H9AA 2JCBA 1JUDA 4PFSA 1R18A 1XP8A 3C6ZA 3OJ0A 4PWYA 3TW8A 2OY0A 3EDMA 4F12A 4WJKB 1X1AA 3BJIC 3GFOA 1MCZA 4OLHA 4AKSA 4LVOA 1Q17A 4WKBA 1C4OA 1HE3A 1PUIA 4HDMB 1N8NA 3KZNA 3PQ4A 4MUNA 1PJZA 1DKRA 1E6KA 3S70A 2A88A 1NX6A 2FPSA 2I91A 2DE0X 2I6SA 1PTJC 3KLPX 5CYOA 1KXZA 1I5EA 2WW8A 3TRHA 3WFZA 3ER6A 4WN9A 3ZU5A 4TS3A 4O4JB 4GIBA 4UHDA 5DP2A 3FDZA 1F6BA 4UTOA 3GJ3A 3E84A 3TX2A 4FYHA 4TWIA 4UXIA 5HF6A 2B9EA 4M21A 4QFMA 3WMFA 2FMKA 5BUQA 3VMFA 1GO2A 2COKA 1FYDA 2C0PA 2OAEA 5HZKA 4OOSA 2NYUA 3BG5A 3N8HA 1DC6A 4RM0A 2WICA 4UZSA 2C3PA 4YP9A 1M8PA 1X7YA 2MINA 4G5SA 1K5HA 1EFVB 2BRUC 4NYIR 4XIGS 4CGZA 2X14A 5KYKA 4L85A 4EGFA 2IS2A 1ZH2A 2WILA 1GQQA 1Z2AA 1J0EA 4KSCA 2OSBA 1E1MA 1T3TA 3G5AA 3TEFA 3TLGA 1YTUA 4D3DA 1NM5A 1T2CA 4ADSG 5LYJF 2XF2A 3P96A 2H4FA 2X4LA 1FQKA 1RQ7A 3G1TA 1SCUB 4C0SA 3D8TA 3MSXA 1Q1EA 4OXYA 1NFRA 1YZ3A 2G1JA 1OIWA 2WU1A 3BL8A 3DOHA 3O31A 4RD2A 4MRRA 4ZICA 2VCHA 1O89A 1POWA 1EUDB 4GP6A 4ZRMA 3VNUA 1BU5A 1NBOA 5J3OA 4Q3BA 2GBGA 1CY1A 3D3NA 1F2DA 1I0ZA 2OC4A 3T99A 5JRDS 1L4GA 2ZIFA 1WABA 3LNCA 3ELYA 1GZUA 1O4VA 4KXUA 1KKUA 1GQ2A 4R98A 4O4IA 3SD7A 1AB6A 4EI8A 1WMSA 3QUBA 4TMZA 3A1DA 4FE4A 3NYQA 4DG8A 2Z6UA 4QM6A 5HM8A 1U94A 1Z38A 1XEAA 3K9NA 5AXBA 3TI9A 4HE6A 4R6WA 5D84A 1O5IA 4L02A 1HTTA 4B80A 2X19A 3S1SA 2IUEA 1X14A 1X7XA 3JYPA 3RI3A 3E70C 2OCBA 4NG5A 2QLTA 1G9SA 4P7JA 1HEYA 3J7AC 1LV8A 1MX3A 2GGSA 1OXXK 2QUKA 4WOKA 3MXTA 4CM8B 1YJQA 3SMVA 1QSGA 2ZWAA 3R3WA 1G1MA 3ZD6A 4P6VF 3ED1A 1H4TA 4OXQA 5EZSA 4RPBA 2CWDA 4AN4A 2WZDA 1YHNA 5HOQA 2F8TA 1P0CA 1Y5LA 1G66A 4UATA 4B40A 4JK3A 4L0DA 4E22A 1O87A 3KQOA 3BT7A 2WNHA 4IRUB 1AKQA 2F9FA 4UARA 5A7FA 1E69A 5CVCA 1U2DA 3LP8A 5L3QB 4HXEB 4XLTA 3QVJA 3OKCA 1Y1RA 4YR7A 1P44A 1JU9A 5JNTA 2W6MA 3CGGA 2QRZA 4BX8A 2FZCA 1TJ4A 1N0HA 2VHTA 3SIPA 3W1VA 5BVGA 5I9NA 3HEBA 1ZWLA 3IP6A 3JRNA 1J49A 3RVJA 5CURA 2ZE8A 3K9CA 1UBJS 7GPBA 4GKJB 2YY6A 2WMYA 2HU8A 1EI9A 4XLHA 1MENA 3AF1A 1BXGA 4GQNA 2PFGA 2R1UA 1UINA 1WXWA 3OC6A 4OG2A 2GCPA 4BL5A 3M6IA 3ZLBA 2HT1A 2DUWA 2PMDA 3FUXA 3EAQA 4BVHA 4F86A 3ZE1B 4BMPB 4YP5A 4M1YA 4TL9A 2AB0A 2DSNA 3DTTA 4HLDA 5C7OO 2BGKA 3PE6A 5K8VA 2FUCA 4GSYA 3TRDA 3OUZA 5I6DA 5K5EA 1BDIA 4TM8A 4JT4A 1ZOOA 5IRCD 1MBZA 2WHRA 1V6AA 3NVKI 1Y6JA 1DDGA 2XXJA 3ETGA 2RD2A 1T3ZA 3BXZA 4TZKA 1OI3A 1PR5A 2Q9BA 3DF9A 3VR6D 4KXVA 1OSNA 5CBPA 2C2OA 3BGIA 5ICCA 2NSDA 5FNVF 4Q15A 1P0IA 3F3YA 1U4NA 4XR6A 2Q1SA 2YJ3A 4OGLA 1V3UA 2ZRAA 4PAGA 4PAOA 1BZYA 1XQWA 4W7IA 5AJWA 1TT7A 2WF5A 4AK9A 1WA5A 4BQIA 3HNOA 3O83A 4MPTA 3N7TA 4UE3S 1V25A 2N42A 3CRNA 5FT9A 1P1IA 1GPAA 4AYWA 1XFDA 1BXKA 1CFZA 1F20A 2PQ2A 2WYRA 1WEKA 2QVXX 2WIFA 4Y1RA 1J5XA 4G8JA 4D99A 4NS1A 2GXAA 3IIKA 1SBHA 2VDWA 3DGFC 4Q3DA 3RC9A 3WI7A 4FOPA 4CQLA 1ZQ1A 2VQSA 1P5RA 1XDWA 2HADA 4X97A 3SAJA 3JALA 2XCRB 4AQ7A 1RRMA 2P6OA 2Q7OE 2E87A 3D26A 1F1BA 3TMAA 4FP9A 4YCBA 2QUAA 1A8HA 4B4KA 4M83A 4CEIB 3LIPA 1U3DA 2Y0CA 3AIOA 1KYYA 3WQZA 3OCXA 1AQUA 3AB8A 4BATA 1IY9A 1RQ2A 3AOEA 3STHA 3ZHVA 2WJJA 5JS8A 5DKFA 2E5WA 2GF2A 1WVGA 4N5DA 1EDZA 3ISJA 1DBPA 4EIWA 1KBOA 2JA1A 2ZRCA 1EJBA 3DWIA 4HAVA 3ROQA 4K1LA 4OGKA 5AP9A 1PJBA 4DJ5X 3DTVB 1X80A 4EFKA 3STXA 4Z9AA 3PBKA 1ZC4A 2P2LA 1ZISA 4M60A 1CF4A 5TQ0B 1KU6A 5ICMA 4LQ4A 4F6LA 3GWZA 1ZUWA 2CNLA 1I2BA 4HQ0A 1MB0A 2PX0A 5B1DA 4ZT4A 4ZVRA 1ZGJA 1YBMA 4YP1A 4RSRA 3S7TA 2C88A 1E8NA 5GGXA 1H8ED 4WVLA 1G5QA 3AM5A 4D4KA 3WIOA 3OECA 1SXJA 2J85A 2OC9A 3RNLA 4BYGA 1WB6A 1R4NA 1VOTA 4QBTA 2IITA 1UJ2A 4Q4JB 1PG2A 3SFTA 1CZUA 4H7EA 4E0FA 1TIPA 1US8A 1EGMB 3E3NA 4R2JA 4FBLA 4F6RA 4Z4TA 4V0OA 5DOZA 1XZ8A 3HYLA 4ENQA 2NMVA 3U37A 4AKTA 1CTQA 1EDOA 2IPMA 2HGSA 1I8TA 1PWXA 4OMUA 3SN6A 1ST2A 4IYRA 3SICE 3T3HA 1PJ3A 1AURA 3GRCA 4FSDA 5ALGA 4EDFA 5CB0A 2JLSA 1DCTA 2P65A 1PSZA 3HS3A 1OZFA 3DAPA 4I4TF 2ZIZA 3DTVD 3MOGA 5TGDA 5TPZD 3RFXA 4D41A 5JSUA 1E9RA 5TRDA 2QPTA 1ZLXA 1QHSA 5G4KA 2HW8A 4EPTA 4IRMA 1IZZA 1X74A 4L08A 5SY9A 3WLMA 4C78A 2ZJ8A 2R8EA 2J9RA 4ASUA 4JU9A 1NUQA 1ZM9A 4AS3A 4MA4A 4P9NA 3HXPA 3W8EA 4DM3A 1ND5A 1G41A 3NDRA 2JZCA 4Y2XA 5E7QA 2OFFA 2ZBFA 5HIKA 3M4YA 1T34A 2R5FA 5JG7A 3LX4A 1E7MA 1KVQA 1XWWA 2EWVA 3A3NA 3BF7A 3L02A 4URHA 2C3UA 3SEJA 3KOYA 5F2EA 4D9GA 2Z95A 2ZZKA 5BYJA 4X0CA 3Q4GA 3U3OA 2O0HA 3TZLA 4P0QB 2M1ZA 3IVCA 5K0SA 1RNLA 1ICEA 3T4UA 7YASA 2C78A 3DP9A 4B74A 8OHMA 1SQGA 1KORA 2XB9A 1IRXA 2ZPTX 3ECCA 4FT4A 4IVPA 1KPHA 3ZZUA 4X20A 3ZJVA 3U19A 1LLCA 1V1MA 1ZLYA 3I8SA 4M88A 4ODIA 5IAKA 4ZKEA 3R7LA 2CRVA 1T9CA 2Z8ZA 1BMFD 3HYSA 3AEKB 1XB2A 3L07A 3NJ8A 4DNFA 5DHUA 4E5NA 2K2WA 2PKEA 3DKKA 4HPWA 1VBFA 1XRQA 2CMGA 1MJGA 1VHTA 4EYOA 1UOQA 2LXNA 1TCUA 1WHSB 3LWNA 4ZPXA 3L7IA 5COBA 5KJ6A 3O1LA 2A5LA 4C7XA 4N0EA 4NRDA 3GLHB 3FDIA 3ICPA 1X7ZB 5REQA 2ZWMA 3UUEA 2WOJA 4EW6A 1JX6A 3CLSD 1N2JA 5ERYA 1B14A 4K0RA 1AG9A 2XT6A 5K6AC 3EDRA 3MPOA 5DTIA 5HZMA 2H2HA 1K88A 2P5TB 3GGJA 2IFTA 4IDFA 2R0QC 4L51A 5KTKA 2JCSA 5ALFA 5AW5A 1AIPA 3K9HA 1HDYA 4O2AA 4XOUA 4ER7A 1C14A 3S3TA 2ZAGA 1SU4A 1BKDR 5JXIA 5I7EA 1YR9A 4LMAA 3LBHA 3OTIA 4D0SA 1AHNA 2A78A 3TPFA 3INNA 3IQFA 2J0QA 1BVUA 1SUAA 2IY9A 3EGXA 1CHDA 2W6CX 1ICIA 4AG3A 2ATIA 1TQDA 2CYAA 2O54A 4IIDA 5BN3B 1N06A 4UZUA 4FDMA 4BMSA 2QGNA 1YRQA 3BIWA 1G5IA 4KX5A 4UHHA 4ARZA 1W4ZA 1NVKA 1FB5A 2DWUA 4C06A 3VR5H 5HGXA 4XVQA 4I2NA 4CCWA 1GTZA 1XCJA 2B8JA 1AGPA 4II7A 2I8AA 3SS7X 4CM7A 4F85A 1APBA 4LE1A 1QTQA 1C4WA 3JQ8B 1XNQB 2V7QD 2RSLA 4PRZA 3K96A 2VNKA 3AR9A 4ZCSA 2D2VA 1MRZA 1Q81D 3VV3A 1XIVA 1SXIA 1CUSA 3IMGA 4L4RA 4PLWA 5MN6A 1HLPA 1TCBA 3RUEA 5AW1A 1FXSA 4YAEA 3CZ9A 2OBNA 4DVJA 2ZYSA 4KPUA 3UWMA 3JWJA 4C07A 4MVJF 1ZAYA 4R7GA 2EV9A 1ECPA 4KNVA 1I4WA 2V65A 4JQCA 3BXFA 5EPUA 1BCSA 1VA5A 2GAJA 4LMPA 3JYLA 4MV1A 2CVQA 4A73A 5L95A 3W5DA 4L4XA 4XN0A 1JE0A 1YASA 4PSDA 4DLSA 1I4LD 2GZHA 1AV7A 2GARA 4LDJA 3WL7A 4ZCTA 1TMGE 4J91A 3HBLA 2PNFA 3UKOA 1HNNA 2I7XA 3WVNA 3L6DA 1ESMA 3LWBA 1T1GA 4P4LA 4MLDA 5CJPA 4BJ3A 5L7TA 2FWAA 3QOXA 4ARAA 4MJXA 1EK5A 3NBZC 3P26A 1WNTA 4BNZA 4C03A 3RHFA 3V1LA 3WOVA 4CDMA 2B1IA 2XV1A 5LNK1 2OP1A 2PKRA 1R6VA 1J0CA 4JL6A 1Z4NA 2BMWA 1DCMA 2A9QA 2GPAA 4X1YA 5FDFA 5EJ6A 2CLIB 3OKFA 4HDNA 4Y2RA 2I9KA 3I6ZA 4C0XA 4DWOA 3C8HA 3O8BA 1ZR2A 3LKVA 4Y1EA 1LX7A 4XSGA 3COSA 2G36A 3UICA 3CKKA 1KJZA 3OE1A 4OYLA 1TXGA 4Q9AA 3CH4B 4X1IB 5IJXA 2IS1A 3MWYW 1N57A 1S72B 1L1QA 1T8YA 4NK4A 1UXOA 1UJ5A 3I0ZA 4H1UA 4JLAA 1IZYA 1PW7A 2A0KA 5TJ9A 3ZV6A 5ARBA 5CFLA 4P32A 1ONBA 3QVXA 4WV3A 1Q1NA 3CEMA 3EHEA 5B3KA 3R0QA 3U3DA 4W5WA 3UB2A 3S28A 4ZVMA 5ICSA 1SKYB 1UBSB 2BGRA 3E81A 3HB7A 5EYPA 4L7VA 1MGPA 5FWDA 3VOTA 1DQSA 2GX6A 4RLFA 1GTVA 4A27A 2WP8J 4C2AA 1Y6FA 3MBOA 5A5EA 3J81k 4BXOB 1D8AA 1IE3A 2D2FA 3CF2A 2NAFA 1ADFA 1Z47A 3F6CA 4ZVQA 4D9IA 3LOUA 4WFIA 4O33A 2VJYA 2RH9B 3UXEA 3KOMA 4IIGA 3ZU4A 1YQEA 1CJKC 4Q9DA 3ZD7A 1Y3FE 1Q9SA 1WE2A 2PA0A 2Z5GA 4AZWA 1YDGA 1A8IA 3W5CA 1PJRA 1ECFA 4RLHA 5LC1A 4AZ3A 2XA1A 4JP2A 2RC5A 4EZIA 4H77A 3EPHA 3ESDA 4OBEA 1TM7E 5AQEA 2I55A 2BN4A 3VZBA 3ILYA 2PT5A 4P5DA 1IAQA 4EEXA 1LI7A 3NIFB 2QX4A 3AFHA 3LD9A 2QTGA 4BP8A 1E3LA 4EVQA 1ORTA 4CUZA 3R44A 4QDJA 4NV3A 3C3DA 4GOMD 4KVFA 2FOIA 5BR7A 2QSYA 3NR2A 1M1UA 1UZLA 3Q3IA 2EFHB 4GPEA 2FQWA 1FY2A 4Z49A 3C5CA 4ZRDA 3I6QA 2WJ4A 2R1VA 4LGVA 4MMZB 3L6OO 2PLAA 4MIYA 6Q21A 5A03A 4ZZ1A 1KWGA 4V2UA 2YX1A 4PLPA 1X19A 1VG0B 3NH6A 4RLSA 4U63A 3H2YA 2UYCA 3T3GA 4ZQBA 3UK2A 3UHOA 2LPMA 4JI4B 2IYYA 1OBFO 3QFTA 1LD3A 4WDQA 1ISJA 4XM1A 2PQ0A 1FTNA 3EXEA 1PJAA 5BSRA 4DMMA 1UMCB 1UD4A 3PUHA 3FA2A 1YQTA 4OBBA 5IANA 2YW2A 3MF4A 3FROA 1OIXA 1FDUA 2CF5A 3A26A 3QTTA 2QTZA 4IM7A 4RZ3A 1FIUA 2FH5B 4RAQA 2JGLA 1AUVA 2J3JA 1R0XA 2FSVA 1ZMTA 1BHO1 3TR5A 1ZDMA 4IVQA 2XMRA 3AERA 4OXKA 2GYWA 5CYFA 3ZTYA 4Y67A 1NJGA 1X8LA 2XMDA 3IT0A 4B6EA 1BHSA 2Y92A 5BN4A 4C4YA 4GNKA 4TTPA 2JIPA 3AEYA 1ZGGA 3WY9A 1BDMA 5C80A 2UUAB 1EA5A 2GB4A 3FIUA 1Z0FA 2IU6A 2C8VA 3UJ3X 2W11A 1XZAA 3FZQA 3OOHA 4X60A 2A4KA 1KIAA 1GQOA 5GONB 6ABPA 2I1WA 5BV1A 4MMXB 5EUQB 4TMYA 4DZZA 2C5SA 2OCDA 5KU1A 4QLAA 1XUOA 4W1PA 4DLLA 2ZG6A 4W7HA 4XUCA 4DLBA 3M4XA 3WRYC 1DIHA 5HF9A 4R83A 1S1CA 3K4PA 5B1IA 3RSZA 5A02A 1SC9A 2GHQA 3ZCUA 1V7ZA 5AD1A 1L9XA 5EIEA 3WK4A 5IT0A 3II6X 2I5PO 4UREA 4DKJA 2XQVA 2PWZA 3H0KA 4E46A 3F5FA 1K9VF 1VLQA 1R0CA 5FOWA 3FD8A 3CTMA 4C1NA 1JFFB 3NWEA 2PSFA 2P4UA 3F71A 1KO1A 4LI0A 4MW9A 1E0JA 2FPGB 5LBUA 1PTJA 2CNBA 3O1JC 1PS0A 5FQOA 3TJRA 1U0JA 3TTVA 3U3JA 2VDJA 3KQVA 2QAIA 3ZS9A 5DSZA 1N3BA 3NIDB 1FRQA 2YBEA 3HEMA 4RVOA 3T7AA 3SEQA 3RRFA 2ZRKA 3HQ4O 3IHTA 3MQ2A 4PZAA 4WNCA 2V0NA 2FY8A 1BQEA 2ZQYA 3B2NA 4UAGA 2HMAA 1BIFA 4NKRA 1IBKB 1E3WB 3JW8A 3UAVA 4ZKDA 2ODBA 2F2TA 1ISMA 4TRRA 2VSYA 5BWOA 1GSOA 1M1YA 2JAWA 2BRUA 3MWJA 3USZA 4RHYA 1PRYA 2QTFA 5KTSA 3K05A 1L4LA 3K1ZA 4RBNA 4WA8A 1L2TA 3NT4A 1G21A 5DM2A 3WLFA 2VHJA 4ED9A 1IK6A 4GVLA 3TBHA 3UMMA 2Y1EA 1HFEL 2WUVA 4KAAA 4N5MA 4Y2GA 5EHIA 4DANA 2JG3A 4P2BA 1EEXB 4XLLA 5AHRA 3O4HA 1J0BA 4RPDA 1KI2A 3ND9A 4I5IA 1KU0A 1Q6ZA 3K94A 4D0RA 3WLIA 1I0LA 2IP1A 1GUYA 2V59A 4GGOA 2BLLA 1GWNA 4QOSA 4HSEA 1Q3HA 2AKAB 5LA6F 2YKGA 2WG0A 3C16C 3HFJA 3OQ6A 3OPYI 1X42A 3D43A 3E5NA 3PLAE 3B60A 3PHHA 1L5QA 4Y18A 5GINE 1EX9A 3PT9A 3W2IA 1IHPA 3QI2A 3VGPA 1G59A 5FFNA 5JI3E 2GN2A 3NH9A 4FCWA 2PMEA 5IBRA 4QO7A 4GR4A 2X0EA 1JT2A 4MJLA 2C7RA 4TRJA 1USUA 4QNRA 4R1OA 3FWHA 4C89A 1RJ9A 3O4RA 1UBUS 4DJFC 2Q5QA 4MW5A 2NO6A 3WLHA 5ADVA 2GCIA 2B5VA 3RWOA 5GV7A 2OV8A 3ASZA 3WK7A 4ZMBA 1C3VA 4C9BA 4NY1A 4Z1OA 1ZONA 4ZMRA 1YITB 4BLVA 1I7NA 5JAHA 2JI8A 4MGHA 2X4DA 2E4VA 3FVRA 4YGXB 5FPSA 1YDHA 2ID4A 4E5VA 4JI0B 4TSKA 2OHJA 3FJOA 1MEOA 3WWYA 4PC1A 3Q3CA 3CISA 4HDQB 3R09A 3U31A 3IULA 1FFGA 2ANBA 1L4KA 2ZIXB 4JLVA 2PTGA 4MQMA 2H2IA 3ZJYA 1XJ0A 5FO1A 3TH5A 2F17A 1A9YA 1XTIA 3CUWA 3C43A 3IP1A 4DDKA 4TSFA 5J5CA 5H59A 4D9EA 4DRXB 5B1SA 1QV7A 4FYYA 3V4LA 5I8WA 4KW7A 3NOOA 3OW7A 2CZQA 1DEHA 4KLNA 3L5KA 2GAAA 3RS3A 1QH1A 2XUJA 2WIBA 2ZREA 1XDDA 4DSZA 3MCWA 4TRNA 4M0DA 3L8GA 2G1PA 2W83A 3O1HB 1XRSB 4ZDIA 1SCIA 4BFVA 4CR6A 5EIBD 1R37A 1MIHA 2A94A 4C7MA 3DUFA 4KKVA 2RAUA 2BFWA 1Y0RA 5CIYA 1Q83A 9LDTA 2VPZA 3H5LA 2WAXA 4ZTBA 3LGAA 3TPCA 5KBYA 1DL5A 3A6EA 2VBTA 2E18A 5CFNA 1EBUA 5KW9A 2H7XA 4OQFA 1HLGA 5EA2A 5IAEA 2ZXHA 2D5IA 3LECA 5DGHA 3DLBA 1TQ8A 4D5GA 4NZ9A 1J00A 3QZUA 1K08A 2ORED 1JLMA 3HDQA 4JT2A 5T4HA 3RJ9A 3CP2A 2NO1A 1XKQA 3EDYA 4C6TB 3VTFA 4WGGA 5P8WA 3U1VA 1F0YA 1JQJC 3EC2A 4M99A 5TEVA 3D8UA 3HZHA 3STWA 4OHVA 4ZCQA 3PFGA 2DLNA 3AJRA 4GU5A 3N39C 5J5VA 4RTQA 1C2YA 1NFQA 3ECSA 2FP3A 4JASB 4DLVA 5G53C 1UADA 1WBJB 3K6SA 4E5YA 1GARA 3IMEA 3NYIA 2J3EA 2OEPA 2YN4A 3K8ZA 2C0CA 1JXQA 3ULKA 3ABIA 3GEBA 2G5GX 1LK0A 2X5NA 3AQIA 4EH1A 1FE8A 3HJRA 3TD6A 4CUKA 3MG9A 3W2GA 1T2VA 1PGPA 2ON6A 3A4NA 4TUYA 3T3IA 3ASTA 5GIPE 1X70A 1YQ9A 3JAKA 3V7AA 2AJDA 3PWSA 1GPWB 3NJ4A 4OI4A 2IA5A 1K98A 1C9KA 4LWQA 5GZ3A 2OWEA 1JFLA 1NP3A 5FBHA 1O1YA 2C5EA 4IDGA 1VPDA 3HSSA 3U44A 3BMCB 1FSSA 1I1HA 1N5MA 3EF3A 4NCHA 3SQXA 2PFKA 3HP1A 3BD8A 3O3OB 5IN5A 1CUZA 3KDAA 5B1HA 3W8FA 4D42A 4JJZA 1P2UA 2KX7A 4XGNA 3OLQA 5DDIP 4CT4B 1N2CB 2W2VA 2X4GA 3FFWA 4X7FA 1MAVA 1BWPA 1GXSA 1W1IA 2JI7A 3BK2A 3H13A 3PQ3A 2BISA 5KOYA 4PPNA 5JSZA 2OXIA 3ZDYB 4LPKA 2YWGA 1FU4A 1WDTA 4G0YA 2B6HA 5H83A 3S27A 4UHCA 1FZQA 2E7ZA 4ZOLB 1VIYA 4ICIA 4JXXA 1OB5A 3Q7IA 4WY5A 4A3SA 4G0UA 6ADHA 5C1DA 1NC3A 1X7WB 3QU2A 1CQIB 4RV4A 1WSVA 2CXSA 5FYDA 3QEJA 1BX1A 4B7CA 1MFPA 3L5OA 1U0OC 2M98A 4AROA 1KOJA 1Z18A 1WG8A 3DW3X 3OURA 5ALNA 1FFEA 1Z7WA 2GCEA 4PIPA 4QUJA 2RHOA 2OPHA 4DV2B 2KW5A 2C3OA 4IXDA 4DRZA 3L8ZA 4GR5A 4Z0HO 2HU7A 1JRLA 3FR7A 4BNIA 3TIGA 3F7OA 4LHZA 1JN0A 2CLMB 1JQ5A 1U8EA 4LXYA 3R6WA 4RQUA 4L5IA 4BFLA 4F8YA 4G1FA 5E3HA 4WFKA 3RTGA 3CCUB 3OKXA 1MQ9A 2BEKA 4C43A 3P2JA 1DZ3A 3HSYA 3PR2B 5ALUA 2GF9A 3A27A 1D6SA 5FFFA 4D3SA 3MGKA 3VJKA 1RZVA 3MLBA 3FLBA 4X7RA 4ZO6A 4S0ZA 1BRTA 2GN8A 4WJLA 5KC9A 1JQEA 1MG0A 4RC9A 3MHPA 4I9HA 1YMQA 3OOWA 5DNDA 4OP3A 5LUAA 4PNEA 3SYKA 4HDAA 3UT6A 4GXTA 5F7OA 1R64A 4GRDA 4TVOA 3IDAA 1XTTA 1LJ8A 1M2EA 3NBAA 3R3XA 4RA9B 2X77A 4YHHB 1TTPB 3DWFA 3EZFA 2JFQA 2BKUA 1JXAA 1Y3IA 2C5BA 1N2CE 3EMVA 4K2AA 1HDRA 3HBJA 3VH1A 1YU9A 3EC1A 3RSSA 3I55B 4TSRA 4Z1MD 2I1VB 1VLMA 4B4WA 5HTOA 4DY6A 1GNLA 2CHFA 3J7TA 2OCKA 1BJTA 1CW2B 1IQPA 2DKFA 3KJZA 3LQ2A 2E4UA 4K6MA 4UXJA 2ERXA 1VQ8B 2IZZA 3N6RA 1HT0A 3GEMA 4JGBA 3ZOKA 1YJ9B 5DLDA 3N0RA 4ZAGA 1N0WA 5IZCA 1ESCA 2OORC 1FBNA 4M0UA 4UE6A 4JI3B 1E2QA 3H2ZA 1EU1A 2F1MA 1EFUA 4FIZA 2DJ5A 4H27A 1QS0A 3BVPA 2QTHA 3CPHA 1JE1A 3E2MA 5KJ1A 2HR1A 4BFZA 2OR3A 4BX9A 1CV2A 1YDMA 3HR4A 5BSKA 3Q3VA 3IOYA 3ADPA 4JJGA 4DZRA 2V7VA 3TDMA 1JR3E 2FLKA 2PX3A 4C30A 4CKEA 4YJ2B 3J81A 4GMDA 1M54A 4YV1A 3D6FA 5CD1A 4DIBA 5AOCA 1UKZA 4GVPA 1J5EB 2WC1A 5LOVB 4ITVA 4EG0A 2HO4A 1FFXA 3BKXA 1N7IA 2P9QA 4Q18A 2Q5EA 3BPSA 4C4XA 3B9PA 3GT0A 4BECA 2UYOA 4GO1A 1DFIA 1CLEA 1ABFA 1ZW1A 4RD1A 3HJTA 5K6AA 1FUUA 1FYVA 3LDUA 4WMLA 4BDTA 3DMGA 3E7WA 4DR4B 1PFUA 3I1JA 1S2NA 2V1XA 1KZYC 3G2QA 4FGLA 4B4DA 5HKAA 4TWRA 3VR3D 1T5DX 4A36A 3FTCA 2HXSA 1U0NA 1KAQA 2B61A 2FG5A 2MTBA 1ODKA 2H7VA 1GZSA 3GZ4A 4MR9A 4I5FA 1QZUA 4IBOA 4IRXA 4KBFA 1JG2A 1DFHA 2H08A 2RK3A 2WG2A 2V6MA 4JX9A 1J8MF 4EKGA 4MV9A 5CG1A 3RNOA 1VIVA 2QTBA 3P0JA 4BO3A 1N1EA 3I62A 3SFVA 4DNOA 3DEJA 1G38A 3T1VA 1NA5A 4DUGA 2DB3A 1SUEA 2JCVA 2BR5A 3OM0A 3SXJA 3THWB 4TGLA 3UT0A 4AJHA 4B7UA 4NZMA 2A0FA 3QLTA 4X8OA 2J5BA 3ZDXB 4BNMA 2VPWA 1PO7A 3O1IC 5HX7A 5CEJA 1NW5A 4Y2PA 5SZKB 5BMVF 2JARA 4G0VA 4CF3A 1P77A 4BGEA 1U1IA 1ZIYA 3TJZA 1QWSA 3CW2A 3PLNA 3W6PA 5K4AA 3S2UA 3LTNC 2W2MA 3WHIA 1XZLA 3T7CA 1HOTA 3EW9A 1KVRA 4OSPA 5HCIA 1M10A 3WSWA 3EULA 3IP7A 1GR1A 2P2DA 4L5CA 3AVQA 3K1TA 4EJSA 2V4UA 1CHNA 3D81A 3LHSA 3WNDA 4I1YA 3DR5A 3MJSA 3T7JA 4X06A 2CE2X 1OV6A 1XAIA 2GKGA 2IYWA 3EBPA 4I3FA 2J3IA 3NHLA 4DTIA 1EFPB 1UPUA 4J6EA 4X5OA 1AGXA 3LBYA 2R6GA 5TXGA 3I6IA 5LIRA 3NBXX 1RBZA 2X0KA 2DM6A 4MHOA 1HOXA 2XZDA 2YQZA 3H9BA 1BE1A 4J7CA 4M9RA 4BCCA 3DBLA 1I18A 1J2UA 3C7CB 1NIJA 5CX4A 3WKAA 3GP8A 1KS9A 4NTZA 3OCCA 1JKJA 3IPRA 1EG2A 3V7YA 4HSGA 2ST1A 1KY4A 4EUSA 1E60A 3A6DA 4FGSA 3TIVA 1R6BX 3V4ZA 4XLZA 2XNCA 1ODFA 2MU1A 5GOZA 4KR2A 4WOJA 4E15A 1X7DA 4QYMA 3HYNA 3MRSA 2Z6QA 3THXB 2N1MA 4MQUA 1GIAA 4JHLA 4U0JA 1NKSA 5CCBA 1H2RS 3KOXA 4UU7A 1N78A 3PK0A 4YJHB 3WZ2A 4A1FA 1VHLA 2W90A 1R3UA 1VLVA 5JSFA 4YRRA 5H3HA 3GDWA 3ND5A 1FF9A 3AR2A 3T94A 2GERA 3SF8A 1QKIA 2P91A 2DERA 2DULA 4MUKA 5FPHA 3TOSA 3H9NA 3FMFA 3HWSA 4KGZA 5KYTA 3RDPA 2LW7A 4YY3B 4RS4A 3PHJA 5E6SA 2Z9DA 1FYXA 3GJ6A 5J1TB 1M8GA 3D6UA 1GAEO 4IMJB 5IXJA 3SHTA 3DH0A 4OIFA 1PJTA 2WK1A 3CKMA 2EDAA 5ALZA 4RCYA 5DHRA 2YMQA 3TE6A 1NW9B 1CIJA 1LB1B 3LVBA 1XU9A 5KDDA 1A4IA 4AY2A 1U8TA 4B2YA 2WDZA 5DNYB 1A9TA 3FB4A 4KQHA 4B31A 5ADUS 4NEQA 1M8FA 3GXBA 1N5RA 4KU4A 1NVXQ 2WAMA 4S1VA 4GMKA 2Y27A 1FMJA 2BM9A 4L8JA 2ZJ3A 1ZH8A 3HNRA 3I9KA 4PPYA 2PUEA 3IV7A 4DUPA 3OPYB 2GZRA 4EATA 2ZSAA 3VTKA 2JLRA 3PYMA 2JGDA 4OHFA 5EZYA 1FSPA 3EPLA 1YS7A 4IJQA 3ZLUA 1D2EA 2AOVA 2V58A 4QL3A 3P19A 3BJZA 3ZCQA 4KE8A 4YELA 1U90A 1SCJA 4B6QA 5ULLA 2REXB 2FRDC 4G5OA 3ZHTA 3OZVA 2RJOA 5IJ9B 2O20A 2IKQA 2XUDA 3GVPA 1YJBA 5ERGB 4L15A 3IMFA 2X6QA 2HD4A 3BD7A 4OGFA 1PJQA 3PICA 5FAXA 3T3NA 2GM9A 2J07A 1Z07A 4PO8A 2QRVB 3JAWB 1NI5A 5CDYA 2Q6OA 2CXNA 3B3GA 3U61B 1A5AB 3F6EX 3T15A 1EWYA 4JMQA 1D9ZA 2J0UA 2PZMA 1GDDA 3TUIC 1QP0A 1AHIA 3GJ5A 2E85A 2IK8A 2W2KA 4MKGA 1P1JA 4OQXA 4QRHA 1P7WA 3WK5A 4O1HA 2PGAA 1P4SA 3K5IA 4N8DA 3RRYA 4UFPA 4D79A 3KPYA 3RAFC 1DEXA 2WF9A 4F2DA 3OFVA 5FPYA 5B4TA 1Y7HA 1LF0A 1GTRA 3I1FA 3Q72A 4DF3A 3HVHA 3LBIA 2DAPA 3LRPA 2LCQA 4I4LA 2M6RA 4H1TA 5T3UA 2NT3A 1DNPA 1HORA 1T9KA 2H92A 1R9GA 1Q57A 2Y1GA 3CLSC 2XH8A 1DRWA 3PWKA 3QLJA 3RVSA 3LCUA 4EP1A 3DL7A 4R2XA 1GCOA 1K3TA 3LCRA 1I7DA 1JG6A 4DILA 1DHRA 2WJGA 2EKPA 2O3TA 4PWZA 4YCSA 3ONYA 5IBPA 5A2QA 3K4QA 4P1VA 1CQXA 3PE3A 2Y9MB 1N0UA 4HB0A 1NBWB 3KSUA 4S1PA 1QFXA 1Z15A 1KAMA 3SQOA 3WGGA 3WRYA 4C3ZA