1H85A

Ferredoxin:nadp+ reductase mutant with val 136 replaced by leu (v136l)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPLGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE
publication title Role of a Cluster of Hydrophobic Residues Near the Fad Cofactor in Anabaena Pcc 7119 Ferredoxin-Nadp+ Reductase for Optimal Complex Formation and Electron Transfer to Ferredoxin
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1h85A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1h85A02
1OGJA 1ZUNB 3CRZA 3LYUA 1CQXA 3QE2A 4TMWA 1VQ9B 3QFTA 1OB2A 3QFSA 5AN9A 4FWTA 4RD6A 1JJ2B 2XNJA 4RD0A 4YAWA 4ZCLA 3CD6B 3PENA 3CB4A 1XE1A 4IW3B 3CC2B 3LO8A 4RCYA 4B43A 2QMUA 4G1VA 4TMVA 3E20A 4ACAA 2BSAA 2J7KA 5THXA 1WDTA 2HMAA 1KD1D 2VNKA 3VMFA 1Q82D 1AMOA 1VQLB 4TMZA 1KC8D 1KK0A 1SKQA 1SM4A 1K73D 4PC1A 1R5NA 5DSZA 2XNCA 1EP3B 3ZZTA 4B3XA 1S0UA 4YAFA 4DQLA 1VQMB 3CCEB 4PC6A 3W5HA 1H42A 2YWEA 4LBZA 1FNDA 3AVUA 1VQPB 1VQ6B 1QUFA 4M0LA 3CCSB 2CRVA 5EMNA 4Y9RA 1FNCA 4FK8A 1EFTA 1GO2A 1U2RA 4R71A 4C0SA 4Q7JB 3ZBUA 3CMEB 3U6KA 4ZGNB 4M1KA 1KRHA 3I56B 3G71B 1W34A 3OZUA 3AGQA 1D1NA 1VQ5B 2QTLA 3LRXA 1BX1A 1EP1B 1UMKA 4M4SA 1ZM4A 3ZZUA 1G7TA 4TN1A 2B7CA 2NPFA 4B47A 4G1BA 2VZLA 3P27A 1GJRA 1FNBA 3OW2B 2FX3A 4TMXA 3JQPA 3U2QA 3VO1A 3W5UA 2BM0A 2DEUA 1IB0A 1EWYA 1W35A 3CXCB 2RC5A 1JA0A 2C78A 1YI2B 2E1RA 1YHQB 1Q81D 1TTTA 3CMAB 3ES9A 5TV2A 4B48A 3LVBA 1ZM2A 5JBQA 1JA1A 2CNDA 3CCRB 1QGAA 2DETA 2VYQA 3W2FA 1N0VC 1DDGA 2X3UA 1IJFA 4B44A 1G7RA 2EIXA 1I7PA 4U9UA 1VQ4B 2QDXA 3AVWA 4P3YA 2PIAA 4ZCIA 2BPOA 2HCJB 3CCLB 3I1FA 4RD1A 2PMDA 1ZM3A 2VNHA 3AGPA 4EH1A 1GVHA 3QFRA 1GAQA 1JB9A 3CW2A 5TR9A 3CCQB 3AVXA 4NCNA 4UAJA 2BF4A 1B2RA 2AHOA 4QFMA 2YWHA 5FA6A 3G4SB 1EFUA 2DERA 1YJWB 3E1YE 4PC2A 1D2EA 1JNYA 1F60A 3A1FA 2YWFA 1R5OA 4MYUA 1FNMA 5KSWB 3WY9A 1QFZA 3MHPA 1DARA 4LBWA 4BPRA 3VNUA 1W87A 2GPJA 3WYAA 4LBYA 4AF7A 1A8PA 3G6EB 3J81k 2C77A 2B5OA 2GQFA 1IJEA 2OTJB 1KTVA 1QVFB 1EP2B 4ZGQB 3CCVB 1BX0A 3I55B 2QEXB 2OK8A 2VNJA 1FRQA 3OJWA 1B23P 1D8TA 4PC7A 1TLLA 2OK7A 1Q7YD 1KQSB 1VQ8B 4FN5A 3FJOA 3ZBTA 1FRNA 3JQQA 1VQ7B 4YAOA 1CNEA 1ELOA 1KK1A 1M1KD 3OZVA 2YWGA 4AF6A 1YIJB 4M2LA 4C43A 4YALA 3B78A 1QVGB 1E64A 2B7BA 3WNBA 1H85A 4M53A 1VQNB 1EFCA 4WQMA 4RD2A 3W2HA 2ZITA 1N8RD 3QFCA 1J9ZA 1TUIA 1K8AD 1KJZA 1KK3A 1DDIA 3FPKA 1DG1G 1KK2A 4Y9UA 2BGJA 1QG0A 4N3GA 3WBJA 3WXMA 4PC3A 2HDNB 3P26A 4ZCMA 1XB2A 4PGOA 1FDRA 1BJKA 1QH0A 1BQEA 3CC4B 4K1XA 1QFJA 1OB5A 4RCZA 1QGZA 3W2IA 3CCMB 5HXBA 3WBKA 1CNFA 1G7CA 4F7DA 1NJID 4HE6A 1OGIA 1Q86D 2BVNA 3WNDA 5H59A 1YJ9B 3AVTA 3MMPA 1N0UA 1TVCA 1ZM9A 3ZC3A 4RJLA 3W2EA 1QGYA 1NDHA 4G5GA 3QSYA 3MCAA 2EFGA 1EXMA 4ACBA 2QA4B 3ZZ0A 2DY1A 2XEXA 2D74A 4YHBA 5GV7A 4B4DA 1W2BB 3CCUB 2RC6A 2BGIA 1QX4A 1F20A 2BV3A 2R6HA 2OTLB 4TMTA 3W5VA 3B8HA 4Y7CA 3WNCA 1GAWA 3OJXA 3JQRA 3V76A 2VNIA 4YAUA 4N3NA 2BN4A 1M90D 4HE5A 3VNVA 4NBSA 2QN6A 1QFYA 3AVYA 4DQKA 5TY0A 1GR1A 4J0QA 4MYTA 4QHYA 4LC0A 4LBVA 3W2GA 1S72B 2DCUA 2BM1A 1YITB 4P6VF 2QTZA 3OZWA 5GV8A 1YJNB 4AC9A 1R5BA 1E63A 1E62A 4RD4A 3SJZA 1VQKB 3AVVA 2BMWA 1K9MD 3U6BA 1HA3A 3CPWB 4RD3A 3B82A 1AIPA 4H9GA 5H5JA 3VO2A 1G7SA 1QUEA 3CC7B 1VQOB 4ZV4A 3CCJB 2PLFA
chains in the Genus database with same CATH superfamily
4EG1A 1NFQA 5B12A 1Q11A 4PM4A 2I6FA 1KZYC 2JFUA 5J1TB 4BFCA 3E3LA 1N92A 1P1JA 3EBLA 3HJTA 3O8LA 1LX7A 4BQIA 4CQMD 4F11A 1JJIA 3HO8A 2JGFA 4KYTA 2WG1A 4BFUA 1E0AA 4Z4EA 4N5IX 2ODQA 2ODNA 1G21E 2QMYA 1XWFA 3K0EA 3BDVA 1XTBA 5F2EA 2QU7A 1JBQA 2P0YA 4F12A 1X1DA 4LGMA 1BWQA 4MARA 1PQUA 3UKDA 1IN5A 2XUGA 3BE5A 3KYCA 3GX1A 1Z6GA 4KWCA 2TMGA 4DRXB 3K4QA 2GZRA 3TUJC 4YUZA 4P31A 4M7RA 5AVKA 2ESRA 3MBOA 2BFCB 5DSXA 4RQAA 3C15C 2YNMC 1Z5GA 1UBCA 3KUCA 2ZSAA 4IP0A 3LO8A 2FR8C 4YN3A 4BX3A 2H2IA 3L7MA 4QTYA 5F7OA 4CT0A 1DINA 3B9BA 3KSUA 3BMCA 3KCNA 4HCJA 3TXXA 1SCUA 2G5CA 3NFRA 4D6XA 1IK4A 3RQIA 3ESAA 3ADCA 3T7DA 2ZSDA 5THXA 3FVRA 4OTZA 3ZQUA 4YMVA 4P7BA 5CXUA 4DTCA 1EZ1A 1E6KA 1SXIA 1ZMRA 2FE4A 4BZWA 1DEKA 2I1WA 3R3HA 2X6WA 1DBQA 4KNVA 2WE8A 3OA2A 3QVTA 3SS9X 3I9KA 5DM2A 3T9FA 1XTUA 2ZB7A 1AT1A 1H1DA 2W2LD 4PTZA 2YZ2A 3RTEA 4DDUA 4LXQA 3RM3A 1C0EA 4D8VA 1KDTA 3I6QA 3VZQA 4XFJA 5FRDA 4ARIA 4GG1A 1I8TA 4JR0A 1M0TA 2XX3A 2AKYA 1IZYA 1I0ZA 2D2FA 4FEAA 4ZQBA 1PQYA 5FI0B 1W52X 1V48A 3ZHUA 2GZHA 1PGQA 1T3ZA 1I94B 4B3XA 3R77A 1F2TA 1N05A 1TMKA 3PUIA 1L5ZA 3VTFA 1TKCA 3NDPA 1SUDA 4GOJA 3WL6A 4BJHB 2X8AA 4BMVA 2WAXA 2H0AA 3RU9A 1SXJA 1K3TA 1UK6A 2X58A 4KP7A 5IFLA 1ZIXA 3OZIA 4EEXA 2PUAA 3E9ZA 2CV0A 5ESDA 1SQ5A 4N7JA 1MU0A 2ID7A 1QH1A 2BUCA 4WKPA 3HZOA 5C5IA 2CL5A 4YMSA 2ZM6B 3K2IA 4YMLA 4HNQA 2WKQA 4ZXFA 1KQPA 2B1IA 2DWUA 2OBRA 1FSGA 4G7XA 3R5HA 4RF2A 4RIIA 1KY2A 2V5VA 5U4XA 3FM9A 4FKMA 1XZHA 1XEAA 2GNAA 2HSEA 2ZROA 3GPIA 2F8MA 3KTOA 5BSYA 1Z39A 2IHVA 1YO6A 3BMOB 1MJNA 2NP6A 5ITWA 2BR4A 1NN1A 2X6RA 3VUEA 1E5LA 3THOA 5BVHB 3OPQA 3GGJA 3V5NA 1M2OA 2DG2A 3K0BA 1E2DA 3AT1A 4BB0A 2CZGA 4Q02A 3L8YA 1MC8A 3PVCA 2JH3A 1CQZA 1FSSA 4QRDA 2ZDHA 3HGMA 4LYHA 2AEEA 5FPTA 2J9ZB 4KL8S 3Q5GA 2B2NA 1PSWA 2CVQA 1I24A 4URYR 3WA7A 1G7TA 4R2KA 3SNHA 5B58C 4RTRA 3HYLA 4J7CA 5A06A 4NAUA 4KREA 5KS2A 4TN1A 2A1TR 1XTSA 1KDPA 4S35A 2Z8YM 3REFA 3UB4A 3UMBA 2J0VA 3U4QA 4G1BA 2C20A 1DLJA 1Q0QA 4MCHA 1V8FA 2OO5C 2NTJA 5ALKA 5MGNA 1HR0B 4K86A 3RRYA 1GKKA 4G3XA 4ZAWA 4BU1A 1VPDA 2JEOA 4Z4QA 3GA7A 3A37A 4KQFA 1NKSA 3FBGA 1T1SA 1JEYB 1P6XA 4OHXA 4GQBA 3W9BA 4I5EA 1XX6A 4NZ9A 1W35A 4Q00A 1PU2A 2NIPA 2H9IA 2O2SA 1G8AA 4O29A 1CUVA 5HZHA 1ZCZA 3C3PA 4OHYA 2ECFA 2FOXA 1NWCA 4ZAXA 1LLCA 3CEPB 1VHTA 1JEYA 4AYWA 4FHGA 5ALMA 3U1BA 2NUAA 1Y6GA 1GKUB 3R6KA 2O1XA 1DAFA 2P5UA 3ZNOA 5EL0A 1DCKA 2A7XA 4HFRA 1E96A 1WSRA 2PCJA 1HE3A 2IEIA 1UAYA 4MAMA 2QPOA 2FFAA 4TKUA 2CNDA 2ZSEA 3S7TA 4B7UA 3AF3A 1BS2A 2FDRA 3FPSA 3SCZA 4BVGA 5LNK1 1L5YA 2BHTA 4G0NA 1HKHA 1L4NA 1TYZA 2GRUA 4QEKA 4XAQA 9GPBA 2G1JA 3CBGA 4CIBA 4F5EA 3B6ZA 3I6ZA 1J2TA 3A32A 2H2WA 4JASB 3ZH2A 3CZ5A 3WZMA 1ZCJA 1J8QA 3JQ9C 4YAGA 2QZSA 3BGSA 3IPYA 2WFZA 4KQ2A 2IH2A 4BCCA 1QHGA 3FPJA 5I7WA 4UTVA 1UBKS 2DMRA 3IHTA 4IDGA 2XHEA 4PIMA 5BR1A 3VU0A 3BXPA 2EZ9A 4IWXA 4XJSA 2LNDA 2C1ZA 5HIMA 2ZYSA 3S5UA 2HCFA 4A36A 1W36C 2VDWA 1E1LA 1ZM3A 4B32A 3OJOA 2QPAA 2O2HA 3Q5EA 1N6HA 4J03A 3TB4A 3GQBB 1FLAA 4LKOA 2ZUBA 2O5CA 2AWOA 2GO1A 5C1BA 2ZATA 4EF4A 1NFRA 1YIAA 1YAHA 4XE5A 1T5TA 2IX3A 4WA7A 3ZHXA 4EHDA 3SVTA 2H6EA 3IMFA 4YP9A 1NNI1 5GIPE 4RWEA 2WJ3A 1ADYA 5U9CA 1H2EA 3M6WA 2VLIA 1T5EA 2B69A 2DUMA 2PA3A 3LY7A 3GDFA 3RRNA 1S7GA 2G3YA 2GM9A 3HCWA 1BJRE 1HT3A 1MENA 2EFEB 3OFSA 5B53A 2B37A 3W7BA 4L5JA 2PUBA 5CGZA 3VYRB 1DC8A 1YQTA 3EISA 3ZWDA 3O7WA 3EXFA 1U8ZA 4TS3A 2PJDA 1Z0IA 3CTPA 5F3RA 5JPIA 1CJBA 3BGIA 5I7UA 4TV9B 2RMKA 1NW9B 2B8EA 5DMXA 1XZPA 2CHVA 4WWVA 1Z5UA 2H06A 1U3CA 2OM6A 3M6UA 2GASA 4IGIA 2LGJA 2PGAA 1RFLA 2C7VA 2GKSA 3F3YA 2FPPA 2D7JA 3NVAA 4FS8A 5EMHA 2NAPA 4ZHQB 3RIYA 1E1RA 3MJTA 3TQFA 4O4LF 1QS0B 1WB4A 4JEIA 4YQEA 3LUBA 2O2CA 2VG8A 4F1JA 5LOVB 1HQYE 1FXWF 1OBCA 2JASA 3O83A 3ORRA 2ZJYA 4OP1A 3SC6A 3ZS8A 4AF7A 2D2XA 3EQ7A 3PGLA 4YCNA 2DPXA 3SS7X 1ETUA 1ZA2A 2V98A 2WPDD 5J5VA 4NL4H 5JD6A 4N0EA 4QG3A 1QVFB 3DB1A 2JVKA 4N3CA 3B3QA 2J45A 3E7XA 3BY1A 3CSUA 3G6WA 4JQSA 5FOXA 2EQAA 3VTAA 5HBGA 1JHQA 3SF8A 1JBKA 3V4PB 4DLPA 4YXFA 3AB7A 2VNJA 1SCNE 2EJWA 3PRJA 1FTSA 4WW0A 2EJBA 1EHCA 4IDHA 4R1LA 2RFLA 3SHWA 5AW0A 2C2KA 2EQ5A 1L7EA 2BZGA 3GMSA 3UPDA 4BP1A 1BWPA 1JAXA 1Y7TA 2J07A 4G85A 4PZCA 4TRMA 2H63A 4HVTA 1LPAB 2YY6A 3PU6A 1ESCA 3ELDA 4NK5A 2XCLA 4S1TA 1FDSA 5JV5A 2GLUA 3O47A 4DG5A 5EP4A 5B36A 2FEKA 4LQLA 3WIBA 4JNKA 4OKIA 3SKXA 5EKUA 2CB9A 3C3DA 3II6X 3VSEA 3IQFA 3BD7A 1U80A 4XTCS 4FFWA 2WKPA 2ZJAA 2PGOA 3K9GA 3SHOA 4JJIA 4G9EA 2XMBA 1SVWA 4JUCA 5TQ0A 3EIHA 1JPNA 3OPOA 1VG8A 3E3NA 3OMWA 3QNWA 4HH4A 3C6YA 2VC2B 3NHRA 5K8IA 2AOXA 3F46A 1XROA 4I1RA 5KVAA 2B3DA 4YAOA 4J4HA 4JVOA 2JANA 5DM4A 2OAEA 4FMDF 4K6HA 5IRCD 1UDBA 4K40A 3ND6A 1XN1A 2I4NA 4DB2A 1L4KA 3WFIA 4BN0A 2GA9A 1GFSA 1MR3F 5B1DA 3QUBA 1BVYF 1ZKMA 2D06A 2WUFA 2Z5VA 2YFYA 4KSYA 8GPBA 4QSMA 4EYOA 4XORA 1NSYA 3LX4A 1KDYA 3UWKA 2WWGA 2AYZA 2BEWB 5KWIA 2ZJOA 1E7SA 2BEJA 3EGXA 1FMFA 2XWBF 5YASA 1EBFA 4HH3C 3ZHVA 2VPPA 2GAOA 4P32A 2PGXA 1UXHA 2HWKA 2I2WA 1U81A 2DAPA 3AQIA 3DFFA 4FHFA 4Q24A 4Q9HA 5CEJA 5EYPB 3ZK9A 2BEWA 1A27A 1AV7A 1WSBA 4G2TA 3IT2A 4DDTA 2W6OA 1XXHA 4MV5A 3GYBA 2HHCA 5JSHA 1J9ZA 2F3RA 3FGOA 4IMPA 5L4LA 4UMFA 1CZHA 4WXMA 2B82A 2A5JA 2TMKA 3O4GA 3ZYZA 1QP7A 1LVGA 2IH5A 2ZS7A 3SEZA 4KUEA 1YOBA 1VLMA 4NZOA 3WLJA 1QIEA 1ZCBA 3DDYA 2PSDA 1P2FA 4KRYA 3OCZA 1O97D 5KX5B 1QG0A 3B7WA 1G16A 4D79A 1MOQA 2Z3WA 1VSVA 4P12A 2X5KO 3SLDA 3KJHA 4W7SA 3OESA 2X0NA 5JCXA 3LTNC 2KVOA 1XB2A 1K8ZB 3AKCA 1W0JD 5DLEA 4MVCA 4UPEA 1C9EA 3TRDA 4M55A 3UICA 2ZCVA 4MQ5A 2OENG 2DBYA 5KOHB 1L1QA 3S2GA 1UF9A 5I7FA 5KX5A 4K1XA 3OLYA 3CMCO 1NW3A 2BUBA 3GFFA 3EW9A 3FI9A 3HG7A 1GNSA 1XEXA 4UM5A 3AETB 2PZJA 3H84A 4GPIB 1OB5A 3H5RA 4GF5A 4TOIA 3RFFA 1G18A 4BX2A 4P3OA 3HL4A 5JSFA 4G0WA 3LV8A 4HPWA 1JKFA 3EWSA 3BH0A 1OH5A 1SWVA 3KLMX 1N2CB 1U6JA 2OWEA 3P19A 2J0EA 3ZXXA 3PQ8A 4FDMA 4XWGA 4Z8XA 5DX0A 5SY4A 1PGPA 3WO1A 2Q46A 3SVLA 3W77A 3QUSA 1TYDE 1RKVA 3BX1A 4MA4A 8AT1A 1CQWA 3FTEA 5CGQB 3MQ4A 1Q86D 4OA8A 4Q1EA 4B9AA 4U3JA 3TRHA 3IV7A 2RB5A 4BFZA 2JLZA 5FPQA 5D1NA 4DMLA 4PXAA 3R8CA 2G0AA 3MW8A 4H3HB 2QM7A 4KPUB 1P5HA 1C9KA 4LF5B 4NMLA 5HZKA 1D3AA 5SZHB 2EDCA 4P1VA 3P9CA 3W2EA 1U94A 4G5GA 4K0KB 2VP3A 1Y1RA 1MB0A 2V7GA 5I8ZA 3WE7A 4AUMA 4C2TA 2G07A 3H5WA 4ENUA 6REQA 4KAAA 1ZNZA 2HO4A 2C61A 1GNQA 3LXRA 3UK0A 1A2BA 4UEKA 4OK6A 2HK9A 3OIGA 5C8YB 2W5UA 3NHKA 4IF4A 3HADA 3RYTC 4QM6A 1GFWA 1TB4A 4OH1A 4UE3S 1KBOA 4UBMA 4B4DA 5DHRA 2Q9CA 4X07A 4KAFA 1R8JA 1TT5B 4AYTA 2R6HA 3V34A 3TDMA 2QAGA 5LP6C 4IIBA 5C18A 2Z2XA 4G56A 3ZWAA 4TMTA 2YC2C 4QQ8A 4WY5A 4XIJA 5HIJA 3X2FA 4D9GA 4F1KA 5K01A 1NTRA 3SF0A 4WKCA 1UK8A 4DUPA 4ZN6A 2VPYA 3TS1A 3M2TA 3T7CA 2D1TA 2VDKB 3G49A 5DHAA 1FS6A 4J90A 4LJLA 5BMOA 2X4LA 3K30A 4WY8A 5DNVA 1TA9A 1E92A 1CETA 4HYTA 1J42A 4EHLA 1WSVA 1QV7A 3I2GA 1B8OA 3U4AA 5CLFA 2I1LA 4NQZA 4DA8A 3UMMA 3BTOA 5TEWA 2HMWA 3FRHA 1QFYA 4GX1A 5FBLB 5LQCA 3D1LA 4KMSA 4EY6A 3AVYA 1QHYA 3CG0A 5KNLA 2IS2A 4RFLA 1KP9A 4XYGA 821PA 4XGKA 2WJ4A 1LSUA 2BM8A 2HQSA 4LBVA 3C97A 3OPXA 2YYSA 2F17A 3DZJA 4XUEA 1G9XA 2P4HX 5A3VA 3NX4A 3EGIA 4YRGA 3T54A 3T9AA 1XA0A 1EFRD 4G24A 4CMIB 2PX2A 1IMJA 1YFZA 2JATA 3EX7C 3BIFA 4JFRA 1NKVA 2BM1A 1Y89A 1Y5LA 2MSKA 2ZWAA 1D6SA 3N2NA 4NCXA 4PIPA 4UM9B 4G1MB 1LNQA 5LQRA 5TGTA 1Y6QA 2P9FA 2Z2JA 4DSTA 1Z56C 3V55A 1DAMA 2F43A 1HE5A 1VQKB 2A4KA 3IP9A 1NX9A 3ODPA 2FW1A 3UBMA 3V4LA 4RK1A 1H4QA 2VWHA 5HKBA 4GE3A 1UEXC 4JB3A 1GYPA 5FV4A 4RHEA 1ZRMA 1DWPA 3A1DA 2DYIA 3KJIA 4IBOA 1MB9A 4V0SA 5CX1B 3ESBA 3IRUA 5AHRA 3VC1A 3ZIAD 3MTIA 1Z8FA 5E4TA 5BUSA 5H5JA 1MQ9A 1V39A 4HFMA 4JVMA 1JLHA 3OTWA 2Q7XA 5BPHA 2REOA 5EUQB 2FH5B 2VRWA 1F06A 2E7ZA 1B8VA 4MVJF 4B74A 2ORED 5JZ9A 3IP3A 1BD3A 5HIKA 4KAXA 2CWDA 1K8RA 2HDWA 2IPMA 4UJ3A 4GH5A 3C7TA 3L0ZA 3ONEA 3BS4A 2Q7OE 3JX9A 4W9RA 1JIIA 3N0WA 1DAKA 1ZI8A 3IT1A 1O4WA 2ONKA 5DW3A 4Z51A 1WUIS 1X9GA 1ISRA 1JN0A 3ND7A 1SC4A 4WZBB 2M2IA 4J49A 1EDDA 4JJZA 5ADVA 3DP9A 4IDAA 4CL8A 3FYHA 1VLOA 1V3VA 1J24A 3RC9A 1U2EA 5B4UA 5BYKA 5EHQA 1HUQA 1WUHS 1BCRB 2QAIA 2ATIA 4L9WA 3FCAA 3N7UA 1W5BA 1CNMA 3T0GA 1PHRA 3WB0A 3ONWA 3KC2A 5ARCA 4YAWA 4V03A 1CWUA 2XVYA 3CRMA 3EUFA 5DNWA 1JQ3A 3M9XA 3A9WA 4MIYA 1FVFA 2YHUA 4HDAA 1HMPA 1JYSA 4K87A 3EPLA 3KT6A 2Y76A 3O0DA 1FTYA 1HNZB 4JB2A 3U44B 3PFBA 3FVTA 4EUHA 1FUEA 4XDYA 3KT8A 2XKKA 3KOUA 3SDBA 5BXYA 1HX7A 1Y0BA 4WH0A 2HJRA 3FMPB 3FXAA 3OA0A 4BL5A 3PSAA 3QU4A 4G25A 1F6BA 2DPHA 4NU0A 3VZRA 1NBWB 1EK6A 1LA2A 5H3CA 2ON6A 4UVDA 1SXPA 2G9QA 3QPUA 1SUWA 1TM4E 5A5GA 4G07A 1CG6A 5LZ7A 3Q9SA 2X19A 3HFRA 2AQKA 4MV6A 4B87A 1G5TA 4HNVA 3ZLTA 2QPTA 2NW6A 3BZWA 3WA6A 4E22A 2PO7A 4EPXA 4YMGA 2BYTA 1Y98A 4CFSA 5C51B 1QGOA 4AKEA 2JBHA 3COSA 4FFBB 3JYHA 1SC1A 1XMJA 5DBEX 5HEKA 3Q1LA 5IAJA 3AJDA 4IH1A 5L7YA 2Q5CA 2WICA 3KR0A 5CNIA 2ZRDA 4QBTA 2Y27A 1T1IA 2BFFB 3CW8X 4KHPB 4L9AA 1MCZA 4CMGA 1OAOC 4M46A 5AW6A 3RADC 2VATA 1GITA 2RGBA 2QV0A 1U0LA 5EGSA 5ED0A 3E5NA 4IS3A 2I99A 3B1JA 3RUDA 4JFAA 4TL7A 3NGXA 2CHGA 1KI2A 3IOMA 3ISJA 2IXTA 3F3MA 3CCSB 3LQ2A 3PPYA 4PLGA 4QPDA 4U0KA 3V4OA 1KKLA 1XVTA 2QMEA 3WLEA 3KSBC 3UVEA 4AZSA 2PRKA 2XRMA 4Y9RA 1COWD 3L06A 1U3DA 4PVCA 4GLJA 1UD3A 1FMLA 2QVBA 2EFDB 3K35A 5FB3A 2F1HA 5IM5A 3TCXB 1Z4OA 3D2CA 4AQDA 3MGBA 1IEXA 5DYIA 1ODSA 3SHQA 4HWPA 1II8A 3BJZA 5KTTA 4B40A 4PRYA 1W34A 2QIPA 3ABSB 3M49A 3MXOA 4GMFA 1L8AA 4NMHA 2ZL5A 2XNSA 1K4YA 3KXPA 5DU2A 1ZGBA 5G3YA 4YV2A 3EQ6A 2PSEA 4QU9A 2DOKA 4JLDA 3ED1A 3LX5A 3KAPA 1ZVQA 3LRXA 3N7TA 5CVDA 3SHVA 2G80A 1QIJA 4CDGA 4R1OA 3EFOA 4PG7A 3U5TA 2GEJA 4B31A 1U3GA 5A2GA 5J43A 5ECDA 1O6GA 5D1HA 5A5FA 3A3YA 2OBTA 3FGNA 2X4GA 4Y2JA 3U7JA 1LLDA 1AHIA 1NURA 2GFHA 1T91A 2CNOA 4XOTA 3TUZC 2WVAA 3MK31 4JJ6A 2VZLA 3R4VA 1FX1A 4P93A 4M9UA 3VKUA 2ZT7A 5JFTA 3NKFA 1EJ2A 1L1RA 1QCYA 2EERA 2V97A 1K6MA 1KI9A 3DFIA 3OLZA 2OLJA 1A1VA 4WI1A 3TE6A 4Y6PA 4REMA 5I9TA 1E3WB 3E9YA 2J3EA 4KPGA 3QF4A 1X1RA 3EULA 3SLRA 4CF4A 2JZNA 3FKQA 3G6KA 1P0MA 1USIA 1YI2B 2ID8A 2Q2NA 3G8AA 2PX5A 1A7AA 2JD2A 3D6JA 3SXUA 3A9TA 2KYRA 2QZZA 2R8PA 5KDDA 3W2TA 3H8JA 3UGKA 3FZNA 1SKMA 1X7XA 2CSUA 4TTQA 1E3WA 5J2UA 2ZYVX 3ENWA 4ZVRA 3ZU2A 1OXKB 1T9AA 2BDUA 2GJRA 2VYVA 1OW3B 5HZAA 1JA1A 1A72A 4BQQA 4CMCA 4C01A 2K2WA 4OHMA 1TC2A 3V7YA 2J3HA 4X0EA 4FYJA 2IPAB 2CUNA 1DEHA 2QVZX 3DL4A 4YRRA 4JI4B 4U0JA 3QOYA 4JCOA 1XTKA 2HJVA 3AC0A 3EN0A 5J59A 2X3UA 4KVGA 4B44A 2PKQO 4D43A 3ND8A 4U9UA 3KB6A 2JGDB 2W90A 4RVSA 3A05A 5DM1A 3SJBA 3WLMA 1ZGZA 5KAMA 2OFOA 2WZNA 1VYTA 1VB5A 3KKZA 5K8TA 5AOVA 1B3BA 1U3FA 2X14A 4KQ9A 2WB4A 2C2XA 4IKPA 1U9YA 1OUMA 4OPMA 3VKVA 4GBGA 2PMDA 5HKLA 2W2PA 1PKXA 2JGDA 1M1XB 4PAWA 2O8DA 3U81A 1UXOA 3HKBA 1TIBA 2P2LA 1B42A 2XD9A 1NBMD 3NHMA 3UV7A 3CY6A 1GAQA 4YPOA 3TZKA 1C8VB 1MB4A 3KD3A 4QPCA 5JXHA 3OJ0A 2FZGA 3JCZA 3KKNA 1QYCA 1YVRA 3PXCX 1Y1LA 4CHGA 1YS1X 4B7XA 3PTLA 4EP1A 2I8LA 3EGOA 1B2RA 3G2IA 3DVRX 3N0VA 4N7RA 2NNWB 2PWZA 1VCNA 2FWIA 3PVZA 2QMQA 1PFVA 3ZNPA 1T5DX 3FNQA 3WWYA 1VLHA 1D2GA 2AMLA 2NV0A 3F7TA 4URZR 2I4RA 1DJPA 2J9GA 5LWHA 2VPQA 5C52B 1F2UA 1VLYA 2Q1XA 3WO0A 2VF4X 3QPAA 3A1FA 1TJ5A 1GTJ1 2ZU6A 3CN7A 3LNTA 4PO3X 4D7AA 2ZIAA 4DSZA 4UULA 5KOJA 3H9JA 4MW1A 1ZGJA 4O2AA 3DOHA 2IT1A 3WGGA 4Z2AA 2OXEA 3ZQ6A 2OGTA 5KNBA 1LC0A 4TT3A 4FUQA 2W22A 4HZUB 1NZFA 4JMQA 1QBGA 3OFJA 3R7NA 3TLJA 5A5EA 4UTOA 1EINA 1S2NA 1J0DA 3O8RA 2C82A 4I6EA 4UXIA 4D3DA 1AB5A 2ZUUA 3BTUA 3MHTA 2WSSD 1DQPA 1F17A 4Y98A 5GM1A 3WV4A 3G89A 4RVDA 4B3JA 4Q48A 1QTNA 2PX8A 3HV2A 4GOKA 2HH9A 3I09A 4YRTA 1TL7C 2NT3A 5A02A 4RBNA 1I9CA 2QD2A 2XA9A 2WWYA 4LGCA 1EX7A 5IULC 6YASA 3MWLA 1LH0A 1X7YA 3AIMA 5C7LO 4U8HA 1NN0A 3DJYA 3OLVA 4MS4B 4RE5A 2J33A 4K88A 2J3KA 3AKYA 1GGFA 4NE7A 5BSRA 2JGIA 4EL5A 3LDGA 6Q21A 5C37A 1XRPA 1UKZA 2Y6VA 3LYAA 1I7DA 4B3TB 3LGXA 1JXMA 2WHYA 2Z5LA 1CY0A 3IIEA 1NLZA 1IDOA 3AHEA 1QHHA 3ESXA 4HRVA 3HN6A 3RVRA 3RIGA 2VHYA 4FZ3A 1WM1A 3STYA 4YASA 3OMLA 1K6XA 5AOAA 4EX6A 3GEIA 2I6SA 3GLTA 3GPDG 3M6IA 1XDWA 4R3WA 2IUUA 3HJGA 5F5LA 3TW8B 4KQJA 2C83A 1E99A 2LVBA 3NUZA 1K06A 3OIDA 5KTOA 1L7MA 4Z4FA 1E77A 2FPMA 2IHYA 3DCNA 4R81A 1CZLA 4WE3A 1OXVA 2BBTA 4KITB 5IXJA 2CW5A 2GZ3A 2HT6A 4FI3C 5LYJB 1FXWA 1B6SA 2X22A 3TSCA 3QEBZ 4QTUB 1TGYA 5FLKA 1NC3A 1DXHA 3MS7A 4OQYA 1JDUA 4M87A 1E4OA 2IWRA 5KYYA 3DYVA 1WF3A 2YXNA 1BHO1 3CEAA 4UBLA 3R7WA 3RAJA 3W6ZA 3B38A 2QY9A 3UQZA 2C9YA 4WBNA 3OX1A 3FPLA 5IDYA 4JHXA 4IRXA 3U7FB 1R15A 1CY2A 3MJ4A 1Z0JA 2C7PA 3H9NA 1IH8A 3W2HA 1Y4SA 2JB9A 1G3MA 2VIIA 3UEOA 3NYWA 3QHAA 1Y48E 1JR3D 4MR7B 4MRAA 4JUAA 4RK5A 3ZDZB 1OR8A 2AR0A 4PQFA 1OH6A 5JJBA 4RESA 4DWVA 5JXWA 2FSVC 2LCFA 5KYKA 3MT8A 4IIJA 4OXKA 3GCWA 4H7DA 3L77A 5CA1A 2X23A 3R44A 4K46A 1E6CA 3ZU4A 4IGFA 4AO6A 5ADWA 2NXNA 3TR6A 4OFZA 2WTBA 4HRXA 3DD1A 3WMFA 4N3GA 3WXMA 2CE2X 3UMCA 4F6RA 4R1UA 2YV2A 1PR2A 1JILA 2JAOA 4LDJA 2HDNB 1XSEA 2W6CX 1G64A 2A9OA 4UBOA 4WJKB 1I0IA 2AX4A 4BQPA 2NSHA 4BKRA 5JNRA 1DRVA 3PZRA 1L5GB 3NC0C 3CGWA 1UKYA 2SCUB 2WA2A 4XM2A 5EP2A 5J9FA 1IY8A 2COKA 5DLYA 5BRJA 4MVJG 4HNHA 3WGQA 3ZDYB 4LJ8A 3WQBA 4DLBA 3REQB 1ZRNA 3HN7A 2BRUC 4R54A 1LQUA 2C8VA 4C7KA 2R84A 2RARA 1A9XB 4P81A 3LNNA 3W2IA 1AKVA 1VHLA 2OSVA 3OE4A 4Q9KA 1T9HA 2J3DA 1Z68A 2PL1A 2Q28A 3WLSA 5KNDA 2I8CA 2QY6A 3BB1A 2QD4A 3NHJA 3NTVA 1ULTA 4CETA 4GS5A 2X0DA 3X2SA 4ZTUB 4FYHA 3ZJ5A 3O1HB 3KQNA 5DN9A 4ARZB 3VYWA 2F64A 1UAAA 4YCDA 4FYXA 4BN4A 3THXB 2M6SA 5EQJB 2OC9A 1OGIA 4C0QC 4DCNA 4NFLA 5DWQA 4X24A 4X91A 4GOXA 1YJ9B 4RULA 1HGXA 4LX8A 3T53B 2YIJA 4FJ0A 1C3JA 3W4IA 3ZDFA 2OY0A 5K1ZA 1F1BA 2GEFA 2C0PA 1JEEA 3K1ZA 3L2OB 4B80A 4RM0A 3O2QB 2HHHB 4KK3A 1ZIYA 4FU0A 4BXOB 4OBEA 5D5HA 5TMBA 1E3JA 4PCAA 4PZEA 2WUGA 3L02A 4OHVA 3VNBA 3UJPA 4A6DA 2I3GA 5AXAA 4W63A 3DL7A 5ALNA 4BRUA 2DFNA 4GYJA 5DNDA 5KHAA 2FG7C 3NBZC 4HAWA 3M3DA 1X19A 2NZVG 3T7SA 1OTXA 1DQZA 3X1ZA 1QX3A 4RVNA 4D2IA 4BO1A 1SAYA 2P8JA 2BJVA 2X15A 4KQKA 3VNAA 1IHOA 1RXIA 3C6ZA 1M8GA 3DL0A 3SYRA 3YASA 2GN4A 1LKZA 2EX4A 2OCDA 5DHSA 5AVVA 4LOHA 2F4VB 3IR5A 2DXIA 2O9JA 4Q3OA 4TM8A 3LHIA 1BJTA 3LT4A 1MA0A 3TQQA 3VO8A 1WRBA 1GN8A 4KJXA 4UMDA 1NM5C 2C5HA 1EM8B 1TD1A 2ALJA 3E3OA 3IQXA 3PFIA 4C0XA 3NIBA 4LHVA 1DXYA 2CV1A 2B98A 3OJXA 5E6RA 4JBIA 1KVSA 1TCAA 1JRLA 1NR7A 1X0VA 3ED5A 3OCYA 4OHZA 1DRKA 1RYBA 4OQQA 1H6CA 4WACA 3EZFA 4Y0VA 2RH8A 3KYBA 3UWMA 3DS8A 4EG4A 4YREA 3DE0X 1YRWA 3GJYA 1A04A 2BN4A 2D2VA 5IKEA 1QRSA 3PVSA 4EW1A 1N08A 5P8WA 2QEQA 1BW9A 1PJLA 2VXYA 4ALKA 3PPWA 4E5UA 2QJWA 3AVPA 4YCMA 4EB3A 4CLOA 2AZTA 2ZRMA 4EITA 3QFHA 3VYUB 2WM2A 4C07A 5JSQA 4DQKA 5ALDA 1GR1A 1E2QA 3BUSA 3VMMA 3WL5A 3IDFA 4XOUA 2JGRA 1DPFA 4HQRA 4JGBA 4QUKA 1I3KA 3FBWA 3VH3A 5F2OA 1XQXA 1ISFA 2OGWA 3ANYB 3LHKA 4WIAA 5DCLA 4AB1A 4UBNA 2JKZA 4AXBA 1YQXA 3OTIA 1VCMA 2RIRA 2YV5A 3MN1A 4L0QA 1OD6A 1V37A 1JEQB 1AQIA 4XYEA 3SYNA 1XTVA 4JYAB 3A6HA 1VHDA 3HP4A 1SG6A 3HLKA 1QKIA 1WCXA 2P2YA 2AK3A 2LKCA 1R4MA 1XTIA 4FX5A 4IJMA 4RPHA 4GRDA 2XDAA 1RQLA 4LZNA 1B26A 3GLIA 1KI7A 4O1HA 4CLRB 1E4YA 4HO1X 4YHHB 3BD8A 1BXRB 2C58A 4ITVA 3X1DA 1UOEA 1TO6A 1XXHE 2QTVB 3NDJA 1DUIA 3AX6A 4OIMA 4ZI7A 3N6XA 1D2NA 1SBYA 3B6MA 5IASA 1OJ7A 1KARA 1TZBA 2OAGA 1JQEA 2VTVA 4MZDA 5GVRA 5THQA 4CKBA 4MQEB 3A3NA 3VR4H 2AVNA 4HGOA 3GUYA 3KQYA 3LKBA 4IYRA 3TD9A 1U7PA 5ALFA 5CB4A 1OI4A 1P5ZB 4INAA 4DNPA 1Z2NX 4G5SA 3CP2A 2BCEA 4KX3A 4MGKR 1TQDA 2GPWA 1FP2A 1TYAE 2Z98A 5AVWA 3MFYA 2CXTA 3S27A 2PGLA 5DF1A 2WR8A 2OA0A 4BTVA 3CRZA 4JD5A 3A2NA 2DHCA 4OQPA 5J2TB 3H2YA 2LUOA 3Q9UA 2HGZA 1SK9A 3KWFA 4FGUA 2QYSA 4GI3A 1LSOA 1YBAA 4I5GA 3D31A 4J0GA 4I9UA 4TTPA 2B61A 2UUBB 3B85A 4ZDIA 5FWDA 2XSZA 2OO3A 3AV0B 5H81A 4EJFA 3HSYA 3JQAA 2G88A 4C0HA 4WGFA 4J6EA 4X9XA 1JI3A 3EA4A 4G4SO 2FMFA 3OD1A 3PENA 3DLTA 1LZKA 1XE1A 3AVQA 3RC7A 1IZZA 1GUDA 1P61B 2PVSA 4B4OA 3BL8A 4ICIA 1CUSA 1SXJC 4J3FA 3S6JA 1ESMA 5AM4A 1AXRA 3VX4A 5K05A 3PLRA 4LV6A 3X3HA 3JQ8B 3OU2A 3BIOA 2QTTA 3WISA 4Z3OA 2X7XA 3UCFA 3ZW8A 4A5OA 3UOWA 1RTTA 3OTQA 1IM2A 2QX7A 4KMRA 3O90A 2G6BA 1VPVA 4RDCA 2J5QA 1TZJA 4Y6OA 2OCIA 2OCYC 4BCDA 4OB8A 1GZDA 3JQ8A 3TYXA 5E7IA 3CURA 2A9FA 4GBJA 3UJNA 2Z9BA 1BEUB 3D4PA 1KHHA 4ZVLA 1SVUA 1WEKA 1IM8A 1S9HA 1KK0A 3H5TA 4HAOA 1BRTA 3O9VA 3UH0A 2DWQA 3A1VA 4NZYA 3ODGA 1L4EA 2EP5A 1KDOA 2PVPA 3UOGA 3PDWA 4C6TB 1FLVA 3QM1A 3AH8A 3QVMA 3BSYA 1BHJA 1EP3B 1CEXA 2FWAA 2O1EA 1BHQ1 1R3DA 3ZPNA 1WBBA 3HEMA 2C5LA 4DQLA 1TZMA 2W0MA 2NXJA 3NDRA 3WLQA 5FBZA 1E94E 1SELA 5C1DA 3TF5A 4DMFA 1F38A 3H1FA 3S70A 2QWXA 3GRPA 1WTHD 4LNUA 2R8RA 1NXTA 2NTNA 4N82A 1G3QA 3UJ3X 3C3MA 4Q3NA 1MX5A 2CMGA 4G0PA 1QO9A 3SG0A 1QUFA 1SC6A 5IABA 3S4YA 4ZYXA 3TFQA 4I8XA 1UPCA 4FCWA 4CWAA 1FFCA 2W8BA 1XOIA 4KO1S 5A89A 2H08A 3PGXA 4OCZA 1G8MA 7REQA 1RAHA 3NE5B 1V0FA 2ZYWX 1E89A 3F67A 3LI2A 1LB1B 3ZBUA 3G9TA 1T0UA 1C3XA 1CRLA 3BA6A 3FRIA 3GHYA 3LW7A 2YYAA 2P30A 4F9EA 4ZGGA 5M2QA 2V3CC 4RDJA 1MDFA 4D99A 5FBWB 3PR3A 4WCFB 5CM9C 2Y1GA 2YJZA 1K28D 4KOEC 4UZEA 3IBFA 1QQ6A 2JIRA 4ITRC 4YLGA 5ESRA 5ANRB 2B2CA 3P4XA 2G5TA 5LKAA 4V2UA 1ORDA 4N9WA 1D1NA 1T35A 4Q3KA 3Q7SA 2MYNA 3KJNA 1R4ZA 5FI3A 4OMCA 1L8QA 4UDXX 2QTLA 5LB2A 3IP7A 5EZQA 1UBGA 1DQRA 2CNBA 1PHPA 2E48A 2WQZA 3QFFA 5BT8A 4I5DA 4DLZA 1MRZA 1XAHA 3EBPA 1J7JA 4HBZA 1ENZA 4DKXA 2WVJA 1F51E 4K03A 5GAJA 2OILA 3GR6A 4QBKA 3IPCA 5JLAA 4GKBA 2YHAA 3WLRA 4WNYA 1L5LA 1LPBB 3NHZA 1O8BA 1SUFA 1TRHA 3WVNA 5AUOB 4G4GA 1LLUA 2VDJA 5J63A 1ZWKA 2EX0A 2OLKA 4FWBA 2IBTA 1GPH1 3OW2B 2X0RA 4I5IA 5KQSA 4QG7A 1M2FA 2NO1A 3S1AB 5LKRA 5T6BA 4ZKDA 1VG1A 4MI6A 2V8OA 4BIIA 1L7BA 3T5BA 2H4XA 4MUEA 2FEOA 1CHDA 2OO7A 2E9SA 1IN6A 4B4UA 1YZNA 3KCQA 2WU0A 3OHPA 4LXGA 1PJ3A 2J0SA 1V16B 1NJ2A 4EZIA 4P80A 2CGEA 3CEJA 3MWEB 2WK1A 4NEQA 1J0XO 1A9QA 2PV7A 3SJPA 2VHJA 3KPWA 4IGAA 4CEHB 3A31A 2H5IA 1YJ5A 2VQSA 3T5GA 5H68A 1YUNA 2QSUA 4FOPA 4DXDA 5EXXA 5M34A 3E9EA 2M32A 5KWSA 2GJAA 1A3CA 4W8HA 1MVOA 1V16A 4LN1A 5ALTA 3T7TA 3U37A 4RZHA 4CJXA 1P6UA 1ZNYA 1W46A 1ND5A 2WJ6A 1QGAA 1JIUA 2C2BA 4CEHA 2X1VA 3SZGA 1EFHA 4FR0A 1LS6A 2PUJA 4JI3B 3H0EA 1G3IA 1Y7PA 4WHMA 4HNAB 4CYMA 6LDHA 3UUGA 3R9KA 2CVPA 1P39A 3U19A 4MW4A 3EZYA 4IRMA 1GGJA 1L6IA 3AY0A 5BV8A 1JFVA 1GL3A 4Q66C 1GZ4A 1PLJA 1VHOA 2OZLB 2VAXA 3QE0A 1HG1A 1JTEA 3QH4A 3KL2A 4TXHA 6ADHA 1JVBA 2OUKA 3C98A 4L5AA 1M54A 2BEKA 1S8FA 4MS1A 2D5LA 4BEVA 1XR3A 5AFSA 2HCJB 5IJ9B 1YK0A 1ZD4A 3VXKA 2WYOA 1IATA 3H2ZA 3LPNA 3M4ZA 2XYPA 4K8OA 4MMYB 2IH4A 1NDQA 1VI6A 1VJ0A 3CT6A 4JBHA 3ZD7A 1EHYA 4NJMA 1J22A 4TXNA 3ZGNA 4N7BA 3LDFA 4E3ZA 1KI8A 1TM3E 2DSNA 5B64A 1KMMA 1QRAA 5G02A 5KYVA 5IUNC 3F5QA 3AOGA 1HDEA 4RF5A 4CL0A 2WM9B 4OQEA 2CNNA 1L4FA 4OATA 4RZ3A 1JKJB 1UZNA 2W4QA 3NGLA 4RDXA 2PZBA 2CMDA 2H2GA 1D9XA 2FUG1 2PAAA 1YU9A 4AP9A 1GARA 3AL2A 3KPVA 5JDCC 2CKDA 3DA8A 4LG1A 3L79A 4RGBA 3TPZA 4PO1A 5DTQA 1TJ3A 2Y8EA 5FX2A 2FRXA 3FB4A 1X7WA 3PQFA 4ARUA 1SIBE 3CRRA 3FMIA 4RQTA 1JFSA 3KKKA 4K9QA 3M2PA 2R6CA 2R1VA 2H4HA 1C41A 1KMNA 2EJTA 3LQYA 4A2WA 4CEJA 4Q1AA 3W90A 3HACA 4R69A 4B8YA 5AKHA 4QVJA 2CUKA 1WSAA 2XKJE 4UHBA 3QUAA 3OZFA 1NP7A 2A0FA 4W5QA 5JS1A 1UPTA 3VNUA 5E6TA 3A35A 1P3DA 2D4HA 2JD0A 4YS6A 3LFHA 4P5PA 2ORYA 1O57A 1PS0A 3PX3A 4BRZA 3ZJTA 5GM2A 3ONFA 2CFRA 3J81k 2C77A 3ZZ1A 4D81A 5CIYA 1CUUA 4L8YA 4DK0A 1IJEA 3FWZA 4R51A 1X7ZB 1GLGA 1XAIA 2WVGA 5AHXA 5EIHA 2J08A 1JU4A 1EDOA 1YC2A 2FK8A 4HAUA 3E48A 4IHJB 3PUMA 5G0TA 1S2LA 2OHFA 2WU3A 4P5DA 4O5OA 5TVGA 5A04A 3ESQA 4Q4HA 4XVQA 2QEXB 2M1ZA 3G23A 3PFFA 4YCAA 1D0IA 6CHYA 3F6PA 1RVV1 1ULBA 1JDBB 4PG5A 5C31A 5IN4A 2ZG6A 2FUKA 1CR2A 2XXAB 3R09A 3U9SA 4M36A 1NQVA 1P80A 3GFBA 3FF1A 3UG7A 3H1BA 1PR6A 2YINC 2ZS9A 4XX0B 4WZEA 1WORA 3FTCA 4XD2A 3GT7A 3WRVA 1Q6YA 2EFYA 1JTFA 2H5LA 4MYSA 4Q7KA 4TTRA 2O54A 4PX9A 4UUAA 4ZA2A 4ZZ0A 3SY8A 3O5AA 3E82A 3HJNA 3FNBA 4P7GA 3RHFA 1DPGA 2VP6A 4XX1A 1SMKA 4L4UA 5HK8A 5BSGA 4EI9A 2AG1A 3AMVA 1LEHA 2A3RA 3JTEA 1WMEA 5EAIA 4TLEA 4Z1OA 4LF8B 3QX7A 4M60A 2MSWA 3RBZA 1M5RA 1NE2A 2GPSA 2R60A 2XUPA 2YASA 3ZCUA 3LUGA 5CDGA 3CQ9A 1PZMA 3KR9A 3GD5A 1KO7A 4KE9A 2JVIA 2QLFA 2BE9A 2JGKA 4C14A 1M1KD 3CIFA 3GBVA 2L2QA 1GG5A 2A9RA 1X94A 2JGMA 3LMKA 4RF3A 4EHHA 4AJLA 1J9GA 3RS5A 4RSGA 4KPFC 4YALA 3MINA 4BNFA 3KLPX 4Q4JB 4B34A 3DLAA 4MUBA 4W4TA 1PEDA 2Z9DA 1OBFO 4FYKA 2XMZA 1PG2A 1XMPA 4Q3CA 5EKSA 1VFPA 3TL2A 2YIDA 4D42A 4L2IB 2GFIA 1A97A 3EIQA 4MQFB 1JECA 3F6CA 2Q21A 2A8YA 4W5HA 3H99A 5MF6A 3QKSB 4BQNA 4H27A 2SHKA 3C14C 1WMAA 3Q3IA 1FP1D 4REQB 5AW2A 2ZQYA 4AX4A 1PJCA 1GSIA 1XTQA 3CZQA 3B3GA 3M6FA 3B5EA 3OKXA 2OHIA 2RG7A 3HA5A 1R6DA 1RHRA 2NZ2A 2QBYA 1D5WA 1C7IA 1YQDA 4CQMB 2PLWA 2ZTMA 1W0CA 1QF6A 1JDJA 3FDZB 2ZBDA 3I76A 4CL3A 3A1EA 3D8UA 1ADFA 3TTYA 5D3MB 2APJA 4ME6A 4EKNB 1ZN2A 4P33A 2WRZA 3RUCA 5DWVA 3KXIA 2O2EA 2Y1KA 4RDHA 4KSCA 1XCMA 4KQEA 4E4TA 3DPUA 4H1WA 3DBHB 5ITZB 3ANTA 1PVDA 3CW9A 3A11A 5J4VA 1LBIA 1BQEA 3MNFA 1Z16A 3R3JA 2ECOA 4II2A 3AESB 2MSEB 4G1EB 1R0KA 1EDZA 2BGKA 4QXOA 4UZFA 2IUEA 5EZ5A 3U4GA 1JAIA 1X92A 2IQIA 4OB6A 3EA0A 4C4TA 3Q2KA 4DLTA 1S7CA 4D4HA 4F0JA 4J0FA 5FFMA 5ITZA 3M89A 2GEDA 4DAOA 4QOIA 1MJGM 3DUWA 2PEZA 4AJ2A 4E09A 2CFIA 3VOAA 3IO3A 1N9GB 1JH8A 1T4MA 4IKEA 2VRNA 3EVAA 4TL8A 4LY9A 4D97A 2QAGC 3MLAA 4GI7A 2VQEB 4WFIA 1NRWA 4ND8A 3K1JA 3QKRA 2NZWA 3R7AA 3GRVA 4KN9S 3QJGA 2BFBB 2BVNA 3OPMA 4D96A 5IVKA 4J9VA 1CVRA 1RJGA 2WJJA 2D3NA 1DKUA 2H1OA 4NMXB 4HT3B 1MOZA 1N0UA 4A2QA 4X7MA 5HUQA 1VBMA 5DM0A 3ZC3A 2GJ9A 4D9FA 2W2LA 2P62A 2O48X 1WULS 3NTUA 2PVCA 1ZIPA 5JXJA 1Z38A 1NDHA 4L0MA 5KSPA 3AI1A 3PDCA 2H1WA 4RGQA 5FPPA 5A62A 2WD8A 1K63A 1R8YA 2AHRA 2NQ8A 2WBLC 3A04A 3IBGA 2ZT6A 1L7NA 4A8HA 3LPMA 5F4JA 4C4SA 4LJSA 3GLUA 3KQPA 3FCOA 5KU1A 3FHTA 2OZEA 4AECA 3ZZ0A 1Y5MA 2QU8A 1GQQA 3FVVA 1YIOA 3HZZA 5BNWA 3ROMA 2ZWMA 3H17A 4UUPA 4B4VA 4P3XA 5L7WA 5NLLA 3NDIA 2VP9A 1W59A 2GCEA 2WDZA 4NE2A 3TKAA 3V1NA 2BKLA 3FTQA 4RTOA 1SCAA 3G2HA 3PPXA 1HFKA 2VBUA 1W85A 2JBAB 3AW9A 4KTTE 1FPMA 5FLEX 4A8JB 5BWLA 1TDJA 2DUJA 1KYVA 5JT1A 1YK1A 2VVTA 1MB2A 2B92A 3G0OA 1GAXA 2QTHA 5EG5A 3FPCA 2ERYA 2PUDA 1CYDA 2MOKA 4B6GA 3LHSA 5BQXA 3HY6A 4EJSA 2IS4A 1V5GA 1MABA 3WNCA 2YIVX 2I3BA 4HFNA 3FPFA 4HVCA 3C3YA 1U31A 5B6JA 3SC4A 1CVLA 4RXUA 3GRYA 4OQXA 1FLNA 3IIJA 1SH7A 3UFXB 2FPXA 2LP4Y 4RSRA 3F4BA 2C2GA 3HMKA 4ALMA 2JFHA 1M90D 3PUNA 1INLA 4J7UA 1X1SA 2W48A 2WF7A 2PYZA 4ZQHA 2IHNA 3IEPA 1NMEA 3T06B 1RPZA 3CLTD 2OFFA 3W8RA 1N78A 5TLSA 1P2TA 1GDDA 3OW7A 3I58A 4FFPA 3QSGA 4FFVA 4XPIA 3UHOA 4AJKA 2C54A 1OT3A 1NBIA 2RDMA 4OV6B 5TY0A 4FYYA 4GGOA 4MYTA 2NQ2C 4D74A 3O95A 4ZOQI 4I55B 3NFYA 1C8LA 2FP4A 3G2NA 1KAMA 2B25A 2LE0A 4R1NA 2IA5A 4ZARA 1FJGB 1DC3A 1J90A 1NKTA 2AFHB 1X74A 3H3FA 3I01M 4OH7A 2IEGA 1XDSA 3G2OA 2QRGA 4G9BA 4MIKA 5JNVA 2WFMA 2RGYA 2XRYA 3GFQA 4P6VF 3VSCA 1PO7A 1WCIB 3OX2A 4E51A 4I55A 2XZLA 1M2GA 5D3ZA 5ALHA 2BKUA 1N57A 2A58A 1E61A 3VH4A 3SJZA 3MTEA 4DEVA 1P1KA 1DFHA 2IOFK 4CF6A 1LWNA 2NQTA 1TJPB 2CNWD 3RHSA 1ISPA 1DQSA 2ROQA 2PG3A 3KS9A 3M3PA 4HDSA 4LRXA 2IV7A 6NULA 1G2OA 3CINA 1ULAA 3C6QA 3QOWA 3IMGA 1JBEA 4FFOA 2C7GA 3P4YA 4FLMA 2OPHA 5B3LA 5IKPA 4DV7B 1E7QA 4Y9SA 3JU4A 1FOEB 1A8UA 1F2DA 3VO2A 4UNRA 1MX3A 5D51S 5HBRA 3W5SA 1QG6A 3K1TA 2GYWA 4WK0B 1D6NA 5CT9A 1WU7A 1T0JB 1YMVA 1WBJB 4AJ4A 4B79A 4NS4A 1RRCA 5CFZA 3T6KA 2CF5A 4KO3S 2REQA 2CEKA 4GBED 4UREA 5CP8A 1JFLA 1U4NA 2YXDA 4B2YA 4CW7A 2XE8A 2XB9A 3U0VA 4GVLA 4M22A 1ORTA 3TNJA 1JDNA 4B45A 4M7PA 1H9CA 5L46A 3H2KA 4LSZA 4MX8A 5FEUA 4CFZA 5HZMA 1HQCA 5ABPA 1IXRC 3HYRA 3NBYC 2YYYA 3BMQA 2DFDA 3EWAA 4KAJA 4Q7QA 1HOTA 1HYHA 3SXJA 4E3WA 3A7DA 1KQGA 2NUPB 1P0CA 4I5FA 2EKZA 3KWLA 3QV2A 3WLAA 2C95A 3FYUA 3WKCA 1N2EA 1T4GA 2WM8A 3ELBA 4CM9D 5A6SB 1CC1S 4PWZA 3KWMA 2QD3A 4JJAA 5E6UA 4BQOA 3ZXSA 3O8OB 4MB6A 4OPVA 1QFXA 2ZTSA 4QQRA 1HTTA 4RIEA 1PNQA 3AONB 5I9NA 3HHPA 2IY7A 2G25A 1CRPA 2H7CA 4DWWA 1B16A 2ATXA 5L3SB 5G0SA 3AHIA 1KQ3A 2PMBA 5JSUA 2CXHA 5EVCA 5I9IA 4AY3A 2Y92A 3RS0A 4DC9A 5L6MB 3FOZA 2GEKA 4L1KA 3GIDA 1Z12A 4ZEOA 5IYRA 3EVCA 2QVYX 4A3SA 2J9XB 2WV9A 5G1NA 3FCYA 1QZTA 5FOSA 4IYJA 1MOPA 1KH2A 1RAFA 4JL8A 4XIIA 2B30A 1DUSA 2DU8A 4GP9A 5JJ5A 2TYSB 2PKWA 3I42A 1VM6A 4PZLA 1NAHA 3NOOA 5DLQC 1BFKA 1YUMA 1PAUA 2W58A 4Q0MA 3OQIB 4M98A 3NXKA 3TFWA 3ULKA 1MT0A 1VJSA 2GILA 2ZW9A 3FFXA 5CH8A 4M8KA 1FNDA 2VUHB 4KR2A 1P73A 1NSFA 3AVUA 2FX2A 2HU8A 3ZWXA 4E46A 2GJKA 4WJLA 4ADSG 4M0LA 3VKWA 5FTJA 1QWSA 2B4RO 4PZ0A 3T3OA 1ZK4A 2GKOA 2FAXA 2WPDA 2HPAA 4WEQA 2WILA 1KMHA 1XUOA 3RRJA 5JNSA 3IEUA 1K7FB 3IS3A 2QI9F 5ALOA 3KB2A 4R71A 4MGZR 4CUJA 3HXOA 4F06A 3TM5A 1H2YA 3UC5A 2AXNA 2H3EA 3CR3C 4MJLA 1E1QD 2VHZA 4F4JA 4FIDA 3E1SA 3LL4A 4M8IA 5I4CA 5C80A 1E8MA 5K6TA 3UXMA 3CLSC 2JI8A 1WF6A 2WU1A 1U7DA 4HUQB 1MAUA 1MO4A 4OLFA 3WMRA 3D8SA 3A25A 4DG8A 4NARA 2OSBA 2XRZA 5K8VA 3FWYA 2AD5A 4MR8A 1OI7A 3K9BA 3V00A 4AAYA 2QRLA 4YT8A 1PZXA 3KVVA 3SXPA 1FY2A 1Y3BE 3OY7A 1K3UB 4S0ZA 1SVIA 2JF0A 1HLDA 2J5BA 1AHNA 2DPYA 2V5AA 1F8YA 3E1KA 4JXJA 4Q1CA 4AIIA 3HNOA 2GPTA 1ZM4A 1B14A 1VXOA 2N46A 5JS8A 2O8FB 5LQSA 3HKEB 4TM7A 4FX2A 4UNPA 3PHJA 4JC8A 4YRQA 3V33A 2ZIWB 3UIEA 4XR6A 4B47A 4EMBA 4QM7A 2AV6A 1DLIA 1EB9A 2EYUA 2PL3A 2Q3EA 3MYRA 1CUFA 4X6YA 3QWFA 1GJRA 2Q3FA 3KT3A 3U1VA 1BMFD 3AINA 1UODA 2ZK7A 4F3CA 2K4MA 1IIRA 1IK6A 1K66A 4DOMA 1GV0A 1AKRA 3W5UA 5JASA 3K70B 2XBMA 4FNGA 4J2TA 2GR9A 4DQXA 4MAAA 1U7XA 1A1SA 3K6JA 3HWX1 2XNDA 3AF2A 2G1KA 5AVJA 2Q0HA 1SJ9A 5HE8A 1Y1TA 1NN5A 2VLBA 1NY6A 2I22A 3VDQA 1XZDA 3PE3A 5LJIA 1W1IA 2XWQA 3SKYA 4C4XA 4AKSA 3O2NA 1RAIA 4A0SA 4BNYA 4M9ZA 3CLUD 3V4ZA 2QXUA 2P77A 2JKYA 1W5FA 4UHCA 1IBLB 2H1LA 1SBCA 2XTJA 1RZ3A 2DT8A 1YDMA 4LGVA 5TS2A 2F1JA 2FPLA 4MIEA 3ONUA 5JH7B 1XNRB 4AZTA 4G0XA 3L1HA 3TCKA 9ABPA 2Z30A 1V3UA 3QNUA 2H57A 1JTVA 2WOJA 3QEMA 4YI3A 3ORQA 1O94D 1I7PA 4HD8A 3KJGA 1E2GA 4UHHA 4ZYVA 4ZOCA 2QDXA 3GU3A 2IXDA 3NV7A 5THKA 3RF7A 2BP7A 4NX2A 3DEAA 3M83A 1QRUA 3ZKAA 3FPAA 2PH1A 4ZXPA 2VPZA 3E58A 2GWRA 1BU5A 1UKAA 3AU8A 3L9WA 1W0JA 1GU1A 2IJGX 2QNBA 2YHSA 2NPIA 5LMZA 4H6WA 2CVOA 4RL6A 1XPUA 3IP1A 4ID9A 3VQTA 5EJGA 1XKTA 1P4HA 4EDHA 1VCHA 4N5LA 4YQZA 3G79A 3BG5A 4WVLA 2X13A 3MRSA 4H7FA 5FT9A 3H6HA 1MB3A 4OQZA 1FP4B 5LM3A 3WXBA 1SBIA 4YEDA 3QFRA 2EZ4A 1NT2A 3HZHA 4WXYB 2OBYA 4Z4WA 4QC2A 5HG0A 4CKEB 1BIFA 1VLLA 3Q7PA 5B6PA 3F2IA 4TL6A 1ODTC 4UUQA 1TM2A 1A5BB 3MCTA 4I6JA 3SZMA 3V4SA 4E1AA 2RHOA 3EXG1 3UK6A 1G1AA 4UAJA 1Y42X 4HDMB 3QP9A 5DGXA 5BW6B 1QCDA 1O9BA 4R8SA 3L01A 4OLAA 1I30A 2AI3A 2XUHA 3LUCA 5AYVA 5FA6A 1HNWB 2BEUA 3UGQA 5MGBA 4IDCA 4H1UA 1UWLA 3LSYA 2ODWA 3E0XA 4CRWB 2XUJA 2EZUA 2TSYB 4PNPA 3EF3A 2HSGA 4UUMA 5E1MA 1PG5A 1OAKA 2H31A 2XI4A 3CNHA 2AJTA 2DHRA 2KPOA 3HMQA 3I05A 3NBAA 5ICGA 2GPYA 1JNYA 1KAGA 2NPOA 5KDOA 1GNPA 2O3QA 4IIDA 4YJGA 2YWFA 4YUXA 2B7LA 3VR4D 3EXHA 3FR7A 1Q95A 3GSIA 2CLDX 2CVZA 2W6MA 1ZC3A 3PD7A 1V43A 2HJSA 2IIPA 4L8GA 3ZOKA 3RYCB 2OCPA 3NBFA 2Z6AA 1YA8A 1VL0A 3WLKX 1L1EA 5I5EA 2MMGA 4HWOA 4C5BA 2LKDA 2QUAA 3DWFA 1KRXA 3HVUA 5D6OA 4EKEA 4WT7A 2XRFA 3IDZA 3HPQA 1ZOIA 1KZHA 3WYAA 1XD2A 1DTEA 1WHTB 2C97A 4CZ2A 1PGNA 1UMDB 1ENOA 3A0UA 1Q7EA 1TXGA 3B5JA 3M6VA 1U0OC 4ZT5A 3THYB 4FLFA 3MT7A 4XKJA 4J16A 4PAAA 3JSAA 2E3JA 4TKLA 2HRCA 5DNYB 1RWMA 2IYQA 3AY7A 3S3TA 3CCVB 1ONNA 4H7KA 2NX2A 5DFAA 5EESA 2II6A 3DOFA 3K15A 3BFPA 2H16A 3SEFA 4EUEA 1Y8RB 4EVQA 3RBVA 2FR0A 3ROXA 3U4MA 2CDNA 2WZBA 1MO5A 1QAOA 4LA4A 4UVHA 5IAAA 1JG3A 5KYWA 3K8YA 3F4LA 3PEEA 7YASA 4P4GA 3QEJA 3RAEC 3K71B 4LE0A 3I32A 1TOAA 2XQGA 4QGGA 4ALLA 1V7PC 3AP1A 3LZ6A 3FJOA 3NC4A 5DP1A 1X15A 3I6MA 1I3OA 5CVVA 5SYNA 5I4IA 3FTFA 2GTHA 4BUZA 3IJEB 3IUPA 4GMGA 4N49A 3W04A 2Y66A 3SP1A 3UV3A 5DEIA 2CMFA 1RYMA 4IVPA 3NDBB 4I8DA 2KMLA 5EKDA 1YQEA 3S44A 5JECA 2RHRA 3ZG6A 1F2VA 1NAIA 1CZKA 3OICA 4CFYA 2FTKE 2BTQB 2Z8YA 1NQUA 1YR6A 1G42A 3HM2A 2JFVA 4FNOA 5FTWA 4Z4TA 3GD7A 1CQJB 4O4JA 4EENA 3K31A 4NSNA 5IDQA 1JP7A 4DLWA 1EFRA 3UXEA 1T2VA 3KBBA 5AM0A 4FGWA 2JCBA 4MPDA 4PFSA 4XCXA 1XLUA 2XMDA 2P9JA 2NZXA 3BT7A 4DTIA 4CE6A 4EQZA 3ZGLA 3PDJA 1YQGA 2D3TA 4XGRA 1UPUA 2DT5A 4PSVA 1F4VA 1ZVVA 4R01A 5J23A 4MKGA 5IAKA 4RCVA 2NU7B 4TSRA 2FX5A 3BHNA 1NJFA 1KNQA 4YQYA 3AZQA 3ZIAA 3HVJA 3ROEA 2OD2A 3CX3A 3Q85A 1CW2B 5EE3A 4KUHA 1N5MA 2PJZA 2VDNB 5JANA 1J8FA 3IV6A 2I2FA 3RNLA 3HAGA 1WXDA 3ZU6A 5KMGA 1GXSA 4DCVA 3GUZA 1KYZA 4G0UA 1R10A 4K26A 5JQGF 5AMXA 3IJ5A 4QYWA 1BE0A 2QVCA 1U8TA 2A35A 1EVKA 4ZQCB 4R1QA 3P26A 1A5AB 1HNXB 3TEMA 4KZPA 4BC1A 3CLRC 3P0FA 5P21A 1OA0A 2FG6C 4H4DA 1TKBA 2NU8B 3SBOA 3HJUA 3P2OA 4GM1A 5BSVA 1R9GA 1J20A 3QWIA 4Y9TA 2ZZQA 2JLBA 2UVPB 4BLQA 4DCOA 1WDLA 4MV8A 2QR2A 1WU8A 2JIOA 1RCFA 1KJYA 4Q4AA 1VJTA 1CUZA 1NMYA 1OXTA 2YDYA 2ZUVA 4XSHA 2I2DA 4ZMRA 3MIZA 4RA6B 3EASA 1RHMA 5KU7A 5KCZA 1QFJA 1MQAA 1E2UA 1HL3A 4XQGA 2FK7A 1UM9B 1EFPB 2JJMA 1Y7IA 2PXAA 2QX8A 1C1XA 1Q92A 4IO1A 4N0PA 5DYYA 4QWWA 5FUBA 1RRFA 4YRJA 1MC1A 1ONOA 2OGUA 5ALYA 3WK5A 3CCMB 5K6AA 1SHZA 4DXAA 4H7HA 1M5UA 4LDNA 5IJAA 3NYIA 1U7ZA 7MHTA 2EW8A 4DR2B 2OVBA 3NTQA 5F5XA 3D7NA 4XL9A 1YTLA 2IOQA 3NALA 1GT6A 4UHKA 5BUZA 5DTIA 2HCRA 1UJ4A 3EMVA 1DT3A 4KIJA 1U2GA 1Y80A 2OWDA 4V3CA 4S1PA 4CLEA 2ZTVA 1CJSA 1I1HA 1O08A 3DAHA 1O9HA 2MCFA 1WVIA 4PSAA 3LZDA 4UTZA 3Q6NA 2VF7A 4TPKA 3AVTA 2G63A 3EVDA 4IIXA 3F7OA 4GNKA 3PNYA 2GAJA 4TWZA 4YIHA 5T57A 1D7OA 1VRVA 1KI4A 2F8LA 3RIEA 1DU4A 2FQ1A 1J9EA 1ZH8A 1J06A 1S9DA 1XZNA 2JARA 3NT2A 4QJ3A 4D26A 1RI4A 3QQ5A 2A1UB 4HQLA 1CEQA 4KVZA 4B7CA 3GZTB 4EVRA 1L4YA 2V7QD 4BP9A 4MVXA 1W4LA 3ER8A 3LO5A 4X7PA 1KKUA 2AG6A 5KVQA 2ERXA 1YNOA 1M1NB 4WX2B 3MCUA 4OXIA 3VYVA 1RZUA 4ROTA 4BKUA 4ZCTA 4W1SA 1VLZA 5FNVF 4ANFA 3PVDA 2ZI5A 3QVUA 2A1UA 5FBKA 1WXXA 1FU4A 3DMDA 2GYVA 2ZYTX 4KV7A 3PC4A 4ZT6A 2FPSA 2O2YA 2OLEA 2QNRA 1YULA 3B2EA 1P29A 1EPUA 1JB1A 2PGDA 3P0IA 3TLGA 3JWGA 5KJFA 5TC4A 4BZQA 5LVAA 2V4UA 3WAJA 1V5IA 2MYUA 3P5BA 4XM1A 4ZMSA 2IW3A 1V6CA 2WKSA 3DPSA 2QLMA 3A27A 1T24A 4RU1A 5CXSA 1MPXA 3HXMA 5AXDA 2GAAA 3DBVO 2PGJA 5ICEA 2OECA 3V8NA 1COWA 2HIGA 2VYND 4S1OA 1GAWA 3A4YA 3CRW1 3PHBE 4B6PA 4QYXA 2QKYA 3HCAA 4DCTA 4DMRA 4J94A 2QRKA 4B6JA 3CISA 2HF2A 4GEKA 3FH0A 3BMNB 1T0BA 3I0MA 3JWPA 5AI8A 4F84A 2GJPA 2GEBA 4NYIQ 2VT7A 3KQVA 4DJAA 1PJQA 1PK9A 3C85A 4TN5A 3QXCA 3V48A 2X6YA 3PIRA 4NEHB 2AQIA 3FJ1A 1BDMA 3VNVA 3A9SA 3SYKA 1JWBB 4QEDA 2JGNA 4NBSA 4ID3A 4RHCA 1R64A 1TM1E 1T2NA 3VJLA 2R8OA 1P9LA 3Q41A 3UY4A 1GCIA 1N7HA 4ZO9A 3V8MA 1LDEA 1D0SA 3SX4A 2NV6A 1Y82A 1XZCA 2NXEA 2RGCA 3HYTA 1G98A 3ZGXA 1MNQA 3QMVA 4KIGA 4QHYA 1BE1A 1R5JA 2B4YA 2WSMA 4LC0A 1GCOA 4JP3A 4YBZA 2BLLA 5KPDA 3AP3A 3PTAA 1L4BA 2XTZA 5BN3B 9LDBA 2RKWA 2IIBA 2N9UA 5F12A 1O96B 1Y3HA 2P0AA 1DIRA 2ZBGA 1EJ0A 4GR9A 4M99A 4J0JA 4OGKA 5G0VA 3T5DA 5KVSA 4KKUA 3PEUA 5EWMA 4P35A 2QTZA 4UE6A 2C2WA 1JHYA 3NIDB 4TMFA 3TPCA 2GN1A 1M74A 1RM4A 1U5CA 3O75A 1U2DA 4G0MA 3V4VB 3T1NA 1XMXA 1GZUA 3FOCA 3FZGA 4R16A 3UWOA 1SQSA 4P9SA 1C30B 2OD7A 4DBZA 4EF5A 3G2QA 4GPD1 4OXXA 3UWPA 3BL6A 2PUGA 3L4JA 3S1LA 4DJJA 1U4SA 4XGQA 1GG9A 2LWIA 2F48A 5A0VA 2AX3A 5AXCA 4DANA 4EABA 4AJNA 3ROTA 2CLKB 1QVZA 4MUMA 5F98A 3VC2A 2ST1A 3AB8A 3NXSA 1F4LA 4E08A 4EPVA 4LPSA 3RY8A 2UVQA 3D2LA 4JB0A 3U1TA 2V6BA 5TXGA 1MX1A 1GZ7A 3H87A 5CMLA 2F1RA 3IV9A 4PG4A 1YMUA 4N9QA 3T15A 4C0WA 1USUA 1DXOA 2QLJA 1FFXA 4P36A 2WJPA 4ARAA 2XVXA 2QZJA 1KAQA 3ZYCA 3U9TA 3MUOA 2ZB8A 4PXSA 2HHLA 4WN9A 2C31A 2ZXIA 3G9QA 1SOMA 2DPMA 3W05A 4KQCA 1HLGA 2QX4A 5EE1A 3TQIA 2XEDA 3B1KA 2G67A 3LLMA 4I4LA 3GLHB 4BQEA 3DDUA 3UAYA 3IO5A 3SMVA 5DSTA 3G3EA 2QRHA 2O14A 1ZLXA 2FN4A 2XCOA 3D02A 2OESA 3HO6A 3KE9A 3N74A 3NBXX 3I3OA 3BL5A 3V8EA 5BYJA 3F98A 4JYBA 3JQ6A 4QYTA 4YJ2F 2JCXA 4L7VA 4HWTA 5ETJA 3VU1A 4D41A 4YUYA 5JNTA 1R0BA 2IHTA 4ZOLF 1W48A 3CB4A 5HFAA 5M29A 3H4VA 4IUBS 1QYVA 3MC1A 4R2JA 3IOBA 4XLCA 1U5BB 1KPGA 3LQQA 1V41E 3JVIA 2C9OA 3BRSA 4L28A 3RI3A 3RT7A 4WESB 1IWOA 2K5UA 3BD9A 1NV9A 1GGNA 4R0VA 3LGSA 1NBMA 1NIPA 1P0IA 1KEZA 1S8AA 1TUBB 2FETA 2ZSBA 4QV2A 1Y9DA 4PX5A 5BSFA 1YTUA 1VG9B 3TD6A 4QAJA 4OJTA 2OP0A 4LQ4A 2WJIA 3JVEA 3RJZA 4EGFA 3CWCA 4JMLA 5AW3A 2V6GA 4BJ3A 2IP1A 1N7IA 1YV9A 3ROKA 2WT4A 1V3TA 1M33A 3LCJA 3TLBA 4PZYA 2UZ1B 1VHEA 1E2BA 1ZOPA 1F6WA 3ONVA 4K9RA 2FXIA 3L6UA 2A0XA 3ASPA 3L8EA 3M9WA 2EX1A 4LMBA 1E3IA 3T7KA 3PA6A 3ZHYA 2E1BA 2XNCA 1MW9X 4OXQA 2WA1A 1QO0A 2BDEA 3UAGA 1J5EB 4AKHA 4IAOA 3V7NA 4IY1A 5KPJA 3K0AA 4IUCS 3WKEA 3QA9A 4JL6A 2R1TB 4C7VA 5LUAA 3KXKA 5KHLB 1C80A 4Y2TA 3LBAA 5I51A 4EG0A 4HS4A 4LBZA 1UUFA 5CEFA 4JQZA 1LS1A 1ECFA 3ZHTA 1OXSC 4CG0A 3CVUA 4GIBA 4U6NA 4A03A 5FWYB 1ISGA 4BIMA 1XZLA 3AFNA 3TR5A 3BIJA 3C6KA 2V6FA 2XMPA 3TBFA 3BM5A 3E4DA 4ZT2A 5HCUA 1AB6A 1KSJA 2R6GA 2CRVA 2P4EA 3TEFA 1QPGA 4ZEWA 4OUDA 3PI7A 4JT2A 4JT9A 1NQXA 2WSSA 4NBKA 4O4IB 2K7ZA 2OFPA 1SWWA 1T9GS 3HPRA 1G2PA 1E79D 1G8PA 4QFDA 2JJ1A 5A9SA 1KMQA 4DLUA 4HXFB 4MV7A 4MLPA 4EI2A 1KO4A 4YJFB 3T5CA 1YHYA 4O4LB 3GLGB 3ZY3A 4LK2A 5H9VA 3O4VA 2HM7A 1MAAA 1VL6A 3T41A 2DPLA 3K53A 3FIUA 4C0AC 2ORIA 2ZRCA 3C8DA 4L7QA 4I14A 3D9QX 4PO9A 4QNMA 4DHEA 2WTUA 2VJMB 2G0NA 3ZU5A 1I3LA 1E3XA 1NRKA 3DYBA 3VRHA 4ZYZA 1EP1B 3D6VA 3DCIA 4OAQA 3IUMA 2GSDA 1G5RA 3ZZUA 3PEVA 3VR0A 3FAZA 5ER9A 4E5KA 2H5JA 5K45A 1H69A 3F9IA 3AFOA 2IXEA 4DILA 2FG5A 2VK8A 1EM6A 3JD3A 1M2VA 1UJNA 1O77A 1Y5RA 3FYDA 4PGHA 3UT5A 1EWKA 3P27A 5ITVA 3RYIB 1O3YA 4G1UC 1WG8A 4AMBA 3WS7A 2NZYA 4DBLE 6AT1A 1I3MA 3AR2A 3E35A 1QCZA 2OV1A 5I9SA 1ABEA 1X77A 3AY3A 3I9MA 4IDOA 1U3WA 4NENA 5DXAA 1GSOA 2AFHE 3X1MA 2J6HA 1IZ9A 3D8NA 2HTFA 1HVXA 4HYQA 3SKBA 4Z2YA 4AWBA 3T61A 1T8WA 4DV2B 1XQBA 2C78A 2CDCA 3N5CA 3LBIA 2IP4A 5LBIA 1VJCA 2ISSD 4GD3Q 3PQ4A 2MSLA 1VE6A 5DYTA 3T7IA 4DNFA 2V6MA 3I4FA 1R6XA 1GPBA 4DSUA 4TZKA 5FTMA 3QMWA 1ATIA 4LZZA 4M3NA 1PNVA 1YVDA 4OGGA 3TLEA 4NXNB 2IYTA 3T4XA 1GGVA 2PQ0A 4KDFA 5EQFA 4ALIA 4TV8F 4FS3A 1QIGA 1QE5A 5FJIA 2HX1A 3EIUA 4LCEA 1JR3A 2Q4OA 2UYYA 4DV6B 2UZ0A 1QRDA 2WUDA 3NH6A 4RACA 4U9IS 4YJHA 3R5SA 4G8BA 4XLZA 2GKGA 4P54A 4X5OA 1MIOA 1O6BA 1RT9A 2FPWA 4ZRNA 1DDGA 1I4OA 4V0RA 2QLNA 2YL2A 2OHGA 3EEYA 3RYFB 1VMAA 4O3FA 4PPQA 3RG8A 1X1BA 3LHFA 3A26A 2Z58A 4P4SB 1Q83A 1W9HA 4M0KA 3VAZA 3KDPA 2ET6A 3M7IA 4ML3A 2Q3HA 5AK0A 5LZ4A 2A57A 3UXHA 2R96A 3NZEA 2P4QA 3O3MB 1OXMA 4B0OA 4BO0A 4DT1A 3ZDBA 2BPOA 2ZLBA 1HEYA 2BGLA 2V6JA 3RS3A 4D0NA 2BEVB 1G3RA 3R7SA 4LI3X 3NHWA 5M5BA 5D8DA 1QVWA 2J5XA 2HZ7A 2JAHA 4KFSA 4M6WA 3TRKA 3UJ9A 4ESEA 4BVAA 4LWZA 2J4DA 1Y9EA 2Q5LA 5I7OA 3FIJA 1ZMXA 3PEWA 2O7VA 1UC5B 3HU5A 4FFNA 4JP2A 3U80A 3HNRA 2JZOA 1I2DA 3BJMA 3TJMA 4F5YA 5LQKA 3O8QA 4RKWA 3CKLA 1IOVA 3AVXA 2F1LA 2H2HA 3O84A 3OM8A 1F7VA 3RVNA 3RG2A 1QU2A 1M6WA 4D4IA 3R76A 5FR2A 2XUIA 4DNOA 5HVNA 4GBMA 3D3WA 2HFJA 1T8TA 3D2AA 4HTFA 3G4SB 2D5BA 4UNNA 2I34A 1J21A 5FO1A 1U9IA 2C99A 2JEZA 3FSEA 3VPHA 3AR4A 1OLUB 4MUAA 1T9DA 3OLWA 4HPXB 1L2TA 4MVYA 1QMGA 4Z54A 2IEYA 3LQEA 3E4CA 1PJ4A 2C5BA 4NYJQ 5DTEA 3WQZA 4NJEB 1RABA 5J3OA 3MWJA 3PQDA 2M6KA 2Q5EA 4A0HA 1NI4A 1FNMA 1OLUA 2G9ZA 3OP4A 5BMVF 2ZE6A 4F3NA 1DE0A 3X1KA 1QFZA 4PYQA 3TAUA 4LBWA 1KZGB 1M1YB 2O6HA 2WFAA 4V0MA 5K5EA 4DR5B 2GPJA 1NBOA 1RPJA 4M0MA 3ZGVA 3GJ7A 4ZTBA 4E5DA 4F3KA 1BA2A 1P4MA 2BI8A 1VMIA 1ZUIA 4JBLA 5JCOA 1RYNA 1TLTA 3I9JA 3EF1A 4S3MA 2DHQA 3DNFA 5LP6F 1ZH4A 1O0CA 2WHPA 3C8ZA 1L8XA 2ZIXB 3M82A 1HTWA 1RPTA 4BUCA 3DO8A 2ZRFA 1FC0A 3DSRA 1N3YA 2ZB3A 1DAIA 1G8JA 2CCJA 5CTAA 4BLWA 4YXWD 5AVZA 5J58A 3B52X 4H1VA 4PQGA 3NWOA 4MHSA 3BGDA 3FUUA 2G7MC 4HNUA 3GIWA 1FTWA 4YV0A 2OK8A 2W37A 1F0PA 1NW4A 1JS1X 1OLOA 2QRVA 2XVZA 2YUTA 3EXG2 4Q3AA 5EXEA 4QQNA 3ROQA 1D8TA 1TEVA 1WZEA 1X6VA 1YDFA 2XE6A 3HDVA 4IXWA 1PJ2A 4OLHA 3L7AA 5K3SA 3NI2A 3VDXA 3KTAA 3Q88A 4WLEA 3GFTA 3QPCA 4Z3KA 1SD2A 4XCVA 1ZHFA 1UPFA 2YV1A 3KB8A 3W0LB 1HDCA 4GW3A 2F3QA 3LE8A 3QIVA 1KQSB 1F8XA 1HE1C 2FR1A 3JALA 2HV8A 3OF2A 4O2BA 3WMWA 1P1BA 4RTPA 4KBGA 1HC7A 4LPKA 4B3GA 1HEIA 4YRKA 4C7BA 1SQ6A 4QPZA 4FZ5A 4YRCA 2Q3MA 3AY6A 1KC3A 1K92A 4J76A 2WJZB 1M2EA 2QJTA 4C7MA 4DV0B 1QLJA 4EQ6A 4GLFA 2NVUB 4K9PA 1E7YA 2PSFA 2PU5A 2ZR0A 1O8CA 3OCJA 2JJ2A 3PNKA 1JG4A 3JPWA 1KK1A 4XDHA 2CBXA 1FCJA 2BSXA 1ZH0A 2P9EA 5E9AA 4OLJA 2PL9A 1QWOA 4TTTS 3BE6A 3BCFA 3THRA 4M2LA 5EQDA 2XUZA 4LUCA 5J4LA 5KVVA 1X80A 5EPUA 5EMKA 4C1BA 2FSGA 4BFVA 4PAGA 4FLEA 2BIFA 4OBWA 1D04A 4AS3A 3LPDA 1NNEA 2FSPA 4QDJA 5AKZA 3RREA 4QUZA 3DJFA 2X1LA 1E0JA 3WBFA 5ECGC 1QYRA 5C2JB 3D3NA 5JROA 3CF2A 5BOVA 3RVBA 1T8UA 4IQ4A 5LUBA 2QOEA 4ZEVA 4WQMA 3EIWA 1G6OA 3CRQA 3HYCA 3QVGB 5CT8A 5KW9A 1WOSA 5IYWA 1FRVA 1E6LA 4ZVNA 1N8RD 5HOQA 1KQNA 1RYYA 3VV3A 2AFIB 3QVVA 4P38A 4WFQA 3S68A 1V6AA 3R9XA 1Y7HA 2FLKA 4J8PA 1T34A 4RMHA 5IP5A 1QLWA 1ZONA 1G8HA 5KYGA 2JLYA 2VXOA 4UUOA 1YVPA 3IB6A 1K89A 1PV1A 4EW3A 3K96A 5COBA 3B6IA 1CYEA 4WNAB 3FMOB 4LRUA 1SUIA 3GMTA 1E1CB 4X45A 3DE4X 3DULA 4JVSB 2AFIA 4DA9A 2CLMB 3WBJA 1OCEA 4DZRA 5CLGA 2GBLA 2H7XA 2XWSA 3UOAB 1SUBA 2IGTA 1SU6A 3TZ6A 2ZIVB 5F2KA 3A6JA 4Q6WA 4Y1GA 1B6GA 4Y9DA 4RM3A 1IBMB 4A82A 3PC7A 5F7ZA 2Q99A 5F1OA 3U4CA 2GNOA 3PLAE 1LK5A 4ZO4A 4XA8A 2ZBVA 1E43A 5ULLA 3F2VA 1ZUNA 3B3FA 2IYWA 3CU5A 1KO1A 3E15A 1PIWA 5B58T 1XMQB 2JHCA 4RCZA 4NTZA 1QGZA 3D0RA 1FX0B 3G1WA 3G0BA 3Q0EA 3LKDA 4KBYA 1TQ4A 2X3YA 4NFHA 3WGZA 1KY5A 1M9NA 2FDXA 2JH8A 2YX1A 5LA6F 4MA5A 2YVUA 3ACCA 4X20A 5BQPA 4A7PA 1UFRA 3H8WA 2L17A 5A1TA 1H66A 3ZHQA 1UEJA 1R4NB 1GZHB 1KS9A 2GN2A 1JU3A 5JJIA 1UR5A 4ZI2A 2L82A 1AO3A 3G9ZA 3LUFA 4GO1A 1SUSA 2R5FA 4I1SA 1N5OX 4Y1RA 3VJMA 1TYBE 2A2ZA 3K7EA 4EJSC 4QBGB 3DHEA 3GP3A 1H9AA 3ROGA 3SC2A 2BWJA 4XXHA 4UKDA 3GCXA 3KL4A 4UCFA 3BFXA 5FA8A 4B3DA 3KSAC 2GM4A 1R4NA 1CR0A 5FF9A 1LC3A 2MYTA 2YQ5A 1RZRD 3DAYA 4R7ZA 1JEAA 2IIVA 5CCBA 2QLBA 2R7NA 1J2UA 3RTCA 3VPBA 3F47A 2QUZA 3I8OA 1E2JA 5IF3A 4BNXA 3DD5A 5F23A 3LFUA 2KBEA 1NW8A 5BV7A 5KDLA 2WT9A 2XYRA 4FGLA 1JKXA 2R68A 2OQVA 5D85A 3ZHBA 2JLSA 2IDJA 4RWZA 4WN3A 1MA3A 3WG9A 4KPYA 3UA3A 4H0NA 2G1AA 5A8AA 2H0QA 2ZBPA 4FILA 1V1MB 2XEXA 1JIVA 1S3FA 2CXXA 1G19A 3KFLA 5BN5B 5JRJA 5JNWA 4UZSA 4ISBA