1H88A

Crystal structure of ternary protein-dna complex1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
70
structure length
70
Chain Sequence
VDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCAAT/ENHANCER BINDING PROTEIN BETA
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 30
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1h88A00
1CSBA 2YNYA 3HE4A 1OXZA 4GKGA 2N9BA 3I5CA 2KP8A 1H8AA 4M3LA 3TK1A 4AYCA 1FAVA 4DZOA 3L36A 5AW6B 3V4QA 3NXSA 3P7KA 3LIDA 3NFQA 5AVUB 2R3CA 1CZQA 4I6MC 5AW3B 2VRSA 1MUUA 3M0DA 4I2LC 3V4WA 2H7HA 5AVTB 4RESB 2IPPA 5APSA 5AVRB 4KHXA 5AVXB 2YO3A 2W6AA 3HE5B 5APXA 2QM8A 1H88A 1OWAA 2JJLA 4AQRD 1X8YA 1GK4A 3T97A 2ZXEB 1G2CB 3M0AA 1IO4A 3TYYA 2WT7A 5AW5B 2XU6A 2C9NY 3A5TA 3VN0A 1S9KE 2E42A 5APTA 1JNMA 5AVQB 1GD2E 2ZFCA 5APWA 4GT1A 5AVVB 1FOSE 2BASA 1NAFA 2W27A 1CI6B 1MFZA 2Q5UA 3TNUA 3KQGA 3UIAA 3VMZA 4HYTB 4B86A 1DH3A 2Q7CA 1A02F 3L35A 1A02J 1GK6A 3O8ZA 3HE4B 1FOSF 5AW7B 3M06A 2P67A 5AW2B 3VTPC 5APQA 2R5BA 2QM7A 5AW4B 4C7NA 4XE5B 1S9KD 1T2KD 2XV5A 3M9BA 2XZRA 3B8EB 3P32A 1JUNA 3L37A 1NWQA 2Q3IA 1SLQA 2WPRA 2P2UA 3OAKA 2C9LY 4C46A 2WWWA 1KQLA 3NMDA 4AUWA 3A2AA 5AVWB 3NTNA 1GU5A 2R32A 5AVYB 2WT7B 1HJBA 1HWTC 3VYIA 3HTKA 5AW8B 3P8MC 3SWFA 4JYCA 3A7OA 3HE5A 3VMXA 3IR9A 1SP4A 2Z5IA 4JYBA 1H89A 1YYCA 3V5BA 1HUCA 4EOTA 5AVZB 3A3YB 5AW1B 2WPSA 3TNUB 1HBWA 5AW0B 2E43A 5APYA 2P7JA 1J2JB 3MGNA 2WPQA 1GU4A 2R5DA 1T2KC 3M9HA 2Z5HA 1GZLA 2WTYA 4LC1A 1GTWA 3VMYA 5AW9B 3MD0A 3LIEA 3M91A 1CI6A 4C7NB 1MV8A 5APUA 5APVA 5AVSB 2YO2A 3KDPB 5CMZA
chains in the Genus database with same CATH superfamily
1MFTA 4AYCA 3BRVB 1FC2C 3CWBJ 3L70E 2W83C 2WSFH 3CWBG 3ABVC 5AW3B 3M0DA 3WMM0 5B5EE 1PGOA 1QLED 1BE3E 3CC2P 4TT3H 1IFPA 1VQ9P 2XNDH 1LT1A 1G2CB 2A45H 4GDOA 3PTZA 5APTA 2WSEH 3BASA 1SQPD 5CBNA 4DOJA 4RO0A 1JY2O 3OJAB 3WUUA 1JB0J 3GF3A 4UB6E 5APQA 1KILB 5CCHD 4H44B 1YJWP 1M57D 3CCEP 2P2UA 1NTMJ 2KSJA 1NTMG 3AE5C 3VYIA 3RBZA 5AW8B 4EI2A 3CCQP 1SP4A 2K9JA 1H89A 2C0XA 5KLVE 4YTPC 2Y0CA 2XDJA 2P7JA 3II6A 2Y9YA 2Q9IA 2E5TA 1T2KC 1LTJB 1M1JB 2SPZA 3L75J 1N7SB 1KYOD 3L75G 2M5AA 1CSBA 1SQQE 1H8AA 1VF5D 3JCUH 2RMZA 3RK2B 3GHGB 1CZQA 3L73G 4GOEA 2I8DA 3HTKB 1FE6A 5CCHC 2YO3A 1ZN5A 3VOPA 3SFEC 3I55P 3OA7A 2KUBA 1P84H 1URQB 5KJ7D 3FXDA 5KAFH 2R3SA 1NU1J 2W27A 3B5ND 1NU1G 1HJ0A 1IFIA 4HYTB 1OVUA 1SQQJ 1FS0E 2NPSB 1RQUA 3HE4B 4GOFA 2ZT9B 4WY4C 3PH0A 1VQ7P 1LT9C 1YHQP 1VPCA 5CJ4A 2Q3IA 4H13C 1LGHB 3AEFC 3LW5H 4OGQD 3RK3B 2OYIA 5B66H 4Z1MH 3P8CE 5B5EH 3H1IE 4XA4A 2AEJA 1VQLP 4Y28J 1LP1A 1NHLA 3A0BE 1NTMK 1GTWA 1JCCA 2KLVA 1ZP0C 4I7ZC 3AE3C 4IL6X 1LTBC 3PJSK 2QVAA 3SFDC 2V4HA 3D6YA 2BEZF 1W2BO 3FGAD 1OXZA 3H1HJ 5KLIC 2K1AA 3MUDC 1S3JA 1SFCA 1BGYD 2Q6QA 2E76C 1K05A 1J1DB 2VRSA 3V4WA 4RESB 3N4XA 2OYHC 2O01J 1Q81Q 4PV1D 1SQBE 2ZXEB 1PIXA 1T3UA 1N8RQ 1L4AA 1VQMP 3Q1MA 2W8ZA 3H1KE 2YXRB 3TGUE 5APWA 4U3FE 2M3BA 1KB9I 4D6TE 5BU8B 1SQXE 4RJTA 3HUSB 1J1EB 2YKPA 1U7MA 1Z56A 1NTKK 3CMEP 1P84D 2K3RA 1L0LJ 3WU2H 1KQFB 1L0LG 3SWYA 1YBKA 1NU1K 3HRNA 1JOCA 2D2CC 3RL0D 1KQLA 3A2AA 1NGMB 1K8AQ 1DD4A 3H1KJ 1HTLC 4JYCA 2GUSA 4A7PA 3VMXA 1RY3A 1YYCA 3V5BA 1ZRTD 1EZVI 1DX7A 1OW6A 3Q5RA 3O6QB 2E43A 2Y0DA 3B71A 2HLOA 2PGDA 4EDFA 5APVA 1KC8Q 4L76A 3KXDA 1OVRA 1S1CX 3I5CA 3L70D 1FZGA 3OW2O 3E1RA 1N7LA 3P7KA 4ZKPA 3RGUA 4I6MC 1S5LE 1BE3D 5AVRB 2O01N 1YI2P 1OVVA 1IJDB 3CXHH 1LWUB 1GL2A 3T97A 4HKZH 1RE3A 1YTZI 2KB7P 1S9KE 2POHA 2OTJP 4H0LD 3A0HE 2KNCB 1EXIA 2WSSH 1EZVG 3GW6A 3CCJP 2W6BA 2QEXP 2E75B 2W6JH 2QIWA 1Q7YQ 1VQKP 2V7QH 1LTGC 1OZHA 2JWAA 4Y99B 2A06E 1GU5A 4KT0J 1RF1B 5E79E 3GHGC 3PP5A 5KLVD 1YTZT 1AV1A 3BATA 2J59M 1VL2A 2RN0A 1G2CA 1L0LK 4WVZA 3N7NA 2N1TC 1J2JB 2ZYDA 3HD7D 3L74E 4CPGA 2QJYB 1VQ6P 2BCCD 1VQ5P 3QH9A 1D7MA 1KILA 3V4QA 3GLMA 5AVUB 4PJ0H 1NAYA 4PD4H 3V2PA 5APXA 2QM8A 1X8YA 2IYPA 1ZW0A 3CX5I 1M56D 2FBWC 2K9YA 1JY2N 1PFIA 2ZFCA 1DEBA 5AVVB 3RK3C 1NAFA 1MFZA 1FDOA 1QL2A 2FYUD 1KORA 3M0DC 3G4SP 1LTJA 3FXEA 2A45G 1M1JA 1VF5B 3CX5E 1N7SA 1GW3A 1K04A 2XKMA 1SQPK 3L37A 3SWKA 1GDTA 1SLQA 2QJPB 2Z4EA 2C9LY 4IL6H 2QJKB 2WVRA 3L72E 3H1LD 3H1JJ 5AVWB 5AVYB 3H1JG 3HTKA 4R4MA 1NKNA 2L91A 2Z5IA 1FJKA 1VQNP 3H1ID 1URQA 1KILE 1VQOP 3AE1C 3CWBE 1IZNB 5TISH 3NFQA 3VP9A 4N78E 1G1JA 2NPSA 5TJHA 3HE4A 4IFMA 3TK1A 1BCCJ 4N6JA 2FFDB 3L71J 3LIDA 2KK7A 4HB1A 3L71G 2H7HA 4KHXA 3C9IA 3HE5B 3CC4P 2ZJSE 1SQBD 4OGQB 1JY3O 1AQ5A 1ZMEC 3TYYA 1JTHB 4ZMDA 2AEFA 1NOHA 1DD3A 3TGUD 5H2FE 1SQVJ 1KTMA 2KS1A 1SQVG 4I1LA 4U3FD 4D6TD 2NRGA 1SQXD 3GF7A 2JDIH 2CPSA 2PP6A 2HR3A 4PD4D 2CK3H 1QGKB 1U7JA 1T6AA 3AECC 1ZR4A 4YXDC 1NTME 4XE5B 1T2KD 1NH4A 5M1BA 1DEEG 2LXCB 2FYNB 4PV1B 1YIJP 2WT7B 1Q90D 3B4SA 1IK7A 1HF9A 3L75E 1PV3A 4BRYB 1IK9A 3M9HA 1FZCB 1L0ND 2W90A 5AW9B 3AEBC 3L73E 1WT6A 3L70G 3USSA 2KP8A 1N73B 3RK3E 3HUSA 2OYIC 1M8OB 3WUTA 3RL0B 1GMJA 4WY4D 2IPPA 1SVFA 2WSCJ 5KKZC 1RE4A 1NU1E 1JY2P 2ZVOB 1HH0A 4H13D 2XU6A 3CCLP 3VN0A 2OARA 2E42A 1QX8A 1HGVA 3L73J 1VQ4P 1FZAA 2DW3A 5DJUB 1LTSC 3O6QA 1SFCC 2H8PD 2QG4A 5GTHE 1NTKJ 2QM7A 3D71A 2GM4A 1NTKG 1NTZD 2ZVNB 1BSHA 3B8EB 5K5GB 1SQVK 1KD1Q 2WPRA 1L4AC 2RKLA 1PL5A 4BWNA 2FY8A 5KLVG 2YIUC 2C0WA 1L2PA 3CXHI 2E76D 3R4YA 1LWUA 3BCCD 4H0LB 1IFMA 1YJNP 3L74D 3RL0g 3PRJA 2BCCG 1GZLA 3H1HE 2K37A 4LC1A 4OWFA 1N2DC 1RF0A 4C7NB 1R5LA 2KNCA 2KS1B 2IFMA 2IZ0A 1USDA 2ZYAA 1NVOA 3RBXA 2IBZD 2R3CA 2WZ7A 5AVXB 5GTIE 1RF1A 3A5TA 3CCUP 2D2CD 2FYUJ 1FOSE 1S5LX 3IN6A 3HD7B 2FYUG 1QVGO 2Q5UA 3U59A 2RH0A 1L0LE 2E5YA 4UB6H 1A02J 3CX5D 1XTCC 4W80A 1GL2C 1PP9D 1KQGB 1RE3C 2AXCA 3P32A 1KN7A 3H1LG 3L72D 3ITKA 1YJ9P 2KYVA 3NMDA 3NTNA 2YMKA 2KZJA 2IDBA 2V7QJ 4ZNCA 2YKQA 3S9OA 1HUCA 2JWDA 1KILD 4YPCA 4DCKA 3A3YB 3R2PA 3M9QA 2E74B 4JQ0D 3CWBD 1KB9E 3H32B 5KLVK 4N78D 1MV8A 3E7KA 5AVSB 4EIJA 1FAVA 5BU5A 2MKVA 1YQ4C 2J5UA 2HYNA 1KMIZ 5KAIE 2W6AA 2AXTE 1MZ9A 3BVHA 1PPJG 1N7SD 3M0AA 2B89A 5KJ7A 1EZVE 3CL3D 4UB8E 4D6TG 1DIPA 1X9VA 1KILC 4C7RA 4ASWA 3CPWO 1DH3A 4H44C 2QA4P 1FOSF 3M06A 1KYOI 2N1TD 3CC7P 1SQPJ 3E1IA 1M7LA 1SQPG 3MZWB 4ZKUA 2FYUK 1NKZB 1HVVA 1UIXA 2FFDA 1IC2A 2NPSD 2O01H 3P8MC 3HE5A 3IR9A 1UIIA 2M8RA 1QVFO 1LTJC 1FU1A 1M1JC 1JTHA 2PAJA 1N7SC 3A0BH 2FYZA 3Q2YA 1L0NG 2WMMA 2FXPA 3GG2A 4W7ZA 1W5CE 1ZLLA 3F89A 4JPZB 1JM0A 1R5SA 3RK2C 3C8VA 4TLFA 2GUVA 3RK3D 2JP3A 4XFJA 1EDKA 1S4XA 2A45I 2JKVA 2QSIA 3NXSA 3KZIE 1FJPA 2HPCB 5CBOA 1URQC 2NZ2A 1JY3N 2K88A 1S72P 1FBMA 1ZXGA 1NU1D 2JEEA 5CCGA 3QWOC 1IO4A 1SQQD 3KPEA 1EXJA 2WT7A 2NPSC 4GT1A 2ZT9C 2BASA 1SQBK 1CI6B 3KQGA 1KFNA 4BRYA 4KJMA 1ZOYC 3L35A 1S2EA 1GK6A 1W2EA 3O8ZA 1FZCA 2P67A 1NTZG 1AA0A 2JO1A 3M9BA 3H1JE 2Y9ZA 2WSFJ 3MIWA 1KB9H 2QRXA 5C39A 4WY4B 3OAKA 1N73A 1AVYA 1LT9B 2WWWA 5EFWB 1OIPA 2OQQA 2XNXA 1AJYA 3BCCG 4H13B 2KXPB 2WSEJ 3FWNA 1NYHA 3PLNA 5AW1B 2KIKA 3L74G 3EFGA 2HODB 3TNUB 1RH5B 3H1HD 1X22A 3MGNA 1BCCE 3G71P 3MD0A 3M91A 2OYOA 3L71E 4UB8H 2YO2A 1J1DC 3EWKA 2YNYA 3P8CD 2N9BA 4DZOA 2IBZG 1P84I 4I7ZB 3L36A 1S5LH 1AFOA 2I1KA 3B5NB 1L0NK 2BEQD 3JCUE 2B87B 5KLIB 1SQVE 2ZYGA 3CMAP 2OGUA 2JJLA 1Y47A 2E76B 2J58A 3K5BA 2OYHB 1BGYJ 1P84E 2YMYA 1BGYG 1GD2E 3PHLA 2FKWB 3A0HH 1L0LD 4HJGH 1AVOA 5KAFE 3HUSC 1J1EC 2LKMA 3AEEC 1YITP 1IFJA 2B88A 5AW2B 3AEGC 1PP9G 1YQ3C 1RE4C 3AE9C 5AW4B 4C7NA 3H1KD 2XZRA 1K73Q 1ZRTE 4ASVA 4HH2A 3MP7B 3V6IA 1USEA 5E79H 4GODA 4N3YB 1HJBA 1NO4A 3SWFA 1NTZK 2ITAA 4U7JA 2D2CB 1EDJA 2HG5D 2E75D 4LGDE 3KZIH 4IFDK 5B66E 1T3JA 2IX7C 1KB9D 1H0TB 3HD7A 3FX0A 3KDPB 2ZAEB 1VQ8P 3SSUA 1JY3P 1SFCD 1Y8AA 1X0TA 1LWUC 1OFCX 4W7YA 4I2LC 5AVTB 2YKOA 1TU3F 3LW5J 3S4RA 3L70J 1QEXA 1EZVD 1L4AD 1RF0C 1BE3J 1JNMA 1BE3G 1SS1A 2OTLP 2KI7B 1NTKE 3W67A 2E75C 4B86A 3VMAA 4QMAA 2Y0EA 3CX5H 5AW7B 2R5BA 3H32A 2R44A 1S9KD 4Y99C 2FXMA 1RF1C 3WU2E 2G3AA 1VQPP 4C46A 2WQYC 1JCDA 1NJIQ 1EC5A 5CJ0A 2BCCE 3Q3DA 1JO5A 4JYBA 3BRTB 5AVZB 3G3ZA 2QJYC 2CPBA 1HBWA 5AW0B 2Q3EA 2LR2A 1FZEA 4WBAA 1PZQA 1EDIA 4R4LA 3V2RA 2A06D 2Z5HA 1X79B 3VMYA 5KLVJ 2WPVB 4K3AA 4L73A 2N1TB 3H6PA 3GMAA 1WMKA 5CMZA 2GA1A 4IFFA 2P10A 1LTIC 1PGJA 2BCCJ 2OTKE 5APSA 1BSNA 1SQQG 1GL2D 1FDIA 2FYUE 5H2FH 3VP8A 3S1KA 3CXHE 4WWIA 3AE7C 5BVZA 2L5GB 1BDDA 1VF5C 5KTBA 1GW4A 2M0BA 3H1LE 4WB4A 3H1JD 2QJPC 1ZR2A 2XV5A 2QJKC 3AEDC 1KZUB 1M90Q 3WUVA 1JUNA 1NWQA 5KJ7C 4AUWA 1LJ2A 2R32A 2HPCA 3B5NC 2FXOA 2WSCH 3A7OA 2N9YB 2G8YA 3F5HA 3CLQA 3AE4C 1OMIA 1Q82Q 2ZXXA 2WPSA 3H1HG 3TDKA 5CCHA 5APYA 3H1LJ 1CW5A 4JBZA 1BCCD 5CCGD 1IFDA 4DJGA 3L71D 3G6EP 2IZ1A 1CI6A 3CCSP 2FFDC 3H1IJ 4PD4I 3H1IG 4GKGA 3AE8C 3FWLA 4M3LA 1PPJE 4BXLA 4OGQC 4H44D 3KHUA 1SQVD 4YXWH 1MUUA 3ZDMA 4OVNF 4WY4A 3L4FA 4PJ0E 2K9JB 1LT9A 1OWAA 4PD4E 4AQRD 4GIFA 3V2NA 3D6ZA 3EQ2A 4RKUJ 5L8RJ 1RHZB 2KOGA 3KYQA 3D70A 5AVQB 1SQBJ 1Y9BA 3TNUA 2HODA 1SQBG 3W68A 3UIAA 1SQPE 2M5AB 1SQQK 1A02F 5GTHH 4JF7A 1E5WA 1FZBA 3TGUJ 3H1KG 3TGUG 1LTTC 5CCGC 4U3FJ 2FYNC 4PV1C 4D6TJ 3Q5PA 4U3FG 1SQXJ 2LXBA 2WITA 1SQXG 1FZFA 3IAOA 4OH8B 2O1KA 3RK2D 3B5NA 1L0NE 1HWTC 1U57A 4IL6E 2B87A 4L74A 1NTMD 3MUDA 3JSVC 1N86A 1URQD 1FZCC 3U1CA 4K35A 2M3EA 2OYHA 3TSIA 2R5DA 3EFFK 3AE6C 1LTAC 1N73C 1K9MQ 2AEMA 3RL0C 1KYOE 2ZT9D 5TISE 3L75D 2O1JA 1T8ZA 1R8EA 5AW6B 1L0NJ 3JC22 3MHVA 2IFNA 1BDCA 2OYIB 1LNQA 3L73D 1MKMA 2IYOA 5GTIH 1GK4A 3G9RA 1ZV8A 1EQ7A 4EYYQ 5AW5B 2C9NY 5KKZB 3IF4A 2YXQB 1LP1B 1NTKD 1NTZE 2H43A 3VMZA 2QE7H 4LLHA 3I56P 1H0TA 1G1IA 1KQSO 4MN4C 5CHXA 1SFCB 2B9BA 3BCCE 3CI9A 2P58A 3CCRP 1IFNA 2IBZI 1JMBA 4H0LC 2PFXA 3AEAC 1NTZJ 1L4AB 1VDFA 4EOTA 1AQTA 2MJZA 2YIUB 1JEKA 2A06G 1SQXK 3C1LA 4DT0A 3TF5A 1GU4A 2Q1KA 2IBZE 2WTYA 1RQVA 1KFMA 3LIEA 3BCCJ 5APUA 3H25A 3L74J 5DJTB 5KAIH 1OW7A 1QL1A 2JR8A 2AXTH 4L75A 1OX3A 2E74D 3CCVP 1BGYE 4NPFX 1Q86Q 2KSEA 2HFED 4IOIH 1XTGB 4O9BA 1H88A 1EDLA 3CXHD 2KLUA 3IFMA 2PRRA 3HD7C 2H89C 3CD6P 1PP9E 4NPEA 1JMMA 3GHGA 2Q7CA 3U1AA 2H88C 1PGPA 2UWJE 1HGZA 3VTPC 2N1TA 1Q2NA 3AE2C 3MTUE 3CCMP 1E79H 1OW8A 1GL2B 3T97B 1FDMA 3V2QA 1KYOH 1PP9J 2E74C 1PGQA 3L72J 2O3JA 1BCCG 1KV4A 3L72G 2KZIA 4NPDA 2WPQA 2I1JA 3Q5SA 1WRGA 1M1KQ 2P1JA 1PPJD
chains in the Genus database with same CATH topology
4IFFA 4AYCA 3BRVB 1FAVA 1LTIC 5BU5A 1KILA 3V4QA 2WSFH 2HYNA 5AVUB 5AW3B 3M0DA 3WMM0 5APSA 3V2PA 2W6AA 5APXA 2QM8A 1GL2D 1MZ9A 3BVHA 1X8YA 1N7SD 1G2CB 3M0AA 3VP8A 2A45H 5KJ7A 3CL3D 1JY2N 1PFIA 5APTA 5BVZA 2WSEH 2ZFCA 1DEBA 3BASA 5AVVB 2L5GB 3RK3C 1NAFA 4DOJA 1MFZA 1JY2O 1X9VA 3OJAB 1KILC 4C7RA 1QL2A 5KTBA 1DH3A 1GW4A 3M0DC 1LTJA 1FOSF 3M06A 4WB4A 2A45G 5APQA 1M1JA 2N1TD 1KILB 1GW3A 1N7SA 2XKMA 1ZR2A 2XV5A 3E1IA 1SQPK 5CCHD 1KZUB 1M7LA 1JUNA 4ZKUA 3L37A 1NWQA 5KJ7C 1GDTA 1SLQA 2P2UA 2FYUK 1NKZB 2Z4EA 2C9LY 1HVVA 2KSJA 2FFDA 1IC2A 4AUWA 5AVWB 2R32A 2HPCA 5AVYB 3VYIA 3B5NC 3HTKA 2NPSD 2O01H 3P8MC 5AW8B 2WSCH 3A7OA 3HE5A 1NKNA 1SP4A 3IR9A 2Z5IA 3CLQA 1FJKA 2M8RA 1H89A 1LTJC 1FU1A 2WPSA 2C0XA 1M1JC 1URQA 1JTHA 2PAJA 1N7SC 5CCHA 2XDJA 2FYZA 5APYA 2P7JA 1CW5A 3II6A 2Q9IA 1T2KC 4W7ZA 1LTJB 5CCGD 1IFDA 1ZLLA 1M1JB 1CI6A 1N7SB 2FFDC 3RK2C 3NFQA 2GUVA 4N78E 1G1JA 3VP9A 3RK3D 2NPSA 1CSBA 3HE4A 4GKGA 4IFMA 1H8AA 4M3LA 3TK1A 4N6JA 2FFDB 2A45I 3NXSA 3RK2B 3LIDA 3GHGB 1FJPA 1CZQA 2HPCB 1MUUA 1URQC 2H7HA 1JY3N 3HTKB 4KHXA 5CCHC 3C9IA 2YO3A 1ZN5A 3VOPA 3HE5B 1FBMA 4WY4A 3L4FA 2JEEA 1LT9A 5CCGA 1OWAA 4AQRD 4GIFA 1JY3O 3OA7A 1IO4A 1AQ5A 3KPEA 3TYYA 1URQB 1JTHB 5KJ7D 1NOHA 3V2NA 2WT7A 3EQ2A 2KOGA 3KYQA 2NPSC 5AVQB 4I1LA 4GT1A 2BASA 2W27A 1SQBK 3B5ND 1CI6B 3TNUA 2HODA 1IFIA 3KQGA 1KFNA 3UIAA 4HYTB 2CPSA 2PP6A 1SQQK 1A02F 3L35A 4JF7A 1E5WA 1FZBA 2NPSB 1GK6A 1W2EA 3O8ZA 3HE4B 1ZR4A 1FZCA 2P67A 4WY4C 1LTTC 5CCGC 1LT9C 4XE5B 1VPCA 1T2KD 3M9BA 1NH4A 3MIWA 2WITA 5CJ4A 2Q3IA 4WY4B 1FZFA 3OAKA 1N73A 4OH8B 1LT9B 2O1KA 3RK2D 1LGHB 2WWWA 3B5NA 2XNXA 2WT7B 1HWTC 3LW5H 3RK3B 2OYIA 3MUDA 1N86A 1URQD 1FZCC 5AW1B 3U1CA 3P8CE 3TNUB 3EFGA 2HODB 4XA4A 2OYHA 3TSIA 3MGNA 1IK9A 2R5DA 3M9HA 1NHLA 1FZCB 1NTMK 1LTAC 1GTWA 1JCCA 5AW9B 3MD0A 2KLVA 3M91A 1N73C 1LTBC 1WT6A 2YO2A 3RL0C 1J1DC 2YNYA 3P8CD 1OXZA 2O1JA 2N9BA 2KP8A 1T8ZA 4DZOA 1N73B 3HUSA 2OYIC 1AFOA 3L36A 5AW6B 2I1KA 3B5NB 1L0NK 1SFCA 3RL0B 1J1DB 2VRSA 3V4WA 4WY4D 4RESB 2IPPA 2IFNA 3N4XA 2OYHC 2OYIB 1SVFA 1RE4A 2JJLA 1GK4A 2ZXEB 1JY2P 2J58A 1ZV8A 1EQ7A 1HH0A 1T3UA 5AW5B 2XU6A 2C9NY 2OYHB 3VN0A 1L4AA 2OARA 2E42A 2YMYA 1GD2E 5APWA 2FKWB 1HGVA 2H43A 3HUSC 1J1EC 1FZAA 2LKMA 1LTSC 3VMZA 2M3BA 4LLHA 5BU8B 1SFCC 2H8PD 1IFJA 5AW2B 3HUSB 1J1EB 2YKPA 1G1IA 1Z56A 1RE4C 1NTKK 2QM7A 5AW4B 4C7NA 2GM4A 5CHXA 1SFCB 2XZRA 3B8EB 1SQVK 4HH2A 2WPRA 1L4AC 3CI9A 3SWYA 1NU1K 3HRNA 1JOCA 1IFNA 3RL0D 1KQLA 3A2AA 4N3YB 1HJBA 1HTLC 1NO4A 1L4AB 1NTZK 2C0WA 2GUSA 4JYCA 1VDFA 3VMXA 3SWFA 1RY3A 1LWUA 1YYCA 2HG5D 3V5BA 4EOTA 4LGDE 1DX7A 4IFDK 2MJZA 2E43A 1IFMA 1SQXK 1T3JA 2IX7C 2HLOA 1GU4A 1GZLA 2WTYA 4LC1A 1KFMA 3HD7A 3LIEA 1N2DC 1RF0A 4C7NB 5APUA 5APVA 3KDPB 2IFMA 3I5CA 1FZGA 1JY3P 1SFCD 1N7LA 1LWUC 1QL1A 3P7KA 4ZKPA 4W7YA 2R3CA 4I6MC 4I2LC 2WZ7A 5AVTB 5AVRB 2YKOA 5AVXB 2HFED 1IJDB 1XTGB 4O9BA 1H88A 1LWUB 1GL2A 3T97A 1RE3A 3IFMA 3HD7C 1L4AD 1RF1A 1RF0C 1YTZI 3A5TA 2KB7P 1S9KE 2POHA 1JNMA 1FOSE 3HD7B 2Q5UA 3U59A 4B86A 1JMMA 3GHGA 2Q7CA 1A02J 3U1AA 1HGZA 2W6BA 5AW7B 3VTPC 1XTCC 2R5BA 3H32A 4W80A 1S9KD 4Y99C 2N1TA 1GL2C 1RE3C 2FXMA 3P32A 3MTUE 1RF1C 1LTGC 4C46A 4Y99B 1GL2B 2KYVA 3NMDA 1FDMA 3V2QA 3NTNA 1GU5A 1JCDA 1RF1B 5CJ0A 3GHGC 3PP5A 1JO5A 4JYBA 1YTZT 3BRTB 2YKQA 1HUCA 3BATA 5AVZB 1KILD 2J59M 3G3ZA 1G2CA 3A3YB 1L0LK 2CPBA 3N7NA 1HBWA 3R2PA 5AW0B 1FZEA 3M9QA 4WBAA 2N1TC 1J2JB 2WPQA 2I1JA 3V2RA 2Z5HA 1WRGA 3HD7D 1X79B 3VMYA 3H32B 5KLVK 2P1JA 4N78D 1MV8A 2N1TB 3H6PA 5AVSB 5CMZA 4EIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSB A;  2YNY A;  3HE4 A;  1OXZ A;  4GKG A;  2N9B A;  3I5C A;  2KP8 A;  1H8A A;  4M3L A;  3TK1 A;  4AYC A;  1FAV A;  4DZO A;  3L36 A;  5AW6 B;  3V4Q A;  3NXS A;  3P7K A;  3LID A;  3NFQ A;  5AVU B;  2R3C A;  1CZQ A;  4I6M C;  5AW3 B;  2VRS A;  1MUU A;  3M0D A;  4I2L C;  3V4W A;  2H7H A;  5AVT B;  4RES B;  2IPP A;  5APS A;  5AVR B;  4KHX A;  5AVX B;  2YO3 A;  2W6A A;  3HE5 B;  5APX A;  2QM8 A;  1H88 A;  1OWA A;  2JJL A;  4AQR D;  1X8Y A;  1GK4 A;  3T97 A;  2ZXE B;  1G2C B;  3M0A A;  1IO4 A;  3TYY A;  2WT7 A;  5AW5 B;  2XU6 A;  2C9N Y;  3A5T A;  3VN0 A;  1S9K E;  2E42 A;  5APT A;  1JNM A;  5AVQ B;  1GD2 E;  2ZFC A;  5APW A;  4GT1 A;  5AVV B;  1FOS E;  2BAS A;  1NAF A;  2W27 A;  1CI6 B;  1MFZ A;  2Q5U A;  3TNU A;  3KQG A;  3UIA A;  3VMZ A;  4HYT B;  4B86 A;  1DH3 A;  2Q7C A;  1A02 F;  3L35 A;  1A02 J;  1GK6 A;  3O8Z A;  3HE4 B;  1FOS F;  5AW7 B;  3M06 A;  2P67 A;  5AW2 B;  3VTP C;  5APQ A;  2R5B A;  2QM7 A;  5AW4 B;  4C7N A;  4XE5 B;  1S9K D;  1T2K D;  2XV5 A;  3M9B A;  2XZR A;  3B8E B;  3P32 A;  1JUN A;  3L37 A;  1NWQ A;  2Q3I A;  1SLQ A;  2WPR A;  2P2U A;  3OAK A;  2C9L Y;  4C46 A;  2WWW A;  1KQL A;  3NMD A;  4AUW A;  3A2A A;  5AVW B;  3NTN A;  1GU5 A;  2R32 A;  5AVY B;  2WT7 B;  1HJB A;  1HWT C;  3VYI A;  3HTK A;  5AW8 B;  3P8M C;  3SWF A;  4JYC A;  3A7O A;  3HE5 A;  3VMX A;  3IR9 A;  1SP4 A;  2Z5I A;  4JYB A;  1H89 A;  1YYC A;  3V5B A;  1HUC A;  4EOT A;  5AVZ B;  3A3Y B;  5AW1 B;  2WPS A;  3TNU B;  1HBW A;  5AW0 B;  2E43 A;  5APY A;  2P7J A;  1J2J B;  3MGN A;  2WPQ A;  1GU4 A;  2R5D A;  1T2K C;  3M9H A;  2Z5H A;  1GZL A;  2WTY A;  4LC1 A;  1GTW A;  3VMY A;  5AW9 B;  3MD0 A;  3LIE A;  3M91 A;  1CI6 A;  4C7N B;  1MV8 A;  5APU A;  5APV A;  5AVS B;  2YO2 A;  3KDP B;  5CMZ A; 
#chains in the Genus database with same CATH topology
 1MFT A;  4AYC A;  3BRV B;  1FC2 C;  3CWB J;  3L70 E;  2W83 C;  2WSF H;  3CWB G;  3ABV C;  5AW3 B;  3M0D A;  3WMM 0;  5B5E E;  1PGO A;  1QLE D;  1BE3 E;  3CC2 P;  4TT3 H;  1IFP A;  1VQ9 P;  2XND H;  1LT1 A;  1G2C B;  2A45 H;  4GDO A;  3PTZ A;  5APT A;  2WSE H;  3BAS A;  1SQP D;  5CBN A;  4DOJ A;  4RO0 A;  1JY2 O;  3OJA B;  3WUU A;  1JB0 J;  3GF3 A;  4UB6 E;  5APQ A;  1KIL B;  5CCH D;  4H44 B;  1YJW P;  1M57 D;  3CCE P;  2P2U A;  1NTM J;  2KSJ A;  1NTM G;  3AE5 C;  3VYI A;  3RBZ A;  5AW8 B;  4EI2 A;  3CCQ P;  1SP4 A;  2K9J A;  1H89 A;  2C0X A;  5KLV E;  4YTP C;  2Y0C A;  2XDJ A;  2P7J A;  3II6 A;  2Y9Y A;  2Q9I A;  2E5T A;  1T2K C;  1LTJ B;  1M1J B;  2SPZ A;  3L75 J;  1N7S B;  1KYO D;  3L75 G;  2M5A A;  1CSB A;  1SQQ E;  1H8A A;  1VF5 D;  3JCU H;  2RMZ A;  3RK2 B;  3GHG B;  1CZQ A;  3L73 G;  4GOE A;  2I8D A;  3HTK B;  1FE6 A;  5CCH C;  2YO3 A;  1ZN5 A;  3VOP A;  3SFE C;  3I55 P;  3OA7 A;  2KUB A;  1P84 H;  1URQ B;  5KJ7 D;  3FXD A;  5KAF H;  2R3S A;  1NU1 J;  2W27 A;  3B5N D;  1NU1 G;  1HJ0 A;  1IFI A;  4HYT B;  1OVU A;  1SQQ J;  1FS0 E;  2NPS B;  1RQU A;  3HE4 B;  4GOF A;  2ZT9 B;  4WY4 C;  3PH0 A;  1VQ7 P;  1LT9 C;  1YHQ P;  1VPC A;  5CJ4 A;  2Q3I A;  4H13 C;  1LGH B;  3AEF C;  3LW5 H;  4OGQ D;  3RK3 B;  2OYI A;  5B66 H;  4Z1M H;  3P8C E;  5B5E H;  3H1I E;  4XA4 A;  2AEJ A;  1VQL P;  4Y28 J;  1LP1 A;  1NHL A;  3A0B E;  1NTM K;  1GTW A;  1JCC A;  2KLV A;  1ZP0 C;  4I7Z C;  3AE3 C;  4IL6 X;  1LTB C;  3PJS K;  2QVA A;  3SFD C;  2V4H A;  3D6Y A;  2BEZ F;  1W2B O;  3FGA D;  1OXZ A;  3H1H J;  5KLI C;  2K1A A;  3MUD C;  1S3J A;  1SFC A;  1BGY D;  2Q6Q A;  2E76 C;  1K05 A;  1J1D B;  2VRS A;  3V4W A;  4RES B;  3N4X A;  2OYH C;  2O01 J;  1Q81 Q;  4PV1 D;  1SQB E;  2ZXE B;  1PIX A;  1T3U A;  1N8R Q;  1L4A A;  1VQM P;  3Q1M A;  2W8Z A;  3H1K E;  2YXR B;  3TGU E;  5APW A;  4U3F E;  2M3B A;  1KB9 I;  4D6T E;  5BU8 B;  1SQX E;  4RJT A;  3HUS B;  1J1E B;  2YKP A;  1U7M A;  1Z56 A;  1NTK K;  3CME P;  1P84 D;  2K3R A;  1L0L J;  3WU2 H;  1KQF B;  1L0L G;  3SWY A;  1YBK A;  1NU1 K;  3HRN A;  1JOC A;  2D2C C;  3RL0 D;  1KQL A;  3A2A A;  1NGM B;  1K8A Q;  1DD4 A;  3H1K J;  1HTL C;  4JYC A;  2GUS A;  4A7P A;  3VMX A;  1RY3 A;  1YYC A;  3V5B A;  1ZRT D;  1EZV I;  1DX7 A;  1OW6 A;  3Q5R A;  3O6Q B;  2E43 A;  2Y0D A;  3B71 A;  2HLO A;  2PGD A;  4EDF A;  5APV A;  1KC8 Q;  4L76 A;  3KXD A;  1OVR A;  1S1C X;  3I5C A;  3L70 D;  1FZG A;  3OW2 O;  3E1R A;  1N7L A;  3P7K A;  4ZKP A;  3RGU A;  4I6M C;  1S5L E;  1BE3 D;  5AVR B;  2O01 N;  1YI2 P;  1OVV A;  1IJD B;  3CXH H;  1LWU B;  1GL2 A;  3T97 A;  4HKZ H;  1RE3 A;  1YTZ I;  2KB7 P;  1S9K E;  2POH A;  2OTJ P;  4H0L D;  3A0H E;  2KNC B;  1EXI A;  2WSS H;  1EZV G;  3GW6 A;  3CCJ P;  2W6B A;  2QEX P;  2E75 B;  2W6J H;  2QIW A;  1Q7Y Q;  1VQK P;  2V7Q H;  1LTG C;  1OZH A;  2JWA A;  4Y99 B;  2A06 E;  1GU5 A;  4KT0 J;  1RF1 B;  5E79 E;  3GHG C;  3PP5 A;  5KLV D;  1YTZ T;  1AV1 A;  3BAT A;  2J59 M;  1VL2 A;  2RN0 A;  1G2C A;  1L0L K;  4WVZ A;  3N7N A;  2N1T C;  1J2J B;  2ZYD A;  3HD7 D;  3L74 E;  4CPG A;  2QJY B;  1VQ6 P;  2BCC D;  1VQ5 P;  3QH9 A;  1D7M A;  1KIL A;  3V4Q A;  3GLM A;  5AVU B;  4PJ0 H;  1NAY A;  4PD4 H;  3V2P A;  5APX A;  2QM8 A;  1X8Y A;  2IYP A;  1ZW0 A;  3CX5 I;  1M56 D;  2FBW C;  2K9Y A;  1JY2 N;  1PFI A;  2ZFC A;  1DEB A;  5AVV B;  3RK3 C;  1NAF A;  1MFZ A;  1FDO A;  1QL2 A;  2FYU D;  1KOR A;  3M0D C;  3G4S P;  1LTJ A;  3FXE A;  2A45 G;  1M1J A;  1VF5 B;  3CX5 E;  1N7S A;  1GW3 A;  1K04 A;  2XKM A;  1SQP K;  3L37 A;  3SWK A;  1GDT A;  1SLQ A;  2QJP B;  2Z4E A;  2C9L Y;  4IL6 H;  2QJK B;  2WVR A;  3L72 E;  3H1L D;  3H1J J;  5AVW B;  5AVY B;  3H1J G;  3HTK A;  4R4M A;  1NKN A;  2L91 A;  2Z5I A;  1FJK A;  1VQN P;  3H1I D;  1URQ A;  1KIL E;  1VQO P;  3AE1 C;  3CWB E;  1IZN B;  5TIS H;  3NFQ A;  3VP9 A;  4N78 E;  1G1J A;  2NPS A;  5TJH A;  3HE4 A;  4IFM A;  3TK1 A;  1BCC J;  4N6J A;  2FFD B;  3L71 J;  3LID A;  2KK7 A;  4HB1 A;  3L71 G;  2H7H A;  4KHX A;  3C9I A;  3HE5 B;  3CC4 P;  2ZJS E;  1SQB D;  4OGQ B;  1JY3 O;  1AQ5 A;  1ZME C;  3TYY A;  1JTH B;  4ZMD A;  2AEF A;  1NOH A;  1DD3 A;  3TGU D;  5H2F E;  1SQV J;  1KTM A;  2KS1 A;  1SQV G;  4I1L A;  4U3F D;  4D6T D;  2NRG A;  1SQX D;  3GF7 A;  2JDI H;  2CPS A;  2PP6 A;  2HR3 A;  4PD4 D;  2CK3 H;  1QGK B;  1U7J A;  1T6A A;  3AEC C;  1ZR4 A;  4YXD C;  1NTM E;  4XE5 B;  1T2K D;  1NH4 A;  5M1B A;  1DEE G;  2LXC B;  2FYN B;  4PV1 B;  1YIJ P;  2WT7 B;  1Q90 D;  3B4S A;  1IK7 A;  1HF9 A;  3L75 E;  1PV3 A;  4BRY B;  1IK9 A;  3M9H A;  1FZC B;  1L0N D;  2W90 A;  5AW9 B;  3AEB C;  3L73 E;  1WT6 A;  3L70 G;  3USS A;  2KP8 A;  1N73 B;  3RK3 E;  3HUS A;  2OYI C;  1M8O B;  3WUT A;  3RL0 B;  1GMJ A;  4WY4 D;  2IPP A;  1SVF A;  2WSC J;  5KKZ C;  1RE4 A;  1NU1 E;  1JY2 P;  2ZVO B;  1HH0 A;  4H13 D;  2XU6 A;  3CCL P;  3VN0 A;  2OAR A;  2E42 A;  1QX8 A;  1HGV A;  3L73 J;  1VQ4 P;  1FZA A;  2DW3 A;  5DJU B;  1LTS C;  3O6Q A;  1SFC C;  2H8P D;  2QG4 A;  5GTH E;  1NTK J;  2QM7 A;  3D71 A;  2GM4 A;  1NTK G;  1NTZ D;  2ZVN B;  1BSH A;  3B8E B;  5K5G B;  1SQV K;  1KD1 Q;  2WPR A;  1L4A C;  2RKL A;  1PL5 A;  4BWN A;  2FY8 A;  5KLV G;  2YIU C;  2C0W A;  1L2P A;  3CXH I;  2E76 D;  3R4Y A;  1LWU A;  3BCC D;  4H0L B;  1IFM A;  1YJN P;  3L74 D;  3RL0 g;  3PRJ A;  2BCC G;  1GZL A;  3H1H E;  2K37 A;  4LC1 A;  4OWF A;  1N2D C;  1RF0 A;  4C7N B;  1R5L A;  2KNC A;  2KS1 B;  2IFM A;  2IZ0 A;  1USD A;  2ZYA A;  1NVO A;  3RBX A;  2IBZ D;  2R3C A;  2WZ7 A;  5AVX B;  5GTI E;  1RF1 A;  3A5T A;  3CCU P;  2D2C D;  2FYU J;  1FOS E;  1S5L X;  3IN6 A;  3HD7 B;  2FYU G;  1QVG O;  2Q5U A;  3U59 A;  2RH0 A;  1L0L E;  2E5Y A;  4UB6 H;  1A02 J;  3CX5 D;  1XTC C;  4W80 A;  1GL2 C;  1PP9 D;  1KQG B;  1RE3 C;  2AXC A;  3P32 A;  1KN7 A;  3H1L G;  3L72 D;  3ITK A;  1YJ9 P;  2KYV A;  3NMD A;  3NTN A;  2YMK A;  2KZJ A;  2IDB A;  2V7Q J;  4ZNC A;  2YKQ A;  3S9O A;  1HUC A;  2JWD A;  1KIL D;  4YPC A;  4DCK A;  3A3Y B;  3R2P A;  3M9Q A;  2E74 B;  4JQ0 D;  3CWB D;  1KB9 E;  3H32 B;  5KLV K;  4N78 D;  1MV8 A;  3E7K A;  5AVS B;  4EIJ A;  1FAV A;  5BU5 A;  2MKV A;  1YQ4 C;  2J5U A;  2HYN A;  1KMI Z;  5KAI E;  2W6A A;  2AXT E;  1MZ9 A;  3BVH A;  1PPJ G;  1N7S D;  3M0A A;  2B89 A;  5KJ7 A;  1EZV E;  3CL3 D;  4UB8 E;  4D6T G;  1DIP A;  1X9V A;  1KIL C;  4C7R A;  4ASW A;  3CPW O;  1DH3 A;  4H44 C;  2QA4 P;  1FOS F;  3M06 A;  1KYO I;  2N1T D;  3CC7 P;  1SQP J;  3E1I A;  1M7L A;  1SQP G;  3MZW B;  4ZKU A;  2FYU K;  1NKZ B;  1HVV A;  1UIX A;  2FFD A;  1IC2 A;  2NPS D;  2O01 H;  3P8M C;  3HE5 A;  3IR9 A;  1UII A;  2M8R A;  1QVF O;  1LTJ C;  1FU1 A;  1M1J C;  1JTH A;  2PAJ A;  1N7S C;  3A0B H;  2FYZ A;  3Q2Y A;  1L0N G;  2WMM A;  2FXP A;  3GG2 A;  4W7Z A;  1W5C E;  1ZLL A;  3F89 A;  4JPZ B;  1JM0 A;  1R5S A;  3RK2 C;  3C8V A;  4TLF A;  2GUV A;  3RK3 D;  2JP3 A;  4XFJ A;  1EDK A;  1S4X A;  2A45 I;  2JKV A;  2QSI A;  3NXS A;  3KZI E;  1FJP A;  2HPC B;  5CBO A;  1URQ C;  2NZ2 A;  1JY3 N;  2K88 A;  1S72 P;  1FBM A;  1ZXG A;  1NU1 D;  2JEE A;  5CCG A;  3QWO C;  1IO4 A;  1SQQ D;  3KPE A;  1EXJ A;  2WT7 A;  2NPS C;  4GT1 A;  2ZT9 C;  2BAS A;  1SQB K;  1CI6 B;  3KQG A;  1KFN A;  4BRY A;  4KJM A;  1ZOY C;  3L35 A;  1S2E A;  1GK6 A;  1W2E A;  3O8Z A;  1FZC A;  2P67 A;  1NTZ G;  1AA0 A;  2JO1 A;  3M9B A;  3H1J E;  2Y9Z A;  2WSF J;  3MIW A;  1KB9 H;  2QRX A;  5C39 A;  4WY4 B;  3OAK A;  1N73 A;  1AVY A;  1LT9 B;  2WWW A;  5EFW B;  1OIP A;  2OQQ A;  2XNX A;  1AJY A;  3BCC G;  4H13 B;  2KXP B;  2WSE J;  3FWN A;  1NYH A;  3PLN A;  5AW1 B;  2KIK A;  3L74 G;  3EFG A;  2HOD B;  3TNU B;  1RH5 B;  3H1H D;  1X22 A;  3MGN A;  1BCC E;  3G71 P;  3MD0 A;  3M91 A;  2OYO A;  3L71 E;  4UB8 H;  2YO2 A;  1J1D C;  3EWK A;  2YNY A;  3P8C D;  2N9B A;  4DZO A;  2IBZ G;  1P84 I;  4I7Z B;  3L36 A;  1S5L H;  1AFO A;  2I1K A;  3B5N B;  1L0N K;  2BEQ D;  3JCU E;  2B87 B;  5KLI B;  1SQV E;  2ZYG A;  3CMA P;  2OGU A;  2JJL A;  1Y47 A;  2E76 B;  2J58 A;  3K5B A;  2OYH B;  1BGY J;  1P84 E;  2YMY A;  1BGY G;  1GD2 E;  3PHL A;  2FKW B;  3A0H H;  1L0L D;  4HJG H;  1AVO A;  5KAF E;  3HUS C;  1J1E C;  2LKM A;  3AEE C;  1YIT P;  1IFJ A;  2B88 A;  5AW2 B;  3AEG C;  1PP9 G;  1YQ3 C;  1RE4 C;  3AE9 C;  5AW4 B;  4C7N A;  3H1K D;  2XZR A;  1K73 Q;  1ZRT E;  4ASV A;  4HH2 A;  3MP7 B;  3V6I A;  1USE A;  5E79 H;  4GOD A;  4N3Y B;  1HJB A;  1NO4 A;  3SWF A;  1NTZ K;  2ITA A;  4U7J A;  2D2C B;  1EDJ A;  2HG5 D;  2E75 D;  4LGD E;  3KZI H;  4IFD K;  5B66 E;  1T3J A;  2IX7 C;  1KB9 D;  1H0T B;  3HD7 A;  3FX0 A;  3KDP B;  2ZAE B;  1VQ8 P;  3SSU A;  1JY3 P;  1SFC D;  1Y8A A;  1X0T A;  1LWU C;  1OFC X;  4W7Y A;  4I2L C;  5AVT B;  2YKO A;  1TU3 F;  3LW5 J;  3S4R A;  3L70 J;  1QEX A;  1EZV D;  1L4A D;  1RF0 C;  1BE3 J;  1JNM A;  1BE3 G;  1SS1 A;  2OTL P;  2KI7 B;  1NTK E;  3W67 A;  2E75 C;  4B86 A;  3VMA A;  4QMA A;  2Y0E A;  3CX5 H;  5AW7 B;  2R5B A;  3H32 A;  2R44 A;  1S9K D;  4Y99 C;  2FXM A;  1RF1 C;  3WU2 E;  2G3A A;  1VQP P;  4C46 A;  2WQY C;  1JCD A;  1NJI Q;  1EC5 A;  5CJ0 A;  2BCC E;  3Q3D A;  1JO5 A;  4JYB A;  3BRT B;  5AVZ B;  3G3Z A;  2QJY C;  2CPB A;  1HBW A;  5AW0 B;  2Q3E A;  2LR2 A;  1FZE A;  4WBA A;  1PZQ A;  1EDI A;  4R4L A;  3V2R A;  2A06 D;  2Z5H A;  1X79 B;  3VMY A;  5KLV J;  2WPV B;  4K3A A;  4L73 A;  2N1T B;  3H6P A;  3GMA A;  1WMK A;  5CMZ A;  2GA1 A;  4IFF A;  2P10 A;  1LTI C;  1PGJ A;  2BCC J;  2OTK E;  5APS A;  1BSN A;  1SQQ G;  1GL2 D;  1FDI A;  2FYU E;  5H2F H;  3VP8 A;  3S1K A;  3CXH E;  4WWI A;  3AE7 C;  5BVZ A;  2L5G B;  1BDD A;  1VF5 C;  5KTB A;  1GW4 A;  2M0B A;  3H1L E;  4WB4 A;  3H1J D;  2QJP C;  1ZR2 A;  2XV5 A;  2QJK C;  3AED C;  1KZU B;  1M90 Q;  3WUV A;  1JUN A;  1NWQ A;  5KJ7 C;  4AUW A;  1LJ2 A;  2R32 A;  2HPC A;  3B5N C;  2FXO A;  2WSC H;  3A7O A;  2N9Y B;  2G8Y A;  3F5H A;  3CLQ A;  3AE4 C;  1OMI A;  1Q82 Q;  2ZXX A;  2WPS A;  3H1H G;  3TDK A;  5CCH A;  5APY A;  3H1L J;  1CW5 A;  4JBZ A;  1BCC D;  5CCG D;  1IFD A;  4DJG A;  3L71 D;  3G6E P;  2IZ1 A;  1CI6 A;  3CCS P;  2FFD C;  3H1I J;  4PD4 I;  3H1I G;  4GKG A;  3AE8 C;  3FWL A;  4M3L A;  1PPJ E;  4BXL A;  4OGQ C;  4H44 D;  3KHU A;  1SQV D;  4YXW H;  1MUU A;  3ZDM A;  4OVN F;  4WY4 A;  3L4F A;  4PJ0 E;  2K9J B;  1LT9 A;  1OWA A;  4PD4 E;  4AQR D;  4GIF A;  3V2N A;  3D6Z A;  3EQ2 A;  4RKU J;  5L8R J;  1RHZ B;  2KOG A;  3KYQ A;  3D70 A;  5AVQ B;  1SQB J;  1Y9B A;  3TNU A;  2HOD A;  1SQB G;  3W68 A;  3UIA A;  1SQP E;  2M5A B;  1SQQ K;  1A02 F;  5GTH H;  4JF7 A;  1E5W A;  1FZB A;  3TGU J;  3H1K G;  3TGU G;  1LTT C;  5CCG C;  4U3F J;  2FYN C;  4PV1 C;  4D6T J;  3Q5P A;  4U3F G;  1SQX J;  2LXB A;  2WIT A;  1SQX G;  1FZF A;  3IAO A;  4OH8 B;  2O1K A;  3RK2 D;  3B5N A;  1L0N E;  1HWT C;  1U57 A;  4IL6 E;  2B87 A;  4L74 A;  1NTM D;  3MUD A;  3JSV C;  1N86 A;  1URQ D;  1FZC C;  3U1C A;  4K35 A;  2M3E A;  2OYH A;  3TSI A;  2R5D A;  3EFF K;  3AE6 C;  1LTA C;  1N73 C;  1K9M Q;  2AEM A;  3RL0 C;  1KYO E;  2ZT9 D;  5TIS E;  3L75 D;  2O1J A;  1T8Z A;  1R8E A;  5AW6 B;  1L0N J;  3JC2 2;  3MHV A;  2IFN A;  1BDC A;  2OYI B;  1LNQ A;  3L73 D;  1MKM A;  2IYO A;  5GTI H;  1GK4 A;  3G9R A;  1ZV8 A;  1EQ7 A;  4EYY Q;  5AW5 B;  2C9N Y;  5KKZ B;  3IF4 A;  2YXQ B;  1LP1 B;  1NTK D;  1NTZ E;  2H43 A;  3VMZ A;  2QE7 H;  4LLH A;  3I56 P;  1H0T A;  1G1I A;  1KQS O;  4MN4 C;  5CHX A;  1SFC B;  2B9B A;  3BCC E;  3CI9 A;  2P58 A;  3CCR P;  1IFN A;  2IBZ I;  1JMB A;  4H0L C;  2PFX A;  3AEA C;  1NTZ J;  1L4A B;  1VDF A;  4EOT A;  1AQT A;  2MJZ A;  2YIU B;  1JEK A;  2A06 G;  1SQX K;  3C1L A;  4DT0 A;  3TF5 A;  1GU4 A;  2Q1K A;  2IBZ E;  2WTY A;  1RQV A;  1KFM A;  3LIE A;  3BCC J;  5APU A;  3H25 A;  3L74 J;  5DJT B;  5KAI H;  1OW7 A;  1QL1 A;  2JR8 A;  2AXT H;  4L75 A;  1OX3 A;  2E74 D;  3CCV P;  1BGY E;  4NPF X;  1Q86 Q;  2KSE A;  2HFE D;  4IOI H;  1XTG B;  4O9B A;  1H88 A;  1EDL A;  3CXH D;  2KLU A;  3IFM A;  2PRR A;  3HD7 C;  2H89 C;  3CD6 P;  1PP9 E;  4NPE A;  1JMM A;  3GHG A;  2Q7C A;  3U1A A;  2H88 C;  1PGP A;  2UWJ E;  1HGZ A;  3VTP C;  2N1T A;  1Q2N A;  3AE2 C;  3MTU E;  3CCM P;  1E79 H;  1OW8 A;  1GL2 B;  3T97 B;  1FDM A;  3V2Q A;  1KYO H;  1PP9 J;  2E74 C;  1PGQ A;  3L72 J;  2O3J A;  1BCC G;  1KV4 A;  3L72 G;  2KZI A;  4NPD A;  2WPQ A;  2I1J A;  3Q5S A;  1WRG A;  1M1K Q;  2P1J A;  1PPJ D; 
#chains in the Genus database with same CATH homology
 4IFF A;  4AYC A;  3BRV B;  1FAV A;  1LTI C;  5BU5 A;  1KIL A;  3V4Q A;  2WSF H;  2HYN A;  5AVU B;  5AW3 B;  3M0D A;  3WMM 0;  5APS A;  3V2P A;  2W6A A;  5APX A;  2QM8 A;  1GL2 D;  1MZ9 A;  3BVH A;  1X8Y A;  1N7S D;  1G2C B;  3M0A A;  3VP8 A;  2A45 H;  5KJ7 A;  3CL3 D;  1JY2 N;  1PFI A;  5APT A;  5BVZ A;  2WSE H;  2ZFC A;  1DEB A;  3BAS A;  5AVV B;  2L5G B;  3RK3 C;  1NAF A;  4DOJ A;  1MFZ A;  1JY2 O;  1X9V A;  3OJA B;  1KIL C;  4C7R A;  1QL2 A;  5KTB A;  1DH3 A;  1GW4 A;  3M0D C;  1LTJ A;  1FOS F;  3M06 A;  4WB4 A;  2A45 G;  5APQ A;  1M1J A;  2N1T D;  1KIL B;  1GW3 A;  1N7S A;  2XKM A;  1ZR2 A;  2XV5 A;  3E1I A;  1SQP K;  5CCH D;  1KZU B;  1M7L A;  1JUN A;  4ZKU A;  3L37 A;  1NWQ A;  5KJ7 C;  1GDT A;  1SLQ A;  2P2U A;  2FYU K;  1NKZ B;  2Z4E A;  2C9L Y;  1HVV A;  2KSJ A;  2FFD A;  1IC2 A;  4AUW A;  5AVW B;  2R32 A;  2HPC A;  5AVY B;  3VYI A;  3B5N C;  3HTK A;  2NPS D;  2O01 H;  3P8M C;  5AW8 B;  2WSC H;  3A7O A;  3HE5 A;  1NKN A;  1SP4 A;  3IR9 A;  2Z5I A;  3CLQ A;  1FJK A;  2M8R A;  1H89 A;  1LTJ C;  1FU1 A;  2WPS A;  2C0X A;  1M1J C;  1URQ A;  1JTH A;  2PAJ A;  1N7S C;  5CCH A;  2XDJ A;  2FYZ A;  5APY A;  2P7J A;  1CW5 A;  3II6 A;  2Q9I A;  1T2K C;  4W7Z A;  1LTJ B;  5CCG D;  1IFD A;  1ZLL A;  1M1J B;  1CI6 A;  1N7S B;  2FFD C;  3RK2 C;  3NFQ A;  2GUV A;  4N78 E;  1G1J A;  3VP9 A;  3RK3 D;  2NPS A;  1CSB A;  3HE4 A;  4GKG A;  4IFM A;  1H8A A;  4M3L A;  3TK1 A;  4N6J A;  2FFD B;  2A45 I;  3NXS A;  3RK2 B;  3LID A;  3GHG B;  1FJP A;  1CZQ A;  2HPC B;  1MUU A;  1URQ C;  2H7H A;  1JY3 N;  3HTK B;  4KHX A;  5CCH C;  3C9I A;  2YO3 A;  1ZN5 A;  3VOP A;  3HE5 B;  1FBM A;  4WY4 A;  3L4F A;  2JEE A;  1LT9 A;  5CCG A;  1OWA A;  4AQR D;  4GIF A;  1JY3 O;  3OA7 A;  1IO4 A;  1AQ5 A;  3KPE A;  3TYY A;  1URQ B;  1JTH B;  5KJ7 D;  1NOH A;  3V2N A;  2WT7 A;  3EQ2 A;  2KOG A;  3KYQ A;  2NPS C;  5AVQ B;  4I1L A;  4GT1 A;  2BAS A;  2W27 A;  1SQB K;  3B5N D;  1CI6 B;  3TNU A;  2HOD A;  1IFI A;  3KQG A;  1KFN A;  3UIA A;  4HYT B;  2CPS A;  2PP6 A;  1SQQ K;  1A02 F;  3L35 A;  4JF7 A;  1E5W A;  1FZB A;  2NPS B;  1GK6 A;  1W2E A;  3O8Z A;  3HE4 B;  1ZR4 A;  1FZC A;  2P67 A;  4WY4 C;  1LTT C;  5CCG C;  1LT9 C;  4XE5 B;  1VPC A;  1T2K D;  3M9B A;  1NH4 A;  3MIW A;  2WIT A;  5CJ4 A;  2Q3I A;  4WY4 B;  1FZF A;  3OAK A;  1N73 A;  4OH8 B;  1LT9 B;  2O1K A;  3RK2 D;  1LGH B;  2WWW A;  3B5N A;  2XNX A;  2WT7 B;  1HWT C;  3LW5 H;  3RK3 B;  2OYI A;  3MUD A;  1N86 A;  1URQ D;  1FZC C;  5AW1 B;  3U1C A;  3P8C E;  3TNU B;  3EFG A;  2HOD B;  4XA4 A;  2OYH A;  3TSI A;  3MGN A;  1IK9 A;  2R5D A;  3M9H A;  1NHL A;  1FZC B;  1NTM K;  1LTA C;  1GTW A;  1JCC A;  5AW9 B;  3MD0 A;  2KLV A;  3M91 A;  1N73 C;  1LTB C;  1WT6 A;  2YO2 A;  3RL0 C;  1J1D C;  2YNY A;  3P8C D;  1OXZ A;  2O1J A;  2N9B A;  2KP8 A;  1T8Z A;  4DZO A;  1N73 B;  3HUS A;  2OYI C;  1AFO A;  3L36 A;  5AW6 B;  2I1K A;  3B5N B;  1L0N K;  1SFC A;  3RL0 B;  1J1D B;  2VRS A;  3V4W A;  4WY4 D;  4RES B;  2IPP A;  2IFN A;  3N4X A;  2OYH C;  2OYI B;  1SVF A;  1RE4 A;  2JJL A;  1GK4 A;  2ZXE B;  1JY2 P;  2J58 A;  1ZV8 A;  1EQ7 A;  1HH0 A;  1T3U A;  5AW5 B;  2XU6 A;  2C9N Y;  2OYH B;  3VN0 A;  1L4A A;  2OAR A;  2E42 A;  2YMY A;  1GD2 E;  5APW A;  2FKW B;  1HGV A;  2H43 A;  3HUS C;  1J1E C;  1FZA A;  2LKM A;  1LTS C;  3VMZ A;  2M3B A;  4LLH A;  5BU8 B;  1SFC C;  2H8P D;  1IFJ A;  5AW2 B;  3HUS B;  1J1E B;  2YKP A;  1G1I A;  1Z56 A;  1RE4 C;  1NTK K;  2QM7 A;  5AW4 B;  4C7N A;  2GM4 A;  5CHX A;  1SFC B;  2XZR A;  3B8E B;  1SQV K;  4HH2 A;  2WPR A;  1L4A C;  3CI9 A;  3SWY A;  1NU1 K;  3HRN A;  1JOC A;  1IFN A;  3RL0 D;  1KQL A;  3A2A A;  4N3Y B;  1HJB A;  1HTL C;  1NO4 A;  1L4A B;  1NTZ K;  2C0W A;  2GUS A;  4JYC A;  1VDF A;  3VMX A;  3SWF A;  1RY3 A;  1LWU A;  1YYC A;  2HG5 D;  3V5B A;  4EOT A;  4LGD E;  1DX7 A;  4IFD K;  2MJZ A;  2E43 A;  1IFM A;  1SQX K;  1T3J A;  2IX7 C;  2HLO A;  1GU4 A;  1GZL A;  2WTY A;  4LC1 A;  1KFM A;  3HD7 A;  3LIE A;  1N2D C;  1RF0 A;  4C7N B;  5APU A;  5APV A;  3KDP B;  2IFM A;  3I5C A;  1FZG A;  1JY3 P;  1SFC D;  1N7L A;  1LWU C;  1QL1 A;  3P7K A;  4ZKP A;  4W7Y A;  2R3C A;  4I6M C;  4I2L C;  2WZ7 A;  5AVT B;  5AVR B;  2YKO A;  5AVX B;  2HFE D;  1IJD B;  1XTG B;  4O9B A;  1H88 A;  1LWU B;  1GL2 A;  3T97 A;  1RE3 A;  3IFM A;  3HD7 C;  1L4A D;  1RF1 A;  1RF0 C;  1YTZ I;  3A5T A;  2KB7 P;  1S9K E;  2POH A;  1JNM A;  1FOS E;  3HD7 B;  2Q5U A;  3U59 A;  4B86 A;  1JMM A;  3GHG A;  2Q7C A;  1A02 J;  3U1A A;  1HGZ A;  2W6B A;  5AW7 B;  3VTP C;  1XTC C;  2R5B A;  3H32 A;  4W80 A;  1S9K D;  4Y99 C;  2N1T A;  1GL2 C;  1RE3 C;  2FXM A;  3P32 A;  3MTU E;  1RF1 C;  1LTG C;  4C46 A;  4Y99 B;  1GL2 B;  2KYV A;  3NMD A;  1FDM A;  3V2Q A;  3NTN A;  1GU5 A;  1JCD A;  1RF1 B;  5CJ0 A;  3GHG C;  3PP5 A;  1JO5 A;  4JYB A;  1YTZ T;  3BRT B;  2YKQ A;  1HUC A;  3BAT A;  5AVZ B;  1KIL D;  2J59 M;  3G3Z A;  1G2C A;  3A3Y B;  1L0L K;  2CPB A;  3N7N A;  1HBW A;  3R2P A;  5AW0 B;  1FZE A;  3M9Q A;  4WBA A;  2N1T C;  1J2J B;  2WPQ A;  2I1J A;  3V2R A;  2Z5H A;  1WRG A;  3HD7 D;  1X79 B;  3VMY A;  3H32 B;  5KLV K;  2P1J A;  4N78 D;  1MV8 A;  2N1T B;  3H6P A;  5AVS B;  5CMZ A;  4EIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...