1H88A

Crystal structure of ternary protein-dna complex1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
70
structure length
70
Chain Sequence
b'VDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
molecule keywords CCAAT/ENHANCER BINDING PROTEIN BETA
source organism Homo sapiens
molecule tags Transcription/dna
total genus 30
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1h88A00
1GZLA 5AW1B 4C46A 1HBWA 3MD0A 3P7KA 4I2LC 2ZFCA 4JYCA 4KHXA 5AVUB 1J2JB 3HE4A 3L36A 1T2KC 4M3LA 1SP4A 3KQGA 2W6AA 1GD2E 3V4QA 3VTPC 5AVZB 2JJLA 3VMXA 2H7HA 2Q3IA 4I6MC 3P32A 3T97A 3M9BA 5AVYB 4JYBA 2Z5HA 3M9HA 5AW2B 2E42A 1T2KD 1CI6A 2YNYA 5AVXB 1S9KD 3I5CA 1FOSE 1GK6A 2IPPA 3TYYA 1HWTC 1CI6B 1H8AA 2WPRA 5APUA 2WT7A 2VRSA 3B8EB 1GTWA 2YO3A 2XU6A 4DZOA 3IR9A 1KQLA 4XE5B 4GT1A 2WT7B 2WTYA 1JNMA 1NWQA 4EOTA 5AW9B 1OWAA 2WWWA 4RESB 2Q5UA 3HE4B 3HE5A 3VMZA 4B86A 3OAKA 4GKGA 2W27A 2BASA 1IO4A 1MFZA 1X8YA 3M0DA 3O8ZA 4LC1A 3A7OA 4C7NA 4HYTB 1A02J 5APVA 3L37A 1HUCA 5AW0B 2Z5IA 4C7NB 2QM8A 2WPQA 1H88A 2C9LY 3V4WA 3V5BA 5APYA 1YYCA 2C9NY 1DH3A 5AW3B 3VN0A 1SLQA 2P67A 5APSA 2P2UA 5APQA 2R5DA 1G2CB 5AW7B 1JUNA 1FAVA 5AW5B 5AW6B 3A5TA 3P8MC 3TK1A 2XZRA 3HTKA 3HE5B 5APTA 3KDPB 1GU5A 2QM7A 2R32A 5AVSB 1OXZA 3L35A 2N9BA 1A02F 3NMDA 4AUWA 1GU4A 3M91A 2XV5A 5AVQB 5AW4B 1MV8A 2WPSA 2ZXEB 4AYCA 3LIDA 3NXSA 3VYIA 1S9KE 1MUUA 3M0AA 1FOSF 3NTNA 1GK4A 2P7JA 3TNUA 1CSBA 5AVTB 1NAFA 2R3CA 5APWA 4AQRD 2KP8A 3TNUB 3MGNA 5AVVB 2YO2A 3SWFA 1CZQA 3A2AA 5APXA 5AVRB 3VMYA 3NFQA 1HJBA 5AVWB 2R5BA 3M06A 3UIAA 2Q7CA 1H89A 5CMZA 5AW8B 2E43A 3A3YB 3LIEA
chains in the Genus database with same CATH superfamily
3RK2D 1ZRTE 1T2KC 2Q6QA 2KSEA 4U3FJ 3H1JD 1L0NE 5H2FE 1KFMA 1S1CX 1AJYA 1KV4A 4H44B 3I5CA 3TGUJ 2QJKC 1JCCA 1SQQG 1YBKA 3Q3DA 1KQLA 2QSIA 1DEBA 1N86A 4JBZA 4ZNCA 1RY3A 2L91A 3VMZA 3FXEA 3RL0B 1QL2A 1HH0A 3QWOC 3H25A 1SFCC 3U1AA 2K9JB 1A02J 1VQ7P 1SQQK 2FFDA 1RE3A 1P84E 3AEEC 2C9LY 5APYA 2XKMA 5KLIC 2E76D 5APSA 1NU1D 4CPGA 2Q3EA 3B5NC 3HRNA 1HTLC 3M9QA 2QEXP 2KS1B 2E74D 4AUWA 3NMDA 2N1TA 1YTZT 2WSFJ 4K3AA 3W68A 2ITAA 4AQRD 3N7NA 1NKNA 1N7SC 4DJGA 1CZQA 2IX7C 3CX5I 5CCHC 1NOHA 4XA4A 5KLVJ 1E79H 3U59A 2W6JH 1FZEA 3CXHI 3P32A 3CI9A 3AEGC 4EI2A 4GOEA 1L0NK 1JY3N 1FJKA 1OVUA 4N3YB 3BCCJ 2K88A 4H13C 4LC1A 1ZXGA 2ZT9D 4W80A 1KILB 3L72E 5DJTB 3FGAD 2PRRA 1YJ9P 4IFDK 1M1KQ 1SLQA 3JCUE 5APQA 3L73E 3L70E 3PP5A 1NTZG 3A5TA 1IFPA 1BSNA 3MUDC 1AVYA 1LTGC 1Y47A 1NHLA 2QVAA 2QJPC 2XNDH 5CJ0A 3M91A 1VF5C 1W2BO 1NTME 1KYOE 3H1LE 2HG5D 2D2CC 3IAOA 1LT9B 5APWA 1NTZK 2R3SA 3L75E 1K8AQ 2NPSB 1SQQJ 2WSFH 3HUSB 5C39A 2OQQA 3O6QA 4L73A 4JYCA 4R4MA 1KB9I 3S9OA 3GF7A 3CD6P 4PV1C 3GW6A 4IFFA 1LNQA 1GL2D 1QVFO 4KJMA 5CCGA 4JF7A 2A45H 2WT7A 2E76B 1N73B 4YTPC 1IJDB 1JNMA 2ZYDA 3TDKA 5CJ4A 1SFCD 2AEMA 4HB1A 3CWBJ 1AQ5A 2ZVNB 4UB8H 1E5WA 3CC4P 3V2RA 3IN6A 4C7NA 2ZAEB 5CBOA 5AW0B 3N4XA 1RH5B 1ZMEC 2WITA 2OTJP 3GLMA 3VN0A 2AXTH 1L4AA 4ZMDA 1EZVE 1JTHA 1NTMG 3H1LG 1LWUC 1LTAC 3RL0g 3L74E 1L0NJ 4LGDE 1RE4A 2WPSA 1R5LA 3NTNA 3EQ2A 3TNUB 2V4HA 3TGUE 2JDIH 3RK2C 1NTMK 1BE3D 2Q7CA 4R4LA 3BCCD 3A3YB 1SS1A 3P7KA 4I2LC 2A06D 3CPWO 1YI2P 1D7MA 5E79E 1VQ6P 3CMEP 1QEXA 2IBZE 3OW2O 2Z4EA 2ZT9B 1NJIQ 1FZBA 1VQ8P 1Q2NA 1CI6A 1KC8Q 3EFFK 2KZIA 1SQBD 4U7JA 1M8OB 1LTJB 1N7SD 2XU6A 3FWLA 1FZAA 1NTZJ 3C1LA 5BU8B 1FBMA 2XNXA 4GKGA 1IO4A 2IDBA 1S4XA 1VQLP 1BDDA 1BCCD 1EZVG 1JB0J 2HPCB 2E74C 1VQ9P 2P67A 2KOGA 3AE3C 1OIPA 2JWDA 3RK3B 5APTA 2P58A 1DD3A 1GU5A 2OYHC 3M0DC 1ZR2A 4WY4D 2XDJA 3G71P 1GL2B 2M5AB 4EIJA 3U1CA 1HVVA 3AE4C 3I56P 2IZ0A 3CWBD 3CCVP 1Q86Q 1FZCB 2FXMA 4C46A 1HGVA 1MKMA 1PP9D 4TT3H 1SQPE 1SFCB 1J2JB 1YJNP 5M1BA 1LP1B 1GMJA 1BDCA 2AXTE 1NTKE 3L72J 3B71A 3G3ZA 3M9BA 2MKVA 5AW2B 3L70J 1L0LG 2O3JA 2QJKB 3B8EB 1L0ND 3H1IE 3USSA 1EDIA 1P84H 2W8ZA 1IC2A 4D6TG 2WWWA 4RESB 1NTMJ 3OAKA 4GIFA 3H1LJ 2W27A 2WVRA 3FXDA 4C7RA 1PGQA 3L4FA 4PV1D 1L0LK 1VPCA 1HUCA 3L75J 1X79B 1RE3C 1LT9A 3AE9C 4NPDA 2V7QJ 1JM0A 1PZQA 1G2CA 3D71A 1DH3A 2QJYC 3CCLP 3AE1C 2P2UA 2NPSA 1ZLLA 5KLIB 1JMMA 4NPEA 3KXDA 3HUSA 2W83C 2XZRA 4IFMA 2G3AA 1K9MQ 2ZVOB 3B5NB 4GOFA 1BGYD 1DD4A 2KSJA 1FC2C 4DCKA 3RBXA 3CCQP 4Z1MH 3B4SA 4EDFA 1N7LA 3R4YA 3JC22 2M0BA 2R5BA 1SQXE 1SQPG 1N7SB 2FY8A 3BRVB 1NTKG 3MD0A 1QL1A 1QVGO 4OGQD 2KK7A 3WMM0 3VTPC 5AVZB 1RF1C 1JEKA 1SQPK 1MFTA 1AQTA 3MP7B 3H1KD 3CL3D 3E1IA 1NTKK 2Y9YA 2IYOA 3VP9A 3L71D 2YO3A 4DZOA 2ZXXA 3KZIH 4IOIH 3L74J 1JOCA 3CCJP 2K3RA 1SVFA 1IZNB 3JCUH 3SWKA 3CX5E 1SQVE 3VOPA 2H8PD 2H43A 4H13B 2OYOA 1VQPP 1KYOH 1URQD 5AW3B 4N78E 3P8MC 3PLNA 3L72D 3Q5RA 2JO1A 3L35A 3HTKB 5GTHE 2V7QH 5AVQB 3CC7P 3AECC 3L70D 3L73D 4N6JA 2QJPB 2P7JA 1VF5B 3CCSP 1SQXG 2KIKA 2D2CB 1G1JA 5EFWB 3H1HD 3TF5A 4GDOA 4JPZB 1H89A 1NTZE 3HD7A 3L75D 3L36A 1SQXK 1JY2O 4PV1B 1DIPA 3T97A 5AVYB 4JYBA 3LW5J 2KNCA 1UIIA 1M1JA 4RJTA 1FOSE 1GK6A 2IPPA 4HKZH 1T6AA 1NH4A 2HPCA 1MZ9A 2BCCE 4XE5B 1SQVG 2GUSA 4EOTA 3F5HA 4L74A 5KTBA 1KILE 2JKVA 1VQNP 2MJZA 1X9VA 2FYUD 4XFJA 2YKPA 1KB9E 3CCMP 1SQVK 2IFMA 2C9NY 3GHGC 2OTLP 5L8RJ 4HJGH 1L4AC 2R5DA 1SQPJ 2AEFA 2HLOA 4WWIA 4WY4C 1FZCA 2OYIA 1NTKJ 2B9BA 2PFXA 3G4SP 1GU4A 1LWUB 2M8RA 5DJUB 4AYCA 3KZIE 5E79H 3L74D 3H1IJ 3IF4A 1W5CE 3UIAA 4U3FD 3RK2B 1HBWA 1LJ2A 3TGUD 4MN4C 4DOJA 1NKZB 4KHXA 2GA1A 3EFGA 2N9YB 2LXCB 2N1TD 3HD7D 2ZYGA 4YPCA 1NO4A 4I7ZC 4KT0J 2HFED 1U57A 3CCUP 2BCCG 3D6YA 1HWTC 2IBZD 3LW5H 1OWAA 3B5NA 3R2PA 1FJPA 4UB6H 1M90Q 1BSHA 1NVOA 2QM8A 1R8EA 1SQXJ 2FBWC 1NGMB 1OZHA 3BATA 1OFCX 3H1JG 5KAFH 2YMYA 2E74B 1IFIA 1IFJA 2R32A 3H32A 5AVSB 3G6EP 5CCHA 2KYVA 2OYHB 5AW4B 2FXOA 3WUVA 1MV8A 1GK4A 2R3CA 5KLVD 1AVOA 1FZGA 2I8DA 1FE6A 2J5UA 2YMKA 1KFNA 1HJBA 1OW8A 5AVWB 2KLVA 1AA0A 2B87B 3M06A 4OGQC 1H0TB 3PRJA 1SQVJ 1PGJA 2P10A 1ZP0C 1JCDA 1S2EA 1XTCC 2W6AA 1PPJD 4BXLA 1NU1G 1Y9BA 3CCEP 1RQVA 2YIUC 1YTZI 1KORA 2VRSA 2DW3A 1OVVA 1NU1K 2KZJA 2Q5UA 1IK9A 2E75D 2H89C 3AE6C 4K35A 2K9JA 2JP3A 3H1ID 3O8ZA 1HF9A 1URQC 3IFMA 3Q1MA 2Z5IA 3KPEA 1KQFB 1IFDA 1FDMA 1RF0A 3KHUA 3PH0A 3V5BA 2B88A 1VQKP 1S3JA 3RK3E 1L0LE 5CCGD 2QRXA 2PGDA 1FAVA 1VQMP 2QJYB 2KS1A 2KXPB 3HUSC 4BRYB 2M3BA 4ZKUA 1X0TA 1J1DC 1Z56A 4D6TE 1YITP 1VDFA 1SQQD 1AFOA 3PTZA 3VYIA 1EXIA 3M0AA 1N2DC 4H0LD 4PD4E 2KP8A 3D70A 1G1IA 5AVVB 1JY3O 2BCCJ 4UB6E 3A2AA 4DT0A 2JEEA 4A7PA 1L4AD 2AEJA 2Y0CA 2E5YA 1EDJA 1SP4A 1SQXD 1J1EC 5KAFE 3VMAA 1RF1B 4W7ZA 2E42A 5AVXB 1S9KD 3Q5PA 1LTTC 3CX5H 3TYYA 1R5SA 4H44D 3SFDC 3H1JJ 3CXHH 3V6IA 3HE4B 2IBZI 3VP8A 3ZDMA 1K04A 1X8YA 1ZRTD 1KILA 3RL0D 1FDIA 1T8ZA 1BE3E 5GTHH 1FU1A 1U7MA 4RKUJ 3A0BE 1H88A 3CC2P 2YKOA 1FDOA 1RHZB 1LGHB 3TK1A 1HGZA 5CHXA 2WMMA 4N78D 2FFDC 2Y0DA 2AXCA 2O1JA 2JR8A 1KN7A 2LKMA 1WMKA 4WBAA 2PAJA 2FYNC 2JWAA 5KJ7A 1PFIA 2C0XA 1P84D 1JO5A 3W67A 4TLFA 5CMZA 3MIWA 2B89A 2A45I 2N1TC 3HD7C 1DEEG 3O6QB 1YQ4C 1BCCE 2H7HA 1NTZD 3CMAP 3A0HH 1M1JC 1YIJP 3G9RA 1N73A 5APUA 1GTWA 4PJ0E 4Y99C 1M57D 1K05A 1KB9H 2WT7B 5AW9B 3QH9A 1USEA 1BE3G 5K5GB 2OYHA 3M0DA 3V2QA 3BCCG 1S5LX 4C7NB 2A06G 1OX3A 1VQ4P 2PP6A 1KILD 3K5BA 3RBZA 1ZV8A 5AW7B 3GHGB 1L4AB 2NZ2A 5KKZC 2OYIC 1JTHB 3V2PA 1SQBG 1OXZA 3E7KA 4WY4B 3E1RA 3P8CE 2O01J 1PIXA 3TNUA 5TISH 2K9YA 3CXHE 2GM4A 4L76A 2WSCJ 1PV3A 3VMYA 3NFQA 1SQBK 2NPSD 5KJ7D 1GZLA 3SFEC 1OMIA 3Q2YA 1U7JA 4RO0A 1BCCG 2WSEJ 2R44A 3OJAB 2HR3A 2KB7P 3VMXA 3TSIA 5KAIH 2YXQB 1NTMD 1LTJA 1KYOD 4I7ZB 1L0LJ 3H1LD 1UIXA 2Y0EA 1CI6B 2E75C 1L2PA 1BGYE 1EDKA 1KD1Q 3FWNA 3OA7A 4HH2A 4D6TJ 4ASVA 4BRYA 1Q81Q 1MFZA 3V2NA 3CWBG 1CW5A 2J59M 2NRGA 3AEBC 4Y28J 2I1JA 5CCGC 1JMBA 1PP9G 2POHA 2QA4P 3C9IA 1PL5A 4ZKPA 2GUVA 2WZ7A 4IL6E 5AW5B 3ITKA 3A0HE 3HE5B 1KMIZ 5B5EE 2BEZF 4H0LC 3WU2E 1FZFA 1L0NG 3NXSA 3BRTB 1M56D 3H1KE 1MUUA 3EWKA 1GL2A 1CSBA 5TJHA 1KQGB 2M5AA 1EC5A 3L71E 1RF1A 2Q9IA 2J58A 1YHQP 4OWFA 2LR2A 2O01H 3MTUE 3MZWB 3H1JE 1USDA 1SFCA 4OGQB 1RE4C 1LP1A 2KUBA 2WSCH 1EZVD 3HE4A 1P84I 1TU3F 3I55P 2CPSA 1BE3J 1FS0E 4WVZA 2Q3IA 4H44C 5BU5A 2HODB 2QIWA 1BGYG 2WSEH 2LXBA 2UWJE 2YIUB 1W2EA 2SPZA 5TISE 3II6A 2WTYA 3RL0C 3MHVA 4LLHA 1SQBJ 4IL6X 2K37A 1NU1E 4HYTB 3H1HE 1LTIC 1WT6A 3H6PA 1URQB 1NYHA 1RF0C 1OW7A 1G2CB 4PD4H 5KAIE 3H1KG 1A02F 1BCCJ 3RK3D 1J1DB 1L0LD 3GG2A 3L71G 5CBNA 3GF3A 1NAFA 3FX0A 4L75A 4D6TD 2H88C 3MGNA 5GTIH 1VL2A 1N7SA 3SWFA 3S1KA 2RMZA 3AE2C 2W6BA 2E43A 4PD4D 2ZFCA 5AVUB 1S72P 2FYUE 1VQ5P 2FKWB 2P1JA 3SWYA 5B66H 2L5GB 1QLED 1J1EB 1NAYA 3L72G 1N8RQ 1GW3A 1T2KD 2KLUA 2YNYA 2RH0A 1PP9J 1VQOP 3BVHA 3L70G 3L73G 1KYOI 3GHGA 3A0BH 4EYYQ 2W90A 2E5TA 4ASWA 3H1HG 2I1KA 4WY4A 1JY3P 1T3UA 1SQPD 1KILC 4JQ0D 3A7OA 2YXRB 5APVA 1S5LH 3L37A 1ZOYC 1NTKD 2WPQA 3BASA 4U3FE 3L75G 1YYCA 1QX8A 1ZR4A 1KQSO 4WB4A 1JUNA 1KTMA 1RQUA 5AW6B 1GDTA 1M7LA 3SSUA 3HTKA 3MUDA 3KDPB 1DX7A 1IFMA 3B5ND 1EXJA 1LTSC 1EDLA 1LT9C 2FFDB 3JSVC 1OVRA 5AVTB 1KZUB 2G8YA 2NPSC 1BGYJ 2YO2A 5KJ7C 2FYNB 1PGOA 2FYUG 2WQYC 4O9BA 5AW8B 3AE8C 2WSSH 1IK7A 4NPFX 2IFNA 3S4RA 4OVNF 1EQ7A 2N1TB 3HD7B 2Q1KA 3AEFC 4PJ0H 4M3LA 2K1AA 5CCHD 2RN0A 3KQGA 1GD2E 1YQ3C 2KI7B 3V4QA 4I6MC 2FYZA 1EZVI 2C0WA 2FYUK 3T97B 1GW4A 2E76C 2KNCB 1H8AA 1M1JB 1N73C 2WPVB 2FXPA 1LTBC 4GT1A 4W7YA 4Y99B 2OGUA 3L74G 3HE5A 5GTIE 4B86A 2O1KA 3H1KJ 1XTGB 2BASA 2RKLA 4U3FG 5KLVE 3L71J 2O01N 3GMAA 1X22A 3RGUA 3D6ZA 3TGUG 1JY2N 1K73Q 2CPBA 3V4WA 2YKQA 2HYNA 4H13D 2IZ1A 5B66E 2OTKE 4YXWH 2OARA 4UB8E 5H2FH 1PPJE 4I1LA 2QM7A 1LWUA 1PGPA 3AE7C 2N9BA 5KKZB 2OYIB 2IBZG 3AEDC 1ZW0A 3BCCE 3CX5D 1SQVD 2HODA 1VF5D 2A06E 3P8CD 5AVRB 2D2CD 4BWNA 1IFNA 4QMAA 1Y8AA 1S5LE 3L73J 3CXHD 5AW1B 1NU1J 2BEQD 1SQBE 3H1HJ 3Q5SA 1AV1A 4YXDC 4PD4I 2ZT9C 2JJLA 3ABVC 2Z5HA 3WUTA 3M9HA 1LTJC 1URQA 3C8VA 1Q7YQ 3AEAC 1WRGA 2WPRA 3IR9A 2E75B 2ZYAA 1NWQA 5KLVG 5BVZA 3CCRP 1SQQE 2IYPA 2A45G 1QGKB 4IL6H 3CLQA 3PJSK 5B5EH 1HJ0A 3WU2H 3WUUA 1Q82Q 3PHLA 5KLVK 1LT1A 1PPJG 2CK3H 3RK3C 2M3EA 2FYUJ 2Y9ZA 2BCCD 4OH8B 2ZJSE 3H32B 1YJWP 2XV5A 1OW6A 1ZN5A 2ZXEB 1S9KE 3LIDA 4H0LB 2QG4A 1FOSF 1GL2C 3CWBE 3F89A 2QE7H 1PP9E 1Q90D 2B87A 1JY2P 5APXA 1T3JA 4GODA 1KB9D 3H1IG 3KYQA 1FZCC 3AE5C 1H0TA 3LIEA
chains in the Genus database with same CATH topology
3RK2D 2FXMA 4C46A 1FZCB 1HGVA 1RE4C 1SFCB 2WSCH 1J2JB 3HE4A 1JCDA 1T2KC 1XTCC 2W6AA 2CPSA 2Q3IA 3G3ZA 3M9BA 1KFMA 5BU5A 2HODB 5AW2B 3I5CA 1JCCA 2WSEH 1YTZI 2VRSA 3B8EB 1W2EA 1KQLA 3II6A 1DEBA 2WTYA 1NU1K 1N86A 3RL0C 1IC2A 4LLHA 2WWWA 1RY3A 2Q5UA 4RESB 3VMZA 1IK9A 3OAKA 4GIFA 2W27A 3RL0B 1QL2A 1HH0A 4C7RA 3L4FA 3O8ZA 3U1AA 1L0LK 1URQC 1VPCA 4HYTB 1A02J 3IFMA 1SQQK 1LTIC 1HUCA 1WT6A 1X79B 1RE3C 2Z5IA 1RE3A 3H6PA 2FFDA 3KPEA 1URQB 1LT9A 1IFDA 1FDMA 1RF0C 2C9LY 1RF0A 3V5BA 5APYA 2XKMA 1G2CA 1DH3A 5APSA 2P2UA 5CCGD 2NPSA 1G2CB 1ZLLA 1JMMA 1FAVA 3B5NC 3HRNA 1HTLC 3HUSC 2M3BA 3HUSA 3M9QA 4ZKUA 2XZRA 4IFMA 3B5NB 1J1DC 2KSJA 1Z56A 1A02F 3NMDA 3RK3D 4AUWA 1J1DB 2N1TA 1YTZT 1VDFA 1AFOA 3VYIA 1N7LA 3M0AA 1NAFA 1N2DC 4AQRD 3N7NA 2KP8A 3MGNA 1G1IA 5AVVB 1JY3O 1NKNA 1N7SC 1N7SA 3SWFA 1CZQA 3A2AA 2R5BA 2JEEA 2IX7C 1N7SB 5CCHC 2W6BA 1NOHA 4XA4A 2E43A 3BRVB 1L4AD 3MD0A 1QL1A 2ZFCA 5AVUB 3U59A 1FZEA 3WMM0 1SP4A 2FKWB 2P1JA 1J1EC 3VTPC 5AVZB 3SWYA 1RF1C 2L5GB 3P32A 1J1EB 1RF1B 1SQPK 4W7ZA 1GW3A 2E42A 1T2KD 3CI9A 2YNYA 5AVXB 1S9KD 1LTTC 3TYYA 3CL3D 3E1IA 1NTKK 3BVHA 3VP9A 1L0NK 2YO3A 4DZOA 3GHGA 1JY3N 1FJKA 1JOCA 3HE4B 1SVFA 3VP8A 2I1KA 4WY4A 4N3YB 3VOPA 1JY3P 1T3UA 1X8YA 1KILC 3RL0D 1KILA 4LC1A 1T8ZA 3A7OA 5APVA 2H8PD 3L37A 2H43A 4W80A 1KILB 2WPQA 3BASA 1FU1A 1H88A 2YKOA 4IFDK 1YYCA 1URQD 1ZR4A 5AW3B 4N78E 1SLQA 1LGHB 5APQA 4WB4A 1JUNA 3PP5A 5AW6B 3A5TA 1GDTA 1M7LA 3P8MC 3TK1A 3HTKA 3MUDA 1LTGC 3KDPB 1DX7A 1IFMA 3L35A 1NHLA 1HGZA 3HTKB 5CHXA 3B5ND 5CJ0A 1LTSC 4N78D 3M91A 5AVQB 2FFDC 4N6JA 1LT9C 2O1JA 2FFDB 2P7JA 2HG5D 2LKMA 1LT9B 5AVTB 1KZUB 4WBAA 5APWA 1NTZK 2PAJA 1G1JA 2NPSC 2YO2A 5KJ7C 5KJ7A 1PFIA 2NPSB 2C0XA 1JO5A 2WSFH 1H89A 4O9BA 5CMZA 3HUSB 3MIWA 5AW8B 2N1TC 2A45I 3HD7C 3HD7A 2IFNA 4JYCA 1EQ7A 2N1TB 3HD7B 3L36A 1SQXK 4M3LA 5CCHD 3KQGA 1GD2E 1JY2O 3V4QA 4IFFA 2H7HA 3T97A 4I6MC 2FYZA 5AVYB 4JYBA 1GL2D 2C0WA 2FYUK 1M1JC 1M1JA 1GW4A 1FOSE 1GK6A 2IPPA 1H8AA 1M1JB 1N73C 5CCGA 1N73A 5APUA 4JF7A 1NH4A 2A45H 2WT7A 2HPCA 1MZ9A 1GTWA 1N73B 4Y99C 4XE5B 1LTBC 1IJDB 4GT1A 2WT7B 1JNMA 4W7YA 2GUSA 4EOTA 4Y99B 5AW9B 5CJ4A 1SFCD 3HE5A 4B86A 2O1KA 5KTBA 1XTGB 2BASA 1AQ5A 1E5WA 2OYHA 3M0DA 2MJZA 3V2QA 1X9VA 3V2RA 4C7NA 2YKPA 5AW0B 4C7NB 3N4XA 1JY2N 2PP6A 2CPBA 3V4WA 1KILD 1SQVK 2YKQA 2IFMA 2HYNA 2C9NY 3GHGC 2WITA 1ZV8A 3VN0A 1L4AC 2R5DA 1L4AA 5AW7B 3GHGB 1JTHA 2OARA 2HLOA 1L4AB 4WY4C 1FZCA 2OYIC 4I1LA 1JTHB 1LWUC 2QM7A 1LWUA 1LTAC 3V2PA 2OYIA 1OXZA 2N9BA 4WY4B 1GU4A 3P8CE 2OYIB 1LWUB 4LGDE 1RE4A 2M8RA 2WPSA 4AYCA 3NTNA 3TNUA 3EQ2A 2HODA 2GM4A 3TNUB 3P8CD 3RK2C 1NTMK 5AVRB 3VMYA 3NFQA 3UIAA 1SQBK 1IFNA 3RK2B 2Q7CA 2NPSD 3A3YB 5KJ7D 1GZLA 5AW1B 1HBWA 3P7KA 4I2LC 4DOJA 1NKZB 4KHXA 3OJAB 3EFGA 2N1TD 3HD7D 2JJLA 1NO4A 2KB7P 3VMXA 2Z4EA 3TSIA 2Z5HA 3M9HA 1FZBA 1LTJC 1LTJA 2HFED 1CI6A 1URQA 1LTJB 1WRGA 1HWTC 1CI6B 2WPRA 1N7SD 2XU6A 3IR9A 3OA7A 4HH2A 1FZAA 1NWQA 5BU8B 5BVZA 3LW5H 1OWAA 1FBMA 3B5NA 3R2PA 2XNXA 2A45G 4GKGA 1FJPA 1IO4A 1MFZA 3V2NA 3LIEA 3CLQA 1CW5A 2J59M 2I1JA 5CCGC 2QM8A 2POHA 3C9IA 5KLVK 2HPCB 4ZKPA 3BATA 2GUVA 2P67A 2KOGA 3RK3C 2WZ7A 2YMYA 5AW5B 1IFIA 3RK3B 3HE5B 5APTA 1IFJA 1GU5A 2R32A 3H32A 2OYHC 3M0DC 5AVSB 5CCHA 4OH8B 1ZR2A 2KYVA 3H32B 2XV5A 2OYHB 5AW4B 1ZN5A 1MV8A 1FZFA 2ZXEB 4WY4D 3LIDA 3BRTB 3NXSA 1S9KE 1MUUA 1FOSF 1GL2C 1GK4A 1GL2A 2XDJA 1CSBA 2R3CA 1RF1A 1FZGA 1GL2B 2Q9IA 1JY2P 4EIJA 2J58A 1KFNA 5APXA 3U1CA 1T3JA 1HJBA 1HVVA 2KLVA 3M06A 5AVWB 3KYQA 2O01H 1FZCC 3MTUE 1SFCC 1SFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GZL A;  5AW1 B;  4C46 A;  1HBW A;  3MD0 A;  3P7K A;  4I2L C;  2ZFC A;  4JYC A;  4KHX A;  5AVU B;  1J2J B;  3HE4 A;  3L36 A;  1T2K C;  4M3L A;  1SP4 A;  3KQG A;  2W6A A;  1GD2 E;  3V4Q A;  3VTP C;  5AVZ B;  2JJL A;  3VMX A;  2H7H A;  2Q3I A;  4I6M C;  3P32 A;  3T97 A;  3M9B A;  5AVY B;  4JYB A;  2Z5H A;  3M9H A;  5AW2 B;  2E42 A;  1T2K D;  1CI6 A;  2YNY A;  5AVX B;  1S9K D;  3I5C A;  1FOS E;  1GK6 A;  2IPP A;  3TYY A;  1HWT C;  1CI6 B;  1H8A A;  2WPR A;  5APU A;  2WT7 A;  2VRS A;  3B8E B;  1GTW A;  2YO3 A;  2XU6 A;  4DZO A;  3IR9 A;  1KQL A;  4XE5 B;  4GT1 A;  2WT7 B;  2WTY A;  1JNM A;  1NWQ A;  4EOT A;  5AW9 B;  1OWA A;  2WWW A;  4RES B;  2Q5U A;  3HE4 B;  3HE5 A;  3VMZ A;  4B86 A;  3OAK A;  4GKG A;  2W27 A;  2BAS A;  1IO4 A;  1MFZ A;  1X8Y A;  3M0D A;  3O8Z A;  4LC1 A;  3A7O A;  4C7N A;  4HYT B;  1A02 J;  5APV A;  3L37 A;  1HUC A;  5AW0 B;  2Z5I A;  4C7N B;  2QM8 A;  2WPQ A;  1H88 A;  2C9L Y;  3V4W A;  3V5B A;  5APY A;  1YYC A;  2C9N Y;  1DH3 A;  5AW3 B;  3VN0 A;  1SLQ A;  2P67 A;  5APS A;  2P2U A;  5APQ A;  2R5D A;  1G2C B;  5AW7 B;  1JUN A;  1FAV A;  5AW5 B;  5AW6 B;  3A5T A;  3P8M C;  3TK1 A;  2XZR A;  3HTK A;  3HE5 B;  5APT A;  3KDP B;  1GU5 A;  2QM7 A;  2R32 A;  5AVS B;  1OXZ A;  3L35 A;  2N9B A;  1A02 F;  3NMD A;  4AUW A;  1GU4 A;  3M91 A;  2XV5 A;  5AVQ B;  5AW4 B;  1MV8 A;  2WPS A;  2ZXE B;  4AYC A;  3LID A;  3NXS A;  3VYI A;  1S9K E;  1MUU A;  3M0A A;  1FOS F;  3NTN A;  1GK4 A;  2P7J A;  3TNU A;  1CSB A;  5AVT B;  1NAF A;  2R3C A;  5APW A;  4AQR D;  2KP8 A;  3TNU B;  3MGN A;  5AVV B;  2YO2 A;  3SWF A;  1CZQ A;  3A2A A;  5APX A;  5AVR B;  3VMY A;  3NFQ A;  1HJB A;  5AVW B;  2R5B A;  3M06 A;  3UIA A;  2Q7C A;  1H89 A;  5CMZ A;  5AW8 B;  2E43 A;  3A3Y B;  3LIE A; 
#chains in the Genus database with same CATH topology
 3RK2 D;  1ZRT E;  1T2K C;  2Q6Q A;  2KSE A;  4U3F J;  3H1J D;  1L0N E;  5H2F E;  1KFM A;  1S1C X;  1AJY A;  1KV4 A;  4H44 B;  3I5C A;  3TGU J;  2QJK C;  1JCC A;  1SQQ G;  1YBK A;  3Q3D A;  1KQL A;  2QSI A;  1DEB A;  1N86 A;  4JBZ A;  4ZNC A;  1RY3 A;  2L91 A;  3VMZ A;  3FXE A;  3RL0 B;  1QL2 A;  1HH0 A;  3QWO C;  3H25 A;  1SFC C;  3U1A A;  2K9J B;  1A02 J;  1VQ7 P;  1SQQ K;  2FFD A;  1RE3 A;  1P84 E;  3AEE C;  2C9L Y;  5APY A;  2XKM A;  5KLI C;  2E76 D;  5APS A;  1NU1 D;  4CPG A;  2Q3E A;  3B5N C;  3HRN A;  1HTL C;  3M9Q A;  2QEX P;  2KS1 B;  2E74 D;  4AUW A;  3NMD A;  2N1T A;  1YTZ T;  2WSF J;  4K3A A;  3W68 A;  2ITA A;  4AQR D;  3N7N A;  1NKN A;  1N7S C;  4DJG A;  1CZQ A;  2IX7 C;  3CX5 I;  5CCH C;  1NOH A;  4XA4 A;  5KLV J;  1E79 H;  3U59 A;  2W6J H;  1FZE A;  3CXH I;  3P32 A;  3CI9 A;  3AEG C;  4EI2 A;  4GOE A;  1L0N K;  1JY3 N;  1FJK A;  1OVU A;  4N3Y B;  3BCC J;  2K88 A;  4H13 C;  4LC1 A;  1ZXG A;  2ZT9 D;  4W80 A;  1KIL B;  3L72 E;  5DJT B;  3FGA D;  2PRR A;  1YJ9 P;  4IFD K;  1M1K Q;  1SLQ A;  3JCU E;  5APQ A;  3L73 E;  3L70 E;  3PP5 A;  1NTZ G;  3A5T A;  1IFP A;  1BSN A;  3MUD C;  1AVY A;  1LTG C;  1Y47 A;  1NHL A;  2QVA A;  2QJP C;  2XND H;  5CJ0 A;  3M91 A;  1VF5 C;  1W2B O;  1NTM E;  1KYO E;  3H1L E;  2HG5 D;  2D2C C;  3IAO A;  1LT9 B;  5APW A;  1NTZ K;  2R3S A;  3L75 E;  1K8A Q;  2NPS B;  1SQQ J;  2WSF H;  3HUS B;  5C39 A;  2OQQ A;  3O6Q A;  4L73 A;  4JYC A;  4R4M A;  1KB9 I;  3S9O A;  3GF7 A;  3CD6 P;  4PV1 C;  3GW6 A;  4IFF A;  1LNQ A;  1GL2 D;  1QVF O;  4KJM A;  5CCG A;  4JF7 A;  2A45 H;  2WT7 A;  2E76 B;  1N73 B;  4YTP C;  1IJD B;  1JNM A;  2ZYD A;  3TDK A;  5CJ4 A;  1SFC D;  2AEM A;  4HB1 A;  3CWB J;  1AQ5 A;  2ZVN B;  4UB8 H;  1E5W A;  3CC4 P;  3V2R A;  3IN6 A;  4C7N A;  2ZAE B;  5CBO A;  5AW0 B;  3N4X A;  1RH5 B;  1ZME C;  2WIT A;  2OTJ P;  3GLM A;  3VN0 A;  2AXT H;  1L4A A;  4ZMD A;  1EZV E;  1JTH A;  1NTM G;  3H1L G;  1LWU C;  1LTA C;  3RL0 g;  3L74 E;  1L0N J;  4LGD E;  1RE4 A;  2WPS A;  1R5L A;  3NTN A;  3EQ2 A;  3TNU B;  2V4H A;  3TGU E;  2JDI H;  3RK2 C;  1NTM K;  1BE3 D;  2Q7C A;  4R4L A;  3BCC D;  3A3Y B;  1SS1 A;  3P7K A;  4I2L C;  2A06 D;  3CPW O;  1YI2 P;  1D7M A;  5E79 E;  1VQ6 P;  3CME P;  1QEX A;  2IBZ E;  3OW2 O;  2Z4E A;  2ZT9 B;  1NJI Q;  1FZB A;  1VQ8 P;  1Q2N A;  1CI6 A;  1KC8 Q;  3EFF K;  2KZI A;  1SQB D;  4U7J A;  1M8O B;  1LTJ B;  1N7S D;  2XU6 A;  3FWL A;  1FZA A;  1NTZ J;  3C1L A;  5BU8 B;  1FBM A;  2XNX A;  4GKG A;  1IO4 A;  2IDB A;  1S4X A;  1VQL P;  1BDD A;  1BCC D;  1EZV G;  1JB0 J;  2HPC B;  2E74 C;  1VQ9 P;  2P67 A;  2KOG A;  3AE3 C;  1OIP A;  2JWD A;  3RK3 B;  5APT A;  2P58 A;  1DD3 A;  1GU5 A;  2OYH C;  3M0D C;  1ZR2 A;  4WY4 D;  2XDJ A;  3G71 P;  1GL2 B;  2M5A B;  4EIJ A;  3U1C A;  1HVV A;  3AE4 C;  3I56 P;  2IZ0 A;  3CWB D;  3CCV P;  1Q86 Q;  1FZC B;  2FXM A;  4C46 A;  1HGV A;  1MKM A;  1PP9 D;  4TT3 H;  1SQP E;  1SFC B;  1J2J B;  1YJN P;  5M1B A;  1LP1 B;  1GMJ A;  1BDC A;  2AXT E;  1NTK E;  3L72 J;  3B71 A;  3G3Z A;  3M9B A;  2MKV A;  5AW2 B;  3L70 J;  1L0L G;  2O3J A;  2QJK B;  3B8E B;  1L0N D;  3H1I E;  3USS A;  1EDI A;  1P84 H;  2W8Z A;  1IC2 A;  4D6T G;  2WWW A;  4RES B;  1NTM J;  3OAK A;  4GIF A;  3H1L J;  2W27 A;  2WVR A;  3FXD A;  4C7R A;  1PGQ A;  3L4F A;  4PV1 D;  1L0L K;  1VPC A;  1HUC A;  3L75 J;  1X79 B;  1RE3 C;  1LT9 A;  3AE9 C;  4NPD A;  2V7Q J;  1JM0 A;  1PZQ A;  1G2C A;  3D71 A;  1DH3 A;  2QJY C;  3CCL P;  3AE1 C;  2P2U A;  2NPS A;  1ZLL A;  5KLI B;  1JMM A;  4NPE A;  3KXD A;  3HUS A;  2W83 C;  2XZR A;  4IFM A;  2G3A A;  1K9M Q;  2ZVO B;  3B5N B;  4GOF A;  1BGY D;  1DD4 A;  2KSJ A;  1FC2 C;  4DCK A;  3RBX A;  3CCQ P;  4Z1M H;  3B4S A;  4EDF A;  1N7L A;  3R4Y A;  3JC2 2;  2M0B A;  2R5B A;  1SQX E;  1SQP G;  1N7S B;  2FY8 A;  3BRV B;  1NTK G;  3MD0 A;  1QL1 A;  1QVG O;  4OGQ D;  2KK7 A;  3WMM 0;  3VTP C;  5AVZ B;  1RF1 C;  1JEK A;  1SQP K;  1MFT A;  1AQT A;  3MP7 B;  3H1K D;  3CL3 D;  3E1I A;  1NTK K;  2Y9Y A;  2IYO A;  3VP9 A;  3L71 D;  2YO3 A;  4DZO A;  2ZXX A;  3KZI H;  4IOI H;  3L74 J;  1JOC A;  3CCJ P;  2K3R A;  1SVF A;  1IZN B;  3JCU H;  3SWK A;  3CX5 E;  1SQV E;  3VOP A;  2H8P D;  2H43 A;  4H13 B;  2OYO A;  1VQP P;  1KYO H;  1URQ D;  5AW3 B;  4N78 E;  3P8M C;  3PLN A;  3L72 D;  3Q5R A;  2JO1 A;  3L35 A;  3HTK B;  5GTH E;  2V7Q H;  5AVQ B;  3CC7 P;  3AEC C;  3L70 D;  3L73 D;  4N6J A;  2QJP B;  2P7J A;  1VF5 B;  3CCS P;  1SQX G;  2KIK A;  2D2C B;  1G1J A;  5EFW B;  3H1H D;  3TF5 A;  4GDO A;  4JPZ B;  1H89 A;  1NTZ E;  3HD7 A;  3L75 D;  3L36 A;  1SQX K;  1JY2 O;  4PV1 B;  1DIP A;  3T97 A;  5AVY B;  4JYB A;  3LW5 J;  2KNC A;  1UII A;  1M1J A;  4RJT A;  1FOS E;  1GK6 A;  2IPP A;  4HKZ H;  1T6A A;  1NH4 A;  2HPC A;  1MZ9 A;  2BCC E;  4XE5 B;  1SQV G;  2GUS A;  4EOT A;  3F5H A;  4L74 A;  5KTB A;  1KIL E;  2JKV A;  1VQN P;  2MJZ A;  1X9V A;  2FYU D;  4XFJ A;  2YKP A;  1KB9 E;  3CCM P;  1SQV K;  2IFM A;  2C9N Y;  3GHG C;  2OTL P;  5L8R J;  4HJG H;  1L4A C;  2R5D A;  1SQP J;  2AEF A;  2HLO A;  4WWI A;  4WY4 C;  1FZC A;  2OYI A;  1NTK J;  2B9B A;  2PFX A;  3G4S P;  1GU4 A;  1LWU B;  2M8R A;  5DJU B;  4AYC A;  3KZI E;  5E79 H;  3L74 D;  3H1I J;  3IF4 A;  1W5C E;  3UIA A;  4U3F D;  3RK2 B;  1HBW A;  1LJ2 A;  3TGU D;  4MN4 C;  4DOJ A;  1NKZ B;  4KHX A;  2GA1 A;  3EFG A;  2N9Y B;  2LXC B;  2N1T D;  3HD7 D;  2ZYG A;  4YPC A;  1NO4 A;  4I7Z C;  4KT0 J;  2HFE D;  1U57 A;  3CCU P;  2BCC G;  3D6Y A;  1HWT C;  2IBZ D;  3LW5 H;  1OWA A;  3B5N A;  3R2P A;  1FJP A;  4UB6 H;  1M90 Q;  1BSH A;  1NVO A;  2QM8 A;  1R8E A;  1SQX J;  2FBW C;  1NGM B;  1OZH A;  3BAT A;  1OFC X;  3H1J G;  5KAF H;  2YMY A;  2E74 B;  1IFI A;  1IFJ A;  2R32 A;  3H32 A;  5AVS B;  3G6E P;  5CCH A;  2KYV A;  2OYH B;  5AW4 B;  2FXO A;  3WUV A;  1MV8 A;  1GK4 A;  2R3C A;  5KLV D;  1AVO A;  1FZG A;  2I8D A;  1FE6 A;  2J5U A;  2YMK A;  1KFN A;  1HJB A;  1OW8 A;  5AVW B;  2KLV A;  1AA0 A;  2B87 B;  3M06 A;  4OGQ C;  1H0T B;  3PRJ A;  1SQV J;  1PGJ A;  2P10 A;  1ZP0 C;  1JCD A;  1S2E A;  1XTC C;  2W6A A;  1PPJ D;  4BXL A;  1NU1 G;  1Y9B A;  3CCE P;  1RQV A;  2YIU C;  1YTZ I;  1KOR A;  2VRS A;  2DW3 A;  1OVV A;  1NU1 K;  2KZJ A;  2Q5U A;  1IK9 A;  2E75 D;  2H89 C;  3AE6 C;  4K35 A;  2K9J A;  2JP3 A;  3H1I D;  3O8Z A;  1HF9 A;  1URQ C;  3IFM A;  3Q1M A;  2Z5I A;  3KPE A;  1KQF B;  1IFD A;  1FDM A;  1RF0 A;  3KHU A;  3PH0 A;  3V5B A;  2B88 A;  1VQK P;  1S3J A;  3RK3 E;  1L0L E;  5CCG D;  2QRX A;  2PGD A;  1FAV A;  1VQM P;  2QJY B;  2KS1 A;  2KXP B;  3HUS C;  4BRY B;  2M3B A;  4ZKU A;  1X0T A;  1J1D C;  1Z56 A;  4D6T E;  1YIT P;  1VDF A;  1SQQ D;  1AFO A;  3PTZ A;  3VYI A;  1EXI A;  3M0A A;  1N2D C;  4H0L D;  4PD4 E;  2KP8 A;  3D70 A;  1G1I A;  5AVV B;  1JY3 O;  2BCC J;  4UB6 E;  3A2A A;  4DT0 A;  2JEE A;  4A7P A;  1L4A D;  2AEJ A;  2Y0C A;  2E5Y A;  1EDJ A;  1SP4 A;  1SQX D;  1J1E C;  5KAF E;  3VMA A;  1RF1 B;  4W7Z A;  2E42 A;  5AVX B;  1S9K D;  3Q5P A;  1LTT C;  3CX5 H;  3TYY A;  1R5S A;  4H44 D;  3SFD C;  3H1J J;  3CXH H;  3V6I A;  3HE4 B;  2IBZ I;  3VP8 A;  3ZDM A;  1K04 A;  1X8Y A;  1ZRT D;  1KIL A;  3RL0 D;  1FDI A;  1T8Z A;  1BE3 E;  5GTH H;  1FU1 A;  1U7M A;  4RKU J;  3A0B E;  1H88 A;  3CC2 P;  2YKO A;  1FDO A;  1RHZ B;  1LGH B;  3TK1 A;  1HGZ A;  5CHX A;  2WMM A;  4N78 D;  2FFD C;  2Y0D A;  2AXC A;  2O1J A;  2JR8 A;  1KN7 A;  2LKM A;  1WMK A;  4WBA A;  2PAJ A;  2FYN C;  2JWA A;  5KJ7 A;  1PFI A;  2C0X A;  1P84 D;  1JO5 A;  3W67 A;  4TLF A;  5CMZ A;  3MIW A;  2B89 A;  2A45 I;  2N1T C;  3HD7 C;  1DEE G;  3O6Q B;  1YQ4 C;  1BCC E;  2H7H A;  1NTZ D;  3CMA P;  3A0H H;  1M1J C;  1YIJ P;  3G9R A;  1N73 A;  5APU A;  1GTW A;  4PJ0 E;  4Y99 C;  1M57 D;  1K05 A;  1KB9 H;  2WT7 B;  5AW9 B;  3QH9 A;  1USE A;  1BE3 G;  5K5G B;  2OYH A;  3M0D A;  3V2Q A;  3BCC G;  1S5L X;  4C7N B;  2A06 G;  1OX3 A;  1VQ4 P;  2PP6 A;  1KIL D;  3K5B A;  3RBZ A;  1ZV8 A;  5AW7 B;  3GHG B;  1L4A B;  2NZ2 A;  5KKZ C;  2OYI C;  1JTH B;  3V2P A;  1SQB G;  1OXZ A;  3E7K A;  4WY4 B;  3E1R A;  3P8C E;  2O01 J;  1PIX A;  3TNU A;  5TIS H;  2K9Y A;  3CXH E;  2GM4 A;  4L76 A;  2WSC J;  1PV3 A;  3VMY A;  3NFQ A;  1SQB K;  2NPS D;  5KJ7 D;  1GZL A;  3SFE C;  1OMI A;  3Q2Y A;  1U7J A;  4RO0 A;  1BCC G;  2WSE J;  2R44 A;  3OJA B;  2HR3 A;  2KB7 P;  3VMX A;  3TSI A;  5KAI H;  2YXQ B;  1NTM D;  1LTJ A;  1KYO D;  4I7Z B;  1L0L J;  3H1L D;  1UIX A;  2Y0E A;  1CI6 B;  2E75 C;  1L2P A;  1BGY E;  1EDK A;  1KD1 Q;  3FWN A;  3OA7 A;  4HH2 A;  4D6T J;  4ASV A;  4BRY A;  1Q81 Q;  1MFZ A;  3V2N A;  3CWB G;  1CW5 A;  2J59 M;  2NRG A;  3AEB C;  4Y28 J;  2I1J A;  5CCG C;  1JMB A;  1PP9 G;  2POH A;  2QA4 P;  3C9I A;  1PL5 A;  4ZKP A;  2GUV A;  2WZ7 A;  4IL6 E;  5AW5 B;  3ITK A;  3A0H E;  3HE5 B;  1KMI Z;  5B5E E;  2BEZ F;  4H0L C;  3WU2 E;  1FZF A;  1L0N G;  3NXS A;  3BRT B;  1M56 D;  3H1K E;  1MUU A;  3EWK A;  1GL2 A;  1CSB A;  5TJH A;  1KQG B;  2M5A A;  1EC5 A;  3L71 E;  1RF1 A;  2Q9I A;  2J58 A;  1YHQ P;  4OWF A;  2LR2 A;  2O01 H;  3MTU E;  3MZW B;  3H1J E;  1USD A;  1SFC A;  4OGQ B;  1RE4 C;  1LP1 A;  2KUB A;  2WSC H;  1EZV D;  3HE4 A;  1P84 I;  1TU3 F;  3I55 P;  2CPS A;  1BE3 J;  1FS0 E;  4WVZ A;  2Q3I A;  4H44 C;  5BU5 A;  2HOD B;  2QIW A;  1BGY G;  2WSE H;  2LXB A;  2UWJ E;  2YIU B;  1W2E A;  2SPZ A;  5TIS E;  3II6 A;  2WTY A;  3RL0 C;  3MHV A;  4LLH A;  1SQB J;  4IL6 X;  2K37 A;  1NU1 E;  4HYT B;  3H1H E;  1LTI C;  1WT6 A;  3H6P A;  1URQ B;  1NYH A;  1RF0 C;  1OW7 A;  1G2C B;  4PD4 H;  5KAI E;  3H1K G;  1A02 F;  1BCC J;  3RK3 D;  1J1D B;  1L0L D;  3GG2 A;  3L71 G;  5CBN A;  3GF3 A;  1NAF A;  3FX0 A;  4L75 A;  4D6T D;  2H88 C;  3MGN A;  5GTI H;  1VL2 A;  1N7S A;  3SWF A;  3S1K A;  2RMZ A;  3AE2 C;  2W6B A;  2E43 A;  4PD4 D;  2ZFC A;  5AVU B;  1S72 P;  2FYU E;  1VQ5 P;  2FKW B;  2P1J A;  3SWY A;  5B66 H;  2L5G B;  1QLE D;  1J1E B;  1NAY A;  3L72 G;  1N8R Q;  1GW3 A;  1T2K D;  2KLU A;  2YNY A;  2RH0 A;  1PP9 J;  1VQO P;  3BVH A;  3L70 G;  3L73 G;  1KYO I;  3GHG A;  3A0B H;  4EYY Q;  2W90 A;  2E5T A;  4ASW A;  3H1H G;  2I1K A;  4WY4 A;  1JY3 P;  1T3U A;  1SQP D;  1KIL C;  4JQ0 D;  3A7O A;  2YXR B;  5APV A;  1S5L H;  3L37 A;  1ZOY C;  1NTK D;  2WPQ A;  3BAS A;  4U3F E;  3L75 G;  1YYC A;  1QX8 A;  1ZR4 A;  1KQS O;  4WB4 A;  1JUN A;  1KTM A;  1RQU A;  5AW6 B;  1GDT A;  1M7L A;  3SSU A;  3HTK A;  3MUD A;  3KDP B;  1DX7 A;  1IFM A;  3B5N D;  1EXJ A;  1LTS C;  1EDL A;  1LT9 C;  2FFD B;  3JSV C;  1OVR A;  5AVT B;  1KZU B;  2G8Y A;  2NPS C;  1BGY J;  2YO2 A;  5KJ7 C;  2FYN B;  1PGO A;  2FYU G;  2WQY C;  4O9B A;  5AW8 B;  3AE8 C;  2WSS H;  1IK7 A;  4NPF X;  2IFN A;  3S4R A;  4OVN F;  1EQ7 A;  2N1T B;  3HD7 B;  2Q1K A;  3AEF C;  4PJ0 H;  4M3L A;  2K1A A;  5CCH D;  2RN0 A;  3KQG A;  1GD2 E;  1YQ3 C;  2KI7 B;  3V4Q A;  4I6M C;  2FYZ A;  1EZV I;  2C0W A;  2FYU K;  3T97 B;  1GW4 A;  2E76 C;  2KNC B;  1H8A A;  1M1J B;  1N73 C;  2WPV B;  2FXP A;  1LTB C;  4GT1 A;  4W7Y A;  4Y99 B;  2OGU A;  3L74 G;  3HE5 A;  5GTI E;  4B86 A;  2O1K A;  3H1K J;  1XTG B;  2BAS A;  2RKL A;  4U3F G;  5KLV E;  3L71 J;  2O01 N;  3GMA A;  1X22 A;  3RGU A;  3D6Z A;  3TGU G;  1JY2 N;  1K73 Q;  2CPB A;  3V4W A;  2YKQ A;  2HYN A;  4H13 D;  2IZ1 A;  5B66 E;  2OTK E;  4YXW H;  2OAR A;  4UB8 E;  5H2F H;  1PPJ E;  4I1L A;  2QM7 A;  1LWU A;  1PGP A;  3AE7 C;  2N9B A;  5KKZ B;  2OYI B;  2IBZ G;  3AED C;  1ZW0 A;  3BCC E;  3CX5 D;  1SQV D;  2HOD A;  1VF5 D;  2A06 E;  3P8C D;  5AVR B;  2D2C D;  4BWN A;  1IFN A;  4QMA A;  1Y8A A;  1S5L E;  3L73 J;  3CXH D;  5AW1 B;  1NU1 J;  2BEQ D;  1SQB E;  3H1H J;  3Q5S A;  1AV1 A;  4YXD C;  4PD4 I;  2ZT9 C;  2JJL A;  3ABV C;  2Z5H A;  3WUT A;  3M9H A;  1LTJ C;  1URQ A;  3C8V A;  1Q7Y Q;  3AEA C;  1WRG A;  2WPR A;  3IR9 A;  2E75 B;  2ZYA A;  1NWQ A;  5KLV G;  5BVZ A;  3CCR P;  1SQQ E;  2IYP A;  2A45 G;  1QGK B;  4IL6 H;  3CLQ A;  3PJS K;  5B5E H;  1HJ0 A;  3WU2 H;  3WUU A;  1Q82 Q;  3PHL A;  5KLV K;  1LT1 A;  1PPJ G;  2CK3 H;  3RK3 C;  2M3E A;  2FYU J;  2Y9Z A;  2BCC D;  4OH8 B;  2ZJS E;  3H32 B;  1YJW P;  2XV5 A;  1OW6 A;  1ZN5 A;  2ZXE B;  1S9K E;  3LID A;  4H0L B;  2QG4 A;  1FOS F;  1GL2 C;  3CWB E;  3F89 A;  2QE7 H;  1PP9 E;  1Q90 D;  2B87 A;  1JY2 P;  5APX A;  1T3J A;  4GOD A;  1KB9 D;  3H1I G;  3KYQ A;  1FZC C;  3AE5 C;  1H0T A;  3LIE A; 
#chains in the Genus database with same CATH homology
 3RK2 D;  2FXM A;  4C46 A;  1FZC B;  1HGV A;  1RE4 C;  1SFC B;  2WSC H;  1J2J B;  3HE4 A;  1JCD A;  1T2K C;  1XTC C;  2W6A A;  2CPS A;  2Q3I A;  3G3Z A;  3M9B A;  1KFM A;  5BU5 A;  2HOD B;  5AW2 B;  3I5C A;  1JCC A;  2WSE H;  1YTZ I;  2VRS A;  3B8E B;  1W2E A;  1KQL A;  3II6 A;  1DEB A;  2WTY A;  1NU1 K;  1N86 A;  3RL0 C;  1IC2 A;  4LLH A;  2WWW A;  1RY3 A;  2Q5U A;  4RES B;  3VMZ A;  1IK9 A;  3OAK A;  4GIF A;  2W27 A;  3RL0 B;  1QL2 A;  1HH0 A;  4C7R A;  3L4F A;  3O8Z A;  3U1A A;  1L0L K;  1URQ C;  1VPC A;  4HYT B;  1A02 J;  3IFM A;  1SQQ K;  1LTI C;  1HUC A;  1WT6 A;  1X79 B;  1RE3 C;  2Z5I A;  1RE3 A;  3H6P A;  2FFD A;  3KPE A;  1URQ B;  1LT9 A;  1IFD A;  1FDM A;  1RF0 C;  2C9L Y;  1RF0 A;  3V5B A;  5APY A;  2XKM A;  1G2C A;  1DH3 A;  5APS A;  2P2U A;  5CCG D;  2NPS A;  1G2C B;  1ZLL A;  1JMM A;  1FAV A;  3B5N C;  3HRN A;  1HTL C;  3HUS C;  2M3B A;  3HUS A;  3M9Q A;  4ZKU A;  2XZR A;  4IFM A;  3B5N B;  1J1D C;  2KSJ A;  1Z56 A;  1A02 F;  3NMD A;  3RK3 D;  4AUW A;  1J1D B;  2N1T A;  1YTZ T;  1VDF A;  1AFO A;  3VYI A;  1N7L A;  3M0A A;  1NAF A;  1N2D C;  4AQR D;  3N7N A;  2KP8 A;  3MGN A;  1G1I A;  5AVV B;  1JY3 O;  1NKN A;  1N7S C;  1N7S A;  3SWF A;  1CZQ A;  3A2A A;  2R5B A;  2JEE A;  2IX7 C;  1N7S B;  5CCH C;  2W6B A;  1NOH A;  4XA4 A;  2E43 A;  3BRV B;  1L4A D;  3MD0 A;  1QL1 A;  2ZFC A;  5AVU B;  3U59 A;  1FZE A;  3WMM 0;  1SP4 A;  2FKW B;  2P1J A;  1J1E C;  3VTP C;  5AVZ B;  3SWY A;  1RF1 C;  2L5G B;  3P32 A;  1J1E B;  1RF1 B;  1SQP K;  4W7Z A;  1GW3 A;  2E42 A;  1T2K D;  3CI9 A;  2YNY A;  5AVX B;  1S9K D;  1LTT C;  3TYY A;  3CL3 D;  3E1I A;  1NTK K;  3BVH A;  3VP9 A;  1L0N K;  2YO3 A;  4DZO A;  3GHG A;  1JY3 N;  1FJK A;  1JOC A;  3HE4 B;  1SVF A;  3VP8 A;  2I1K A;  4WY4 A;  4N3Y B;  3VOP A;  1JY3 P;  1T3U A;  1X8Y A;  1KIL C;  3RL0 D;  1KIL A;  4LC1 A;  1T8Z A;  3A7O A;  5APV A;  2H8P D;  3L37 A;  2H43 A;  4W80 A;  1KIL B;  2WPQ A;  3BAS A;  1FU1 A;  1H88 A;  2YKO A;  4IFD K;  1YYC A;  1URQ D;  1ZR4 A;  5AW3 B;  4N78 E;  1SLQ A;  1LGH B;  5APQ A;  4WB4 A;  1JUN A;  3PP5 A;  5AW6 B;  3A5T A;  1GDT A;  1M7L A;  3P8M C;  3TK1 A;  3HTK A;  3MUD A;  1LTG C;  3KDP B;  1DX7 A;  1IFM A;  3L35 A;  1NHL A;  1HGZ A;  3HTK B;  5CHX A;  3B5N D;  5CJ0 A;  1LTS C;  4N78 D;  3M91 A;  5AVQ B;  2FFD C;  4N6J A;  1LT9 C;  2O1J A;  2FFD B;  2P7J A;  2HG5 D;  2LKM A;  1LT9 B;  5AVT B;  1KZU B;  4WBA A;  5APW A;  1NTZ K;  2PAJ A;  1G1J A;  2NPS C;  2YO2 A;  5KJ7 C;  5KJ7 A;  1PFI A;  2NPS B;  2C0X A;  1JO5 A;  2WSF H;  1H89 A;  4O9B A;  5CMZ A;  3HUS B;  3MIW A;  5AW8 B;  2N1T C;  2A45 I;  3HD7 C;  3HD7 A;  2IFN A;  4JYC A;  1EQ7 A;  2N1T B;  3HD7 B;  3L36 A;  1SQX K;  4M3L A;  5CCH D;  3KQG A;  1GD2 E;  1JY2 O;  3V4Q A;  4IFF A;  2H7H A;  3T97 A;  4I6M C;  2FYZ A;  5AVY B;  4JYB A;  1GL2 D;  2C0W A;  2FYU K;  1M1J C;  1M1J A;  1GW4 A;  1FOS E;  1GK6 A;  2IPP A;  1H8A A;  1M1J B;  1N73 C;  5CCG A;  1N73 A;  5APU A;  4JF7 A;  1NH4 A;  2A45 H;  2WT7 A;  2HPC A;  1MZ9 A;  1GTW A;  1N73 B;  4Y99 C;  4XE5 B;  1LTB C;  1IJD B;  4GT1 A;  2WT7 B;  1JNM A;  4W7Y A;  2GUS A;  4EOT A;  4Y99 B;  5AW9 B;  5CJ4 A;  1SFC D;  3HE5 A;  4B86 A;  2O1K A;  5KTB A;  1XTG B;  2BAS A;  1AQ5 A;  1E5W A;  2OYH A;  3M0D A;  2MJZ A;  3V2Q A;  1X9V A;  3V2R A;  4C7N A;  2YKP A;  5AW0 B;  4C7N B;  3N4X A;  1JY2 N;  2PP6 A;  2CPB A;  3V4W A;  1KIL D;  1SQV K;  2YKQ A;  2IFM A;  2HYN A;  2C9N Y;  3GHG C;  2WIT A;  1ZV8 A;  3VN0 A;  1L4A C;  2R5D A;  1L4A A;  5AW7 B;  3GHG B;  1JTH A;  2OAR A;  2HLO A;  1L4A B;  4WY4 C;  1FZC A;  2OYI C;  4I1L A;  1JTH B;  1LWU C;  2QM7 A;  1LWU A;  1LTA C;  3V2P A;  2OYI A;  1OXZ A;  2N9B A;  4WY4 B;  1GU4 A;  3P8C E;  2OYI B;  1LWU B;  4LGD E;  1RE4 A;  2M8R A;  2WPS A;  4AYC A;  3NTN A;  3TNU A;  3EQ2 A;  2HOD A;  2GM4 A;  3TNU B;  3P8C D;  3RK2 C;  1NTM K;  5AVR B;  3VMY A;  3NFQ A;  3UIA A;  1SQB K;  1IFN A;  3RK2 B;  2Q7C A;  2NPS D;  3A3Y B;  5KJ7 D;  1GZL A;  5AW1 B;  1HBW A;  3P7K A;  4I2L C;  4DOJ A;  1NKZ B;  4KHX A;  3OJA B;  3EFG A;  2N1T D;  3HD7 D;  2JJL A;  1NO4 A;  2KB7 P;  3VMX A;  2Z4E A;  3TSI A;  2Z5H A;  3M9H A;  1FZB A;  1LTJ C;  1LTJ A;  2HFE D;  1CI6 A;  1URQ A;  1LTJ B;  1WRG A;  1HWT C;  1CI6 B;  2WPR A;  1N7S D;  2XU6 A;  3IR9 A;  3OA7 A;  4HH2 A;  1FZA A;  1NWQ A;  5BU8 B;  5BVZ A;  3LW5 H;  1OWA A;  1FBM A;  3B5N A;  3R2P A;  2XNX A;  2A45 G;  4GKG A;  1FJP A;  1IO4 A;  1MFZ A;  3V2N A;  3LIE A;  3CLQ A;  1CW5 A;  2J59 M;  2I1J A;  5CCG C;  2QM8 A;  2POH A;  3C9I A;  5KLV K;  2HPC B;  4ZKP A;  3BAT A;  2GUV A;  2P67 A;  2KOG A;  3RK3 C;  2WZ7 A;  2YMY A;  5AW5 B;  1IFI A;  3RK3 B;  3HE5 B;  5APT A;  1IFJ A;  1GU5 A;  2R32 A;  3H32 A;  2OYH C;  3M0D C;  5AVS B;  5CCH A;  4OH8 B;  1ZR2 A;  2KYV A;  3H32 B;  2XV5 A;  2OYH B;  5AW4 B;  1ZN5 A;  1MV8 A;  1FZF A;  2ZXE B;  4WY4 D;  3LID A;  3BRT B;  3NXS A;  1S9K E;  1MUU A;  1FOS F;  1GL2 C;  1GK4 A;  1GL2 A;  2XDJ A;  1CSB A;  2R3C A;  1RF1 A;  1FZG A;  1GL2 B;  2Q9I A;  1JY2 P;  4EIJ A;  2J58 A;  1KFN A;  5APX A;  3U1C A;  1T3J A;  1HJB A;  1HVV A;  2KLV A;  3M06 A;  5AVW B;  3KYQ A;  2O01 H;  1FZC C;  3MTU E;  1SFC C;  1SFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...