1H88A

Crystal structure of ternary protein-dna complex1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
70
structure length
70
Chain Sequence
VDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords CCAAT/ENHANCER BINDING PROTEIN BETA
total genus 30
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1h88A00
2WTYA 3V5BA 3HE4A 3HE4B 5APYA 5APUA 3TK1A 1CI6B 2R5BA 2W6AA 4AYCA 2P2UA 5AW3B 1H88A 2P67A 1JUNA 3TYYA 5AW6B 1FAVA 5AVXB 1FOSE 1HBWA 3I5CA 1GK4A 4XE5B 5AW1B 4I2LC 4B86A 1IO4A 4GKGA 2XU6A 1HWTC 5AW8B 2WPQA 5AW0B 3M0AA 3VTPC 1SP4A 1S9KE 2R32A 2P7JA 1J2JB 5AVWB 4LC1A 4C7NB 3VMZA 3P8MC 3V4QA 3KQGA 3MGNA 4AUWA 3LIEA 2Q7CA 1H8AA 5APQA 4DZOA 3A5TA 1GU5A 5AW2B 4GT1A 1H89A 5AVSB 2YNYA 3NFQA 5APXA 2ZFCA 3LIDA 2C9LY 2QM7A 1DH3A 3M06A 4I6MC 4RESB 4EOTA 3V4WA 1NWQA 2Z5HA 5AVQB 5AW7B 2ZXEB 3M9BA 3P7KA 3NTNA 1T2KC 2E43A 3NXSA 5AW4B 3UIAA 1GZLA 1MUUA 3NMDA 2XV5A 5APSA 3L37A 1X8YA 3T97A 2C9NY 2WPSA 1GU4A 3HE5A 2R5DA 5AVUB 3HE5B 1KQLA 1YYCA 3A3YB 5AVVB 1CI6A 1A02J 5AVZB 5AVTB 1G2CB 3MD0A 2N9BA 2WT7A 4AQRD 2WT7B 3KDPB 2BASA 3B8EB 1GK6A 1GTWA 1MV8A 1T2KD 2WWWA 1HJBA 3HTKA 5APWA 3VYIA 2Q5UA 4HYTB 4JYCA 3P32A 3M9HA 2WPRA 3TNUB 1FOSF 2H7HA 2KP8A 3OAKA 3L35A 2YO2A 2R3CA 3TNUA 1OWAA 1SLQA 5AVRB 1CZQA 2YO3A 3O8ZA 5AW5B 4C7NA 2E42A 2XZRA 2JJLA 5CMZA 5AVYB 1GD2E 3VN0A 3VMYA 1MFZA 2IPPA 4JYBA 1JNMA 1NAFA 3L36A 3A2AA 1A02F 4C46A 2Z5IA 1OXZA 2W27A 1CSBA 5APVA 3SWFA 2VRSA 4M3LA 3IR9A 3M0DA 3M91A 3A7OA 2Q3IA 5AW9B 3VMXA 4KHXA 1S9KD 1HUCA 2QM8A 5APTA
chains in the Genus database with same CATH superfamily
1SQBE 3CCLP 1KB9D 2IZ1A 1PGOA 3HE4A 2KS1A 1URQB 1LTJB 1X22A 2B87A 2KNCA 2POHA 1FDMA 1SQQE 2AXCA 5APYA 4DT0A 5APUA 5KAFH 2O1KA 4AYCA 5GTHH 3I56P 1N73C 3BRTB 1YJNP 1H88A 3WU2H 2P67A 1N7LA 2A06D 3CCMP 1T3JA 2BCCJ 3GHGA 1FAVA 4YPCA 1EZVE 1BGYD 3HUSC 3I5CA 3L4FA 4XE5B 4L75A 5E79E 4OGQC 1KILB 1IO4A 3AE3C 1L0ND 1NTMK 1L0LJ 2XU6A 2Y0DA 3AEEC 4LLHA 3SSUA 1HWTC 2QRXA 1YHQP 1IC2A 1LTBC 3G9RA 1SQQD 1NU1G 2C0WA 2AXTH 2N1TD 1E5WA 3II6A 5AW0B 1LJ2A 1BCCD 3CPWO 1BSHA 3B4SA 3MIWA 3AE7C 1S9KE 1AV1A 1FDIA 1ZRTE 1RE3C 2A45H 2CPBA 3K5BA 3L75G 3VN0A 1KB9E 1BGYE 3H1IE 2IYPA 4YXDC 1LWUA 1TU3F 1Y8AA 1J2JB 2R3SA 1SQQJ 4UB8E 3BCCJ 2ZT9D 1PGQA 2JWAA 5AVWB 1NTKK 5CCGC 2QE7H 3H1LG 3L71J 4A7PA 5TISH 1AA0A 1L0LD 3P8MC 3H1KG 1QEXA 2QM8A 4GODA 4JPZB 2K9YA 1N7SB 2A06E 3LIEA 3H1LJ 3AEDC 3L71G 3L71D 1VQMP 1GDTA 1Q86Q 3TF5A 5H2FH 1SS1A 5AW2B 1NHLA 1LP1B 1NO4A 4GT1A 5AVSB 3H1KD 1YI2P 1FZBA 3RK3D 1SQXD 2FKWB 2IFNA 2ZFCA 3BCCE 1EDIA 1P84E 1P84I 1S3JA 2NPSD 2RN0A 3CWBG 1EZVI 2O01J 3MTUE 1NTMJ 3PTZA 5CCHC 4EOTA 1RE3A 2FFDB 1SQBG 1WMKA 4EIJA 1FZAA 1USEA 3CXHH 3RGUA 1PV3A 5AW4B 2E43A 2WPVB 3SWYA 2W6BA 1MUUA 2KI7B 1PP9D 5EFWB 2PGDA 2XV5A 3CX5D 5DJUB 1LTJA 1NU1D 2B87B 2PP6A 5E79H 1VQNP 2WPSA 3HE5A 3EFGA 1VQ6P 4BXLA 1KV4A 3CLQA 2V7QH 3B5NC 4H13B 2K9JB 1EZVG 1N7SC 1BSNA 2WZ7A 5AVVB 5L8RJ 3SWKA 3KPEA 5B66E 3IFMA 1KN7A 2B88A 2C0XA 4OVNF 1G2CB 3MD0A 1FDOA 3KZIH 1FJKA 2WSEJ 3FXEA 2WT7A 3G6EP 2ZYGA 2OARA 1SQQK 2YKOA 3CCRP 2HPCA 2Q1KA 4TLFA 2BASA 4D6TD 3CCEP 4W80A 3O6QA 1ZW0A 5KLVJ 1GK6A 3H1JD 1HUCA 1DD4A 3L75E 1SQBJ 4IFFA 3L73J 3C9IA 2XNXA 1M1JA 3QWOC 1NVOA 5CCHD 1FZCC 2Y0CA 3HTKA 2Q6QA 5APWA 4RJTA 5KKZC 2Q5UA 1JY3N 1BCCJ 2WSFH 1MKMA 3TNUB 3H1LE 1LWUB 2K88A 5GTIH 1KILC 2WITA 2IBZG 3AEFC 3L74E 3EWKA 3AE6C 1SLQA 4D6TE 2YO3A 2CPSA 2JDIH 4L76A 2Y9YA 1LTJC 1BDCA 1XTGB 2JJLA 2P10A 3TK1A 1BGYJ 1L0NE 1GD2E 1RE4A 3BASA 1YJWP 3L70D 1IFPA 1OZHA 3TGUD 2QEXP 1BDDA 1AQ5A 2Y9ZA 3BCCG 1YQ4C 1JNMA 4I7ZB 1DIPA 3L36A 1E79H 2M5AA 4C46A 1OW6A 1SQVG 2V7QJ 3C8VA 2ZJSE 3U1CA 3Q5RA 4RO0A 3ITKA 3L74D 2W27A 5KJ7D 1VL2A 3W68A 1WT6A 3SWFA 1LT9C 2FFDA 2D2CC 2FY8A 2XNDH 3RK2D 1YIJP 2G3AA 3IN6A 4N6JA 3L74J 3CL3D 1KYOE 2Q3IA 3D6ZA 1BCCE 3G3ZA 2FXMA 3PH0A 4W7YA 1HH0A 1ZP0C 2FYUD 1AQTA 2N1TA 2ZYAA 3CCSP 5APTA 2WTYA 5BU5A 3H1ID 2O01N 3RBXA 2FYUJ 3P8CE 1JTHA 1OIPA 2R5BA 1GL2A 2JWDA 4K35A 2YKQA 3HD7D 3CCQP 3TGUG 4KJMA 1NH4A 5AW3B 1SQXE 3BCCD 3H1HJ 4Y99B 2QJPB 1KQFB 1JMBA 4XFJA 3SFDC 1JUNA 4PV1C 1JO5A 1SQPJ 3GG2A 2PRRA 5AW1B 1QL2A 2GUVA 3HRNA 4GDOA 2K37A 3ZDMA 5AW8B 1GL2D 2JR8A 3M0DC 1K04A 3FGAD 1ZN5A 2ITAA 1P84D 1SQPE 3RBZA 2E5TA 1FZCA 1KB9I 1M1JC 4D6TG 2OTKE 1FJPA 4H0LB 4WB4A 1ZR2A 2FBWC 1HF9A 1L0LK 3E1RA 1QX8A 2R32A 5C39A 1NTME 3CX5E 4EI2A 1YITP 3F89A 3OJAB 1JY2O 1WRGA 4LC1A 1N2DC 1AVYA 1SVFA 3VMZA 3E1IA 3KQGA 1HGZA 4U3FD 2M3BA 3MGNA 5KKZB 4AUWA 2Q7CA 1H8AA 3B71A 1IFJA 3W67A 1VQOP 2E76C 1SQXK 2I8DA 4L74A 2SPZA 1DD3A 3A5TA 2W90A 1GU5A 2A06G 2OYHA 3L71E 1CW5A 3V2PA 1HVVA 2MKVA 1JMMA 5CJ4A 2R44A 1VQPP 2WSSH 2C9LY 2JEEA 3M06A 3JCUH 1S4XA 2QJKC 1EDJA 4UB6H 1UIIA 2AXTE 1QL1A 2Z5HA 4H13D 3M9BA 1BE3J 2N1TB 3NTNA 4W7ZA 3NXSA 3CWBE 3L72E 5KLIB 1Q7YQ 3AEGC 3CXHI 2BEQD 3T97B 4PD4D 3S1KA 3BVHA 5APSA 2B9BA 2Q3EA 2WMMA 1FZFA 3L37A 2OYOA 1ZLLA 5CBNA 3TGUE 2ZT9C 1J1EC 1SQXG 4YTPC 1JTHB 1GU4A 3VP9A 1KQLA 2KLUA 4ASVA 1PGPA 3H1HD 3AECC 1N86A 1YYCA 3A3YB 2A45I 2L5GB 3U1AA 4NPDA 2JO1A 1VF5B 5AVZB 3L70E 1KZUB 1SFCB 1URQD 5H2FE 4Z1MH 5CCGA 2CK3H 1RQVA 2QJYC 1Q90D 1SQPG 3KDPB 3CMEP 3B8EB 2Z4EA 2IFMA 3RK3C 3KHUA 1GTWA 2YMKA 1JY2P 1MV8A 1RHZB 3FXDA 3JC22 3G4SP 1VQ9P 1NTZK 1VQ5P 2NRGA 1KFMA 3PLNA 1M57D 5CCHA 1S1CX 3CD6P 1KYOD 1SQBK 1OVUA 4IFDK 1KB9H 2V4HA 1LNQA 2WPRA 3M9HA 3I55P 2H7HA 2AEJA 2XDJA 1OWAA 5AW5B 1LT9B 2FYNB 1QGKB 2YIUC 2E42A 2XZRA 1OW8A 3CC7P 2IBZE 2KLVA 3A0HH 3L74G 2GA1A 5CMZA 4BRYB 4EDFA 2RH0A 4EYYQ 1K73Q 1KTMA 2YXRB 3VMYA 1NTKD 5BVZA 1VPCA 5KLIC 5GTIE 3CMAP 2UWJE 2OYHB 2E74D 2WQYC 1SQVJ 4PV1B 2HG5D 2Y0EA 3AE1C 2ZVOB 1KMIZ 1OXZA 1CSBA 4OGQD 4OGQB 1L2PA 1OVRA 2NPSC 4PD4I 2A45G 5TJHA 4M3LA 4D6TJ 1EC5A 5TISE 1LT1A 2BCCD 2HODB 3M91A 4DOJA 5KAIH 3OW2O 1RF1C 3CC2P 1ZXGA 1NU1J 2IBZD 2XKMA 3L73G 3L73D 5DJTB 4ZKUA 2FFDC 1RF1A 1KC8Q 2QVAA 1EQ7A 1X9VA 3VMXA 5AVXB 5CJ0A 5KJ7A 1DH3A 4O9BA 1UIXA 3V5BA 1JCCA 2KYVA 2W8ZA 4GOFA 1BCCG 3L75J 4R4MA 2J58A 3VP8A 1LTSC 2ZXXA 5KLVE 1S5LE 3HE4B 1VQ8P 1URQA 1NTZG 2KNCB 5CCGD 4KT0J 2W6AA 3RL0D 2P2UA 4H44D 1LGHB 2OYHC 3L70J 5AW6B 1HBWA 4OH8B 1GK4A 1KILA 3EQ2A 1K05A 2WSFJ 2KSJA 4B86A 1DX7A 4GKGA 2I1JA 2LR2A 1BE3G 3VMAA 1KD1Q 3A0BE 3AEAC 1KYOH 1NOHA 3H6PA 4HH2A 3M0AA 1VQKP 3RK2B 1PGJA 2AEMA 3A0HE 2NZ2A 2W6JH 2WSCJ 3KZIE 4WY4A 3VTPC 4U3FJ 3H1HE 4Y99C 1SQXJ 3V2RA 1OFCX 3GF7A 4BWNA 3PRJA 2KIKA 2P7JA 3E7KA 4U7JA 5K5GB 1YJ9P 3MUDC 1X79B 4ZKPA 2QA4P 1K9MQ 2WVRA 1N7SA 3V4QA 1JOCA 4N78E 1J1DB 1IK7A 1NTMG 1EDKA 2E75B 2E75D 2HFED 1R5LA 3AEBC 3MP7B 4WY4D 3WUTA 5CBOA 4R4LA 3H1JE 1FZEA 2G8YA 3N7NA 3ABVC 1H89A 4Y28J 1YBKA 2YNYA 3FWLA 1P84H 2HODA 2GUSA 2HYNA 3H1LD 3HUSA 3LIDA 2QM7A 3NFQA 3L72G 4HJGH 1GL2C 4I6MC 1EXJA 1JM0A 4RESB 2KZIA 2YMYA 3OA7A 3V4WA 3RK3E 1NAYA 1Q2NA 1X0TA 2ZXEB 5AW7B 3P7KA 4U3FE 5KLVG 2K1AA 1FC2C 1JY2N 3UIAA 3D71A 1T2KC 1GZLA 2KB7P 1VQ7P 1NYHA 3D70A 1NTZE 1L0NJ 1Z56A 2C9NY 1Q81Q 2B89A 3H32B 1M1KQ 3CX5H 4N3YB 2K9JA 2R5DA 1FU1A 3AE8C 1Y9BA 3QH9A 3AE9C 1OW7A 3HE5B 1FE6A 3A0BH 1CI6A 1LTIC 2IZ0A 3IAOA 1HGVA 4HB1A 2H43A 1KQGB 3M9QA 1A02J 5AVTB 1OVVA 1LWUC 2OYIC 2HPCB 2DW3A 1KFNA 1BE3E 2E76D 1IFIA 1M8OB 4GIFA 1G2CA 1IFMA 2E74C 1NTZD 1URQC 1YTZI 5KLVK 4YXWH 2WT7B 3V2NA 2P1JA 2FXPA 3L70G 1RE4C 2FYUE 1PL5A 1VQ4P 4ZNCA 1PP9G 3CCJP 3H1HG 3SFEC 3CCVP 3D6YA 3O6QB 1RY3A 2O3JA 3RK2C 4WY4B 1ZOYC 1U7JA 1PPJD 5KLVD 1T2KD 1QVGO 2WWWA 4H0LC 4TT3H 3VYIA 1Y47A 3HD7A 4H0LD 1M1JB 4NPEA 3IF4A 2H88C 2J59M 3R2PA 3HTKB 1RQUA 4I1LA 4IL6H 1Q82Q 2KP8A 3OAKA 1RH5B 2R3CA 3AE4C 3L35A 2M8RA 4MN4C 3TNUA 3GHGC 4OWFA 5AVRB 1CZQA 2YKPA 3O8ZA 5KAFE 1M56D 1PPJG 3H1JG 4PJ0H 1NTKJ 4JBZA 1FZGA 4PJ0E 1NKNA 1W2BO 5B5EH 3Q5SA 2KXPB 4H44C 4DCKA 2OYIB 1SFCD 1NTKG 2E75C 2LXCB 2M0BA 2P58A 1MFZA 2QIWA 1OMIA 2PFXA 2LXBA 1U7MA 4JYBA 3TDKA 3USSA 1A02F 1IFDA 3A2AA 3V2QA 1VQLP 2O01H 1GMJA 3HUSB 2M5AB 5APVA 3G71P 4U3FG 3VOPA 2VRSA 2ZYDA 1HTLC 3M0DA 4WBAA 1LTTC 3A7OA 1GW4A 3Q2YA 4QMAA 3WMM0 2HR3A 1SQQG 1VF5C 5AW9B 3F5HA 3H32A 1R5SA 1L4AA 5M1BA 3L73E 2KZJA 1R8EA 1DEEG 1LTAC 1JY3P 1YQ3C 4LGDE 4PD4H 1QLED 1GL2B 3GW6A 3BATA 5KAIE 1N7SD 2QJKB 1CI6B 1SQVD 1IFNA 2H89C 2YXQB 3B5ND 3B5NB 3C1LA 1RF1B 3RL0C 2GM4A 2I1KA 3Q3DA 2ZAEB 3LW5J 4WY4C 3WU2E 1ZV8A 1M90Q 3TYYA 1KORA 1L4AD 1FOSE 1ZMEC 2QSIA 2M3EA 4I2LC 3H25A 2LKMA 2E74B 1S72P 3N4XA 1L0LE 2WPQA 1N8RQ 4IFMA 3V6IA 5B5EE 1T3UA 3RK3B 3TGUJ 1U57A 3HD7B 3Q1MA 3H1IG 4XA4A 1NTZJ 2QG4A 1SP4A 2OQQA 1FZCB 1RF0C 2RKLA 3BRVB 2L91A 1KILD 4WWIA 2MJZA 4IL6E 3H1KE 3WUVA 4WVZA 2K3RA 3TSIA 3CX5I 1BE3D 4JF7A 1S5LX 1D7MA 1KQSO 4C7NB 4H44B 3R4YA 4UB6E 3KYQA 2D2CB 4IL6X 2WSEH 1N73A 2OYIA 2PAJA 4DJGA 5APQA 4DZOA 1EZVD 3CXHE 2E5YA 1AVOA 2BEZF 4I7ZC 3P8CD 4PV1D 1T6AA 1HJ0A 2FYNC 2YIUB 1W2EA 3PP5A 1AJYA 1QVFO 3JSVC 5APXA 1JY3O 1JB0J 2JP3A 3AE5C 2OTLP 3GMAA 4GOEA 1T8ZA 3EFFK 1USDA 3H1IJ 3WUUA 2AEFA 1NU1K 3H1KJ 3MZWB 4N78D 1J1DC 5AVQB 1LTGC 1SQPK 1NKZB 2OTJP 1IJDB 1L4AB 1MZ9A 2H8PD 2QJPC 3AE2C 1VDFA 1PIXA 3NMDA 4HKZH 2IX7C 3CXHD 1JEKA 4JQ0D 2N9YB 4NPFX 5CHXA 1NWQA 1H0TB 1X8YA 3T97A 2HLOA 2NPSB 1SQPD 3CWBD 3L72D 1S5LH 1IK9A 2BCCG 1N73B 3S9OA 1G1JA 5AVUB 4PD4E 3B5NA 2FYUK 2KS1B 2FXOA 3GF3A 1ZRTD 3KXDA 3JCUE 1L0NK 1NTMD 1L0LG 2IYOA 2N9BA 1SQVK 1ZR4A 3MUDA 4IOIH 3GHGB 3PJSK 4AQRD 1SFCA 1RF0A 2IBZI 4CPGA 1IZNB 3CI9A 3MHVA 1J1EB 2D2CD 1PFIA 1XTCC 2N1TC 5GTHE 1HJBA 1NGMB 2FYUG 1PP9E 4HYTB 4JYCA 3P32A 3U59A 1NU1E 1DEBA 2FYZA 2KOGA 1FOSF 1FBMA 2YO2A 3S4RA 2KUBA 1L0NG 1M7LA 1NJIQ 5KTBA 2JKVA 1FS0E 1SQBD 1YTZT 2KK7A 4C7NA 1PZQA 1LT9A 3HD7C 4RKUJ 4C7RA 1BGYG 1W5CE 2KSEA 1SQVE 2O1JA 5AVYB 2E76B 5B66H 1PPJE 3CWBJ 3L72J 1SFCC 2IPPA 4BRYA 1AFOA 1NAFA 1MFTA 1L4AC 1G1IA 1JCDA 2QJYB 4UB8H 3Q5PA 2Z5IA 1KYOI 2RMZA 5KJ7C 1NTKE 1K8AQ 4L73A 2OGUA 1LP1A 3CCUP 1EDLA 1KILE 2ZT9B 2Q9IA 3FWNA 3RL0g 3IR9A 4ZMDA 4K3AA 2ZVNB 3RL0B 2J5UA 3GLMA 5BU8B 1GW3A 4H13C 3CC4P 1S2EA 2W83C 2WSCH 1PP9J 1OX3A 3H1JJ 2BCCE 2IDBA 3LW5H 1H0TA 3PHLA 4KHXA 1S9KD 1VF5D 3FX0A 2NPSA 3L75D 1EXIA 4ASWA
chains in the Genus database with same CATH topology
3HE4A 1URQB 1LTJB 2POHA 1FDMA 5APYA 5APUA 2O1KA 4AYCA 3BRTB 1H88A 2P67A 1N7LA 1T3JA 3GHGA 1FAVA 3HUSC 3I5CA 3L4FA 4XE5B 1KILB 1IO4A 1NTMK 2XU6A 4LLHA 1HWTC 1IC2A 1LTBC 3II6A 2C0WA 2N1TD 1E5WA 5AW0B 3MIWA 1S9KE 1RE3C 2A45H 2CPBA 1LWUA 1J2JB 5CCHA 5AVWB 5CCGC 1NTKK 3P8MC 1N7SB 3LIEA 1GDTA 5AW2B 1NHLA 1NO4A 4GT1A 5AVSB 1FZBA 3RK3D 2FKWB 2IFNA 2ZFCA 2NPSD 3MTUE 4ZKUA 5CCHC 2FFDB 4EOTA 1RE3A 4EIJA 1FZAA 2E43A 5AW4B 3SWYA 2W6BA 1MUUA 2XV5A 1LTJA 2PP6A 2WPSA 3HE5A 3EFGA 3CLQA 3B5NC 1N7SC 2WZ7A 5AVVB 3KPEA 3IFMA 2C0XA 1G2CB 3MD0A 1FJKA 2WT7A 2OARA 1SQQK 2YKOA 2HPCA 2BASA 4W80A 1GK6A 4IFFA 3C9IA 2XNXA 1M1JA 5CCHD 1FZCC 3HTKA 5APWA 2Q5UA 1JY3N 3TNUB 1LWUB 1KILC 2WITA 1SLQA 2YO3A 2CPSA 1LTJC 1XTGB 2JJLA 1GD2E 1RE4A 3BASA 1AQ5A 1JNMA 3L36A 4C46A 3U1CA 2W27A 5KJ7D 3SWFA 1WT6A 1LT9C 2FFDA 3RK2D 4N6JA 3CL3D 2Q3IA 3G3ZA 2FXMA 4W7YA 1HH0A 2N1TA 5APTA 2WTYA 5BU5A 3P8CE 1JTHA 2R5BA 1GL2A 2YKQA 3HD7D 1NH4A 5AW3B 4Y99B 1JUNA 1JO5A 5AW1B 1QL2A 2GUVA 3HRNA 5AW8B 1GL2D 3M0DC 1ZN5A 1FZCA 1M1JC 1FJPA 4WB4A 1L0LK 2R32A 3OJAB 1JY2O 1WRGA 4LC1A 1N2DC 1SVFA 3VMZA 3E1IA 3KQGA 1HGZA 2M3BA 3MGNA 4AUWA 2Q7CA 1H8AA 1IFJA 1SQXK 3A5TA 1GU5A 2OYHA 1CW5A 3V2PA 1HVVA 5CJ4A 1JMMA 2C9LY 2JEEA 3M06A 1NWQA 2Z5HA 1QL1A 3M9BA 2N1TB 3NTNA 4W7ZA 3NXSA 3BVHA 5APSA 1FZFA 3L37A 1RF1C 1ZLLA 1J1EC 1GU4A 1JTHB 3VP9A 1KQLA 1N86A 1YYCA 3A3YB 2A45I 2L5GB 3U1AA 5AVZB 1KZUB 1SFCB 1URQD 5CCGA 3KDPB 3B8EB 2Z4EA 2IFMA 3RK3C 1GTWA 1JY2P 1MV8A 1NTZK 1KFMA 1SQBK 4IFDK 2H7HA 3M9HA 2WPRA 2XDJA 1OWAA 5AW5B 1LT9B 2E42A 2XZRA 2KLVA 5CMZA 3VMYA 5BVZA 1VPCA 2OYHB 2HG5D 1OXZA 1CSBA 2NPSC 1N73C 2A45G 4M3LA 2HODB 3M91A 4DOJA 2FFDC 2XKMA 1RF1A 1EQ7A 1X9VA 3VMXA 5AVXB 5CJ0A 1DH3A 4O9BA 3V5BA 1JCCA 2KYVA 3VP8A 5KJ7A 1ZR2A 2J58A 1LTSC 3HE4B 1URQA 5CCGD 2W6AA 3RL0D 2P2UA 1LGHB 2OYHC 5AW6B 1HBWA 4OH8B 1GK4A 1KILA 3EQ2A 4B86A 2KSJA 1DX7A 4GKGA 2I1JA 1NOHA 4HH2A 3H6PA 3M0AA 3RK2B 4WY4A 3VTPC 4Y99C 3V2RA 2P7JA 1X79B 4ZKPA 1N7SA 3V4QA 1JOCA 4N78E 1J1DB 4WY4D 2HFED 1FZEA 3N7NA 1H89A 2YNYA 2HODA 3HUSA 2GUSA 2HYNA 3LIDA 3NFQA 2QM7A 1GL2C 4I6MC 4RESB 2YMYA 3OA7A 3V4WA 5AW7B 2ZXEB 3P7KA 1T2KC 1JY2N 3UIAA 1GZLA 2KB7P 1Z56A 2C9NY 3H32B 4N3YB 2R5DA 1FU1A 3HE5B 1CI6A 1LTIC 2H43A 1A02J 1HGVA 3M9QA 5AVTB 2OYIC 1LWUC 2HPCB 1KFNA 4GIFA 1IFIA 1G2CA 1IFMA 1URQC 1YTZI 5KLVK 2WT7B 3V2NA 2P1JA 1RE4C 1RY3A 3RK2C 4WY4B 1T2KD 2WWWA 3VYIA 3HD7A 1M1JB 4I1LA 2J59M 3R2PA 3HTKB 3OAKA 2KP8A 3L35A 2R3CA 3TNUA 2M8RA 3GHGC 5AVRB 1CZQA 2YKPA 3O8ZA 1FZGA 1NKNA 2OYIB 1SFCD 2WSFH 3VN0A 1MFZA 4JYBA 1A02F 1IFDA 3A2AA 3V2QA 2O01H 3HUSB 5APVA 3VOPA 2VRSA 1HTLC 3M0DA 4WBAA 1LTTC 3A7OA 1GW4A 3WMM0 5AW9B 3H32A 1L4AA 1LTAC 1JY3P 4LGDE 1GL2B 3BATA 1N7SD 3TK1A 1CI6B 1IFNA 3B5ND 3B5NB 3RL0C 2GM4A 2I1KA 4WY4C 1ZV8A 3TYYA 1L4AD 1FOSE 4I2LC 2LKMA 3N4XA 2WPQA 4IFMA 1T3UA 3RK3B 3HD7B 4XA4A 1SP4A 1FZCB 1RF0C 3BRVB 1KILD 2MJZA 3TSIA 4JF7A 4C7NB 3KYQA 2OYIA 2WSEH 1N73A 2PAJA 5APQA 4DZOA 3P8CD 3PP5A 1W2EA 5APXA 1JY3O 1T8ZA 1NU1K 4N78D 5AVQB 1J1DC 1LTGC 1SQPK 1NKZB 1IJDB 1L4AB 1MZ9A 2H8PD 3NMDA 1VDFA 2IX7C 5CHXA 1X8YA 3T97A 2HLOA 2NPSB 1N73B 1IK9A 1G1JA 5AVUB 3B5NA 2FYUK 1L0NK 2N9BA 1ZR4A 1SQVK 3MUDA 4AQRD 3GHGB 1SFCA 1RF0A 3CI9A 1J1EB 1PFIA 1XTCC 2NPSA 2N1TC 1HJBA 4HYTB 4JYCA 3P32A 3U59A 1DEBA 2FYZA 2KOGA 1FOSF 1FBMA 2YO2A 1M7LA 5KTBA 4C7NA 1YTZT 1LT9A 3HD7C 4C7RA 2O1JA 5AVYB 1SFCC 2IPPA 1AFOA 1NAFA 1L4AC 1G1IA 1JCDA 2Z5IA 5KJ7C 2Q9IA 3IR9A 5BU8B 3RL0B 1GW3A 2WSCH 3LW5H 4KHXA 1S9KD 1HUCA 1RF1B 2QM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WTY A;  3V5B A;  3HE4 A;  3HE4 B;  5APY A;  5APU A;  3TK1 A;  1CI6 B;  2R5B A;  2W6A A;  4AYC A;  2P2U A;  5AW3 B;  1H88 A;  2P67 A;  1JUN A;  3TYY A;  5AW6 B;  1FAV A;  5AVX B;  1FOS E;  1HBW A;  3I5C A;  1GK4 A;  4XE5 B;  5AW1 B;  4I2L C;  4B86 A;  1IO4 A;  4GKG A;  2XU6 A;  1HWT C;  5AW8 B;  2WPQ A;  5AW0 B;  3M0A A;  3VTP C;  1SP4 A;  1S9K E;  2R32 A;  2P7J A;  1J2J B;  5AVW B;  4LC1 A;  4C7N B;  3VMZ A;  3P8M C;  3V4Q A;  3KQG A;  3MGN A;  4AUW A;  3LIE A;  2Q7C A;  1H8A A;  5APQ A;  4DZO A;  3A5T A;  1GU5 A;  5AW2 B;  4GT1 A;  1H89 A;  5AVS B;  2YNY A;  3NFQ A;  5APX A;  2ZFC A;  3LID A;  2C9L Y;  2QM7 A;  1DH3 A;  3M06 A;  4I6M C;  4RES B;  4EOT A;  3V4W A;  1NWQ A;  2Z5H A;  5AVQ B;  5AW7 B;  2ZXE B;  3M9B A;  3P7K A;  3NTN A;  1T2K C;  2E43 A;  3NXS A;  5AW4 B;  3UIA A;  1GZL A;  1MUU A;  3NMD A;  2XV5 A;  5APS A;  3L37 A;  1X8Y A;  3T97 A;  2C9N Y;  2WPS A;  1GU4 A;  3HE5 A;  2R5D A;  5AVU B;  3HE5 B;  1KQL A;  1YYC A;  3A3Y B;  5AVV B;  1CI6 A;  1A02 J;  5AVZ B;  5AVT B;  1G2C B;  3MD0 A;  2N9B A;  2WT7 A;  4AQR D;  2WT7 B;  3KDP B;  2BAS A;  3B8E B;  1GK6 A;  1GTW A;  1MV8 A;  1T2K D;  2WWW A;  1HJB A;  3HTK A;  5APW A;  3VYI A;  2Q5U A;  4HYT B;  4JYC A;  3P32 A;  3M9H A;  2WPR A;  3TNU B;  1FOS F;  2H7H A;  2KP8 A;  3OAK A;  3L35 A;  2YO2 A;  2R3C A;  3TNU A;  1OWA A;  1SLQ A;  5AVR B;  1CZQ A;  2YO3 A;  3O8Z A;  5AW5 B;  4C7N A;  2E42 A;  2XZR A;  2JJL A;  5CMZ A;  5AVY B;  1GD2 E;  3VN0 A;  3VMY A;  1MFZ A;  2IPP A;  4JYB A;  1JNM A;  1NAF A;  3L36 A;  3A2A A;  1A02 F;  4C46 A;  2Z5I A;  1OXZ A;  2W27 A;  1CSB A;  5APV A;  3SWF A;  2VRS A;  4M3L A;  3IR9 A;  3M0D A;  3M91 A;  3A7O A;  2Q3I A;  5AW9 B;  3VMX A;  4KHX A;  1S9K D;  1HUC A;  2QM8 A;  5APT A; 
#chains in the Genus database with same CATH topology
 1SQB E;  3CCL P;  1KB9 D;  2IZ1 A;  1PGO A;  3HE4 A;  2KS1 A;  1URQ B;  1LTJ B;  1X22 A;  2B87 A;  2KNC A;  2POH A;  1FDM A;  1SQQ E;  2AXC A;  5APY A;  4DT0 A;  5APU A;  5KAF H;  2O1K A;  4AYC A;  5GTH H;  3I56 P;  1N73 C;  3BRT B;  1YJN P;  1H88 A;  3WU2 H;  2P67 A;  1N7L A;  2A06 D;  3CCM P;  1T3J A;  2BCC J;  3GHG A;  1FAV A;  4YPC A;  1EZV E;  1BGY D;  3HUS C;  3I5C A;  3L4F A;  4XE5 B;  4L75 A;  5E79 E;  4OGQ C;  1KIL B;  1IO4 A;  3AE3 C;  1L0N D;  1NTM K;  1L0L J;  2XU6 A;  2Y0D A;  3AEE C;  4LLH A;  3SSU A;  1HWT C;  2QRX A;  1YHQ P;  1IC2 A;  1LTB C;  3G9R A;  1SQQ D;  1NU1 G;  2C0W A;  2AXT H;  2N1T D;  1E5W A;  3II6 A;  5AW0 B;  1LJ2 A;  1BCC D;  3CPW O;  1BSH A;  3B4S A;  3MIW A;  3AE7 C;  1S9K E;  1AV1 A;  1FDI A;  1ZRT E;  1RE3 C;  2A45 H;  2CPB A;  3K5B A;  3L75 G;  3VN0 A;  1KB9 E;  1BGY E;  3H1I E;  2IYP A;  4YXD C;  1LWU A;  1TU3 F;  1Y8A A;  1J2J B;  2R3S A;  1SQQ J;  4UB8 E;  3BCC J;  2ZT9 D;  1PGQ A;  2JWA A;  5AVW B;  1NTK K;  5CCG C;  2QE7 H;  3H1L G;  3L71 J;  4A7P A;  5TIS H;  1AA0 A;  1L0L D;  3P8M C;  3H1K G;  1QEX A;  2QM8 A;  4GOD A;  4JPZ B;  2K9Y A;  1N7S B;  2A06 E;  3LIE A;  3H1L J;  3AED C;  3L71 G;  3L71 D;  1VQM P;  1GDT A;  1Q86 Q;  3TF5 A;  5H2F H;  1SS1 A;  5AW2 B;  1NHL A;  1LP1 B;  1NO4 A;  4GT1 A;  5AVS B;  3H1K D;  1YI2 P;  1FZB A;  3RK3 D;  1SQX D;  2FKW B;  2IFN A;  2ZFC A;  3BCC E;  1EDI A;  1P84 E;  1P84 I;  1S3J A;  2NPS D;  2RN0 A;  3CWB G;  1EZV I;  2O01 J;  3MTU E;  1NTM J;  3PTZ A;  5CCH C;  4EOT A;  1RE3 A;  2FFD B;  1SQB G;  1WMK A;  4EIJ A;  1FZA A;  1USE A;  3CXH H;  3RGU A;  1PV3 A;  5AW4 B;  2E43 A;  2WPV B;  3SWY A;  2W6B A;  1MUU A;  2KI7 B;  1PP9 D;  5EFW B;  2PGD A;  2XV5 A;  3CX5 D;  5DJU B;  1LTJ A;  1NU1 D;  2B87 B;  2PP6 A;  5E79 H;  1VQN P;  2WPS A;  3HE5 A;  3EFG A;  1VQ6 P;  4BXL A;  1KV4 A;  3CLQ A;  2V7Q H;  3B5N C;  4H13 B;  2K9J B;  1EZV G;  1N7S C;  1BSN A;  2WZ7 A;  5AVV B;  5L8R J;  3SWK A;  3KPE A;  5B66 E;  3IFM A;  1KN7 A;  2B88 A;  2C0X A;  4OVN F;  1G2C B;  3MD0 A;  1FDO A;  3KZI H;  1FJK A;  2WSE J;  3FXE A;  2WT7 A;  3G6E P;  2ZYG A;  2OAR A;  1SQQ K;  2YKO A;  3CCR P;  2HPC A;  2Q1K A;  4TLF A;  2BAS A;  4D6T D;  3CCE P;  4W80 A;  3O6Q A;  1ZW0 A;  5KLV J;  1GK6 A;  3H1J D;  1HUC A;  1DD4 A;  3L75 E;  1SQB J;  4IFF A;  3L73 J;  3C9I A;  2XNX A;  1M1J A;  3QWO C;  1NVO A;  5CCH D;  1FZC C;  2Y0C A;  3HTK A;  2Q6Q A;  5APW A;  4RJT A;  5KKZ C;  2Q5U A;  1JY3 N;  1BCC J;  2WSF H;  1MKM A;  3TNU B;  3H1L E;  1LWU B;  2K88 A;  5GTI H;  1KIL C;  2WIT A;  2IBZ G;  3AEF C;  3L74 E;  3EWK A;  3AE6 C;  1SLQ A;  4D6T E;  2YO3 A;  2CPS A;  2JDI H;  4L76 A;  2Y9Y A;  1LTJ C;  1BDC A;  1XTG B;  2JJL A;  2P10 A;  3TK1 A;  1BGY J;  1L0N E;  1GD2 E;  1RE4 A;  3BAS A;  1YJW P;  3L70 D;  1IFP A;  1OZH A;  3TGU D;  2QEX P;  1BDD A;  1AQ5 A;  2Y9Z A;  3BCC G;  1YQ4 C;  1JNM A;  4I7Z B;  1DIP A;  3L36 A;  1E79 H;  2M5A A;  4C46 A;  1OW6 A;  1SQV G;  2V7Q J;  3C8V A;  2ZJS E;  3U1C A;  3Q5R A;  4RO0 A;  3ITK A;  3L74 D;  2W27 A;  5KJ7 D;  1VL2 A;  3W68 A;  1WT6 A;  3SWF A;  1LT9 C;  2FFD A;  2D2C C;  2FY8 A;  2XND H;  3RK2 D;  1YIJ P;  2G3A A;  3IN6 A;  4N6J A;  3L74 J;  3CL3 D;  1KYO E;  2Q3I A;  3D6Z A;  1BCC E;  3G3Z A;  2FXM A;  3PH0 A;  4W7Y A;  1HH0 A;  1ZP0 C;  2FYU D;  1AQT A;  2N1T A;  2ZYA A;  3CCS P;  5APT A;  2WTY A;  5BU5 A;  3H1I D;  2O01 N;  3RBX A;  2FYU J;  3P8C E;  1JTH A;  1OIP A;  2R5B A;  1GL2 A;  2JWD A;  4K35 A;  2YKQ A;  3HD7 D;  3CCQ P;  3TGU G;  4KJM A;  1NH4 A;  5AW3 B;  1SQX E;  3BCC D;  3H1H J;  4Y99 B;  2QJP B;  1KQF B;  1JMB A;  4XFJ A;  3SFD C;  1JUN A;  4PV1 C;  1JO5 A;  1SQP J;  3GG2 A;  2PRR A;  5AW1 B;  1QL2 A;  2GUV A;  3HRN A;  4GDO A;  2K37 A;  3ZDM A;  5AW8 B;  1GL2 D;  2JR8 A;  3M0D C;  1K04 A;  3FGA D;  1ZN5 A;  2ITA A;  1P84 D;  1SQP E;  3RBZ A;  2E5T A;  1FZC A;  1KB9 I;  1M1J C;  4D6T G;  2OTK E;  1FJP A;  4H0L B;  4WB4 A;  1ZR2 A;  2FBW C;  1HF9 A;  1L0L K;  3E1R A;  1QX8 A;  2R32 A;  5C39 A;  1NTM E;  3CX5 E;  4EI2 A;  1YIT P;  3F89 A;  3OJA B;  1JY2 O;  1WRG A;  4LC1 A;  1N2D C;  1AVY A;  1SVF A;  3VMZ A;  3E1I A;  3KQG A;  1HGZ A;  4U3F D;  2M3B A;  3MGN A;  5KKZ B;  4AUW A;  2Q7C A;  1H8A A;  3B71 A;  1IFJ A;  3W67 A;  1VQO P;  2E76 C;  1SQX K;  2I8D A;  4L74 A;  2SPZ A;  1DD3 A;  3A5T A;  2W90 A;  1GU5 A;  2A06 G;  2OYH A;  3L71 E;  1CW5 A;  3V2P A;  1HVV A;  2MKV A;  1JMM A;  5CJ4 A;  2R44 A;  1VQP P;  2WSS H;  2C9L Y;  2JEE A;  3M06 A;  3JCU H;  1S4X A;  2QJK C;  1EDJ A;  4UB6 H;  1UII A;  2AXT E;  1QL1 A;  2Z5H A;  4H13 D;  3M9B A;  1BE3 J;  2N1T B;  3NTN A;  4W7Z A;  3NXS A;  3CWB E;  3L72 E;  5KLI B;  1Q7Y Q;  3AEG C;  3CXH I;  2BEQ D;  3T97 B;  4PD4 D;  3S1K A;  3BVH A;  5APS A;  2B9B A;  2Q3E A;  2WMM A;  1FZF A;  3L37 A;  2OYO A;  1ZLL A;  5CBN A;  3TGU E;  2ZT9 C;  1J1E C;  1SQX G;  4YTP C;  1JTH B;  1GU4 A;  3VP9 A;  1KQL A;  2KLU A;  4ASV A;  1PGP A;  3H1H D;  3AEC C;  1N86 A;  1YYC A;  3A3Y B;  2A45 I;  2L5G B;  3U1A A;  4NPD A;  2JO1 A;  1VF5 B;  5AVZ B;  3L70 E;  1KZU B;  1SFC B;  1URQ D;  5H2F E;  4Z1M H;  5CCG A;  2CK3 H;  1RQV A;  2QJY C;  1Q90 D;  1SQP G;  3KDP B;  3CME P;  3B8E B;  2Z4E A;  2IFM A;  3RK3 C;  3KHU A;  1GTW A;  2YMK A;  1JY2 P;  1MV8 A;  1RHZ B;  3FXD A;  3JC2 2;  3G4S P;  1VQ9 P;  1NTZ K;  1VQ5 P;  2NRG A;  1KFM A;  3PLN A;  1M57 D;  5CCH A;  1S1C X;  3CD6 P;  1KYO D;  1SQB K;  1OVU A;  4IFD K;  1KB9 H;  2V4H A;  1LNQ A;  2WPR A;  3M9H A;  3I55 P;  2H7H A;  2AEJ A;  2XDJ A;  1OWA A;  5AW5 B;  1LT9 B;  2FYN B;  1QGK B;  2YIU C;  2E42 A;  2XZR A;  1OW8 A;  3CC7 P;  2IBZ E;  2KLV A;  3A0H H;  3L74 G;  2GA1 A;  5CMZ A;  4BRY B;  4EDF A;  2RH0 A;  4EYY Q;  1K73 Q;  1KTM A;  2YXR B;  3VMY A;  1NTK D;  5BVZ A;  1VPC A;  5KLI C;  5GTI E;  3CMA P;  2UWJ E;  2OYH B;  2E74 D;  2WQY C;  1SQV J;  4PV1 B;  2HG5 D;  2Y0E A;  3AE1 C;  2ZVO B;  1KMI Z;  1OXZ A;  1CSB A;  4OGQ D;  4OGQ B;  1L2P A;  1OVR A;  2NPS C;  4PD4 I;  2A45 G;  5TJH A;  4M3L A;  4D6T J;  1EC5 A;  5TIS E;  1LT1 A;  2BCC D;  2HOD B;  3M91 A;  4DOJ A;  5KAI H;  3OW2 O;  1RF1 C;  3CC2 P;  1ZXG A;  1NU1 J;  2IBZ D;  2XKM A;  3L73 G;  3L73 D;  5DJT B;  4ZKU A;  2FFD C;  1RF1 A;  1KC8 Q;  2QVA A;  1EQ7 A;  1X9V A;  3VMX A;  5AVX B;  5CJ0 A;  5KJ7 A;  1DH3 A;  4O9B A;  1UIX A;  3V5B A;  1JCC A;  2KYV A;  2W8Z A;  4GOF A;  1BCC G;  3L75 J;  4R4M A;  2J58 A;  3VP8 A;  1LTS C;  2ZXX A;  5KLV E;  1S5L E;  3HE4 B;  1VQ8 P;  1URQ A;  1NTZ G;  2KNC B;  5CCG D;  4KT0 J;  2W6A A;  3RL0 D;  2P2U A;  4H44 D;  1LGH B;  2OYH C;  3L70 J;  5AW6 B;  1HBW A;  4OH8 B;  1GK4 A;  1KIL A;  3EQ2 A;  1K05 A;  2WSF J;  2KSJ A;  4B86 A;  1DX7 A;  4GKG A;  2I1J A;  2LR2 A;  1BE3 G;  3VMA A;  1KD1 Q;  3A0B E;  3AEA C;  1KYO H;  1NOH A;  3H6P A;  4HH2 A;  3M0A A;  1VQK P;  3RK2 B;  1PGJ A;  2AEM A;  3A0H E;  2NZ2 A;  2W6J H;  2WSC J;  3KZI E;  4WY4 A;  3VTP C;  4U3F J;  3H1H E;  4Y99 C;  1SQX J;  3V2R A;  1OFC X;  3GF7 A;  4BWN A;  3PRJ A;  2KIK A;  2P7J A;  3E7K A;  4U7J A;  5K5G B;  1YJ9 P;  3MUD C;  1X79 B;  4ZKP A;  2QA4 P;  1K9M Q;  2WVR A;  1N7S A;  3V4Q A;  1JOC A;  4N78 E;  1J1D B;  1IK7 A;  1NTM G;  1EDK A;  2E75 B;  2E75 D;  2HFE D;  1R5L A;  3AEB C;  3MP7 B;  4WY4 D;  3WUT A;  5CBO A;  4R4L A;  3H1J E;  1FZE A;  2G8Y A;  3N7N A;  3ABV C;  1H89 A;  4Y28 J;  1YBK A;  2YNY A;  3FWL A;  1P84 H;  2HOD A;  2GUS A;  2HYN A;  3H1L D;  3HUS A;  3LID A;  2QM7 A;  3NFQ A;  3L72 G;  4HJG H;  1GL2 C;  4I6M C;  1EXJ A;  1JM0 A;  4RES B;  2KZI A;  2YMY A;  3OA7 A;  3V4W A;  3RK3 E;  1NAY A;  1Q2N A;  1X0T A;  2ZXE B;  5AW7 B;  3P7K A;  4U3F E;  5KLV G;  2K1A A;  1FC2 C;  1JY2 N;  3UIA A;  3D71 A;  1T2K C;  1GZL A;  2KB7 P;  1VQ7 P;  1NYH A;  3D70 A;  1NTZ E;  1L0N J;  1Z56 A;  2C9N Y;  1Q81 Q;  2B89 A;  3H32 B;  1M1K Q;  3CX5 H;  4N3Y B;  2K9J A;  2R5D A;  1FU1 A;  3AE8 C;  1Y9B A;  3QH9 A;  3AE9 C;  1OW7 A;  3HE5 B;  1FE6 A;  3A0B H;  1CI6 A;  1LTI C;  2IZ0 A;  3IAO A;  1HGV A;  4HB1 A;  2H43 A;  1KQG B;  3M9Q A;  1A02 J;  5AVT B;  1OVV A;  1LWU C;  2OYI C;  2HPC B;  2DW3 A;  1KFN A;  1BE3 E;  2E76 D;  1IFI A;  1M8O B;  4GIF A;  1G2C A;  1IFM A;  2E74 C;  1NTZ D;  1URQ C;  1YTZ I;  5KLV K;  4YXW H;  2WT7 B;  3V2N A;  2P1J A;  2FXP A;  3L70 G;  1RE4 C;  2FYU E;  1PL5 A;  1VQ4 P;  4ZNC A;  1PP9 G;  3CCJ P;  3H1H G;  3SFE C;  3CCV P;  3D6Y A;  3O6Q B;  1RY3 A;  2O3J A;  3RK2 C;  4WY4 B;  1ZOY C;  1U7J A;  1PPJ D;  5KLV D;  1T2K D;  1QVG O;  2WWW A;  4H0L C;  4TT3 H;  3VYI A;  1Y47 A;  3HD7 A;  4H0L D;  1M1J B;  4NPE A;  3IF4 A;  2H88 C;  2J59 M;  3R2P A;  3HTK B;  1RQU A;  4I1L A;  4IL6 H;  1Q82 Q;  2KP8 A;  3OAK A;  1RH5 B;  2R3C A;  3AE4 C;  3L35 A;  2M8R A;  4MN4 C;  3TNU A;  3GHG C;  4OWF A;  5AVR B;  1CZQ A;  2YKP A;  3O8Z A;  5KAF E;  1M56 D;  1PPJ G;  3H1J G;  4PJ0 H;  1NTK J;  4JBZ A;  1FZG A;  4PJ0 E;  1NKN A;  1W2B O;  5B5E H;  3Q5S A;  2KXP B;  4H44 C;  4DCK A;  2OYI B;  1SFC D;  1NTK G;  2E75 C;  2LXC B;  2M0B A;  2P58 A;  1MFZ A;  2QIW A;  1OMI A;  2PFX A;  2LXB A;  1U7M A;  4JYB A;  3TDK A;  3USS A;  1A02 F;  1IFD A;  3A2A A;  3V2Q A;  1VQL P;  2O01 H;  1GMJ A;  3HUS B;  2M5A B;  5APV A;  3G71 P;  4U3F G;  3VOP A;  2VRS A;  2ZYD A;  1HTL C;  3M0D A;  4WBA A;  1LTT C;  3A7O A;  1GW4 A;  3Q2Y A;  4QMA A;  3WMM 0;  2HR3 A;  1SQQ G;  1VF5 C;  5AW9 B;  3F5H A;  3H32 A;  1R5S A;  1L4A A;  5M1B A;  3L73 E;  2KZJ A;  1R8E A;  1DEE G;  1LTA C;  1JY3 P;  1YQ3 C;  4LGD E;  4PD4 H;  1QLE D;  1GL2 B;  3GW6 A;  3BAT A;  5KAI E;  1N7S D;  2QJK B;  1CI6 B;  1SQV D;  1IFN A;  2H89 C;  2YXQ B;  3B5N D;  3B5N B;  3C1L A;  1RF1 B;  3RL0 C;  2GM4 A;  2I1K A;  3Q3D A;  2ZAE B;  3LW5 J;  4WY4 C;  3WU2 E;  1ZV8 A;  1M90 Q;  3TYY A;  1KOR A;  1L4A D;  1FOS E;  1ZME C;  2QSI A;  2M3E A;  4I2L C;  3H25 A;  2LKM A;  2E74 B;  1S72 P;  3N4X A;  1L0L E;  2WPQ A;  1N8R Q;  4IFM A;  3V6I A;  5B5E E;  1T3U A;  3RK3 B;  3TGU J;  1U57 A;  3HD7 B;  3Q1M A;  3H1I G;  4XA4 A;  1NTZ J;  2QG4 A;  1SP4 A;  2OQQ A;  1FZC B;  1RF0 C;  2RKL A;  3BRV B;  2L91 A;  1KIL D;  4WWI A;  2MJZ A;  4IL6 E;  3H1K E;  3WUV A;  4WVZ A;  2K3R A;  3TSI A;  3CX5 I;  1BE3 D;  4JF7 A;  1S5L X;  1D7M A;  1KQS O;  4C7N B;  4H44 B;  3R4Y A;  4UB6 E;  3KYQ A;  2D2C B;  4IL6 X;  2WSE H;  1N73 A;  2OYI A;  2PAJ A;  4DJG A;  5APQ A;  4DZO A;  1EZV D;  3CXH E;  2E5Y A;  1AVO A;  2BEZ F;  4I7Z C;  3P8C D;  4PV1 D;  1T6A A;  1HJ0 A;  2FYN C;  2YIU B;  1W2E A;  3PP5 A;  1AJY A;  1QVF O;  3JSV C;  5APX A;  1JY3 O;  1JB0 J;  2JP3 A;  3AE5 C;  2OTL P;  3GMA A;  4GOE A;  1T8Z A;  3EFF K;  1USD A;  3H1I J;  3WUU A;  2AEF A;  1NU1 K;  3H1K J;  3MZW B;  4N78 D;  1J1D C;  5AVQ B;  1LTG C;  1SQP K;  1NKZ B;  2OTJ P;  1IJD B;  1L4A B;  1MZ9 A;  2H8P D;  2QJP C;  3AE2 C;  1VDF A;  1PIX A;  3NMD A;  4HKZ H;  2IX7 C;  3CXH D;  1JEK A;  4JQ0 D;  2N9Y B;  4NPF X;  5CHX A;  1NWQ A;  1H0T B;  1X8Y A;  3T97 A;  2HLO A;  2NPS B;  1SQP D;  3CWB D;  3L72 D;  1S5L H;  1IK9 A;  2BCC G;  1N73 B;  3S9O A;  1G1J A;  5AVU B;  4PD4 E;  3B5N A;  2FYU K;  2KS1 B;  2FXO A;  3GF3 A;  1ZRT D;  3KXD A;  3JCU E;  1L0N K;  1NTM D;  1L0L G;  2IYO A;  2N9B A;  1SQV K;  1ZR4 A;  3MUD A;  4IOI H;  3GHG B;  3PJS K;  4AQR D;  1SFC A;  1RF0 A;  2IBZ I;  4CPG A;  1IZN B;  3CI9 A;  3MHV A;  1J1E B;  2D2C D;  1PFI A;  1XTC C;  2N1T C;  5GTH E;  1HJB A;  1NGM B;  2FYU G;  1PP9 E;  4HYT B;  4JYC A;  3P32 A;  3U59 A;  1NU1 E;  1DEB A;  2FYZ A;  2KOG A;  1FOS F;  1FBM A;  2YO2 A;  3S4R A;  2KUB A;  1L0N G;  1M7L A;  1NJI Q;  5KTB A;  2JKV A;  1FS0 E;  1SQB D;  1YTZ T;  2KK7 A;  4C7N A;  1PZQ A;  1LT9 A;  3HD7 C;  4RKU J;  4C7R A;  1BGY G;  1W5C E;  2KSE A;  1SQV E;  2O1J A;  5AVY B;  2E76 B;  5B66 H;  1PPJ E;  3CWB J;  3L72 J;  1SFC C;  2IPP A;  4BRY A;  1AFO A;  1NAF A;  1MFT A;  1L4A C;  1G1I A;  1JCD A;  2QJY B;  4UB8 H;  3Q5P A;  2Z5I A;  1KYO I;  2RMZ A;  5KJ7 C;  1NTK E;  1K8A Q;  4L73 A;  2OGU A;  1LP1 A;  3CCU P;  1EDL A;  1KIL E;  2ZT9 B;  2Q9I A;  3FWN A;  3RL0 g;  3IR9 A;  4ZMD A;  4K3A A;  2ZVN B;  3RL0 B;  2J5U A;  3GLM A;  5BU8 B;  1GW3 A;  4H13 C;  3CC4 P;  1S2E A;  2W83 C;  2WSC H;  1PP9 J;  1OX3 A;  3H1J J;  2BCC E;  2IDB A;  3LW5 H;  1H0T A;  3PHL A;  4KHX A;  1S9K D;  1VF5 D;  3FX0 A;  2NPS A;  3L75 D;  1EXI A;  4ASW A; 
#chains in the Genus database with same CATH homology
 3HE4 A;  1URQ B;  1LTJ B;  2POH A;  1FDM A;  5APY A;  5APU A;  2O1K A;  4AYC A;  3BRT B;  1H88 A;  2P67 A;  1N7L A;  1T3J A;  3GHG A;  1FAV A;  3HUS C;  3I5C A;  3L4F A;  4XE5 B;  1KIL B;  1IO4 A;  1NTM K;  2XU6 A;  4LLH A;  1HWT C;  1IC2 A;  1LTB C;  3II6 A;  2C0W A;  2N1T D;  1E5W A;  5AW0 B;  3MIW A;  1S9K E;  1RE3 C;  2A45 H;  2CPB A;  1LWU A;  1J2J B;  5CCH A;  5AVW B;  5CCG C;  1NTK K;  3P8M C;  1N7S B;  3LIE A;  1GDT A;  5AW2 B;  1NHL A;  1NO4 A;  4GT1 A;  5AVS B;  1FZB A;  3RK3 D;  2FKW B;  2IFN A;  2ZFC A;  2NPS D;  3MTU E;  4ZKU A;  5CCH C;  2FFD B;  4EOT A;  1RE3 A;  4EIJ A;  1FZA A;  2E43 A;  5AW4 B;  3SWY A;  2W6B A;  1MUU A;  2XV5 A;  1LTJ A;  2PP6 A;  2WPS A;  3HE5 A;  3EFG A;  3CLQ A;  3B5N C;  1N7S C;  2WZ7 A;  5AVV B;  3KPE A;  3IFM A;  2C0X A;  1G2C B;  3MD0 A;  1FJK A;  2WT7 A;  2OAR A;  1SQQ K;  2YKO A;  2HPC A;  2BAS A;  4W80 A;  1GK6 A;  4IFF A;  3C9I A;  2XNX A;  1M1J A;  5CCH D;  1FZC C;  3HTK A;  5APW A;  2Q5U A;  1JY3 N;  3TNU B;  1LWU B;  1KIL C;  2WIT A;  1SLQ A;  2YO3 A;  2CPS A;  1LTJ C;  1XTG B;  2JJL A;  1GD2 E;  1RE4 A;  3BAS A;  1AQ5 A;  1JNM A;  3L36 A;  4C46 A;  3U1C A;  2W27 A;  5KJ7 D;  3SWF A;  1WT6 A;  1LT9 C;  2FFD A;  3RK2 D;  4N6J A;  3CL3 D;  2Q3I A;  3G3Z A;  2FXM A;  4W7Y A;  1HH0 A;  2N1T A;  5APT A;  2WTY A;  5BU5 A;  3P8C E;  1JTH A;  2R5B A;  1GL2 A;  2YKQ A;  3HD7 D;  1NH4 A;  5AW3 B;  4Y99 B;  1JUN A;  1JO5 A;  5AW1 B;  1QL2 A;  2GUV A;  3HRN A;  5AW8 B;  1GL2 D;  3M0D C;  1ZN5 A;  1FZC A;  1M1J C;  1FJP A;  4WB4 A;  1L0L K;  2R32 A;  3OJA B;  1JY2 O;  1WRG A;  4LC1 A;  1N2D C;  1SVF A;  3VMZ A;  3E1I A;  3KQG A;  1HGZ A;  2M3B A;  3MGN A;  4AUW A;  2Q7C A;  1H8A A;  1IFJ A;  1SQX K;  3A5T A;  1GU5 A;  2OYH A;  1CW5 A;  3V2P A;  1HVV A;  5CJ4 A;  1JMM A;  2C9L Y;  2JEE A;  3M06 A;  1NWQ A;  2Z5H A;  1QL1 A;  3M9B A;  2N1T B;  3NTN A;  4W7Z A;  3NXS A;  3BVH A;  5APS A;  1FZF A;  3L37 A;  1RF1 C;  1ZLL A;  1J1E C;  1GU4 A;  1JTH B;  3VP9 A;  1KQL A;  1N86 A;  1YYC A;  3A3Y B;  2A45 I;  2L5G B;  3U1A A;  5AVZ B;  1KZU B;  1SFC B;  1URQ D;  5CCG A;  3KDP B;  3B8E B;  2Z4E A;  2IFM A;  3RK3 C;  1GTW A;  1JY2 P;  1MV8 A;  1NTZ K;  1KFM A;  1SQB K;  4IFD K;  2H7H A;  3M9H A;  2WPR A;  2XDJ A;  1OWA A;  5AW5 B;  1LT9 B;  2E42 A;  2XZR A;  2KLV A;  5CMZ A;  3VMY A;  5BVZ A;  1VPC A;  2OYH B;  2HG5 D;  1OXZ A;  1CSB A;  2NPS C;  1N73 C;  2A45 G;  4M3L A;  2HOD B;  3M91 A;  4DOJ A;  2FFD C;  2XKM A;  1RF1 A;  1EQ7 A;  1X9V A;  3VMX A;  5AVX B;  5CJ0 A;  1DH3 A;  4O9B A;  3V5B A;  1JCC A;  2KYV A;  3VP8 A;  5KJ7 A;  1ZR2 A;  2J58 A;  1LTS C;  3HE4 B;  1URQ A;  5CCG D;  2W6A A;  3RL0 D;  2P2U A;  1LGH B;  2OYH C;  5AW6 B;  1HBW A;  4OH8 B;  1GK4 A;  1KIL A;  3EQ2 A;  4B86 A;  2KSJ A;  1DX7 A;  4GKG A;  2I1J A;  1NOH A;  4HH2 A;  3H6P A;  3M0A A;  3RK2 B;  4WY4 A;  3VTP C;  4Y99 C;  3V2R A;  2P7J A;  1X79 B;  4ZKP A;  1N7S A;  3V4Q A;  1JOC A;  4N78 E;  1J1D B;  4WY4 D;  2HFE D;  1FZE A;  3N7N A;  1H89 A;  2YNY A;  2HOD A;  3HUS A;  2GUS A;  2HYN A;  3LID A;  3NFQ A;  2QM7 A;  1GL2 C;  4I6M C;  4RES B;  2YMY A;  3OA7 A;  3V4W A;  5AW7 B;  2ZXE B;  3P7K A;  1T2K C;  1JY2 N;  3UIA A;  1GZL A;  2KB7 P;  1Z56 A;  2C9N Y;  3H32 B;  4N3Y B;  2R5D A;  1FU1 A;  3HE5 B;  1CI6 A;  1LTI C;  2H43 A;  1A02 J;  1HGV A;  3M9Q A;  5AVT B;  2OYI C;  1LWU C;  2HPC B;  1KFN A;  4GIF A;  1IFI A;  1G2C A;  1IFM A;  1URQ C;  1YTZ I;  5KLV K;  2WT7 B;  3V2N A;  2P1J A;  1RE4 C;  1RY3 A;  3RK2 C;  4WY4 B;  1T2K D;  2WWW A;  3VYI A;  3HD7 A;  1M1J B;  4I1L A;  2J59 M;  3R2P A;  3HTK B;  3OAK A;  2KP8 A;  3L35 A;  2R3C A;  3TNU A;  2M8R A;  3GHG C;  5AVR B;  1CZQ A;  2YKP A;  3O8Z A;  1FZG A;  1NKN A;  2OYI B;  1SFC D;  2WSF H;  3VN0 A;  1MFZ A;  4JYB A;  1A02 F;  1IFD A;  3A2A A;  3V2Q A;  2O01 H;  3HUS B;  5APV A;  3VOP A;  2VRS A;  1HTL C;  3M0D A;  4WBA A;  1LTT C;  3A7O A;  1GW4 A;  3WMM 0;  5AW9 B;  3H32 A;  1L4A A;  1LTA C;  1JY3 P;  4LGD E;  1GL2 B;  3BAT A;  1N7S D;  3TK1 A;  1CI6 B;  1IFN A;  3B5N D;  3B5N B;  3RL0 C;  2GM4 A;  2I1K A;  4WY4 C;  1ZV8 A;  3TYY A;  1L4A D;  1FOS E;  4I2L C;  2LKM A;  3N4X A;  2WPQ A;  4IFM A;  1T3U A;  3RK3 B;  3HD7 B;  4XA4 A;  1SP4 A;  1FZC B;  1RF0 C;  3BRV B;  1KIL D;  2MJZ A;  3TSI A;  4JF7 A;  4C7N B;  3KYQ A;  2OYI A;  2WSE H;  1N73 A;  2PAJ A;  5APQ A;  4DZO A;  3P8C D;  3PP5 A;  1W2E A;  5APX A;  1JY3 O;  1T8Z A;  1NU1 K;  4N78 D;  5AVQ B;  1J1D C;  1LTG C;  1SQP K;  1NKZ B;  1IJD B;  1L4A B;  1MZ9 A;  2H8P D;  3NMD A;  1VDF A;  2IX7 C;  5CHX A;  1X8Y A;  3T97 A;  2HLO A;  2NPS B;  1N73 B;  1IK9 A;  1G1J A;  5AVU B;  3B5N A;  2FYU K;  1L0N K;  2N9B A;  1ZR4 A;  1SQV K;  3MUD A;  4AQR D;  3GHG B;  1SFC A;  1RF0 A;  3CI9 A;  1J1E B;  1PFI A;  1XTC C;  2NPS A;  2N1T C;  1HJB A;  4HYT B;  4JYC A;  3P32 A;  3U59 A;  1DEB A;  2FYZ A;  2KOG A;  1FOS F;  1FBM A;  2YO2 A;  1M7L A;  5KTB A;  4C7N A;  1YTZ T;  1LT9 A;  3HD7 C;  4C7R A;  2O1J A;  5AVY B;  1SFC C;  2IPP A;  1AFO A;  1NAF A;  1L4A C;  1G1I A;  1JCD A;  2Z5I A;  5KJ7 C;  2Q9I A;  3IR9 A;  5BU8 B;  3RL0 B;  1GW3 A;  2WSC H;  3LW5 H;  4KHX A;  1S9K D;  1HUC A;  1RF1 B;  2QM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...