1H8CA

Ubx domain from human faf1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
82
Chain Sequence
b'NAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAS-ASSOCIATED FACTOR 1
molecule tags Apoptosis
source organism Homo sapiens
publication title The Ubx Domain: A Widespread Ubiquitin-Like Module
pubmed doi rcsb
total genus 15
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2001-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1h8cA00
4NQKE 4M8NA 2GBMA 1KOTA 3PS6A 2LGYA 2MBBB 3WAPA 1E7UA 2WDTB 2LUEA 1OEYJ 3HM3A 3IHPC 2C9WB 3APDA 3V6EB 1K8RB 4FJVB 5E6PA 3QWZB 1Q1OA 1LFDA 2LASA 4WWPA 3MJWA 4EEWA 3NY5A 4A20A 2UYZB 4BOSC 1YQBA 1WMHA 3SU8X 4JIOU 1WZ0A 5TR5A 2WYQA 1GNUA 4BKSA 2JZ3B 1E5WA 2KDFB 1WZ3A 4MSQB 3LDZE 3M63B 4B9KA 2AEHA 4GB9A 4TKNA 3U7DA 3VDZA 3L13A 4P7IA 4HPLB 4GGQA 2LWPA 4WQOB 1P0RA 1WJ6A 2LD9A 2L8JA 3UIOB 2HTHA 2O6VB 4GDKA 2KFKB 2ZZPB 4LDTD 4RM9A 3EC8A 3RULA 3WANA 2MBQA 2PPHA 2V4LA 3ECIA 2V3SA 3DBHI 4DK5A 2XBBC 3GOEA 1T0YA 2ZCCA 3TIXA 1I42A 3NZSA 4ANUA 3PRMB 2IY1B 2KQ7A 4FJZA 2C5LC 4ANVA 2CR5A 3WIMA 1M94A 4PYZA 2O6VD 5JHAA 3B1LX 1GUAB 4KIKB 4MJSA 2RD0A 4W9FA 5GMVA 4KDLB 1OQYA 2K39A 4HWIB 3HM6X 4ZRJA 1EUVB 3AULA 3Q3JA 4DDGD 2LZ6A 3N32A 5CX3A 3X23A 1WGYA 4IUMB 5CHVC 1WX9A 2MCNB 3TCAA 2C7HA 1XT9B 1P3QU 2CS4A 1J19A 3H1UA 4MGKE 2KTRA 2D3GA 1YIWA 2ZNVB 1UD7A 3P2BA 1S1QB 1GC7A 3JSVB 4KV2A 2MBHA 1U4AA 4EKUA 5L83A 2DZIA 3B0AA 2WWZA 2RR9A 3L08A 2LGXA 2L00B 1R4NI 4ICVA 1E7VA 2L0FA 4IWPA 4GIVA 4DBGA 5C23A 2GBJA 3PGEA 1A5RA 3OJ4B 2KDIA 5JH5C 2HE7A 1MG8A 2YLMA 3L54A 4NNJB 2BYEA 1TTNA 2IO0B 2LI5A 2XK5A 4WAAA 1V2YA 4FHJA 1V86A 4WJOA 1OEYA 4BKSD 4DHJD 4WJPA 1YX6B 2C60A 4LCDE 4AJYB 5FR6A 4F7ZA 4KSKC 4W9KA 2JF5A 3VH3B 2MSED 4GOCA 2DAJA 2K6DB 2KMAA 1TZ1A 2IBIB 3KVFB 3A9JA 3D32A 2O2VA 3UF8A 3BY4B 3SD5A 1IP9A 4KZCA 2FIFA 3DCGA 3GZNI 3VQIA 4DHZE 1E90A 1SGHA 3QHTA 2FCQA 2KJRA 2LVQA 4HCNB 4IM2A 1WIAA 4HXDA 2K8HA 2I1JA 1SE9A 2M17A 4MDKE 5AEKB 1S3SG 4YL8A 3U30A 3U8ZA 3NOBA 3L16A 4FJYA 4ICUA 3KUZA 4I6NB 4HVBA 5EDSA 1UH6A 2I1KA 4K1RB 2V1YA 2ZCBA 1FXTB 3DBRI 2FIDA 5LXIB 1G6JA 1RRBA 4WWNA 2DHZA 2CU1A 1GJZA 3DVNV 5D6JB 2IO1B 3ZNID 2LVOA 3AU5A 3QARA 2C7MB 2K1FA 2KHWB 4FLHA 2OJRA 3DVGY 4OVVA 2JT4B 1ZW7A 3LJ3A 3ZTCA 2R2OA 4K7WA 3S2AA 3VFKA 3PT2B 3KH0A 4I6LB 1X1MA 2M0XA 2OOBB 2NS5A 4HPMB 4BVUC 2XK5B 1UZXB 3TL5A 2EMTA 3ZRCA 4G50A 2KC2A 4JGHB 3NZUA 4AOFA 1HE8A 2BYFA 2CHXA 2DYMA 3JYUA 2M1MA 3JVZX 2MLBA 4MH0E 1LXDA 4MELA 1WGHA 4FHKA 4BBNC 4IM3A 5IAAC 2FNJB 1WGGA 1WM2A 1ZGUB 3VHTC 4WWOA 1WM3A 3CMMB 1TBEA 4E71A 3JSVA 3MTNB 4MM3A 2MA9B 3W1YA 2L76A 3H7PA 2KDEB 3VVWB 1WE6A 1V49A 4FN2A 1IPGA 2JVCA 4X57B 3WAMA 4AUQC 3DPDA 4MSMB 1E8ZA 2D2QA 2N4FA 4GU2A 3VTUA 2KQSA 3O65B 1WXVA 2HJ8A 2GOWA 2REXA 2BF8B 3WALA 3B08A 2KNBA 2MWSB 3ZDTA 3QA8A 3UINB 3DVGX 5AZHA 3H7SA 3AU4A 4NQLB 4IW0A 4BBNF 2G4DB 3ALBA 1ISNA 4K7SA 2M8SA 1WR1A 2NR2A 4G0NB 4A3PA 2IZVB 5AZFA 4RM8A 1BT0A 3ZRFA 4DXAB 2FCMA 5LXHA 3PVLA 4CO7A 5G2NA 1C3TA 1V5OA 1F9JA 1RFAA 1V81A 2LRUA 3MHSD 1AARA 2ZPNA 3VXWA 2IYDB 2N9XA 4NY0A 3A9KB 5KHOA 4BOZB 2ASQA 2G4SA 2VRRB 1WXMA 3I3TB 3L17A 3WA0A 2KFKA 2O6VA 2DZMA 4IWOA 5D7GA 2WX1A 3OLMD 5JHBA 1Q0WB 4XZ4A 5J17A 1EF1A 1L7YA 2BPSA 4GN1A 5LLIA 3ONSA 1QZEA 2K8BA 2KD0A 3A1QB 3IFWB 1IYFA 5D94A 1ZKHA 3T8MA 1R4MI 3QC8B 2UWQA 2EMSA 3T9LA 3N30A 4MGYE 2KWUB 2KK8A 4PS3A 4GDLA 4W9JA 3TJPA 4AP4C 4HLEA 2ZNVC 5AZGA 1LQBA 2Z0EB 3KW5B 3V60A 2DX5B 2NBUA 2KZRA 4GDKB 4PYUA 1V5TA 3PREA 2WX0A 3UQAA 3EFUA 4EZJA 4FA6A 3H9DA 1RAXA 3A4SC 2KWVB 2KLGA 3R7QA 3TBLD 2LVPA 3ENEA 1E8WA 2KJHB 3H7PB 5L95C 1WGRA 5DPSA 4WJNA 2N1VA 4A3OA 5E6NA 3A1QA 2N9PC 3DVNU 4RMAA 4E3CA 3HK0A 5IA7A 1SIFA 2J7QB 3ZNGC 2AWTA 2K6QA 3HHMA 1VCBA 3ZNZB 1YD8U 3WAOA 2KWCA 5DCNA 2KX3A 3KUCB 4HDQA 3ZO5B 2EKEC 3RD2A 3APCA 4JQWC 3ZDMC 2CHZA 1OGWA 5DPRA 1J8CA 2PEAA 2L05A 1UELA 1L2NA 2KXJA 4GSWA 3EHVA 3PHWB 4URKA 4DDID 4XC2A 5DPWA 2PE9A 5JZEB 2BGFA 3QCAA 3VTVA 1WGDA 2LRWA 1CMXB 2DYBA 4OVUA 1J0GA 4N9F4 3APFA 2KMCA 2JPHA 3V61A 3DQVA 3IVFA 1EO6A 2RGFA 3PRPB 1YJ1A 4F8CB 2DZKA 1WR6E 2RSUA 3R66C 4DWFA 3QX1A 4CHKA 1Z5SB 4ZYNA 4B95A 4ANWA 2KFJA 3M3JA 4EFOA 4B6WA 2IO3B 2HD5B 3W1SC 1WXSA 1WX7A 2D07B 3ZTDA 2PJHA 3ZVVA 1YX5B 1WFYA 1V80A 2FUHB 1WXAA 1WY8A 2BKRB 3A9JB 3C0RB 3PV1A 4CYEA 1GG3A 5D2MB 3PLUA 4IC7B 4FADA 1V6EA 3R7RA 2MRPA 2JUOA 2KLCA 4MGIE 3OJ3A 3RT3B 3BINA 1NI2A 3PPAA 4KZ0A 2FAZA 4KSLC 2DENB 2GBKA 2GBRA 5CTRC 3VUXA 5C1ZA 2XEWA 1WH3A 4II3B 4W9HA 1WJUA 2NVUI 3RYTA 2LJ5A 2DYOA 1LM8B 2CHWA 2QHOA 4W9CA 2NPTA 2PE6B 1RLFA 2A5UA 4G11A 2KTRB 2MBOA 3K9OB 5CHWA 5DPTA 3RZFA 2KJ6A 2JZZA 4GDLB 1WJNA 1P98A 2N7DA 2KKCA 2KVRA 4JLCA 4AWJA 3NS8A 3PZDA 4ASWC 4PS8A 1E8YA 3X0WA 3RCZA 4EUTA 1WX8A 4NAWA 3AI5A 3M95A 4KIKA 4MJSB 3ZW3A 3VUYA 2AYOB 2JRHA 3OAWA 4DHJB 4HDOA 3RUIB 1D3ZA 2A4ZA 2JY6A 2KC1A 3EECA 2L7RA 1TGZB 1VD2A 3QJZA 2DZJA 3IG3A 2N7EA 3IBEA 1KLVA 2K25A 3UIPB 3K9PB 5CHFA 2D10A 2BKFA 2JRIB 3CSFA 3QK0A 4EZKA 3M62B 1NBFC 1NDDA 2LGDA 2FCNA 2KX0A 4I6PA 4DHZB 4EZLA 3UQBA 3UGBB 3NHEB 3PTFC 4GXBA 2LXAA 3ZLZA 2DAFA 3ZIMA 2KOXA 3RZWC 3CF6E 2MX2A 3V6CB 4LDTB 2K8CA 4ZRIA 3SHQA 2KN5A 2J0MA 2NCNA 2ZVNA 4KDIC 4GMVA 1C1YB 2NPTB 3ZNHB 3KYCD 5KHQA 2JWZA 4W9EA 2IY0B 2ZVOA 2L0TA 2LXCA 3DBSA 3DDCB 2ZPYA 4HK2A 4NJ7A 2BWES 3ML9A 1GC6A 1EF5A 2Z0DB 3DOWA 3L0WB 2C7NB 1H4RA 3Q3FA 3PSEB 4J6IA 4IWQA 4NAWB 4TQ0A 3N3KB 4E74A 3A9KA 1E8XA 2O2VB 4FULA 2M4NA 3VAWA 2J0KA 3ZKJC 1OTRB 1Q5WB 1WYWB 3H6NA 2AL6A 3A4RA 2G3QB 4AJWA 2ZJDA 4M8MA 4G3XB 4EOYA 5G55A 1H8CA 3QIJA 2MBEA 3QQ8B 4IM0A 4BKGA 3ZUNA 4W9DA 3TMPB 2MW5A 3PHXB 3VTWA 1UBIA 2NBWB 4ZRKA 3R3MA 4F1SA 2Y5BB 2AL3A 3KUDB 4NJ6A 1P1AA 2CKHB 3VUWA 4FBJB 1WF9A 4JL9A 1Y8RC 4K81A 3W1SA 2ZEQA 4IG7B 4K7UA 2MQJA 3KYDD 1WRDB 3QAQA 4W9LA 4ZDVA 2BYVE 2YVCA 3DBLI 4MGZE 1XQQA 3ML8A 3PRZA 4LJPB 4WJQA 2BWFA 2JXXA 1Z2MA 3AXCA 2D11A 2W9NA 4HCPB 1WJ4A 3CSTA 3HIZA 4PS7A 1V9JA 1UGMA 2N1WA 2N9EB 3JW0X 4TV3A 3SDLC 4BFRA 3PLVA 1WMHB 4NPNA 2RPQA 1WE7A 2Z59B 2B3AA 4XX5A 1UBQA 2R2QA 3A33B 2KTFA 4ANXA 4LJOB 2IO2B 2GBNA 1WI0A 5E6OA 1P9DU 2KDBA 2G45B 2L3ZA 4HJKA 4M0WB 4BKTA 2J0JA 4W9IA 5J18A 1I35A 2NBVB 3VH4B 4W9GA 1KJTA 2KO3A 3L10B 5HKHA 4TQ1A 2MP2B 2GMIC 4TUUA 5BO4B 5J2RA 1KM7A 4II2B 1XD3B 4MEMA 1JRUA 1PQSA 3V62A 2MP2A 4KVGB 2KANA 2FCSA
chains in the Genus database with same CATH superfamily
2GLSA 2V9HA 2JQRB 3WAPA 2MBBB 2LHDA 2WDTB 3V6EB 2D3CA 3TSSA 3B2FA 1NVID 3MJWA 4A90A 3HRDD 4EEWA 4P16A 1TKGA 1TY2A 3SU8X 4BKSA 1HZ5A 3BVMA 2XN9C 3U7DA 3GB1A 4P7IA 4HPLB 4GGQA 4H2AA 4GDKA 1K52A 2MBQA 4QAYA 4TMAB 3DBHI 4DK5A 1T0YA 3TIXA 1HXYD 3NZSA 2NMQA 1HA5A 1QKZA 2KQ7A 4FJZA 1OQQA 5C2TB 4DXFA 3B1LX 1GUAB 4W9FA 5GMVA 2K39A 5HI1A 2MHJA 3N32A 2WGSA 1AN8A 3TEXA 1SBBB 4A55A 2MCNB 2C7HA 1XT9B 1P3QU 2Y3AA 1J19A 3H1UA 1FNWA 1UD7A 3P2BA 4LLGM 4XYCA 1U4AA 4EKUA 2RDGA 3AEFB 3B0AA 3W5VB 2RR9A 3VRAB 5C23A 3PGEA 3P1MA 5JH5C 4ACFA 2HE7A 4C4VB 2WXOA 4NNJB 2BYEA 2EKIA 2XK5A 4WAAA 3EUB2 4C56C 2N7JA 4F7ZA 1AYFA 1PDXA 4UDUC 4GOCA 2K6DB 4KKJA 3LB8C 1IP9A 2FIFA 1E90A 3QHTA 4IM2A 2FCQA 2KJRA 3Q2AC 3N20C 4HXDA 1QILA 3H8HA 4WH4A 5E6JA 3DHIC 2BQQA 3N1ZC 1FXIA 3KUZA 4I6NB 4HVBA 2JX5A 3AE3B 1FXTB 1G6JA 1UWXA 1CQVA 3PZ7A 1N63A 1ZE3D 5EE1A 5D6JB 1TKEA 1XLOA 2H89B 3Q69A 2NTTA 3DBLB 3C19A 3U4EG 3ZTCA 3LJ3A 3S2AA 2KYWA 3VFKA 5I4DA 1FFVA 1ROEA 2OOBB 2XK5B 3TL5A 3ZRCA 4ZHPA 1E7PB 2OEDA 4JGHB 4C4VA 3NZUA 2CHXA 4YTNB 2M1MA 4PK1A 4MELA 1WM3A 4E71A 1V1PB 2I2YA 3W1YA 3H7PA 2KDEB 1KRHA 2JVCA 4X57B 3I63C 3WAMA 1JALA 4AUQC 1WSPA 2N4FA 3VTUA 1FO4A 2REXA 3B08A 2MWSB 3AEDB 1XLNA 5AZHA 4BBNF 4BZAA 1WR1A 2NR2A 2IZVB 4RM8A 5LXHA 2FCMA 5D3IB 3PVLA 1C3TA 2IGDA 1F9JA 3VXWA 4HPPA 4BOZB 2ASQA 1YJIA 2O6VA 3KLSX 3ZYYX 2V0GA 1JRPA 3FC4A 2KD0A 4LNKA 2JWUA 1IYFA 1FCCC 2VH2A 5D94A 2WXHA 1R4NB 2UWQA 1YQ4B 2KK8A 4PS3A 4W9JA 4AP4C 2E6XA 1EU3A 3R8BA 2Z0EB 1YOVB 2DBYA 1XLPA 2DX5B 1BMLC 3DWGC 2NBUA 1ZXIA 4PYUA 4XWWA 3EFUA 3A4SC 3R7QA 1E8WA 2KDMA 2KJHB 5L95C 2PTLA 1JQ4A 1YMHE 4WJNA 4DQOC 5E6NA 4E3CA 4OZBA 5IA7A 1MVKA 3AN1A 2J7QB 2K6QA 1GB4A 1YD8U 4OZAA 1WYGA 1TJEA 2GRIA 4HDQA 3NRZA 2KWDA 3APCA 4JQWC 1OGWA 3P4RB 5DPRA 5D3DA 1UELA 2CU3A 3AEEB 2KXJA 1RFKA 3W9CB 2ICIA 4XC2A 2BGFA 3NS1A 1JWUD 1CMXB 3DQVA 1JROA 1YN4A 3IVFA 3DBHB 2DZKA 1WR6E 4DWFA 1ENFA 1L6VA 2KFJA 2WXGA 3BWUD 2IO3B 2HD5B 4HROA 1WXSA 3W1SC 2PJHA 1ZOYB 3ZVVA 1SE3A 1WFYA 1V80A 1VZ6A 1WXAA 5EE3A 3A9JB 2INPE 1XEEA 1GG3A 1QOGA 2JXTA 3R7RA 2KLCA 1QOBA 3RT3B 4KZ0A 3PPAA 2EELA 3VUXA 5HG2A 3NJTA 1WH3A 4II3B 2LJ5A 2DYOA 2CHWA 2QHOA 1MPEA 2NPTA 2PE6B 1RLFA 4G11A 2JZZA 1P98A 3ETRA 5FR3A 3PZDA 4PS8A 2WXFA 1E8YA 2XNAC 3RN9C 4EUTA 3SFEB 3P4PB 1SE4A 4KIKA 3ZW3A 1F52A 3OAWA 4DHJB 4HDOA 1ZP0B 3FILA 2KVZA 3IG3A 2Y5PA 5H8YE 4EZKA 4USAA 2LGDA 4C7YA 3UQBA 3NHEB 3ZLZA 5BYQA 5C3JB 3RZWC 3KYCD 2WDQB 1F0ZA 3DBSA 3DDCB 3Q3FA 4J6IA 1C76A 4NAWB 2W54A 4TQ0A 3N3KB 3ZKJC 2IGGA 3W5UB 1A70A 2ZJDA 4M8MA 1QT9A 4ARCA 2MBEA 3ZUNA 1GB1A 1SSNA 2MW5A 3PHXB 4ZRKA 1P1AA 2V3PA 3NZ3A 2I38A 3VUWA 1WF9A 2DLBA 3W1SA 4IG7B 5T8IA 3DBLI 3ML8A 3PRZA 2BWFA 1Q10A 1NEKB 2JSVX 2W9NA 1I4HA 1WJ4A 3HIZA 3Q6BA 4PS7A 1UGMA 2QIEB 4TV3A 3SDLC 1UBQA 2K0PA 4XWTA 3TUOA 2IO2B 1J7BA 5E6OA 3AB5A 1P9DU 2INNE 1I35A 2BS3B 3P4SB 4W9GA 1KJTA 4TQ1A 1NI3A 3N1XC 1CJEA 2KN4A 2VZKB 4II2B 1XD3B 1C4CA 4MEMA 1QOAA 3V62A 2MP2A 2D10A 4IDIA 1TY0A 1KOTA 1K50A 1UNSA 2LGYA 2E3TA 2TSSA 1OEYJ 3IHPC 2C9WB 2WLBA 4FJVB 3QWZB 1Q1OA 4YTPB 3NY5A 4A20A 2UYZB 3AEGB 1P7EA 2WXMA 1V1OA 5TR5A 1SJED 3U52E 1E5WA 2KDFB 1WZ3A 3M63B 4GB9A 3GE3C 3VDZA 3L13A 2KMMA 4ZHOA 4JE3B 2KFKB 3AH7A 4LDTD 3Q8CA 4RM9A 1ET6A 3WANA 3ECIA 2V4LA 4NJCA 1I42A 2K5PA 2IY1B 4ANVA 4YWGG 4PYZA 3IT4B 4BAXA 4MJSA 1ZDXA 4HWIB 2W3RA 4KGSA 3Q3JA 3IXSA 2VH1A 2L1AA 1GC7A 2DZIA 3ZJTA 1R4NI 1FIQA 4DBGA 1A5RA 3OJ4B 3L54A 2IPKD 3NVWA 3R2IA 2LI5A 4FHJA 2M56B 4DHJD 4LCDE 2RDHA 4AJYB 1D5MC 3VH3B 2MSED 1UUPA 2Q5WD 3OG5A 2IBIB 1XF5L 2LMCA 2WP9B 4A8XC 1QOFA 3UF8A 4N6EB 5MPOA 2QSDA 2LVQA 1L6UA 1WIAA 2K8HA 2I1JA 2M17A 1S3SG 3U30A 3Q3NC 5G5GA 3WCQA 3NOBA 4US8A 2OHFA 3RNFC 2I1KA 4K1RB 2V1YA 1JCKB 1BUIC 1P7FA 1ZXHA 1RRBA 2DHZA 4S0RA 3DVNV 3AU5A 2C7MB 4US9A 4RH6A 4FLHA 4YT0B 3DVGY 4K7WA 1F2RC 2WS3B 3KH0A 4I6LB 4HPMB 2EMTA 2KAJA 4G50A 3BK2A 1F1HA 4AOFA 4NAMA 3AE7B 1AWDA 4IM3A 1ZGUB 3VHTC 4FXCA 5GXGB 3JSVA 4MM3A 1YNTE 3VVWB 1SB3C 3SR6A 3DPDA 3ZXVA 2D2QA 3AV8A 4P6VF 2HJ8A 3WALA 3ZDTA 3UI3A 1E6EB 1XCTL 3DWMA 3H7SA 3AU4A 4JWSC 4IW0A 1T0SC 5BYSA 2QILA 2OJWA 4G0NB 4A3PA 5AZFA 3ZRFA 5G2NA 1V5OA 2LRUA 2ZPNA 1ZPSA 4NY0A 4RF1A 3DBRB 1R7SA 2G4SA 3BYTB 2VRRB 3L17A 2M19A 2KFKA 2DZMA 4IWOA 3RNGC 5LLIA 3ONSA 4N59A 3Q8AA 4ARIA 1F77A 1KTKA 3IFWB 1AW7A 3ZJUA 2K3UA 1C4AA 3QC8B 1KF6B 2KWUB 4HLEA 1LQBA 3V60A 1PFDA 3PREA 2BB6A 3H9DA 2KLGA 1HQRD 2LVPA 3ENEA 2KACA 3Q14C 3IAS1 2N1VA 2BS4B 3AMZA 4RMAA 1VCBA 1T5XD 4HRSA 1TKYA 5IOIA 5DCNA 3KUCB 3ZO5B 2CHZA 2WHIA 1IUEA 1J8CA 2PEAA 2L05A 3BIID 2KT7A 3PHWB 1UF0A 3GE8C 5DPWA 3VTVA 1ZDVA 2LRWA 3AE4B 2DYBA 3APFA 1J7CA 2YEPB 2BTEA 2RGFA 2LJIA 4KX6B 1Z5SB 4ZYNA 3FILB 2ZW0A 4XE0A 2D07B 2INDC 1T0QC 1J7AA 2ACZB 4CQNA 1YN5A 2SEBD 3EGRA 4IC7B 1V6EA 4WIPA 2JUOA 4M00A 4KSLC 2DENB 2GBKA 4MH8A 2GBRA 3RYTA 2RMMA 1VJKA 1NYRA 2KTRB 5DPTA 3RZFA 1WJNA 4C7ZA 4JLCA 1CZPA 3IT6B 4DXGA 1WWTA 3X0WA 3RCZA 4NAWA 3M95A 1L4DB 2HTME 4RGTA 3V3XA 2AYOB 2JRHA 5AUKA 2HJ1A 5AUIA 1WGKA 1VD2A 1SE2A 2DZJA 2N9KA 4RF0A 2N7EA 1FXAA 5LNK1 2BKFA 3QK0A 3M62B 1FRRA 4DHZB 4GXBA 3LXFA 4AQ7A 2KOXA 4S17A 3V6CB 4OVZA 2KN5A 2NCNA 3ZNHB 4GMVA 3HVDA 2PIAA 3ZQ4A 4W9EA 2DWQA 2LXCA 1TS4A 4ZRPA 1FFUA 2ZPYA 3AE6B 4HK2A 4NJ7A 3ML9A 1EF5A 3DOWA 3L0WB 1SXTA 2C7NB 3PSEB 3B9JA 1LGRA 3A9KA 3BVGA 2M4NA 1OTRB 2ONQA 1WYWB 3H6NA 2AL6A 4AJWA 4EOYA 5G55A 1XXGA 4W9DA 3VTWA 2NBWB 3R3MA 3KUDB 2AL3A 4NJ6A 2CKHB 1F2RI 2BB5A 3KYDD 5BYRA 2JYTA 2YVCA 2JXXA 3ZJVA 2D11A 4HCPB 4JWUC 2QJLA 1FRDA 3CSTA 3P4QB 2N1WA 2N9EB 3GZNB 2B76B 4NPNA 4XDCA 2Z59B 4NZLB 4XX5A 2ON8A 1LO5D 4ANXA 2FBWB 1PYWD 4HJKA 2KDBA 2G45B 2L3ZA 2WU2B 4W9IA 2NBVB 4M01A 2DNFA 5HKHA 2GMIC 4TUUA 1B1ZA 2JZPA 1PQSA 2AQ2B 2V4IB 2PKOA 2ZW1A 1OFFA 3CWIA 4M8NA 2LUEA 1K8RB 1FNVA 5E6PA 1LFDA 4WWPA 4BOSC 2D3BA 4K3CA 5FKAC 2MJ3A 2AQ3B 2RPVA 2LFIA 2JZ3B 2AX5A 3LDZE 4TKNA 3FKYA 2LUMA 1VLBA 5J2RA 3UIOB 1P0RA 2LD9A 1YJJA 2L8JA 2O6VB 2QC8A 2ZZPB 3EC8A 3RULA 3RNEC 4RFBA 1D5ZC 2XBBC 4ANUA 3AE2B 4RGOS 3PRMB 4LTUA 1T3QA 3PZ8A 2CR5A 1D5XC 3WIMA 1N61A 3Q8EA 3MHZA 4KIKB 2R61A 2UU7A 1OQYA 3HM6X 4ZRJA 1EUVB 2PW9A 5BMHA 4DDGD 1IGCA 3X23A 4IUMB 5CHVC 3TCAA 1VZ8A 2CS4A 5IN7A 3KWVA 4MGKE 2D3GA 1YIWA 1ACCA 3ZGZA 1V1PA 4KV2A 3L08A 2WWZA 1CK1A 4GIVA 2GBJA 2WXKA 2M0AA 1MG8A 2IO0B 1V2YA 1V86A 4WJOA 1OEYA 3NVVA 1VRAB 4KSKC 2JF5A 1ZUD2 2DAJA 2KMAA 5HHDG 1R4MB 3KVFB 2YEPF 3U7ZA 3A9JA 3D32A 3SD5A 4KZCA 3VQIA 3DCGA 4DHZE 1SGHA 4HCNB 1KLUD 1SE9A 3O13A 5AEKB 1D6EC 1STEA 3U8ZA 2QCZA 3L16A 4FJYA 1DOXA 1GAQB 4K3BA 5EDSA 1QF6A 2FIDA 5LXIB 4WWNA 3MC0B 3ZNID 2IO1B 4D2KA 2LVOA 2NTSA 4OVVA 2JT4B 1ZW7A 4OZCA 5FK9C 3W2DA 1SJHD 1X1MA 2M0XA 2NS5A 1L0XB 1PGAA 3LYYA 2MLBA 4MH0E 1LXDA 4FHKA 4BBNC 1N60A 1T6BX 3KQ4A 1WM2A 3MP9A 3CMMB 1TBEA 3MTNB 2MA9B 1ET9A 1WE6A 4FN2A 1L0VB 3BVZA 3P63A 4MSMB 1E8ZA 4GU2A 1WXVA 3DHHC 2GOWA 3N9YC 1FD6A 2WNMA 1YQ3B 1I4XA 3N1YC 2G4DB 3ALBA 2PVGC 1IGDA 1VZ7A 4GLSC 4DXAB 1V81A 1RFAA 3MHSD 1AARA 1PUTA 3MC8A 2IYDB 2QEJC 2N9XA 3V05A 3PO0A 1WXMA 3WA0A 5D7GA 1I4GA 2WX1A 3OLMD 1Q0WB 4XZ4A 1TIFA 1EF1A 2BPSA 1QZEA 2K8BA 2IGHA 1RM6C 3T8MA 2EMSA 1SEBD 3T9LA 3P42A 4MGYE 3IAM1 2ZNVC 5AZGA 1SIJA 4GDKB 1WXQA 1V8CA 4C80A 2WX0A 3UQAA 4EZJA 1QQRA 1RAXA 5HFYA 3OWEB 2KWVB 3TBLD 1N5XA 4YXDB 3H7PB 1WGRA 4B0EA 4REZA 4YSZB 3A1QA 2N9PC 1SF0A 3HK0A 4J3OD 1E10A 3BYYB 3HUIA 2AWTA 3MFGA 2IJ0A 2KWCA 3C8YA 5TSSA 2WXJA 1PGBA 2FE8A 2BW2A 1MFWA 2MJDA 1L2NA 1RYJA 2L52A 2SAKA 4C00A 4GSWA 3EHVA 4URKA 5EE9A 4YSXB 3RNBC 3QCAA 3NVZA 1J0GA 1FM0D 2JPHA 2G9HD 2MJEA 3V61A 3PRPB 4F8CB 3RPFC 3QX1A 1JWAD 4CHKA 3BK1A 3RFZB 4EFOA 3RMKC 1YX5B 3URYA 4JX1C 4CYEA 5D2MB 3PLUA 4FADA 2MRPA 4WWMA 1NI2A 1C79A 2FAZA 2CJOA 4ZYSA 4KKIA 2XEWA 1WJUA 4LNFA 3ZXRA 2A5UA 2LGIA 3K9OB 4A6QA 4GDLB 2PVOD 2N7DA 4LNIA 4AWJA 2Y5CA 2PLPA 3AI5A 4YTMB 2K22A 3VUYA 1EWCA 3RUIB 3HVZA 1L4ZB 1JWSD 2A4ZA 3EECA 2KC1A 4IKGA 3IBEA 2G1EA 2WDVB 1VR9A 3K9PB 1N6ZA 4IOIE 1K51A 1NBFC 2FCNA 2KX0A 4I6PA 4XGAB 3PTFC 2LXAA 1FCLA 2DAFA 3ZIMA 3ABVB 2MX2A 1TT5B 1WRIA 4LDTB 4O1NA 2J0MA 4KGTA 2JWZA 3AE8B 2IY0B 3Q8BA 2L0TA 1I4QA 2WXPA 2LEKA 3E9SA 2BWES 1GC6A 2Z0DB 1H4RA 5IO9A 4IWQA 4EE2A 4OHJA 1E8XA 2O2VB 3NUHB 2J0KA 3E56A 1Q5WB 4PT5A 4Q2JA 2G3QB 4G3XB 3RI7C 3QQ8B 3AM9A 4MT5A 3CIRB 4FBJB 4K81A 4K7UA 2MQJA 3QAQA 4W9LA 2BYVE 4MGZE 4WJQA 4LJPB 1M4VA 3AXCA 2KQ4X 1E9MA 3PLVA 1WE7A 2R2QA 5G5HA 2KTFA 3AEAB 2GBNA 1TS2A 2WXIA 4M0WB 4BKTA 2WXQA 2J0JA 5J18A 3VH4B 3MJ5A 3L10B 1MJDA 1FNUA 1IBXA 2V3NA 3NG0A 1DGJA 1JRUA 4ITKA 2CJNA 2KANA 2FCSA 4NQKE 4RCOA 2GBMA 2RDBC 3PS6A 1E7UA 3HM3A 3APDA 3B2GA 2LASA 1YQBA 1WMHA 4JIOU 1WZ0A 2WYQA 1GNUA 2X38A 4MSQB 3U2SC 4B9KA 2AEHA 3AEBB 3Q3MC 1K53A 4WQOB 2LWPA 1WJ6A 2HTHA 1EM7A 2N9LA 2PPHA 2V3SA 1MHHE 3GOEA 2ZCCA 1DYQA 2C5LC 1FEHA 3AE9B 4B0MA 1M94A 1MI0A 2O6VD 1N5WA 5JHAA 2RD0A 4KDLB 2D5GA 3AULA 5H92C 2LZ6A 5CX3A 1WGYA 4RGNA 1OQRA 3I9V1 1WX9A 3RNCC 1T0RC 4A9AA 1JW9D 2KTRA 2BBCA 2ZNVB 1S1QB 1E0ZA 3JSVB 1N62A 2MBHA 5L83A 1DOIA 2LGXA 2L00B 4ICVA 1E7VA 2L0FA 4IWPA 3SFDB 1QLBB 2MH7A 2KDIA 1JWBD 4HKZE 2YLMA 3T3NA 1TTNA 4R3DA 1D4BA 4BKSD 4WJPA 1YX6B 2C60A 5FR6A 4W9KA 2HDEA 4XDDA 1TZ1A 2D3AA 2X8XX 2O2VA 3BY4B 1UGJA 3GZNI 1C78A 4MDKE 4YL8A 1C4PA 4ICUA 3VRBB 2JYEA 1UH6A 1TS5A 2ZCBA 3DBRI 3DHGC 1KLGD 2CU1A 1FPYA 1GJZA 3QARA 2K1FA 2KHWB 4P1CC 3GS2A 2OJRA 2R2OA 1NYQA 2BS2B 3PT2B 3AECB 1MHXA 4BVUC 1UZXB 2KC2A 1RWSA 2QMTA 4ZOHC 4RGMA 1HE8A 2BYFA 2DYMA 3JYUA 3JVZX 1WGHA 1EWYC 5IAAC 4RNAA 2FNJB 1WGGA 2J53A 4WWOA 2L76A 1V49A 1IPGA 1BXTA 4OW0A 2JU6X 2KQSA 3O65B 2BF8B 2KNBA 3QA8A 3UINB 3DVGX 4NQLB 1ISNA 4K7SA 2WQYB 2M8SA 1ESFA 3VR9B 1BT0A 4YSYB 2IDYA 4CO7A 2W3SA 2MEKA 2N0SB 5KHOA 3A9KB 2FUG1 2W55A 4MM3B 3SEBA 2BYTA 4TSSA 3I3TB 1FMAD 4KGRA 5JHBA 5J17A 1L7YA 1HTQA 4GN1A 2WDRB 3A1QB 4JPSA 4ZRQA 1EU4A 2W82A 1C77A 3BZDB 1ZKHA 1R4MI 5IKCM 3N30A 2WXRA 4GDLA 3TJPA 1TS3A 1XLQA 2QDFA 3KW5B 2KZRA 1V5TA 1GPXA 1V97A 4FA6A 3L4PA 5DPSA 4HJGE 2J42A 4A3OA 1I4PA 3DVNU 3FAHA 1SIFA 3ZNGC 2L32A 1VDVA 3HHMA 3ZNZB 1L5PA 3WAOA 2K9XA 2KX3A 1HTOA 4N58A 3NVYA 2EKEC 3RD2A 3ZDMC 4M02A 1XCQL 4DDID 5IP4D 4MACA 1B9RA 2PE9A 5JZEB 1TZOA 1WGDA 4OVUA 4N9F4 2GI9A 2KMCA 2LGSA 4L23A 4M0WA 1KH0A 1EO6A 1YJ1A 1MG4A 2RSUA 3R66C 3RNAC 3EFCA 4B95A 1L0YB 4ANWA 3M3JA 4B6WA 1WX7A 3ZTDA 2FUHB 1GOZA 1WY8A 2BKRB 3PV1A 3C0RB 2J4XA 4AS1A 1TYGB 3EA6A 4HKQA 4MGIE 3OJ3A 3I57A 3BINA 3J9CA 3MC9A 4L2YA 5CTRC 5C1ZA 1PGXA 4W9HA 2NVUI 2WU5B 1LM8B 2GB1A 4W9CA 2BT6A 2MBOA 5CHWA 1NENB 2KJ6A 5BMIA 2KKCA 2KVRA 3NS8A 4ASWC 3KWLA 1WX8A 4MJSB 4WURA 1D3ZA 2J52A 2JY6A 2L7RA 1TGZB 3QJZA 3TEYA 3T3OA 3TEZA 1KLVA 2K25A 3UIPB 2AQ1B 5CHFA 2JRIB 3CSFA 1NDDA 3TEWA 4EZLA 1HZ6A 2BVCA 3UGBB 5JXVA 2L83A 3R2TA 1HEZE 1IBXB 1JWMD 3CF6E 2INCC 2K8CA 4ZRIA 3SHQA 2H88B 2ZVNA 3AE5B 4KDIC 5KHQA 1C1YB 2NPTB 2ZVOA 1KFYB 3GP7A 4HEA1 4LNOA 4E74A 5EE0A 5BMGA 4FULA 3VAWA 4P1BC 4WQMA 3A4RA 1H8CA 3QIJA 4IM0A 4BKGA 3TMPB 2Z8LA 1JMLA 1UBIA 4F1SA 2Y5BB 4L1BA 4JL9A 1Y8RC 1YN3A 2ZEQA 1WRDB 4ZDVA 2WXNA 1XQQA 2PMVA 1Y56A 1Z2MA 1DOYA 1C9FA 1V9JA 3JW0X 4BFRA 1WMHB 4WAFA 2RPQA 1XO3A 2B3AA 1I7HA 2VZKD 3A33B 2WXLA 3I5JC 3Q8FA 4LJOB 1UWMA 3VR8B 1WI0A 2LHEA 3AE1B 2KO3A 3Q3OC 2MP2B 5BO4B 1KM7A 4LNNA 1I4RA 4KVGB 4LK0M
chains in the Genus database with same CATH topology
4NQKE 4M8NA 2GBMA 1KOTA 3PS6A 2LGYA 2MBBB 3WAPA 1E7UA 2WDTB 2LUEA 1OEYJ 3HM3A 3IHPC 2C9WB 3APDA 3V6EB 1K8RB 4FJVB 5E6PA 3QWZB 1Q1OA 1LFDA 2LASA 4WWPA 3MJWA 4EEWA 3NY5A 4A20A 2UYZB 4BOSC 1YQBA 1WMHA 3SU8X 4JIOU 1WZ0A 5TR5A 2WYQA 1GNUA 4BKSA 2JZ3B 1E5WA 2KDFB 1WZ3A 4MSQB 3LDZE 3M63B 4B9KA 2AEHA 4GB9A 4TKNA 3U7DA 3VDZA 3L13A 4P7IA 4HPLB 4GGQA 2LWPA 4WQOB 1P0RA 1WJ6A 2LD9A 2L8JA 3UIOB 2HTHA 2O6VB 4GDKA 2KFKB 2ZZPB 4LDTD 4RM9A 3EC8A 3RULA 3WANA 2MBQA 2PPHA 2V4LA 3ECIA 2V3SA 3DBHI 4DK5A 2XBBC 3GOEA 1T0YA 2ZCCA 3TIXA 1I42A 3NZSA 4ANUA 3PRMB 2IY1B 2KQ7A 4FJZA 2C5LC 4ANVA 2CR5A 3WIMA 1M94A 4PYZA 2O6VD 5JHAA 3B1LX 1GUAB 4KIKB 4MJSA 2RD0A 4W9FA 5GMVA 4KDLB 1OQYA 2K39A 4HWIB 3HM6X 4ZRJA 1EUVB 3AULA 3Q3JA 4DDGD 2LZ6A 3N32A 5CX3A 3X23A 1WGYA 4IUMB 5CHVC 1WX9A 2MCNB 3TCAA 2C7HA 1XT9B 1P3QU 2CS4A 1J19A 3H1UA 4MGKE 2KTRA 2D3GA 1YIWA 2ZNVB 1UD7A 3P2BA 1S1QB 1GC7A 3JSVB 4KV2A 2MBHA 1U4AA 4EKUA 5L83A 2DZIA 3B0AA 2WWZA 2RR9A 3L08A 2LGXA 2L00B 1R4NI 4ICVA 1E7VA 2L0FA 4IWPA 4GIVA 4DBGA 5C23A 2GBJA 3PGEA 1A5RA 3OJ4B 2KDIA 5JH5C 2HE7A 1MG8A 2YLMA 3L54A 4NNJB 2BYEA 1TTNA 2IO0B 2LI5A 2XK5A 4WAAA 1V2YA 4FHJA 1V86A 4WJOA 1OEYA 4BKSD 4DHJD 4WJPA 1YX6B 2C60A 4LCDE 4AJYB 5FR6A 4F7ZA 4KSKC 4W9KA 2JF5A 3VH3B 2MSED 4GOCA 2DAJA 2K6DB 2KMAA 1TZ1A 2IBIB 3KVFB 3A9JA 3D32A 2O2VA 3UF8A 3BY4B 3SD5A 1IP9A 4KZCA 2FIFA 3DCGA 3GZNI 3VQIA 4DHZE 1E90A 1SGHA 3QHTA 2FCQA 2KJRA 2LVQA 4HCNB 4IM2A 1WIAA 4HXDA 2K8HA 2I1JA 1SE9A 2M17A 4MDKE 5AEKB 1S3SG 4YL8A 3U30A 3U8ZA 3NOBA 3L16A 4FJYA 4ICUA 3KUZA 4I6NB 4HVBA 5EDSA 1UH6A 2I1KA 4K1RB 2V1YA 2ZCBA 1FXTB 3DBRI 2FIDA 5LXIB 1G6JA 1RRBA 4WWNA 2DHZA 2CU1A 1GJZA 3DVNV 5D6JB 2IO1B 3ZNID 2LVOA 3AU5A 3QARA 2C7MB 2K1FA 2KHWB 4FLHA 2OJRA 3DVGY 4OVVA 2JT4B 1ZW7A 3LJ3A 3ZTCA 2R2OA 4K7WA 3S2AA 3VFKA 3PT2B 3KH0A 4I6LB 1X1MA 2M0XA 2OOBB 2NS5A 4HPMB 4BVUC 2XK5B 1UZXB 3TL5A 2EMTA 3ZRCA 4G50A 2KC2A 4JGHB 3NZUA 4AOFA 1HE8A 2BYFA 2CHXA 2DYMA 3JYUA 2M1MA 3JVZX 2MLBA 4MH0E 1LXDA 4MELA 1WGHA 4FHKA 4BBNC 4IM3A 5IAAC 2FNJB 1WGGA 1WM2A 1ZGUB 3VHTC 4WWOA 1WM3A 3CMMB 1TBEA 4E71A 3JSVA 3MTNB 4MM3A 2MA9B 3W1YA 2L76A 3H7PA 2KDEB 3VVWB 1WE6A 1V49A 4FN2A 1IPGA 2JVCA 4X57B 3WAMA 4AUQC 3DPDA 4MSMB 1E8ZA 2D2QA 2N4FA 4GU2A 3VTUA 2KQSA 3O65B 1WXVA 2HJ8A 2GOWA 2REXA 2BF8B 3WALA 3B08A 2KNBA 2MWSB 3ZDTA 3QA8A 3UINB 3DVGX 5AZHA 3H7SA 3AU4A 4NQLB 4IW0A 4BBNF 2G4DB 3ALBA 1ISNA 4K7SA 2M8SA 1WR1A 2NR2A 4G0NB 4A3PA 2IZVB 5AZFA 4RM8A 1BT0A 3ZRFA 4DXAB 2FCMA 5LXHA 3PVLA 4CO7A 5G2NA 1C3TA 1V5OA 1F9JA 1RFAA 1V81A 2LRUA 3MHSD 1AARA 2ZPNA 3VXWA 2IYDB 2N9XA 4NY0A 3A9KB 5KHOA 4BOZB 2ASQA 2G4SA 2VRRB 1WXMA 3I3TB 3L17A 3WA0A 2KFKA 2O6VA 2DZMA 4IWOA 5D7GA 2WX1A 3OLMD 5JHBA 1Q0WB 4XZ4A 5J17A 1EF1A 1L7YA 2BPSA 4GN1A 5LLIA 3ONSA 1QZEA 2K8BA 2KD0A 3A1QB 3IFWB 1IYFA 5D94A 1ZKHA 3T8MA 1R4MI 3QC8B 2UWQA 2EMSA 3T9LA 3N30A 4MGYE 2KWUB 2KK8A 4PS3A 4GDLA 4W9JA 3TJPA 4AP4C 4HLEA 2ZNVC 5AZGA 1LQBA 2Z0EB 3KW5B 3V60A 2DX5B 2NBUA 2KZRA 4GDKB 4PYUA 1V5TA 3PREA 2WX0A 3UQAA 3EFUA 4EZJA 4FA6A 3H9DA 1RAXA 3A4SC 2KWVB 2KLGA 3R7QA 3TBLD 2LVPA 3ENEA 1E8WA 2KJHB 3H7PB 5L95C 1WGRA 5DPSA 4WJNA 2N1VA 4A3OA 5E6NA 3A1QA 2N9PC 3DVNU 4RMAA 4E3CA 3HK0A 5IA7A 1SIFA 2J7QB 3ZNGC 2AWTA 2K6QA 3HHMA 1VCBA 3ZNZB 1YD8U 3WAOA 2KWCA 5DCNA 2KX3A 3KUCB 4HDQA 3ZO5B 2EKEC 3RD2A 3APCA 4JQWC 3ZDMC 2CHZA 1OGWA 5DPRA 1J8CA 2PEAA 2L05A 1UELA 1L2NA 2KXJA 4GSWA 3EHVA 3PHWB 4URKA 4DDID 4XC2A 5DPWA 2PE9A 5JZEB 2BGFA 3QCAA 3VTVA 1WGDA 2LRWA 1CMXB 2DYBA 4OVUA 1J0GA 4N9F4 3APFA 2KMCA 2JPHA 3V61A 3DQVA 3IVFA 1EO6A 2RGFA 3PRPB 1YJ1A 4F8CB 2DZKA 1WR6E 2RSUA 3R66C 4DWFA 3QX1A 4CHKA 1Z5SB 4ZYNA 4B95A 4ANWA 2KFJA 3M3JA 4EFOA 4B6WA 2IO3B 2HD5B 3W1SC 1WXSA 1WX7A 2D07B 3ZTDA 2PJHA 3ZVVA 1YX5B 1WFYA 1V80A 2FUHB 1WXAA 1WY8A 2BKRB 3A9JB 3C0RB 3PV1A 4CYEA 1GG3A 5D2MB 3PLUA 4IC7B 4FADA 1V6EA 3R7RA 2MRPA 2JUOA 2KLCA 4MGIE 3OJ3A 3RT3B 3BINA 1NI2A 3PPAA 4KZ0A 2FAZA 4KSLC 2DENB 2GBKA 2GBRA 5CTRC 3VUXA 5C1ZA 2XEWA 1WH3A 4II3B 4W9HA 1WJUA 2NVUI 3RYTA 2LJ5A 2DYOA 1LM8B 2CHWA 2QHOA 4W9CA 2NPTA 2PE6B 1RLFA 2A5UA 4G11A 2KTRB 2MBOA 3K9OB 5CHWA 5DPTA 3RZFA 2KJ6A 2JZZA 4GDLB 1WJNA 1P98A 2N7DA 2KKCA 2KVRA 4JLCA 4AWJA 3NS8A 3PZDA 4ASWC 4PS8A 1E8YA 3X0WA 3RCZA 4EUTA 1WX8A 4NAWA 3AI5A 3M95A 4KIKA 4MJSB 3ZW3A 3VUYA 2AYOB 2JRHA 3OAWA 4DHJB 4HDOA 3RUIB 1D3ZA 2A4ZA 2JY6A 2KC1A 3EECA 2L7RA 1TGZB 1VD2A 3QJZA 2DZJA 3IG3A 2N7EA 3IBEA 1KLVA 2K25A 3UIPB 3K9PB 5CHFA 2D10A 2BKFA 2JRIB 3CSFA 3QK0A 4EZKA 3M62B 1NBFC 1NDDA 2LGDA 2FCNA 2KX0A 4I6PA 4DHZB 4EZLA 3UQBA 3UGBB 3NHEB 3PTFC 4GXBA 2LXAA 3ZLZA 2DAFA 3ZIMA 2KOXA 3RZWC 3CF6E 2MX2A 3V6CB 4LDTB 2K8CA 4ZRIA 3SHQA 2KN5A 2J0MA 2NCNA 2ZVNA 4KDIC 4GMVA 1C1YB 2NPTB 3ZNHB 3KYCD 5KHQA 2JWZA 4W9EA 2IY0B 2ZVOA 2L0TA 2LXCA 3DBSA 3DDCB 2ZPYA 4HK2A 4NJ7A 2BWES 3ML9A 1GC6A 1EF5A 2Z0DB 3DOWA 3L0WB 2C7NB 1H4RA 3Q3FA 3PSEB 4J6IA 4IWQA 4NAWB 4TQ0A 3N3KB 4E74A 3A9KA 1E8XA 2O2VB 4FULA 2M4NA 3VAWA 2J0KA 3ZKJC 1OTRB 1Q5WB 1WYWB 3H6NA 2AL6A 3A4RA 2G3QB 4AJWA 2ZJDA 4M8MA 4G3XB 4EOYA 5G55A 1H8CA 3QIJA 2MBEA 3QQ8B 4IM0A 4BKGA 3ZUNA 4W9DA 3TMPB 2MW5A 3PHXB 3VTWA 1UBIA 2NBWB 4ZRKA 3R3MA 4F1SA 2Y5BB 2AL3A 3KUDB 4NJ6A 1P1AA 2CKHB 3VUWA 4FBJB 1WF9A 4JL9A 1Y8RC 4K81A 3W1SA 2ZEQA 4IG7B 4K7UA 2MQJA 3KYDD 1WRDB 3QAQA 4W9LA 4ZDVA 2BYVE 2YVCA 3DBLI 4MGZE 1XQQA 3ML8A 3PRZA 4LJPB 4WJQA 2BWFA 2JXXA 1Z2MA 3AXCA 2D11A 2W9NA 4HCPB 1WJ4A 3CSTA 3HIZA 4PS7A 1V9JA 1UGMA 2N1WA 2N9EB 3JW0X 4TV3A 3SDLC 4BFRA 3PLVA 1WMHB 4NPNA 2RPQA 1WE7A 2Z59B 2B3AA 4XX5A 1UBQA 2R2QA 3A33B 2KTFA 4ANXA 4LJOB 2IO2B 2GBNA 1WI0A 5E6OA 1P9DU 2KDBA 2G45B 2L3ZA 4HJKA 4M0WB 4BKTA 2J0JA 4W9IA 5J18A 1I35A 2NBVB 3VH4B 4W9GA 1KJTA 2KO3A 3L10B 5HKHA 4TQ1A 2MP2B 2GMIC 4TUUA 5BO4B 5J2RA 1KM7A 4II2B 1XD3B 4MEMA 1JRUA 1PQSA 3V62A 2MP2A 4KVGB 2KANA 2FCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQK E;  4M8N A;  2GBM A;  1KOT A;  3PS6 A;  2LGY A;  2MBB B;  3WAP A;  1E7U A;  2WDT B;  2LUE A;  1OEY J;  3HM3 A;  3IHP C;  2C9W B;  3APD A;  3V6E B;  1K8R B;  4FJV B;  5E6P A;  3QWZ B;  1Q1O A;  1LFD A;  2LAS A;  4WWP A;  3MJW A;  4EEW A;  3NY5 A;  4A20 A;  2UYZ B;  4BOS C;  1YQB A;  1WMH A;  3SU8 X;  4JIO U;  1WZ0 A;  5TR5 A;  2WYQ A;  1GNU A;  4BKS A;  2JZ3 B;  1E5W A;  2KDF B;  1WZ3 A;  4MSQ B;  3LDZ E;  3M63 B;  4B9K A;  2AEH A;  4GB9 A;  4TKN A;  3U7D A;  3VDZ A;  3L13 A;  4P7I A;  4HPL B;  4GGQ A;  2LWP A;  4WQO B;  1P0R A;  1WJ6 A;  2LD9 A;  2L8J A;  3UIO B;  2HTH A;  2O6V B;  4GDK A;  2KFK B;  2ZZP B;  4LDT D;  4RM9 A;  3EC8 A;  3RUL A;  3WAN A;  2MBQ A;  2PPH A;  2V4L A;  3ECI A;  2V3S A;  3DBH I;  4DK5 A;  2XBB C;  3GOE A;  1T0Y A;  2ZCC A;  3TIX A;  1I42 A;  3NZS A;  4ANU A;  3PRM B;  2IY1 B;  2KQ7 A;  4FJZ A;  2C5L C;  4ANV A;  2CR5 A;  3WIM A;  1M94 A;  4PYZ A;  2O6V D;  5JHA A;  3B1L X;  1GUA B;  4KIK B;  4MJS A;  2RD0 A;  4W9F A;  5GMV A;  4KDL B;  1OQY A;  2K39 A;  4HWI B;  3HM6 X;  4ZRJ A;  1EUV B;  3AUL A;  3Q3J A;  4DDG D;  2LZ6 A;  3N32 A;  5CX3 A;  3X23 A;  1WGY A;  4IUM B;  5CHV C;  1WX9 A;  2MCN B;  3TCA A;  2C7H A;  1XT9 B;  1P3Q U;  2CS4 A;  1J19 A;  3H1U A;  4MGK E;  2KTR A;  2D3G A;  1YIW A;  2ZNV B;  1UD7 A;  3P2B A;  1S1Q B;  1GC7 A;  3JSV B;  4KV2 A;  2MBH A;  1U4A A;  4EKU A;  5L83 A;  2DZI A;  3B0A A;  2WWZ A;  2RR9 A;  3L08 A;  2LGX A;  2L00 B;  1R4N I;  4ICV A;  1E7V A;  2L0F A;  4IWP A;  4GIV A;  4DBG A;  5C23 A;  2GBJ A;  3PGE A;  1A5R A;  3OJ4 B;  2KDI A;  5JH5 C;  2HE7 A;  1MG8 A;  2YLM A;  3L54 A;  4NNJ B;  2BYE A;  1TTN A;  2IO0 B;  2LI5 A;  2XK5 A;  4WAA A;  1V2Y A;  4FHJ A;  1V86 A;  4WJO A;  1OEY A;  4BKS D;  4DHJ D;  4WJP A;  1YX6 B;  2C60 A;  4LCD E;  4AJY B;  5FR6 A;  4F7Z A;  4KSK C;  4W9K A;  2JF5 A;  3VH3 B;  2MSE D;  4GOC A;  2DAJ A;  2K6D B;  2KMA A;  1TZ1 A;  2IBI B;  3KVF B;  3A9J A;  3D32 A;  2O2V A;  3UF8 A;  3BY4 B;  3SD5 A;  1IP9 A;  4KZC A;  2FIF A;  3DCG A;  3GZN I;  3VQI A;  4DHZ E;  1E90 A;  1SGH A;  3QHT A;  2FCQ A;  2KJR A;  2LVQ A;  4HCN B;  4IM2 A;  1WIA A;  4HXD A;  2K8H A;  2I1J A;  1SE9 A;  2M17 A;  4MDK E;  5AEK B;  1S3S G;  4YL8 A;  3U30 A;  3U8Z A;  3NOB A;  3L16 A;  4FJY A;  4ICU A;  3KUZ A;  4I6N B;  4HVB A;  5EDS A;  1UH6 A;  2I1K A;  4K1R B;  2V1Y A;  2ZCB A;  1FXT B;  3DBR I;  2FID A;  5LXI B;  1G6J A;  1RRB A;  4WWN A;  2DHZ A;  2CU1 A;  1GJZ A;  3DVN V;  5D6J B;  2IO1 B;  3ZNI D;  2LVO A;  3AU5 A;  3QAR A;  2C7M B;  2K1F A;  2KHW B;  4FLH A;  2OJR A;  3DVG Y;  4OVV A;  2JT4 B;  1ZW7 A;  3LJ3 A;  3ZTC A;  2R2O A;  4K7W A;  3S2A A;  3VFK A;  3PT2 B;  3KH0 A;  4I6L B;  1X1M A;  2M0X A;  2OOB B;  2NS5 A;  4HPM B;  4BVU C;  2XK5 B;  1UZX B;  3TL5 A;  2EMT A;  3ZRC A;  4G50 A;  2KC2 A;  4JGH B;  3NZU A;  4AOF A;  1HE8 A;  2BYF A;  2CHX A;  2DYM A;  3JYU A;  2M1M A;  3JVZ X;  2MLB A;  4MH0 E;  1LXD A;  4MEL A;  1WGH A;  4FHK A;  4BBN C;  4IM3 A;  5IAA C;  2FNJ B;  1WGG A;  1WM2 A;  1ZGU B;  3VHT C;  4WWO A;  1WM3 A;  3CMM B;  1TBE A;  4E71 A;  3JSV A;  3MTN B;  4MM3 A;  2MA9 B;  3W1Y A;  2L76 A;  3H7P A;  2KDE B;  3VVW B;  1WE6 A;  1V49 A;  4FN2 A;  1IPG A;  2JVC A;  4X57 B;  3WAM A;  4AUQ C;  3DPD A;  4MSM B;  1E8Z A;  2D2Q A;  2N4F A;  4GU2 A;  3VTU A;  2KQS A;  3O65 B;  1WXV A;  2HJ8 A;  2GOW A;  2REX A;  2BF8 B;  3WAL A;  3B08 A;  2KNB A;  2MWS B;  3ZDT A;  3QA8 A;  3UIN B;  3DVG X;  5AZH A;  3H7S A;  3AU4 A;  4NQL B;  4IW0 A;  4BBN F;  2G4D B;  3ALB A;  1ISN A;  4K7S A;  2M8S A;  1WR1 A;  2NR2 A;  4G0N B;  4A3P A;  2IZV B;  5AZF A;  4RM8 A;  1BT0 A;  3ZRF A;  4DXA B;  2FCM A;  5LXH A;  3PVL A;  4CO7 A;  5G2N A;  1C3T A;  1V5O A;  1F9J A;  1RFA A;  1V81 A;  2LRU A;  3MHS D;  1AAR A;  2ZPN A;  3VXW A;  2IYD B;  2N9X A;  4NY0 A;  3A9K B;  5KHO A;  4BOZ B;  2ASQ A;  2G4S A;  2VRR B;  1WXM A;  3I3T B;  3L17 A;  3WA0 A;  2KFK A;  2O6V A;  2DZM A;  4IWO A;  5D7G A;  2WX1 A;  3OLM D;  5JHB A;  1Q0W B;  4XZ4 A;  5J17 A;  1EF1 A;  1L7Y A;  2BPS A;  4GN1 A;  5LLI A;  3ONS A;  1QZE A;  2K8B A;  2KD0 A;  3A1Q B;  3IFW B;  1IYF A;  5D94 A;  1ZKH A;  3T8M A;  1R4M I;  3QC8 B;  2UWQ A;  2EMS A;  3T9L A;  3N30 A;  4MGY E;  2KWU B;  2KK8 A;  4PS3 A;  4GDL A;  4W9J A;  3TJP A;  4AP4 C;  4HLE A;  2ZNV C;  5AZG A;  1LQB A;  2Z0E B;  3KW5 B;  3V60 A;  2DX5 B;  2NBU A;  2KZR A;  4GDK B;  4PYU A;  1V5T A;  3PRE A;  2WX0 A;  3UQA A;  3EFU A;  4EZJ A;  4FA6 A;  3H9D A;  1RAX A;  3A4S C;  2KWV B;  2KLG A;  3R7Q A;  3TBL D;  2LVP A;  3ENE A;  1E8W A;  2KJH B;  3H7P B;  5L95 C;  1WGR A;  5DPS A;  4WJN A;  2N1V A;  4A3O A;  5E6N A;  3A1Q A;  2N9P C;  3DVN U;  4RMA A;  4E3C A;  3HK0 A;  5IA7 A;  1SIF A;  2J7Q B;  3ZNG C;  2AWT A;  2K6Q A;  3HHM A;  1VCB A;  3ZNZ B;  1YD8 U;  3WAO A;  2KWC A;  5DCN A;  2KX3 A;  3KUC B;  4HDQ A;  3ZO5 B;  2EKE C;  3RD2 A;  3APC A;  4JQW C;  3ZDM C;  2CHZ A;  1OGW A;  5DPR A;  1J8C A;  2PEA A;  2L05 A;  1UEL A;  1L2N A;  2KXJ A;  4GSW A;  3EHV A;  3PHW B;  4URK A;  4DDI D;  4XC2 A;  5DPW A;  2PE9 A;  5JZE B;  2BGF A;  3QCA A;  3VTV A;  1WGD A;  2LRW A;  1CMX B;  2DYB A;  4OVU A;  1J0G A;  4N9F 4;  3APF A;  2KMC A;  2JPH A;  3V61 A;  3DQV A;  3IVF A;  1EO6 A;  2RGF A;  3PRP B;  1YJ1 A;  4F8C B;  2DZK A;  1WR6 E;  2RSU A;  3R66 C;  4DWF A;  3QX1 A;  4CHK A;  1Z5S B;  4ZYN A;  4B95 A;  4ANW A;  2KFJ A;  3M3J A;  4EFO A;  4B6W A;  2IO3 B;  2HD5 B;  3W1S C;  1WXS A;  1WX7 A;  2D07 B;  3ZTD A;  2PJH A;  3ZVV A;  1YX5 B;  1WFY A;  1V80 A;  2FUH B;  1WXA A;  1WY8 A;  2BKR B;  3A9J B;  3C0R B;  3PV1 A;  4CYE A;  1GG3 A;  5D2M B;  3PLU A;  4IC7 B;  4FAD A;  1V6E A;  3R7R A;  2MRP A;  2JUO A;  2KLC A;  4MGI E;  3OJ3 A;  3RT3 B;  3BIN A;  1NI2 A;  3PPA A;  4KZ0 A;  2FAZ A;  4KSL C;  2DEN B;  2GBK A;  2GBR A;  5CTR C;  3VUX A;  5C1Z A;  2XEW A;  1WH3 A;  4II3 B;  4W9H A;  1WJU A;  2NVU I;  3RYT A;  2LJ5 A;  2DYO A;  1LM8 B;  2CHW A;  2QHO A;  4W9C A;  2NPT A;  2PE6 B;  1RLF A;  2A5U A;  4G11 A;  2KTR B;  2MBO A;  3K9O B;  5CHW A;  5DPT A;  3RZF A;  2KJ6 A;  2JZZ A;  4GDL B;  1WJN A;  1P98 A;  2N7D A;  2KKC A;  2KVR A;  4JLC A;  4AWJ A;  3NS8 A;  3PZD A;  4ASW C;  4PS8 A;  1E8Y A;  3X0W A;  3RCZ A;  4EUT A;  1WX8 A;  4NAW A;  3AI5 A;  3M95 A;  4KIK A;  4MJS B;  3ZW3 A;  3VUY A;  2AYO B;  2JRH A;  3OAW A;  4DHJ B;  4HDO A;  3RUI B;  1D3Z A;  2A4Z A;  2JY6 A;  2KC1 A;  3EEC A;  2L7R A;  1TGZ B;  1VD2 A;  3QJZ A;  2DZJ A;  3IG3 A;  2N7E A;  3IBE A;  1KLV A;  2K25 A;  3UIP B;  3K9P B;  5CHF A;  2D10 A;  2BKF A;  2JRI B;  3CSF A;  3QK0 A;  4EZK A;  3M62 B;  1NBF C;  1NDD A;  2LGD A;  2FCN A;  2KX0 A;  4I6P A;  4DHZ B;  4EZL A;  3UQB A;  3UGB B;  3NHE B;  3PTF C;  4GXB A;  2LXA A;  3ZLZ A;  2DAF A;  3ZIM A;  2KOX A;  3RZW C;  3CF6 E;  2MX2 A;  3V6C B;  4LDT B;  2K8C A;  4ZRI A;  3SHQ A;  2KN5 A;  2J0M A;  2NCN A;  2ZVN A;  4KDI C;  4GMV A;  1C1Y B;  2NPT B;  3ZNH B;  3KYC D;  5KHQ A;  2JWZ A;  4W9E A;  2IY0 B;  2ZVO A;  2L0T A;  2LXC A;  3DBS A;  3DDC B;  2ZPY A;  4HK2 A;  4NJ7 A;  2BWE S;  3ML9 A;  1GC6 A;  1EF5 A;  2Z0D B;  3DOW A;  3L0W B;  2C7N B;  1H4R A;  3Q3F A;  3PSE B;  4J6I A;  4IWQ A;  4NAW B;  4TQ0 A;  3N3K B;  4E74 A;  3A9K A;  1E8X A;  2O2V B;  4FUL A;  2M4N A;  3VAW A;  2J0K A;  3ZKJ C;  1OTR B;  1Q5W B;  1WYW B;  3H6N A;  2AL6 A;  3A4R A;  2G3Q B;  4AJW A;  2ZJD A;  4M8M A;  4G3X B;  4EOY A;  5G55 A;  1H8C A;  3QIJ A;  2MBE A;  3QQ8 B;  4IM0 A;  4BKG A;  3ZUN A;  4W9D A;  3TMP B;  2MW5 A;  3PHX B;  3VTW A;  1UBI A;  2NBW B;  4ZRK A;  3R3M A;  4F1S A;  2Y5B B;  2AL3 A;  3KUD B;  4NJ6 A;  1P1A A;  2CKH B;  3VUW A;  4FBJ B;  1WF9 A;  4JL9 A;  1Y8R C;  4K81 A;  3W1S A;  2ZEQ A;  4IG7 B;  4K7U A;  2MQJ A;  3KYD D;  1WRD B;  3QAQ A;  4W9L A;  4ZDV A;  2BYV E;  2YVC A;  3DBL I;  4MGZ E;  1XQQ A;  3ML8 A;  3PRZ A;  4LJP B;  4WJQ A;  2BWF A;  2JXX A;  1Z2M A;  3AXC A;  2D11 A;  2W9N A;  4HCP B;  1WJ4 A;  3CST A;  3HIZ A;  4PS7 A;  1V9J A;  1UGM A;  2N1W A;  2N9E B;  3JW0 X;  4TV3 A;  3SDL C;  4BFR A;  3PLV A;  1WMH B;  4NPN A;  2RPQ A;  1WE7 A;  2Z59 B;  2B3A A;  4XX5 A;  1UBQ A;  2R2Q A;  3A33 B;  2KTF A;  4ANX A;  4LJO B;  2IO2 B;  2GBN A;  1WI0 A;  5E6O A;  1P9D U;  2KDB A;  2G45 B;  2L3Z A;  4HJK A;  4M0W B;  4BKT A;  2J0J A;  4W9I A;  5J18 A;  1I35 A;  2NBV B;  3VH4 B;  4W9G A;  1KJT A;  2KO3 A;  3L10 B;  5HKH A;  4TQ1 A;  2MP2 B;  2GMI C;  4TUU A;  5BO4 B;  5J2R A;  1KM7 A;  4II2 B;  1XD3 B;  4MEM A;  1JRU A;  1PQS A;  3V62 A;  2MP2 A;  4KVG B;  2KAN A;  2FCS A; 
#chains in the Genus database with same CATH topology
 2GLS A;  2V9H A;  2JQR B;  3WAP A;  2MBB B;  2LHD A;  2WDT B;  3V6E B;  2D3C A;  3TSS A;  3B2F A;  1NVI D;  3MJW A;  4A90 A;  3HRD D;  4EEW A;  4P16 A;  1TKG A;  1TY2 A;  3SU8 X;  4BKS A;  1HZ5 A;  3BVM A;  2XN9 C;  3U7D A;  3GB1 A;  4P7I A;  4HPL B;  4GGQ A;  4H2A A;  4GDK A;  1K52 A;  2MBQ A;  4QAY A;  4TMA B;  3DBH I;  4DK5 A;  1T0Y A;  3TIX A;  1HXY D;  3NZS A;  2NMQ A;  1HA5 A;  1QKZ A;  2KQ7 A;  4FJZ A;  1OQQ A;  5C2T B;  4DXF A;  3B1L X;  1GUA B;  4W9F A;  5GMV A;  2K39 A;  5HI1 A;  2MHJ A;  3N32 A;  2WGS A;  1AN8 A;  3TEX A;  1SBB B;  4A55 A;  2MCN B;  2C7H A;  1XT9 B;  1P3Q U;  2Y3A A;  1J19 A;  3H1U A;  1FNW A;  1UD7 A;  3P2B A;  4LLG M;  4XYC A;  1U4A A;  4EKU A;  2RDG A;  3AEF B;  3B0A A;  3W5V B;  2RR9 A;  3VRA B;  5C23 A;  3PGE A;  3P1M A;  5JH5 C;  4ACF A;  2HE7 A;  4C4V B;  2WXO A;  4NNJ B;  2BYE A;  2EKI A;  2XK5 A;  4WAA A;  3EUB 2;  4C56 C;  2N7J A;  4F7Z A;  1AYF A;  1PDX A;  4UDU C;  4GOC A;  2K6D B;  4KKJ A;  3LB8 C;  1IP9 A;  2FIF A;  1E90 A;  3QHT A;  4IM2 A;  2FCQ A;  2KJR A;  3Q2A C;  3N20 C;  4HXD A;  1QIL A;  3H8H A;  4WH4 A;  5E6J A;  3DHI C;  2BQQ A;  3N1Z C;  1FXI A;  3KUZ A;  4I6N B;  4HVB A;  2JX5 A;  3AE3 B;  1FXT B;  1G6J A;  1UWX A;  1CQV A;  3PZ7 A;  1N63 A;  1ZE3 D;  5EE1 A;  5D6J B;  1TKE A;  1XLO A;  2H89 B;  3Q69 A;  2NTT A;  3DBL B;  3C19 A;  3U4E G;  3ZTC A;  3LJ3 A;  3S2A A;  2KYW A;  3VFK A;  5I4D A;  1FFV A;  1ROE A;  2OOB B;  2XK5 B;  3TL5 A;  3ZRC A;  4ZHP A;  1E7P B;  2OED A;  4JGH B;  4C4V A;  3NZU A;  2CHX A;  4YTN B;  2M1M A;  4PK1 A;  4MEL A;  1WM3 A;  4E71 A;  1V1P B;  2I2Y A;  3W1Y A;  3H7P A;  2KDE B;  1KRH A;  2JVC A;  4X57 B;  3I63 C;  3WAM A;  1JAL A;  4AUQ C;  1WSP A;  2N4F A;  3VTU A;  1FO4 A;  2REX A;  3B08 A;  2MWS B;  3AED B;  1XLN A;  5AZH A;  4BBN F;  4BZA A;  1WR1 A;  2NR2 A;  2IZV B;  4RM8 A;  5LXH A;  2FCM A;  5D3I B;  3PVL A;  1C3T A;  2IGD A;  1F9J A;  3VXW A;  4HPP A;  4BOZ B;  2ASQ A;  1YJI A;  2O6V A;  3KLS X;  3ZYY X;  2V0G A;  1JRP A;  3FC4 A;  2KD0 A;  4LNK A;  2JWU A;  1IYF A;  1FCC C;  2VH2 A;  5D94 A;  2WXH A;  1R4N B;  2UWQ A;  1YQ4 B;  2KK8 A;  4PS3 A;  4W9J A;  4AP4 C;  2E6X A;  1EU3 A;  3R8B A;  2Z0E B;  1YOV B;  2DBY A;  1XLP A;  2DX5 B;  1BML C;  3DWG C;  2NBU A;  1ZXI A;  4PYU A;  4XWW A;  3EFU A;  3A4S C;  3R7Q A;  1E8W A;  2KDM A;  2KJH B;  5L95 C;  2PTL A;  1JQ4 A;  1YMH E;  4WJN A;  4DQO C;  5E6N A;  4E3C A;  4OZB A;  5IA7 A;  1MVK A;  3AN1 A;  2J7Q B;  2K6Q A;  1GB4 A;  1YD8 U;  4OZA A;  1WYG A;  1TJE A;  2GRI A;  4HDQ A;  3NRZ A;  2KWD A;  3APC A;  4JQW C;  1OGW A;  3P4R B;  5DPR A;  5D3D A;  1UEL A;  2CU3 A;  3AEE B;  2KXJ A;  1RFK A;  3W9C B;  2ICI A;  4XC2 A;  2BGF A;  3NS1 A;  1JWU D;  1CMX B;  3DQV A;  1JRO A;  1YN4 A;  3IVF A;  3DBH B;  2DZK A;  1WR6 E;  4DWF A;  1ENF A;  1L6V A;  2KFJ A;  2WXG A;  3BWU D;  2IO3 B;  2HD5 B;  4HRO A;  1WXS A;  3W1S C;  2PJH A;  1ZOY B;  3ZVV A;  1SE3 A;  1WFY A;  1V80 A;  1VZ6 A;  1WXA A;  5EE3 A;  3A9J B;  2INP E;  1XEE A;  1GG3 A;  1QOG A;  2JXT A;  3R7R A;  2KLC A;  1QOB A;  3RT3 B;  4KZ0 A;  3PPA A;  2EEL A;  3VUX A;  5HG2 A;  3NJT A;  1WH3 A;  4II3 B;  2LJ5 A;  2DYO A;  2CHW A;  2QHO A;  1MPE A;  2NPT A;  2PE6 B;  1RLF A;  4G11 A;  2JZZ A;  1P98 A;  3ETR A;  5FR3 A;  3PZD A;  4PS8 A;  2WXF A;  1E8Y A;  2XNA C;  3RN9 C;  4EUT A;  3SFE B;  3P4P B;  1SE4 A;  4KIK A;  3ZW3 A;  1F52 A;  3OAW A;  4DHJ B;  4HDO A;  1ZP0 B;  3FIL A;  2KVZ A;  3IG3 A;  2Y5P A;  5H8Y E;  4EZK A;  4USA A;  2LGD A;  4C7Y A;  3UQB A;  3NHE B;  3ZLZ A;  5BYQ A;  5C3J B;  3RZW C;  3KYC D;  2WDQ B;  1F0Z A;  3DBS A;  3DDC B;  3Q3F A;  4J6I A;  1C76 A;  4NAW B;  2W54 A;  4TQ0 A;  3N3K B;  3ZKJ C;  2IGG A;  3W5U B;  1A70 A;  2ZJD A;  4M8M A;  1QT9 A;  4ARC A;  2MBE A;  3ZUN A;  1GB1 A;  1SSN A;  2MW5 A;  3PHX B;  4ZRK A;  1P1A A;  2V3P A;  3NZ3 A;  2I38 A;  3VUW A;  1WF9 A;  2DLB A;  3W1S A;  4IG7 B;  5T8I A;  3DBL I;  3ML8 A;  3PRZ A;  2BWF A;  1Q10 A;  1NEK B;  2JSV X;  2W9N A;  1I4H A;  1WJ4 A;  3HIZ A;  3Q6B A;  4PS7 A;  1UGM A;  2QIE B;  4TV3 A;  3SDL C;  1UBQ A;  2K0P A;  4XWT A;  3TUO A;  2IO2 B;  1J7B A;  5E6O A;  3AB5 A;  1P9D U;  2INN E;  1I35 A;  2BS3 B;  3P4S B;  4W9G A;  1KJT A;  4TQ1 A;  1NI3 A;  3N1X C;  1CJE A;  2KN4 A;  2VZK B;  4II2 B;  1XD3 B;  1C4C A;  4MEM A;  1QOA A;  3V62 A;  2MP2 A;  2D10 A;  4IDI A;  1TY0 A;  1KOT A;  1K50 A;  1UNS A;  2LGY A;  2E3T A;  2TSS A;  1OEY J;  3IHP C;  2C9W B;  2WLB A;  4FJV B;  3QWZ B;  1Q1O A;  4YTP B;  3NY5 A;  4A20 A;  2UYZ B;  3AEG B;  1P7E A;  2WXM A;  1V1O A;  5TR5 A;  1SJE D;  3U52 E;  1E5W A;  2KDF B;  1WZ3 A;  3M63 B;  4GB9 A;  3GE3 C;  3VDZ A;  3L13 A;  2KMM A;  4ZHO A;  4JE3 B;  2KFK B;  3AH7 A;  4LDT D;  3Q8C A;  4RM9 A;  1ET6 A;  3WAN A;  3ECI A;  2V4L A;  4NJC A;  1I42 A;  2K5P A;  2IY1 B;  4ANV A;  4YWG G;  4PYZ A;  3IT4 B;  4BAX A;  4MJS A;  1ZDX A;  4HWI B;  2W3R A;  4KGS A;  3Q3J A;  3IXS A;  2VH1 A;  2L1A A;  1GC7 A;  2DZI A;  3ZJT A;  1R4N I;  1FIQ A;  4DBG A;  1A5R A;  3OJ4 B;  3L54 A;  2IPK D;  3NVW A;  3R2I A;  2LI5 A;  4FHJ A;  2M56 B;  4DHJ D;  4LCD E;  2RDH A;  4AJY B;  1D5M C;  3VH3 B;  2MSE D;  1UUP A;  2Q5W D;  3OG5 A;  2IBI B;  1XF5 L;  2LMC A;  2WP9 B;  4A8X C;  1QOF A;  3UF8 A;  4N6E B;  5MPO A;  2QSD A;  2LVQ A;  1L6U A;  1WIA A;  2K8H A;  2I1J A;  2M17 A;  1S3S G;  3U30 A;  3Q3N C;  5G5G A;  3WCQ A;  3NOB A;  4US8 A;  2OHF A;  3RNF C;  2I1K A;  4K1R B;  2V1Y A;  1JCK B;  1BUI C;  1P7F A;  1ZXH A;  1RRB A;  2DHZ A;  4S0R A;  3DVN V;  3AU5 A;  2C7M B;  4US9 A;  4RH6 A;  4FLH A;  4YT0 B;  3DVG Y;  4K7W A;  1F2R C;  2WS3 B;  3KH0 A;  4I6L B;  4HPM B;  2EMT A;  2KAJ A;  4G50 A;  3BK2 A;  1F1H A;  4AOF A;  4NAM A;  3AE7 B;  1AWD A;  4IM3 A;  1ZGU B;  3VHT C;  4FXC A;  5GXG B;  3JSV A;  4MM3 A;  1YNT E;  3VVW B;  1SB3 C;  3SR6 A;  3DPD A;  3ZXV A;  2D2Q A;  3AV8 A;  4P6V F;  2HJ8 A;  3WAL A;  3ZDT A;  3UI3 A;  1E6E B;  1XCT L;  3DWM A;  3H7S A;  3AU4 A;  4JWS C;  4IW0 A;  1T0S C;  5BYS A;  2QIL A;  2OJW A;  4G0N B;  4A3P A;  5AZF A;  3ZRF A;  5G2N A;  1V5O A;  2LRU A;  2ZPN A;  1ZPS A;  4NY0 A;  4RF1 A;  3DBR B;  1R7S A;  2G4S A;  3BYT B;  2VRR B;  3L17 A;  2M19 A;  2KFK A;  2DZM A;  4IWO A;  3RNG C;  5LLI A;  3ONS A;  4N59 A;  3Q8A A;  4ARI A;  1F77 A;  1KTK A;  3IFW B;  1AW7 A;  3ZJU A;  2K3U A;  1C4A A;  3QC8 B;  1KF6 B;  2KWU B;  4HLE A;  1LQB A;  3V60 A;  1PFD A;  3PRE A;  2BB6 A;  3H9D A;  2KLG A;  1HQR D;  2LVP A;  3ENE A;  2KAC A;  3Q14 C;  3IAS 1;  2N1V A;  2BS4 B;  3AMZ A;  4RMA A;  1VCB A;  1T5X D;  4HRS A;  1TKY A;  5IOI A;  5DCN A;  3KUC B;  3ZO5 B;  2CHZ A;  2WHI A;  1IUE A;  1J8C A;  2PEA A;  2L05 A;  3BII D;  2KT7 A;  3PHW B;  1UF0 A;  3GE8 C;  5DPW A;  3VTV A;  1ZDV A;  2LRW A;  3AE4 B;  2DYB A;  3APF A;  1J7C A;  2YEP B;  2BTE A;  2RGF A;  2LJI A;  4KX6 B;  1Z5S B;  4ZYN A;  3FIL B;  2ZW0 A;  4XE0 A;  2D07 B;  2IND C;  1T0Q C;  1J7A A;  2ACZ B;  4CQN A;  1YN5 A;  2SEB D;  3EGR A;  4IC7 B;  1V6E A;  4WIP A;  2JUO A;  4M00 A;  4KSL C;  2DEN B;  2GBK A;  4MH8 A;  2GBR A;  3RYT A;  2RMM A;  1VJK A;  1NYR A;  2KTR B;  5DPT A;  3RZF A;  1WJN A;  4C7Z A;  4JLC A;  1CZP A;  3IT6 B;  4DXG A;  1WWT A;  3X0W A;  3RCZ A;  4NAW A;  3M95 A;  1L4D B;  2HTM E;  4RGT A;  3V3X A;  2AYO B;  2JRH A;  5AUK A;  2HJ1 A;  5AUI A;  1WGK A;  1VD2 A;  1SE2 A;  2DZJ A;  2N9K A;  4RF0 A;  2N7E A;  1FXA A;  5LNK 1;  2BKF A;  3QK0 A;  3M62 B;  1FRR A;  4DHZ B;  4GXB A;  3LXF A;  4AQ7 A;  2KOX A;  4S17 A;  3V6C B;  4OVZ A;  2KN5 A;  2NCN A;  3ZNH B;  4GMV A;  3HVD A;  2PIA A;  3ZQ4 A;  4W9E A;  2DWQ A;  2LXC A;  1TS4 A;  4ZRP A;  1FFU A;  2ZPY A;  3AE6 B;  4HK2 A;  4NJ7 A;  3ML9 A;  1EF5 A;  3DOW A;  3L0W B;  1SXT A;  2C7N B;  3PSE B;  3B9J A;  1LGR A;  3A9K A;  3BVG A;  2M4N A;  1OTR B;  2ONQ A;  1WYW B;  3H6N A;  2AL6 A;  4AJW A;  4EOY A;  5G55 A;  1XXG A;  4W9D A;  3VTW A;  2NBW B;  3R3M A;  3KUD B;  2AL3 A;  4NJ6 A;  2CKH B;  1F2R I;  2BB5 A;  3KYD D;  5BYR A;  2JYT A;  2YVC A;  2JXX A;  3ZJV A;  2D11 A;  4HCP B;  4JWU C;  2QJL A;  1FRD A;  3CST A;  3P4Q B;  2N1W A;  2N9E B;  3GZN B;  2B76 B;  4NPN A;  4XDC A;  2Z59 B;  4NZL B;  4XX5 A;  2ON8 A;  1LO5 D;  4ANX A;  2FBW B;  1PYW D;  4HJK A;  2KDB A;  2G45 B;  2L3Z A;  2WU2 B;  4W9I A;  2NBV B;  4M01 A;  2DNF A;  5HKH A;  2GMI C;  4TUU A;  1B1Z A;  2JZP A;  1PQS A;  2AQ2 B;  2V4I B;  2PKO A;  2ZW1 A;  1OFF A;  3CWI A;  4M8N A;  2LUE A;  1K8R B;  1FNV A;  5E6P A;  1LFD A;  4WWP A;  4BOS C;  2D3B A;  4K3C A;  5FKA C;  2MJ3 A;  2AQ3 B;  2RPV A;  2LFI A;  2JZ3 B;  2AX5 A;  3LDZ E;  4TKN A;  3FKY A;  2LUM A;  1VLB A;  5J2R A;  3UIO B;  1P0R A;  2LD9 A;  1YJJ A;  2L8J A;  2O6V B;  2QC8 A;  2ZZP B;  3EC8 A;  3RUL A;  3RNE C;  4RFB A;  1D5Z C;  2XBB C;  4ANU A;  3AE2 B;  4RGO S;  3PRM B;  4LTU A;  1T3Q A;  3PZ8 A;  2CR5 A;  1D5X C;  3WIM A;  1N61 A;  3Q8E A;  3MHZ A;  4KIK B;  2R61 A;  2UU7 A;  1OQY A;  3HM6 X;  4ZRJ A;  1EUV B;  2PW9 A;  5BMH A;  4DDG D;  1IGC A;  3X23 A;  4IUM B;  5CHV C;  3TCA A;  1VZ8 A;  2CS4 A;  5IN7 A;  3KWV A;  4MGK E;  2D3G A;  1YIW A;  1ACC A;  3ZGZ A;  1V1P A;  4KV2 A;  3L08 A;  2WWZ A;  1CK1 A;  4GIV A;  2GBJ A;  2WXK A;  2M0A A;  1MG8 A;  2IO0 B;  1V2Y A;  1V86 A;  4WJO A;  1OEY A;  3NVV A;  1VRA B;  4KSK C;  2JF5 A;  1ZUD 2;  2DAJ A;  2KMA A;  5HHD G;  1R4M B;  3KVF B;  2YEP F;  3U7Z A;  3A9J A;  3D32 A;  3SD5 A;  4KZC A;  3VQI A;  3DCG A;  4DHZ E;  1SGH A;  4HCN B;  1KLU D;  1SE9 A;  3O13 A;  5AEK B;  1D6E C;  1STE A;  3U8Z A;  2QCZ A;  3L16 A;  4FJY A;  1DOX A;  1GAQ B;  4K3B A;  5EDS A;  1QF6 A;  2FID A;  5LXI B;  4WWN A;  3MC0 B;  3ZNI D;  2IO1 B;  4D2K A;  2LVO A;  2NTS A;  4OVV A;  2JT4 B;  1ZW7 A;  4OZC A;  5FK9 C;  3W2D A;  1SJH D;  1X1M A;  2M0X A;  2NS5 A;  1L0X B;  1PGA A;  3LYY A;  2MLB A;  4MH0 E;  1LXD A;  4FHK A;  4BBN C;  1N60 A;  1T6B X;  3KQ4 A;  1WM2 A;  3MP9 A;  3CMM B;  1TBE A;  3MTN B;  2MA9 B;  1ET9 A;  1WE6 A;  4FN2 A;  1L0V B;  3BVZ A;  3P63 A;  4MSM B;  1E8Z A;  4GU2 A;  1WXV A;  3DHH C;  2GOW A;  3N9Y C;  1FD6 A;  2WNM A;  1YQ3 B;  1I4X A;  3N1Y C;  2G4D B;  3ALB A;  2PVG C;  1IGD A;  1VZ7 A;  4GLS C;  4DXA B;  1V81 A;  1RFA A;  3MHS D;  1AAR A;  1PUT A;  3MC8 A;  2IYD B;  2QEJ C;  2N9X A;  3V05 A;  3PO0 A;  1WXM A;  3WA0 A;  5D7G A;  1I4G A;  2WX1 A;  3OLM D;  1Q0W B;  4XZ4 A;  1TIF A;  1EF1 A;  2BPS A;  1QZE A;  2K8B A;  2IGH A;  1RM6 C;  3T8M A;  2EMS A;  1SEB D;  3T9L A;  3P42 A;  4MGY E;  3IAM 1;  2ZNV C;  5AZG A;  1SIJ A;  4GDK B;  1WXQ A;  1V8C A;  4C80 A;  2WX0 A;  3UQA A;  4EZJ A;  1QQR A;  1RAX A;  5HFY A;  3OWE B;  2KWV B;  3TBL D;  1N5X A;  4YXD B;  3H7P B;  1WGR A;  4B0E A;  4REZ A;  4YSZ B;  3A1Q A;  2N9P C;  1SF0 A;  3HK0 A;  4J3O D;  1E10 A;  3BYY B;  3HUI A;  2AWT A;  3MFG A;  2IJ0 A;  2KWC A;  3C8Y A;  5TSS A;  2WXJ A;  1PGB A;  2FE8 A;  2BW2 A;  1MFW A;  2MJD A;  1L2N A;  1RYJ A;  2L52 A;  2SAK A;  4C00 A;  4GSW A;  3EHV A;  4URK A;  5EE9 A;  4YSX B;  3RNB C;  3QCA A;  3NVZ A;  1J0G A;  1FM0 D;  2JPH A;  2G9H D;  2MJE A;  3V61 A;  3PRP B;  4F8C B;  3RPF C;  3QX1 A;  1JWA D;  4CHK A;  3BK1 A;  3RFZ B;  4EFO A;  3RMK C;  1YX5 B;  3URY A;  4JX1 C;  4CYE A;  5D2M B;  3PLU A;  4FAD A;  2MRP A;  4WWM A;  1NI2 A;  1C79 A;  2FAZ A;  2CJO A;  4ZYS A;  4KKI A;  2XEW A;  1WJU A;  4LNF A;  3ZXR A;  2A5U A;  2LGI A;  3K9O B;  4A6Q A;  4GDL B;  2PVO D;  2N7D A;  4LNI A;  4AWJ A;  2Y5C A;  2PLP A;  3AI5 A;  4YTM B;  2K22 A;  3VUY A;  1EWC A;  3RUI B;  3HVZ A;  1L4Z B;  1JWS D;  2A4Z A;  3EEC A;  2KC1 A;  4IKG A;  3IBE A;  2G1E A;  2WDV B;  1VR9 A;  3K9P B;  1N6Z A;  4IOI E;  1K51 A;  1NBF C;  2FCN A;  2KX0 A;  4I6P A;  4XGA B;  3PTF C;  2LXA A;  1FCL A;  2DAF A;  3ZIM A;  3ABV B;  2MX2 A;  1TT5 B;  1WRI A;  4LDT B;  4O1N A;  2J0M A;  4KGT A;  2JWZ A;  3AE8 B;  2IY0 B;  3Q8B A;  2L0T A;  1I4Q A;  2WXP A;  2LEK A;  3E9S A;  2BWE S;  1GC6 A;  2Z0D B;  1H4R A;  5IO9 A;  4IWQ A;  4EE2 A;  4OHJ A;  1E8X A;  2O2V B;  3NUH B;  2J0K A;  3E56 A;  1Q5W B;  4PT5 A;  4Q2J A;  2G3Q B;  4G3X B;  3RI7 C;  3QQ8 B;  3AM9 A;  4MT5 A;  3CIR B;  4FBJ B;  4K81 A;  4K7U A;  2MQJ A;  3QAQ A;  4W9L A;  2BYV E;  4MGZ E;  4WJQ A;  4LJP B;  1M4V A;  3AXC A;  2KQ4 X;  1E9M A;  3PLV A;  1WE7 A;  2R2Q A;  5G5H A;  2KTF A;  3AEA B;  2GBN A;  1TS2 A;  2WXI A;  4M0W B;  4BKT A;  2WXQ A;  2J0J A;  5J18 A;  3VH4 B;  3MJ5 A;  3L10 B;  1MJD A;  1FNU A;  1IBX A;  2V3N A;  3NG0 A;  1DGJ A;  1JRU A;  4ITK A;  2CJN A;  2KAN A;  2FCS A;  4NQK E;  4RCO A;  2GBM A;  2RDB C;  3PS6 A;  1E7U A;  3HM3 A;  3APD A;  3B2G A;  2LAS A;  1YQB A;  1WMH A;  4JIO U;  1WZ0 A;  2WYQ A;  1GNU A;  2X38 A;  4MSQ B;  3U2S C;  4B9K A;  2AEH A;  3AEB B;  3Q3M C;  1K53 A;  4WQO B;  2LWP A;  1WJ6 A;  2HTH A;  1EM7 A;  2N9L A;  2PPH A;  2V3S A;  1MHH E;  3GOE A;  2ZCC A;  1DYQ A;  2C5L C;  1FEH A;  3AE9 B;  4B0M A;  1M94 A;  1MI0 A;  2O6V D;  1N5W A;  5JHA A;  2RD0 A;  4KDL B;  2D5G A;  3AUL A;  5H92 C;  2LZ6 A;  5CX3 A;  1WGY A;  4RGN A;  1OQR A;  3I9V 1;  1WX9 A;  3RNC C;  1T0R C;  4A9A A;  1JW9 D;  2KTR A;  2BBC A;  2ZNV B;  1S1Q B;  1E0Z A;  3JSV B;  1N62 A;  2MBH A;  5L83 A;  1DOI A;  2LGX A;  2L00 B;  4ICV A;  1E7V A;  2L0F A;  4IWP A;  3SFD B;  1QLB B;  2MH7 A;  2KDI A;  1JWB D;  4HKZ E;  2YLM A;  3T3N A;  1TTN A;  4R3D A;  1D4B A;  4BKS D;  4WJP A;  1YX6 B;  2C60 A;  5FR6 A;  4W9K A;  2HDE A;  4XDD A;  1TZ1 A;  2D3A A;  2X8X X;  2O2V A;  3BY4 B;  1UGJ A;  3GZN I;  1C78 A;  4MDK E;  4YL8 A;  1C4P A;  4ICU A;  3VRB B;  2JYE A;  1UH6 A;  1TS5 A;  2ZCB A;  3DBR I;  3DHG C;  1KLG D;  2CU1 A;  1FPY A;  1GJZ A;  3QAR A;  2K1F A;  2KHW B;  4P1C C;  3GS2 A;  2OJR A;  2R2O A;  1NYQ A;  2BS2 B;  3PT2 B;  3AEC B;  1MHX A;  4BVU C;  1UZX B;  2KC2 A;  1RWS A;  2QMT A;  4ZOH C;  4RGM A;  1HE8 A;  2BYF A;  2DYM A;  3JYU A;  3JVZ X;  1WGH A;  1EWY C;  5IAA C;  4RNA A;  2FNJ B;  1WGG A;  2J53 A;  4WWO A;  2L76 A;  1V49 A;  1IPG A;  1BXT A;  4OW0 A;  2JU6 X;  2KQS A;  3O65 B;  2BF8 B;  2KNB A;  3QA8 A;  3UIN B;  3DVG X;  4NQL B;  1ISN A;  4K7S A;  2WQY B;  2M8S A;  1ESF A;  3VR9 B;  1BT0 A;  4YSY B;  2IDY A;  4CO7 A;  2W3S A;  2MEK A;  2N0S B;  5KHO A;  3A9K B;  2FUG 1;  2W55 A;  4MM3 B;  3SEB A;  2BYT A;  4TSS A;  3I3T B;  1FMA D;  4KGR A;  5JHB A;  5J17 A;  1L7Y A;  1HTQ A;  4GN1 A;  2WDR B;  3A1Q B;  4JPS A;  4ZRQ A;  1EU4 A;  2W82 A;  1C77 A;  3BZD B;  1ZKH A;  1R4M I;  5IKC M;  3N30 A;  2WXR A;  4GDL A;  3TJP A;  1TS3 A;  1XLQ A;  2QDF A;  3KW5 B;  2KZR A;  1V5T A;  1GPX A;  1V97 A;  4FA6 A;  3L4P A;  5DPS A;  4HJG E;  2J42 A;  4A3O A;  1I4P A;  3DVN U;  3FAH A;  1SIF A;  3ZNG C;  2L32 A;  1VDV A;  3HHM A;  3ZNZ B;  1L5P A;  3WAO A;  2K9X A;  2KX3 A;  1HTO A;  4N58 A;  3NVY A;  2EKE C;  3RD2 A;  3ZDM C;  4M02 A;  1XCQ L;  4DDI D;  5IP4 D;  4MAC A;  1B9R A;  2PE9 A;  5JZE B;  1TZO A;  1WGD A;  4OVU A;  4N9F 4;  2GI9 A;  2KMC A;  2LGS A;  4L23 A;  4M0W A;  1KH0 A;  1EO6 A;  1YJ1 A;  1MG4 A;  2RSU A;  3R66 C;  3RNA C;  3EFC A;  4B95 A;  1L0Y B;  4ANW A;  3M3J A;  4B6W A;  1WX7 A;  3ZTD A;  2FUH B;  1GOZ A;  1WY8 A;  2BKR B;  3PV1 A;  3C0R B;  2J4X A;  4AS1 A;  1TYG B;  3EA6 A;  4HKQ A;  4MGI E;  3OJ3 A;  3I57 A;  3BIN A;  3J9C A;  3MC9 A;  4L2Y A;  5CTR C;  5C1Z A;  1PGX A;  4W9H A;  2NVU I;  2WU5 B;  1LM8 B;  2GB1 A;  4W9C A;  2BT6 A;  2MBO A;  5CHW A;  1NEN B;  2KJ6 A;  5BMI A;  2KKC A;  2KVR A;  3NS8 A;  4ASW C;  3KWL A;  1WX8 A;  4MJS B;  4WUR A;  1D3Z A;  2J52 A;  2JY6 A;  2L7R A;  1TGZ B;  3QJZ A;  3TEY A;  3T3O A;  3TEZ A;  1KLV A;  2K25 A;  3UIP B;  2AQ1 B;  5CHF A;  2JRI B;  3CSF A;  1NDD A;  3TEW A;  4EZL A;  1HZ6 A;  2BVC A;  3UGB B;  5JXV A;  2L83 A;  3R2T A;  1HEZ E;  1IBX B;  1JWM D;  3CF6 E;  2INC C;  2K8C A;  4ZRI A;  3SHQ A;  2H88 B;  2ZVN A;  3AE5 B;  4KDI C;  5KHQ A;  1C1Y B;  2NPT B;  2ZVO A;  1KFY B;  3GP7 A;  4HEA 1;  4LNO A;  4E74 A;  5EE0 A;  5BMG A;  4FUL A;  3VAW A;  4P1B C;  4WQM A;  3A4R A;  1H8C A;  3QIJ A;  4IM0 A;  4BKG A;  3TMP B;  2Z8L A;  1JML A;  1UBI A;  4F1S A;  2Y5B B;  4L1B A;  4JL9 A;  1Y8R C;  1YN3 A;  2ZEQ A;  1WRD B;  4ZDV A;  2WXN A;  1XQQ A;  2PMV A;  1Y56 A;  1Z2M A;  1DOY A;  1C9F A;  1V9J A;  3JW0 X;  4BFR A;  1WMH B;  4WAF A;  2RPQ A;  1XO3 A;  2B3A A;  1I7H A;  2VZK D;  3A33 B;  2WXL A;  3I5J C;  3Q8F A;  4LJO B;  1UWM A;  3VR8 B;  1WI0 A;  2LHE A;  3AE1 B;  2KO3 A;  3Q3O C;  2MP2 B;  5BO4 B;  1KM7 A;  4LNN A;  1I4R A;  4KVG B;  4LK0 M; 
#chains in the Genus database with same CATH homology
 4NQK E;  4M8N A;  2GBM A;  1KOT A;  3PS6 A;  2LGY A;  2MBB B;  3WAP A;  1E7U A;  2WDT B;  2LUE A;  1OEY J;  3HM3 A;  3IHP C;  2C9W B;  3APD A;  3V6E B;  1K8R B;  4FJV B;  5E6P A;  3QWZ B;  1Q1O A;  1LFD A;  2LAS A;  4WWP A;  3MJW A;  4EEW A;  3NY5 A;  4A20 A;  2UYZ B;  4BOS C;  1YQB A;  1WMH A;  3SU8 X;  4JIO U;  1WZ0 A;  5TR5 A;  2WYQ A;  1GNU A;  4BKS A;  2JZ3 B;  1E5W A;  2KDF B;  1WZ3 A;  4MSQ B;  3LDZ E;  3M63 B;  4B9K A;  2AEH A;  4GB9 A;  4TKN A;  3U7D A;  3VDZ A;  3L13 A;  4P7I A;  4HPL B;  4GGQ A;  2LWP A;  4WQO B;  1P0R A;  1WJ6 A;  2LD9 A;  2L8J A;  3UIO B;  2HTH A;  2O6V B;  4GDK A;  2KFK B;  2ZZP B;  4LDT D;  4RM9 A;  3EC8 A;  3RUL A;  3WAN A;  2MBQ A;  2PPH A;  2V4L A;  3ECI A;  2V3S A;  3DBH I;  4DK5 A;  2XBB C;  3GOE A;  1T0Y A;  2ZCC A;  3TIX A;  1I42 A;  3NZS A;  4ANU A;  3PRM B;  2IY1 B;  2KQ7 A;  4FJZ A;  2C5L C;  4ANV A;  2CR5 A;  3WIM A;  1M94 A;  4PYZ A;  2O6V D;  5JHA A;  3B1L X;  1GUA B;  4KIK B;  4MJS A;  2RD0 A;  4W9F A;  5GMV A;  4KDL B;  1OQY A;  2K39 A;  4HWI B;  3HM6 X;  4ZRJ A;  1EUV B;  3AUL A;  3Q3J A;  4DDG D;  2LZ6 A;  3N32 A;  5CX3 A;  3X23 A;  1WGY A;  4IUM B;  5CHV C;  1WX9 A;  2MCN B;  3TCA A;  2C7H A;  1XT9 B;  1P3Q U;  2CS4 A;  1J19 A;  3H1U A;  4MGK E;  2KTR A;  2D3G A;  1YIW A;  2ZNV B;  1UD7 A;  3P2B A;  1S1Q B;  1GC7 A;  3JSV B;  4KV2 A;  2MBH A;  1U4A A;  4EKU A;  5L83 A;  2DZI A;  3B0A A;  2WWZ A;  2RR9 A;  3L08 A;  2LGX A;  2L00 B;  1R4N I;  4ICV A;  1E7V A;  2L0F A;  4IWP A;  4GIV A;  4DBG A;  5C23 A;  2GBJ A;  3PGE A;  1A5R A;  3OJ4 B;  2KDI A;  5JH5 C;  2HE7 A;  1MG8 A;  2YLM A;  3L54 A;  4NNJ B;  2BYE A;  1TTN A;  2IO0 B;  2LI5 A;  2XK5 A;  4WAA A;  1V2Y A;  4FHJ A;  1V86 A;  4WJO A;  1OEY A;  4BKS D;  4DHJ D;  4WJP A;  1YX6 B;  2C60 A;  4LCD E;  4AJY B;  5FR6 A;  4F7Z A;  4KSK C;  4W9K A;  2JF5 A;  3VH3 B;  2MSE D;  4GOC A;  2DAJ A;  2K6D B;  2KMA A;  1TZ1 A;  2IBI B;  3KVF B;  3A9J A;  3D32 A;  2O2V A;  3UF8 A;  3BY4 B;  3SD5 A;  1IP9 A;  4KZC A;  2FIF A;  3DCG A;  3GZN I;  3VQI A;  4DHZ E;  1E90 A;  1SGH A;  3QHT A;  2FCQ A;  2KJR A;  2LVQ A;  4HCN B;  4IM2 A;  1WIA A;  4HXD A;  2K8H A;  2I1J A;  1SE9 A;  2M17 A;  4MDK E;  5AEK B;  1S3S G;  4YL8 A;  3U30 A;  3U8Z A;  3NOB A;  3L16 A;  4FJY A;  4ICU A;  3KUZ A;  4I6N B;  4HVB A;  5EDS A;  1UH6 A;  2I1K A;  4K1R B;  2V1Y A;  2ZCB A;  1FXT B;  3DBR I;  2FID A;  5LXI B;  1G6J A;  1RRB A;  4WWN A;  2DHZ A;  2CU1 A;  1GJZ A;  3DVN V;  5D6J B;  2IO1 B;  3ZNI D;  2LVO A;  3AU5 A;  3QAR A;  2C7M B;  2K1F A;  2KHW B;  4FLH A;  2OJR A;  3DVG Y;  4OVV A;  2JT4 B;  1ZW7 A;  3LJ3 A;  3ZTC A;  2R2O A;  4K7W A;  3S2A A;  3VFK A;  3PT2 B;  3KH0 A;  4I6L B;  1X1M A;  2M0X A;  2OOB B;  2NS5 A;  4HPM B;  4BVU C;  2XK5 B;  1UZX B;  3TL5 A;  2EMT A;  3ZRC A;  4G50 A;  2KC2 A;  4JGH B;  3NZU A;  4AOF A;  1HE8 A;  2BYF A;  2CHX A;  2DYM A;  3JYU A;  2M1M A;  3JVZ X;  2MLB A;  4MH0 E;  1LXD A;  4MEL A;  1WGH A;  4FHK A;  4BBN C;  4IM3 A;  5IAA C;  2FNJ B;  1WGG A;  1WM2 A;  1ZGU B;  3VHT C;  4WWO A;  1WM3 A;  3CMM B;  1TBE A;  4E71 A;  3JSV A;  3MTN B;  4MM3 A;  2MA9 B;  3W1Y A;  2L76 A;  3H7P A;  2KDE B;  3VVW B;  1WE6 A;  1V49 A;  4FN2 A;  1IPG A;  2JVC A;  4X57 B;  3WAM A;  4AUQ C;  3DPD A;  4MSM B;  1E8Z A;  2D2Q A;  2N4F A;  4GU2 A;  3VTU A;  2KQS A;  3O65 B;  1WXV A;  2HJ8 A;  2GOW A;  2REX A;  2BF8 B;  3WAL A;  3B08 A;  2KNB A;  2MWS B;  3ZDT A;  3QA8 A;  3UIN B;  3DVG X;  5AZH A;  3H7S A;  3AU4 A;  4NQL B;  4IW0 A;  4BBN F;  2G4D B;  3ALB A;  1ISN A;  4K7S A;  2M8S A;  1WR1 A;  2NR2 A;  4G0N B;  4A3P A;  2IZV B;  5AZF A;  4RM8 A;  1BT0 A;  3ZRF A;  4DXA B;  2FCM A;  5LXH A;  3PVL A;  4CO7 A;  5G2N A;  1C3T A;  1V5O A;  1F9J A;  1RFA A;  1V81 A;  2LRU A;  3MHS D;  1AAR A;  2ZPN A;  3VXW A;  2IYD B;  2N9X A;  4NY0 A;  3A9K B;  5KHO A;  4BOZ B;  2ASQ A;  2G4S A;  2VRR B;  1WXM A;  3I3T B;  3L17 A;  3WA0 A;  2KFK A;  2O6V A;  2DZM A;  4IWO A;  5D7G A;  2WX1 A;  3OLM D;  5JHB A;  1Q0W B;  4XZ4 A;  5J17 A;  1EF1 A;  1L7Y A;  2BPS A;  4GN1 A;  5LLI A;  3ONS A;  1QZE A;  2K8B A;  2KD0 A;  3A1Q B;  3IFW B;  1IYF A;  5D94 A;  1ZKH A;  3T8M A;  1R4M I;  3QC8 B;  2UWQ A;  2EMS A;  3T9L A;  3N30 A;  4MGY E;  2KWU B;  2KK8 A;  4PS3 A;  4GDL A;  4W9J A;  3TJP A;  4AP4 C;  4HLE A;  2ZNV C;  5AZG A;  1LQB A;  2Z0E B;  3KW5 B;  3V60 A;  2DX5 B;  2NBU A;  2KZR A;  4GDK B;  4PYU A;  1V5T A;  3PRE A;  2WX0 A;  3UQA A;  3EFU A;  4EZJ A;  4FA6 A;  3H9D A;  1RAX A;  3A4S C;  2KWV B;  2KLG A;  3R7Q A;  3TBL D;  2LVP A;  3ENE A;  1E8W A;  2KJH B;  3H7P B;  5L95 C;  1WGR A;  5DPS A;  4WJN A;  2N1V A;  4A3O A;  5E6N A;  3A1Q A;  2N9P C;  3DVN U;  4RMA A;  4E3C A;  3HK0 A;  5IA7 A;  1SIF A;  2J7Q B;  3ZNG C;  2AWT A;  2K6Q A;  3HHM A;  1VCB A;  3ZNZ B;  1YD8 U;  3WAO A;  2KWC A;  5DCN A;  2KX3 A;  3KUC B;  4HDQ A;  3ZO5 B;  2EKE C;  3RD2 A;  3APC A;  4JQW C;  3ZDM C;  2CHZ A;  1OGW A;  5DPR A;  1J8C A;  2PEA A;  2L05 A;  1UEL A;  1L2N A;  2KXJ A;  4GSW A;  3EHV A;  3PHW B;  4URK A;  4DDI D;  4XC2 A;  5DPW A;  2PE9 A;  5JZE B;  2BGF A;  3QCA A;  3VTV A;  1WGD A;  2LRW A;  1CMX B;  2DYB A;  4OVU A;  1J0G A;  4N9F 4;  3APF A;  2KMC A;  2JPH A;  3V61 A;  3DQV A;  3IVF A;  1EO6 A;  2RGF A;  3PRP B;  1YJ1 A;  4F8C B;  2DZK A;  1WR6 E;  2RSU A;  3R66 C;  4DWF A;  3QX1 A;  4CHK A;  1Z5S B;  4ZYN A;  4B95 A;  4ANW A;  2KFJ A;  3M3J A;  4EFO A;  4B6W A;  2IO3 B;  2HD5 B;  3W1S C;  1WXS A;  1WX7 A;  2D07 B;  3ZTD A;  2PJH A;  3ZVV A;  1YX5 B;  1WFY A;  1V80 A;  2FUH B;  1WXA A;  1WY8 A;  2BKR B;  3A9J B;  3C0R B;  3PV1 A;  4CYE A;  1GG3 A;  5D2M B;  3PLU A;  4IC7 B;  4FAD A;  1V6E A;  3R7R A;  2MRP A;  2JUO A;  2KLC A;  4MGI E;  3OJ3 A;  3RT3 B;  3BIN A;  1NI2 A;  3PPA A;  4KZ0 A;  2FAZ A;  4KSL C;  2DEN B;  2GBK A;  2GBR A;  5CTR C;  3VUX A;  5C1Z A;  2XEW A;  1WH3 A;  4II3 B;  4W9H A;  1WJU A;  2NVU I;  3RYT A;  2LJ5 A;  2DYO A;  1LM8 B;  2CHW A;  2QHO A;  4W9C A;  2NPT A;  2PE6 B;  1RLF A;  2A5U A;  4G11 A;  2KTR B;  2MBO A;  3K9O B;  5CHW A;  5DPT A;  3RZF A;  2KJ6 A;  2JZZ A;  4GDL B;  1WJN A;  1P98 A;  2N7D A;  2KKC A;  2KVR A;  4JLC A;  4AWJ A;  3NS8 A;  3PZD A;  4ASW C;  4PS8 A;  1E8Y A;  3X0W A;  3RCZ A;  4EUT A;  1WX8 A;  4NAW A;  3AI5 A;  3M95 A;  4KIK A;  4MJS B;  3ZW3 A;  3VUY A;  2AYO B;  2JRH A;  3OAW A;  4DHJ B;  4HDO A;  3RUI B;  1D3Z A;  2A4Z A;  2JY6 A;  2KC1 A;  3EEC A;  2L7R A;  1TGZ B;  1VD2 A;  3QJZ A;  2DZJ A;  3IG3 A;  2N7E A;  3IBE A;  1KLV A;  2K25 A;  3UIP B;  3K9P B;  5CHF A;  2D10 A;  2BKF A;  2JRI B;  3CSF A;  3QK0 A;  4EZK A;  3M62 B;  1NBF C;  1NDD A;  2LGD A;  2FCN A;  2KX0 A;  4I6P A;  4DHZ B;  4EZL A;  3UQB A;  3UGB B;  3NHE B;  3PTF C;  4GXB A;  2LXA A;  3ZLZ A;  2DAF A;  3ZIM A;  2KOX A;  3RZW C;  3CF6 E;  2MX2 A;  3V6C B;  4LDT B;  2K8C A;  4ZRI A;  3SHQ A;  2KN5 A;  2J0M A;  2NCN A;  2ZVN A;  4KDI C;  4GMV A;  1C1Y B;  2NPT B;  3ZNH B;  3KYC D;  5KHQ A;  2JWZ A;  4W9E A;  2IY0 B;  2ZVO A;  2L0T A;  2LXC A;  3DBS A;  3DDC B;  2ZPY A;  4HK2 A;  4NJ7 A;  2BWE S;  3ML9 A;  1GC6 A;  1EF5 A;  2Z0D B;  3DOW A;  3L0W B;  2C7N B;  1H4R A;  3Q3F A;  3PSE B;  4J6I A;  4IWQ A;  4NAW B;  4TQ0 A;  3N3K B;  4E74 A;  3A9K A;  1E8X A;  2O2V B;  4FUL A;  2M4N A;  3VAW A;  2J0K A;  3ZKJ C;  1OTR B;  1Q5W B;  1WYW B;  3H6N A;  2AL6 A;  3A4R A;  2G3Q B;  4AJW A;  2ZJD A;  4M8M A;  4G3X B;  4EOY A;  5G55 A;  1H8C A;  3QIJ A;  2MBE A;  3QQ8 B;  4IM0 A;  4BKG A;  3ZUN A;  4W9D A;  3TMP B;  2MW5 A;  3PHX B;  3VTW A;  1UBI A;  2NBW B;  4ZRK A;  3R3M A;  4F1S A;  2Y5B B;  2AL3 A;  3KUD B;  4NJ6 A;  1P1A A;  2CKH B;  3VUW A;  4FBJ B;  1WF9 A;  4JL9 A;  1Y8R C;  4K81 A;  3W1S A;  2ZEQ A;  4IG7 B;  4K7U A;  2MQJ A;  3KYD D;  1WRD B;  3QAQ A;  4W9L A;  4ZDV A;  2BYV E;  2YVC A;  3DBL I;  4MGZ E;  1XQQ A;  3ML8 A;  3PRZ A;  4LJP B;  4WJQ A;  2BWF A;  2JXX A;  1Z2M A;  3AXC A;  2D11 A;  2W9N A;  4HCP B;  1WJ4 A;  3CST A;  3HIZ A;  4PS7 A;  1V9J A;  1UGM A;  2N1W A;  2N9E B;  3JW0 X;  4TV3 A;  3SDL C;  4BFR A;  3PLV A;  1WMH B;  4NPN A;  2RPQ A;  1WE7 A;  2Z59 B;  2B3A A;  4XX5 A;  1UBQ A;  2R2Q A;  3A33 B;  2KTF A;  4ANX A;  4LJO B;  2IO2 B;  2GBN A;  1WI0 A;  5E6O A;  1P9D U;  2KDB A;  2G45 B;  2L3Z A;  4HJK A;  4M0W B;  4BKT A;  2J0J A;  4W9I A;  5J18 A;  1I35 A;  2NBV B;  3VH4 B;  4W9G A;  1KJT A;  2KO3 A;  3L10 B;  5HKH A;  4TQ1 A;  2MP2 B;  2GMI C;  4TUU A;  5BO4 B;  5J2R A;  1KM7 A;  4II2 B;  1XD3 B;  4MEM A;  1JRU A;  1PQS A;  3V62 A;  2MP2 A;  4KVG B;  2KAN A;  2FCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...