1H8KA

A-spectrin sh3 domain a11v, v23l, m25v, v53i, v58l mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
KELVLVLYDYQEKSPREVTVKKGDILTLLNSTNKDWWKVEVDDRQGFIPAAYLKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN
publication title Conformational Strain in the Hydrophobic Core and its Implications for Protein Folding and Design
pubmed doi rcsb
source organism Gallus gallus
molecule tags Sh3-domain
total genus 6
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1h8kA00
4KRTA 2DL4A 1QWEA 2KRNA 2RNAA 3H41A 3VS0A 1GBRA 2KXCA 2DL3A 3QWYA 4EIKA 1JO8A 2KYMA 1OPKA 4OMQA 2RQRA 4LUDA 1E7OA 3FJ5A 2KR3A 1AEYA 4K11A 1ARKA 3M0RA 2BZXA 2O9SA 1KIKA 2V1QA 4X1VA 2RF0A 3I5RA 2I0NA 2FPEA 3I35A 1H92A 2MOXA 1LCKA 2GGRA 2GQIA 2AZSA 4AFUC 1WLPB 1K76A 1JEGA 1MV0B 2OJ2A 3EHQA 1GRIA 2LZ6B 2M0YA 2K3BA 1X43A 1ZUYA 2ECZA 1K0SA 2C0TA 2RPNA 1VYVA 1GCQA 2CH4W 2J05A 3VS7A 2K2MA 2AK5A 1AZGB 4LE9A 1WXUA 1ABOA 2LMJA 2DMOA 2KGTA 1WIEA 2HDAA 1H8KA 3R6NA 2DL8A 3NGPA 1PKSA 1Z9ZA 2J7IA 5I22A 2JW4A 1SPKA 2KT1A 1TUCA 2J6KA 1UJ0A 2F2XA 4AFSC 1BBZA 1I1JA 4HVVA 2CSQA 3REAB 2DM1A 2K6DA 3SHWA 3IQLA 1KJWA 2BTTA 1I07A 1M30A 2LNHB 1SRMA 1NYFA 1YNZA 3PE0A 3UA7A 2EYYA 2EGEA 1BK2A 2KEAA 4GBQA 1K0XA 1GL5A 2DA9A 1Y57A 2DYBA 2RQVA 1E6GA 3VS5A 1VYUA 2D0NA 4HVWA 2OI3A 2W0ZA 3H0HA 2O31A 2KXDA 2ENMA 4D8DA 4J9HA 1GFCA 4FSSA 1NLPC 4JJDA 4JZ4A 1T0HA 2BZYA 2MIOA 2SEMA 1JQQA 4ZNXA 1T3LA 4J9FA 1PKTA 2F2WA 2A37A 1YN8A 4RUGA 1AWJA 2JMAA 4JZ3A 2K7AA 1BB9A 3I5SA 4JJCA 4IIMA 2E5KA 2CUDA 5I11A 2PNIA 5IXFA 2YT6A 4M4ZA 1IO6A 2JXBA 1GCPA 1QKXA 1UE9A 2FEIA 1KFZA 2ESWA 4JJBA 4AG1C 2EVRA 2DBMA 4J9IA 2KE9A 1Z9QA 2EPDA 2FRYA 1FYNA 1CSKA 1RUWA 1M8MA 2GNCA 2LX7A 2RN8A 1WFWA 2DNUA 1NLOC 3RNJA 4J9EA 5IXBA 1WDXA 2HBWA 2DRMA 1JU5C 5FW9A 2JM8A 4OMMA 3EG0A 2LQWA 3REBB 4Z8AA 4J9CA 2DJQA 4OMPA 1PWTA 1NYGA 2JMCA 1A0NB 2FG0A 1JXMA 2KROA 2J6FA 3PVLA 4OMOA 3PVQA 1AZEA 2HSPA 1NEGA 3M0QA 3U23A 1VYTA 2JS0A 1T3SA 1OV3A 2DBKA 2DRKA 1UJYA 3LH5A 1AVZC 1U06A 2CT4A 3M0SA 1PNJA 3UA6A 1KSWA 5EC7A 2MCNA 1OEBA 5L23A 1AWXA 1MV3A 4CC4B 1UHCA 2VVKA 2DE0X 2P4RA 4F14A 1ZX6A 2J06A 2AKKA 3EG3A 1X6BA 1TG0A 4J9DA 1PHTA 2LJ3A 3THKA 1CKBA 1S1NA 2EYXA 2EYZA 4RTZA 2DVJA 1AOJA 1M3BA 1WXBA 1RLPC 2A36A 2H8HA 2KYBA 2X3XD 2GBQA 3RBBB 2LQNA 2FO0A 1AD5A 2EKHA 4HXJA 1W6XA 4DEYA 1WI7A 4QT7A 1Y0MA 4OMLA 2NUZA 1HJDA 4RTXA 2QDLA 1B07A 4CC7A 1X27A 5FWBA 2A28A 1N5ZA 1JXOA 2CSIA 3VS4A 1SSHA 3CQTA 2K79A 2FPFA 1K4US 5GJWB 2YSQA 4HCKA 3H0FA 2W10A 2DILA 4Z89A 1SHGA 2ROLA 2CDTA 4LUEA 1ZUKA 2KT8A 1NM7A 2K9GA 1AWWA 3TSZA 3VS2A 4LNPA 2YUOA 4F16A 1SRLA 1YP5A 2EYWA 1EFNA 2DF6A 3O5ZA 4LN2A 4CC2A 2ED1A 2DL7A 2RMOA 2YUNA 2BZ8A 1AWOA 2B86A 2EQIA 2CREA 2L2PA 1HSQA 3M0TA 2JS2A 1E6HA 1OPLA 3NHNA 4AFQC 1ZSGA 1T0JA 1UG1A 2C0IA 1X2QA 2VKNA 1YCSB 2L3SA 2L3QA 1SHFA 3SEMA 2ED0A 2SRCA 3ZL7C 3VS3A 1RI9A 1MUZA 2D1XA 2FPDA 1WXTA 2HEQA 4R0KA 4RTUA 1QCFA 1B3QA 2LCSA 4RTTA 2EGAA 3VRZA 1QLYA 2PTKA 1YWPA 2RQUA 1G83A 4ESRA 1UFFA 2LP5A 1HD3A 1U5SA 1RLQC 2JM9A 2KBTA 3TSWA 2D8HA 5ECAA 1J3TA 3NMZC 4J9GA 2FRWA 5HCKA 4Y92A 4RTYA 2EW3A 1I0CA 1X69A 3H0IA 2GTOA 4E6RA 3NPFA 2DX1A 1X6GA 5GJVB 2ABLA 4AG2C 1YWOA 2ROTA 1BU1A 5IH2A 1V1CA 2LJ1A 2AKLA 4J9BA 3VS1A 1FMKA 2DLPA 2YUPA 1QKWA 2L3PA 3EG1A 1SEMA 3A98A 1PRMC 1UECA 1ZBJA 2KRSA 2RQWA 3I9QA 2A08A 1NG2A 3VS6A 2D8JA 4IIOA 2JTEA 1UUEA 2L0AA 2YUQA 1WX6A 1UTIA 2KNBB 1U3OA 3VRYA 3GBQA 2O9VA 3TVTA 4ORZA 1NEBA 2EGCA 1UDLA 4HVUA 3JV3A 2IIMA 2CUBA 1H3HA 2YDLA 4JPBW 1GFDA 1WYXA 2OAWA 2G6FX 3KFVA 2LJ0A 2O88A 2KRMA 2O2OA 2GTJA 2JT4A 4RTWA 5IHKA 3C0CA 2RQTA 2XMFA 5IHNA 1M3AA 2NWMA 2C0OA 1VA7A 1M27C 1ZLMA 1PRLC 1W1FA 1ZUUA 3M0PA 4A63B 3UATA 1OOTA 1G2BA 1UHFA 1W70A 3EHRA 3QWXX 2EBPA 1XOVA 2F2VA 4GLMA 4F17A 3UF4A 1M3CA 1CKAA 3EGUA 1GBQA 2X3WD 3EG2A 4RTVA 1UGVA 3ULRB 2M51A 1X2KA 1QWFA 2AZVA 4OMNA 2DL5A 2CH4A 1TUDA 2CT3A 4CC3A 4DEXA 3M0UA 1WA7A 1K1ZA 2HCKA 1GCQC 4D8KA 5IHIA 4AFZC 1K9AA 2J6OA 5FWCA 2PZ1A 4Z88A 1ABQA 2VWFA 2V1RA 4WCIA
chains in the Genus database with same CATH superfamily
4JUVA 1M1GA 4LDVA 3S3NA 2DL4A 2IVWA 1QWEA 2KRNA 2JUFA 3JB9H 4OB2B 2HKQB 2QA4A 3RIRA 4MDWA 1YJWT 2LDMA 3VS0A 5GAOp 1PSEA 2DL3A 3QWYA 2DJZA 1VOMA 1OU8A 2M0OA 2XK0A 1TTHB 3PMTA 2QDYB 3JB9J 4FYXB 3M9QA 1XTDA 1KIKA 3I55A 2RF0A 2E4HA 2AZSA 1QP2A 1WLPB 1KQSS 1K76A 1MV0B 3QJYA 2MMPA 1GRIA 4Y91A 1ZUYA 1U8RA 5GANd 1MNEA 2QQ9A 4B9WA 2RPNA 2CH4W 3CBMA 1IZ6A 3HRTA 2HMAA 1AZGB 2GFUA 4LE9A 2PUOB 1WXUA 3M53A 1ABOA 3MCAB 1NPRA 1Q82C 1KK7A 4M77B 3ER0A 2KGTA 1OYXA 3TREA 1WGSA 4PJOB 4NL2A 2HL3A 1Z9ZA 5LJ5f 2DAQA 2JW4A 4ZGJB 1VQ9Q 1TUCA 1I1JA 4HVVA 3CCLT 1I07A 1IGQA 4M78F 3PE0A 2DFUA 2KEAA 4JS4A 3CCQA 3CCLA 3EFSA 2DA9A 3HRSA 2WSFE 2DYBA 2HBPA 4XU1A 1E6GA 1X01A 3VS5A 1QW1A 2EJGA 2KQWA 3O8VA 4J9HA 1JJ2A 1GFCA 4FSSA 2RJFA 3RMQA 3VUBA 1VQ7T 2A37A 3OW2P 1LVKA 4RUGA 4OMFB 3CCUT 3L2QA 5I21A 2CUDA 3A1PA 3X28B 1Q86R 2CGHA 3CCUA 3MP6A 3SFMA 1Q95G 5IXFA 4PJNA 2YT6A 3J7AF 1S72T 1SSFA 1YJ9T 1X75C 1VQPA 4LDWA 4BI3A 1QVFA 5GAOl 2RO0A 3QIIA 3M54A 1VQLQ 2JOYA 5KYNA 1CSKA 4Z02A 1R0BG 2HAXA 1M8MA 1VIFA 2GNCA 2RN8A 1WFWA 2DNUA 4C8QD 3G4SQ 3RNJA 4PNOA 3JCMW 2KK4A 2QAZA 1KHCA 2IG0A 3UDCA 2RHZA 4QQ6A 3EFRA 4Z8AA 1NYGA 1A0NB 2K2VA 4M7AB 4EMHA 4XU2A 1AZEA 1QVGP 1VYTA 1XQHA 2DRKA 1NJIC 4M77E 1EIFA 3CMET 4M75B 1PNJA 4F04B 4PJOE 1Q82R 2M1HA 2X4XA 3CCEQ 3CMEA 1B34A 2CS7A 1MMDA 2L3RA 2DO3A 2VVKA 3ZEHA 4PLLA 1I8FA 1B34B 2E6ZA 3EG3A 1TG0A 4J9DA 4DA4A 2CZ1B 2EYXA 2EYZA 4RTZA 2DVJA 1BI0A 3J80E 1WXBA 1RLPC 1G3WA 5GANf 1OX8A 2GBQA 4HXJA 1W6XA 2EJ9A 1G8XA 4IKFA 5LJ3d 3R6OA 4C5IA 2QYZA 5GAMd 2BE9B 4FYWB 5IAYA 1YHQQ 2YLCA 1X27A 1ACMB 5FWBA 3JCMh 2CSIA 3EFOA 2K79A 3HFNA 2OTJT 3OS2A 5GJWB 1WHLA 4HCKA 1VQ8T 3H0FA 3LGFA 4JRKA 3HHTB 1SHGA 4M7DG 2CDTA 2XDPA 3A8GB 1VQ8A 4L6V5 1U1TA 3OYJA 2NUTA 2DZ9A 2COWA 2QI2A 1YP5A 2EYWA 1Q81C 2VXFA 3TQ7P 4CC2A 2ED1A 2PU9B 5GMKm 4X34A 5CK9A 2RMOA 2NUTB 2YUNA 2RI2A 4ME7A 3CXCS 1K9MU 4E7JA 4C8QA 3FLGA 4M7AE 2L89A 3NTHA 2X9HA 1OPLA 3UT1A 3RDVA 2WSCE 2RJDA 1C0MA 1YCSB 5GAN8 1M90C 4M75E 1VIEA 3CBPA 2SRCA 2ZPHB 4MMKA 1NJIR 2MWPA 1D1BA 1NZ9A 2JNGA 1RI9A 4BD3A 5CVIA 2D1XA 2EQMA 2HEQA 2RHIA 3AT1B 3P8HA 3FEOA 3X24B 2FL7A 3HSBA 1AT1B 1UFFA 5CKFA 2LP5A 4FIBA 2D8HA 4E7LA 2YXYA 4DBHA 5ECAA 4J9GA 4RG2A 4RCCA 1I0CA 1M1FA 2XG8D 4DBRA 3L2UA 1TS9A 1X6GA 4L59A 2ABLA 3L1AA 1YWOA 2ROTA 4QVCA 5GAOn 5IH2A 3CPWS 1V1CA 3X26B 1MMAA 2ZPGB 4XTVA 2Z0WA 2ZPIB 2QA4Q 1FMKA 2VV5A 3CCMQ 1K73C 2L3PA 4PL6A 3M56A 5KYUA 4WTOB 1UECA 1R0CB 2RQWA 1NG2A 2D8JA 4O5VA 3OYBA 1YJWQ 2LNVA 4L5GA 3HRUA 4FSXA 1VQ4T 1G3SA 4OB3B 3VRYA 2O9VA 5KYUB 4ORZA 3PNWC 4BI8B 3LW5E 3RERA 4JPBW 1GFDA 4PFPA 2LT1A 1D0XA 2O88A 3A8MB 4DOVA 5KYYB 1VQLA 2FHDA 4RTWA 5IHKA 4PFZA 3DLMA 2VASA 2YLBA 3E2UA 1VA7A 3G4SA 1IHVA 4KGZB 5FRNA 5J39A 3PTAA 1OI1A 1ZUUA 2CZ7B 3QHSA 1C6VX 4XTUA 4A4GA 4A54A 3OYLA 1IB8A 1G2BA 1W70A 3OMGA 4F7UF 2FZKB 4F17A 3UF4A 1M3CA 3EGUA 3MPUB 2EFIA 4AMCA 3URGA 1W2BS 2AZVA 4OMNA 5GAN4 4Q5WA 5GAMf 2JVVA 3VJPA 4M7AG 1K1ZA 4XTXA 4PJMA 5IHIA 4J8OA 3GNFB 3CCLQ 4M7DD 4C92B 4Z88A 2RJEA 4M75G 1ZQ1A 4LD9K 2RNAA 4N4IA 2RK2A 2COYA 1M1KU 1WNLA 2O4XA 2MAMA 3VUZA 4EIKA 2E3IA 2KYMA 4OMQA 2RQRA 4LUDA 2JZ2A 1QVPA 3FJ5A 2KR3A 2R57A 2QGGA 1VQ5T 4EMKA 2O4XB 4HA8A 1VQ7Q 2XICA 5C0MA 4X1VA 3SB2A 5LJ5j 4PKCC 3VV0A 2E1HA 2FPEA 2MOXA 2GQIA 3CCUQ 3JCMe 2QASA 1YHQA 1VQNT 1X43A 2R58A 2F5KA 1VUBA 3OYHA 1K0SA 2C0TA 1GCQA 1S72Q 4M77D 1YJ9Q 3QXEB 2AK5A 3INZA 1M2VB 1QVGA 2DMOA 4PJLA 2RD1A 3SWNA 3RKYA 1MNDA 1H8KA 1G3YA 4E2FB 1V29B 1PKSA 4MZMA 3A8OB 1ZHIA 5KH6A 5D6XA 2P0KA 4ZGDB 2MYSA 5CQXA 2XD0A 1UJ0A 3M55A 4FT4A 4X9CA 2CSQA 1WJSA 3SHWA 2WACA 4J6XA 1KJWA 2BKDN 1D09B 1D0YA 2RHUA 2OX7A 5GMKh 5CIUA 3UA7A 1N8RC 4GBQA 1K0XA 3GF5A 4XTYA 4JRIA 4JRPA 2RQVA 1NJIU 3CMEQ 2OI3A 3H0HA 2DEUA 2ENMA 3JCMV 2KAFA 4D8DA 1HXDA 5AYFA 3HFOA 2ZPBB 5IT9E 1RACB 2BZYA 2MIOA 2SEMA 4PK4A 4C92E 3QPHA 3PIPA 4JZ3A 1BB9A 2YRCA 2E3HA 1QCOA 1BIBA 2HQXA 1N9RA 2NYSA 3CCVT 1UB4A 3SD4A 3V7CA 2RI3A 4M4ZA 2DETA 1YFNA 3UWNA 1QKXA 1Y96A 1UE9A 1OQKA 2ESWA 1Y71A 2XKOC 4BE2A 2DBMA 3CCMA 3CC4T 4IUUA 2XU8A 2EPDA 3QSUA 4FCYA 2EYQA 4R55A 2K5FA 1Y96B 2YRVA 1YJWA 4J9EA 1BCMA 4M7AD 4J7FA 4M7DF 1LJOA 2PVGB 4BE1A 4BY6B 1SF9A 1IRXA 4XU0A 3LLRA 2LQWA 3REBB 4XTWA 2OTJQ 5CAIA 1VQ8Q 3V8LA 3FDRA 4JS5A 1PWTA 3A8LB 5CKEA 1JXMA 1YIJT 4OMOA 4M75D 4V2SA 2K5IA 3U23A 1FWZA 3JCMg 2JS0A 1T3SA 1OV3A 1UJYA 3LH5A 2CT4A 4M77A 3M0SA 5GANj 1Q81U 3UA6A 1WPYA 5EC7A 4PJOA 1OEBA 5DLOA 4FU6A 2VGMA 1SG5A 1MV3A 3FC3A 2JTMA 2M02A 5KCHA 1WHKA 2KDSA 5GAOq 3S3MA 4F14A 4EMGA 1K9MR 3JCMP 3RMSA 1WJRA 2I2LA 4FYVB 1QVFS 1OULA 2QG9B 3CC7T 4ZN1A 2LJ3A 1VQMT 1S1NA 3HPWA 1ZSZA 2K4YA 1M90U 3CCST 3CPFA 4LD6A 1U1SA 4NL3A 1M1KC 1F1BB 3V8JA 4C8QC 2FO0A 1UGPB 4M78B 5GAN3 1ZSZB 3CCSA 2EKHA 2BE7D 4DEYA 1WI7A 1HJDA 2XHCA 3EGDB 3NFCA 1B07A 3RUXA 2HNIA 3OYDA 2LCCA 3CQTA 1VQOT 2P4TA 3OYIA 4C92G 2BIVA 1K4US 3RR6A 1JB0E 4O6JA 4Z89A 3GIBA 3HKSA 4A4EA 1RAFB 2KT8A 4FYYB 2XI9A 1VQ7A 1ZA2B 1OZ3A 1NM7A 2K9GA 4KT0E 2QEXT 1JBMA 1K73U 2E5QA 4LDXA 3OS0A 1EFNA 3O5ZA 1QCNA 2E65A 4A4HA 5FU7C 3OYGA 3FRNA 3OA6A 2RJCA 5HK3A 5HK0A 4OGCA 2YWWA 1XJWB 1S72A 2B86A 3VYGA 1YJ9A 1Q7YC 1WHJA 2EQIA 2E6NA 2CREA 2L2PA 1YI2T 3JCMQ 5LL6S 4M7AA 3L2RA 4AFQC 1MHNA 1T0JA 1UG1A 2EIFA 2VUBA 3QYGB 2DIGA 3N5BB 1C1AA 2ED0A 4M75A 3ZL7C 1WJQA 3CCRT 3M57A 4J6WA 2P0QA 1IHWA 2FPDA 1WXTA 2GF7A 5GMKe 4RTTA 2EGAA 1QLYA 4FL6A 2HL5C 3CCRA 1U5SA 3MP1A 2ZCFB 2PUKB 1J3TA 1W2BP 5HCKA 2FRWA 2ZAEA 4Y92A 1X69A 1LNXA 1G3TA 5AT1B 2M16A 1BU1A 3L42A 1UGSB 2KMTA 2LJ1A 2AKLA 3VS1A 3OS5A 1QMCA 2CP5A 4M78E 3EG1A 2RHYA 1RADB 4J6YA 1ZBJA 2KY9A 1R77A 3BW1A 3VU3C 1K8AU 2AIRB 1M1KR 4FT2A 7AT1B 1P92A 2E12A 1UUEA 4IUPA 4WF2A 1UTIA 1PCXA 3TVTA 3LX7A 3HP9A 1O75A 4HVUA 1VQ5Q 2CUBA 4HCZA 1WYXA 2G6FX 5LJ3j 3KFVA 2CKKA 2E41A 2E64A 4XTZA 4BACA 2MWOA 1RABB 2KRMA 2EQUA 3CCJT 3JCMd 3BDLA 3CD6T 4BB7A 2C0OA 2QQSA 4E7HA 1VQNQ 1W1FA 5LJ3h 3CD6A 2Y4YA 4N4HA 4FM4B 4A63B 4QW2A 2OTJA 3WVEB 3OSVA 5DM7R 4II1A 1UHFA 1RAEB 4ANJA 1UGRB 2PVDB 4GLMA 1CKAA 1YITT 2D6FA 3BFMA 3OYMA 1UGVA 3ULRB 3QG1A 2LTOA 1YITA 5LJ5g 2CH4A 2CT3A 3BY7A 3M0UA 4C92D 2HCKA 3MP8A 3F70A 1GCQC 2X4WA 2K5LA 4E7ZA 1D3BA 2GFAA 2J6OA 5FWCA 1H641 2PZ1A 1OX9A 1ABQA 4YTLA 4QQGA 4OB1B 2RM4A 1N8RU 4MMLA 1D3BB 2V8IA 4NOYA 1GBRA 2Y90A 3X25B 2EWNA 3ME9A 2KXCA 2X51A 5GAN5 1M4ZA 4M77G 3EH2A 2DVEA 3SDZA 5I2SA 1OPKA 3MEWA 4BDZA 3FIFA 3PT9A 2PQWA 1AEYA 4PJOG 4K11A 4C0DC 1ARKA 4C8QF 2BZXA 3MEAA 2V1QA 2PVOB 4XAXB 3I5RA 2I0NA 1H92A 3I35A 3KBGA 2QQBA 2GGRA 4AFUC 1WQWA 1JEGA 1KQ2A 2QGFB 1DJ7B 4UC4A 3TU4K 5HKCA 2M0YA 3CCVQ 1FX7A 4ZTJA 2HSEB 3QYHB 4M78G 1KC8C 1QP3A 4LXCA 2ECZA 3ZFJA 3P8DA 4E7SA 3JB9I 6AT1B 4B9XA 1GXIE 2LMJA 2OTLT 3CC4Q 3VKIA 1WIEA 4KBMB 2HDAA 3ASKA 5KYYA 5CKHA 2E10A 3NGPA 4M7DC 3OBYA 2OTLA 2J7IA 4C0FA 5I22A 2RA2A 5FU7B 4DOWA 1VQ4A 2J6KA 4AFSC 2WSEE 3OQ5A 3REAB 2K6DA 3JAME 1M30A 1KQSP 1ZBXA 3JB9D 1YIJQ 1NYFA 1YNZA 1KHIA 2EGEA 5GMKl 1GL5A 4GLKA 3A8HB 2BUDA 3LYIA 4C5HA 4BE0A 3OYNA 3DKMA 2O31A 1TWBA 4BI4A 2KXDA 1Q81R 2D0QB 4ZTFA 1W4SA 1NLPC 4F7UB 4JJDA 4JZ4A 1T0HA 4OP0A 2DKGA 4ZNXA 1PKTA 2F2WA 1WHGA 2LQKA 1YN8A 3WXMB 3DLLA 2DTIA 1TSFA 3EGXA 4N4GA 4C92A 1N27A 3I5SA 4JJCA 2EQKA 3CC7Q 1QVGS 1VQMQ 2E5KA 3JCMf 4ELZC 3P8BB 4DBFA 3G6ET 3EGXB 3CCSQ 1M90R 2P0PA 5GANg 3OW2A 1GCPA 2FEIA 1BI1A 1K8AC 4DBQA 2EVRA 1M5Q1 4J9IA 8ATCB 1Z9QA 2FRYA 1M9SA 1FYNA 3OSSC 3MEVA 4X9DA 5CO7A 1YJNT 3G1JA 4ZN3A 1WDXA 2X35A 2HBWA 1BIAA 5FW9A 5IN1A 4OMMA 3EG0A 4J9CA 4MZTA 4OMPA 1TXQA 3V8KA 1VQ5A 3S6WA 3E9GA 4KGXB 2FG0A 4E7IA 4AT1B 4ZGEB 3M0QA 5FLXE 3RKXA 1I5LA 2QEXQ 2R5MA 4QVZA 2V8KA 5J26A 1K73R 1M2VA 1U06A 3MO8A 5LJ3e 3H8ZA 5LJ5h 1VQNA 1KSWA 2G3RA 1D1CA 4EDUA 4C0ZA 2EAYA 1BYMA 4PJOD 1M2OA 5DLQE 5L23A 2DXTA 1UHCA 2MPXC 1Q7YU 2P4RA 1ZX6A 4KGVB 1YI2Q 2AKKA 1V76A 2C06A 1X6BA 5C6SA 1PHTA 2A3LA 2Y4XA 1W2BA 3M59A 4QQDA 4M78D 1AOJA 1M3BA 2A36A 4JRQA 1KQ1A 3CCRQ 1IGUA 2KYBA 2RI5A 2X3XD 4F7UE 2D9TA 2LQNA 2VXEA 2XDBA 3BE3A 1VQKT 3DB4A 1AD5A 4PFOA 2QXFA 4M7AC 4QT7A 4OMLA 3X20B 2JN0A 2NUZA 3M5AA 5I2MA 1VQKA 1RAAB 2LVMA 4RTXA 4CC7A 1N5ZA 1JXOA 8AT1B 1SSHA 1UEBA 4M75C 5CR2A 4RMOA 2YSQA 2W10A 1ZUKA 3VS2A 2V26A 2YUOA 4F16A 2F5TX 3M4GA 2DXCA 4HT8A 4LN2A 1K8AR 4EPCA 3CCVA 2VC8A 5CKDA 3OYEA 2CZ0B 1Y07A 3CMAT 1PD0A 3AHUA 2BZ8A 4CRIA 1AWOA 3KXTA 9ATCB 4FW2A 1YCYA 2AT1B 2JS2A 1PC0A 2FVUA 2FYKA 2LQ8A 3CC4A 3QUIA 3CCJQ 3NHNA 1ZSGA 4JJNK 2C0IA 3CD6Q 1X2QA 5KYWA 2IPOB 3G71T 5GAN2 2L3SA 4M7DB 5A0LA 2L3QA 1SHFA 2LX9A 1HYOA 1JJ2S 1N6AA 3G7ZA 4PJJA 3VS3A 5DY9A 3G71A 3L2VA 1MUZA 3CBOA 4R0KA 5KYWB 3Q1JA 1WZOA 3EAEA 1QCFA 3VRZA 2LCSA 2PTKA 5FU6C 1YWPA 2RQUA 3I55T 4N0AA 1YIJA 1YITQ 1RLQC 3TSWA 3CC2T 2H3JA 1RAGB 2VYTA 1KD1U 4E7KA 5LJ3g 5GAOm 5GAMg 2K57A 4RTYA 5A2QE 2GTOA 2QTVA 4OB0B 3CC2A 3PFSA 3CXCP 2DX1A 3OY9A 4AG2C 3T9NA 2FZGB 1BCOA 5GANh 2QQAA 2YUPA 3L2ZA 2OAUA 1QKWA 4M78A 1RL2A 2YHTA 1HK9A 4M77F 2A08A 1N8RR 4IUVA 3VS6A 3CC7A 3HL8A 4F7UG 1VQMA 1D0ZA 4PJOF 3EGDA 4A53A 1VQ6T 2KNBB 3GBQA 1NEBA 4XU3A 1UDLA 2F69A 3JV3A 2IIMA 1H3HA 1VQ6A 5HY6A 2LJ0A 5KCOA 3CCQT 1YBYA 4IUTA 3MKDA 2O2OA 2JT4A 3C0CA 2RQTA 3HTRA 4C5GA 2XMFA 2QTXA 2HQEA 1LPLA 1M27C 1ZLMA 3E9FA 3CPWP 1RAHB 3WVDB 2V8JA 1OU9A 1VQOA 5KE3A 1TUGB 3QJ6A 1FXXA 1KC8U 5M9OA 2LT4A 1OOTA 2X4JA 1OZ2A 2NUPA 4QVDA 3JCMX 2EBPA 2LRQA 1I5OB 1KQSA 1GBQA 5GAN6 2OTLQ 2YRDA 2QEXA 4KUDK 3ZBDA 5LJ5e 1VQ4Q 5D7UA 4CI0C 2KI7A 2NUPB 1X2KA 1QWFA 1LOJA 2CYZB 1TUDA 1BI3A 1PG5B 2KSSA 4DEXA 3META 4M7DE 1WA7A 1MGQA 5GAOr 1K9AA 2NLUA 1VQPT 2O01E 5GAN7 2VWFA 4WCIA 3LWHA 5EG2A 4KRTA 1YI2A 4P5NA 1Y7XA 3H41A 3OYYA 1PD1A 3FJPA 1JO8A 1NPPA 1PM3A 2RB6A 1E7OA 4KULA 3M0RA 3NTKA 2O9SA 2HD0A 5GMKi 4M7AF 3OB9A 4VUBA 4JLGA 1I81A 3DB3A 1LCKA 2P84A 2COZA 1FMWA 3D7SB 4ELYC 3TCJA 2OJ2A 3EHQA 2ZGWA 2LZ6B 2K3BA 2K3XA 4M75F 1TOVA 3G6EQ 1VYVA 3JB9G 1NE8A 2J05A 3VS7A 2K2MA 2QQRA 2EJFA 3MEUA 3EG9A 5CCAA 1WQ7A 4C92C 3QDRB 3R6NA 2DL8A 3EG9B 2DXBA 1YJNQ 1SPKA 1BI2A 2KT1A 2F2XA 4OGEA 1BBZA 2DD5A 1IREB 2DM1A 3GPLA 3I56T 3IQLA 5GAMj 5KYXA 2BTTA 3H9NA 2LNHB 1SRMA 3V7RA 2CP0A 2EYYA 1BK2A 3I56A 1Y57A 1R8OB 2DXUA 3CCJA 5KYXB 1VYUA 2D0NA 2DZCA 2CP3A 3BDUA 4HVWA 2W0ZA 5GAMh 1NBEB 2E70A 4EMKC 3RESA 2FZCB 4IUQA 3JRZA 4J5YA 3H6ZA 4D6WA 3KUFA 2DYIA 1KD1C 4BUGA 1JQQA 1T3LA 4J9FA 1XNIA 4XK8E 5FU6B 4Y28E 4KH1B 1Q7YR 1AWJA 2JMAA 2K7AA 3L2WA 3EFOB 4HCBA 1MMGA 1RAIB 4IIMA 4TVRA 4RG8A 1BKBA 2ZPEB 5I11A 2L8DA 5KE2A 1QQJA 2PNIA 2CP6A 2MF2A 5GANe 4OF1A 1IO6A 2JXBA 2H3EB 1PSFA 3SWNC 1KFZA 4JJBA 3V7SA 2B8AA 4AG1C 1VQKQ 2KE9A 2DIQA 1ZA1B 2M9UA 1RUWA 2GCXA 2LX7A 1NLOC 1FMVA 5IXBA 1VQ9T 2DD4A 2DRMA 1JU5C 3OYCA 2JM8A 4RCBA 4C8QB 2HQHA 2DJQA 1VQ9A 1JRIA 3OYAA 2JMCA 2CZ6B 2KROA 2J6FA 3PVLA 3PVQA 2HSPA 1NEGA 2DBKA 1AVZC 3EH1A 3E1SA 4LDYA 3NTIA 4HCCA 2QK0A 2AHJB 2HKNA 2X4YA 2DTHA 2MCNA 2MI6A 3CMAQ 1WHHA 2RHXA 2JJ9A 1AWXA 4A4FA 4CC4B 2DE0X 3OW2S 2J06A 4HKEA 1M8VA 3QO3A 1Q86U 3THKA 1CKBA 1I4K1 1UGQB 3G71Q 3GLXA 1AHJB 5CKBA 1JJ2P 3GNGA 3CXCA 1IXDA 3TEEA 4MZPA 2H8HA 4BY6C 3J81E 3RBBB 4IURA 2CP7A 4F7UA 3I55Q 1VQLT 3PIOA 5FROA 1Y0MA 3CC2Q 3QZ9B 1B7TA 3G4ST 1KD1R 2QDLA 5L8RE 2A28A 3VS4A 3OYKA 2FPFA 3OBWA 5D6WA 2DILA 2ROLA 1QVFP 4LUEA 4N0AC 3VYHB 3A5ZB 3OMCA 4M77C 1KG1A 1AWWA 3TSZA 3QBYA 4LNPA 3RKWA 1SRLA 3QKJA 4PJOC 4HT9A 3OS1A 2DF6A 3LH0A 1Q82U 2DL7A 3S3OA 4C0GA 3CPWA 2DPPB 3CCET 5LJ3f 1VQ6Q 1RI0A 2RK1A 3G6EA 3JSCA 4J7IA 4J83A 3UPUA 4MDXA 4C8QE 3C94A 3FB9A 3CCEA 5J3BA 2KVQG 2DERA 4C92F 1HSQA 3M0TA 4GY5A 4M78C 3CCQQ 1ZSZC 3JCMb 1E6HA 1WHMA 3C12A 4QKUA 3QDFA 3PGGA 3E19A 1VQOQ 2VKNA 2K3YA 1O9SA 1YJNA 2CP2A 3CEYA 3SEMA 4B6MA 4JLIA 3GP8A 4PLIA 3LGLA 1KC8R 4RTUA 1B3QA 2F1LA 4KH0B 2JTFA 2GQVA 1G83A 4ESRA 3GOXA 4FW1A 4JDSA 1HD3A 2JM9A 2KBTA 3MHXA 5LJ5d 1YHQT 1H3ZA 5GAMe 3NMZC 4LDUA 2EW3A 3JCMJ 3H0IA 5A0GA 4E6RA 3NPFA 1G5VA 2ATCB 5GJVB 3C95A 4EMKB 3JCMc 3MJXA 2HZYA 3C4SA 2R5AA 4OVAA 1VQPQ 3LWIA 4J9BA 2DLPA 5FRMA 1SEMA 3A98A 1PRMC 1N9SA 2KRSA 2A0FB 3I9QA 1D1AA 2EQJA 4IIOA 4DQ2A 4ATOA 2JTEA 2L0AA 3M58A 2YUQA 1WX6A 1U3OA 5GMKj 1X6OA 2EGCA 2DTOA 1K9MC 2YDLA 2L5QA 2OAWA 3SWNB 2MK5A 3QZ5B 2DEQA 2XDDA 2FB7A 2ZZDA 2GTJA 4KUIA 4NS5A 5IHNA 1M3AA 4E47A 3OYFA 5CQYA 2NWMA 2EKOA 1PRLC 4XQ3A 3JB9F 1TH7A 4R56A 2VB6A 3M0PA 4C0DB 2VGNA 2DK3A 3UATA 3EHRA 3QWXX 1XOVA 4A4KA 4C5EA 2F2VA 4BDYA 1EZZB 2XIDA 2LCLA 2X3WD 3EG2A 3M4YA 4RTVA 2M51A 4C8QG 4RKUE 2DL5A 2LC4A 2RH2A 4CC3A 1MMNA 3CMAA 2A7YA 5D6YA 4D8KA 4AFZC 1SKUB 4M7DA 3PMIA 3I56Q 1TU0B 1EX4A 2ZPFB 5A0DA 2QA4T 3CCMT 1Q86C 2V1RA
chains in the Genus database with same CATH topology
4KRTA 2DL4A 1QWEA 2KRNA 2RNAA 3H41A 3VS0A 1GBRA 2KXCA 2DL3A 3QWYA 4EIKA 1JO8A 2KYMA 1OPKA 4OMQA 2RQRA 4LUDA 1E7OA 3FJ5A 2KR3A 1AEYA 4K11A 1ARKA 3M0RA 2BZXA 2O9SA 1KIKA 2V1QA 4X1VA 2RF0A 3I5RA 2I0NA 2FPEA 3I35A 1H92A 2MOXA 1LCKA 2GGRA 2GQIA 2AZSA 4AFUC 1WLPB 1K76A 1JEGA 1MV0B 2OJ2A 3EHQA 1GRIA 2LZ6B 2M0YA 2K3BA 1X43A 1ZUYA 2ECZA 1K0SA 2C0TA 2RPNA 1VYVA 1GCQA 2CH4W 2J05A 3VS7A 2K2MA 2AK5A 1AZGB 4LE9A 1WXUA 1ABOA 2LMJA 2DMOA 2KGTA 1WIEA 2HDAA 1H8KA 3R6NA 2DL8A 3NGPA 1PKSA 1Z9ZA 2J7IA 5I22A 2JW4A 1SPKA 2KT1A 1TUCA 2J6KA 1UJ0A 2F2XA 4AFSC 1BBZA 1I1JA 4HVVA 2CSQA 3REAB 2DM1A 2K6DA 3SHWA 3IQLA 1KJWA 2BTTA 1I07A 1M30A 2LNHB 1SRMA 1NYFA 1YNZA 3PE0A 3UA7A 2EYYA 2EGEA 1BK2A 2KEAA 4GBQA 1K0XA 1GL5A 2DA9A 1Y57A 2DYBA 2RQVA 1E6GA 3VS5A 1VYUA 2D0NA 4HVWA 2OI3A 2W0ZA 3H0HA 2O31A 2KXDA 2ENMA 4D8DA 4J9HA 1GFCA 4FSSA 1NLPC 4JJDA 4JZ4A 1T0HA 2BZYA 2MIOA 2SEMA 1JQQA 4ZNXA 1T3LA 4J9FA 1PKTA 2F2WA 2A37A 1YN8A 4RUGA 1AWJA 2JMAA 4JZ3A 2K7AA 1BB9A 3I5SA 4JJCA 4IIMA 2E5KA 2CUDA 5I11A 2PNIA 5IXFA 2YT6A 4M4ZA 1IO6A 2JXBA 1GCPA 1QKXA 1UE9A 2FEIA 1KFZA 2ESWA 4JJBA 4AG1C 2EVRA 2DBMA 4J9IA 2KE9A 1Z9QA 2EPDA 2FRYA 1FYNA 1CSKA 1RUWA 1M8MA 2GNCA 2LX7A 2RN8A 1WFWA 2DNUA 1NLOC 3RNJA 4J9EA 5IXBA 1WDXA 2HBWA 2DRMA 1JU5C 5FW9A 2JM8A 4OMMA 3EG0A 2LQWA 3REBB 4Z8AA 4J9CA 2DJQA 4OMPA 1PWTA 1NYGA 2JMCA 1A0NB 2FG0A 1JXMA 2KROA 2J6FA 3PVLA 4OMOA 3PVQA 1AZEA 2HSPA 1NEGA 3M0QA 3U23A 1VYTA 2JS0A 1T3SA 1OV3A 2DBKA 2DRKA 1UJYA 3LH5A 1AVZC 1U06A 2CT4A 3M0SA 1PNJA 3UA6A 1KSWA 5EC7A 2MCNA 1OEBA 5L23A 1AWXA 1MV3A 4CC4B 1UHCA 2VVKA 2DE0X 2P4RA 4F14A 1ZX6A 2J06A 2AKKA 3EG3A 1X6BA 1TG0A 4J9DA 1PHTA 2LJ3A 3THKA 1CKBA 1S1NA 2EYXA 2EYZA 4RTZA 2DVJA 1AOJA 1M3BA 1WXBA 1RLPC 2A36A 2H8HA 2KYBA 2X3XD 2GBQA 3RBBB 2LQNA 2FO0A 1AD5A 2EKHA 4HXJA 1W6XA 4DEYA 1WI7A 4QT7A 1Y0MA 4OMLA 2NUZA 1HJDA 4RTXA 2QDLA 1B07A 4CC7A 1X27A 5FWBA 2A28A 1N5ZA 1JXOA 2CSIA 3VS4A 1SSHA 3CQTA 2K79A 2FPFA 1K4US 5GJWB 2YSQA 4HCKA 3H0FA 2W10A 2DILA 4Z89A 1SHGA 2ROLA 2CDTA 4LUEA 1ZUKA 2KT8A 1NM7A 2K9GA 1AWWA 3TSZA 3VS2A 4LNPA 2YUOA 4F16A 1SRLA 1YP5A 2EYWA 1EFNA 2DF6A 3O5ZA 4LN2A 4CC2A 2ED1A 2DL7A 2RMOA 2YUNA 2BZ8A 1AWOA 2B86A 2EQIA 2CREA 2L2PA 1HSQA 3M0TA 2JS2A 1E6HA 1OPLA 3NHNA 4AFQC 1ZSGA 1T0JA 1UG1A 2C0IA 1X2QA 2VKNA 1YCSB 2L3SA 2L3QA 1SHFA 3SEMA 2ED0A 2SRCA 3ZL7C 3VS3A 1RI9A 1MUZA 2D1XA 2FPDA 1WXTA 2HEQA 4R0KA 4RTUA 1QCFA 1B3QA 2LCSA 4RTTA 2EGAA 3VRZA 1QLYA 2PTKA 1YWPA 2RQUA 1G83A 4ESRA 1UFFA 2LP5A 1HD3A 1U5SA 1RLQC 2JM9A 2KBTA 3TSWA 2D8HA 5ECAA 1J3TA 3NMZC 4J9GA 2FRWA 5HCKA 4Y92A 4RTYA 2EW3A 1I0CA 1X69A 3H0IA 2GTOA 4E6RA 3NPFA 2DX1A 1X6GA 5GJVB 2ABLA 4AG2C 1YWOA 2ROTA 1BU1A 5IH2A 1V1CA 2LJ1A 2AKLA 4J9BA 3VS1A 1FMKA 2DLPA 2YUPA 1QKWA 2L3PA 3EG1A 1SEMA 3A98A 1PRMC 1UECA 1ZBJA 2KRSA 2RQWA 3I9QA 2A08A 1NG2A 3VS6A 2D8JA 4IIOA 2JTEA 1UUEA 2L0AA 2YUQA 1WX6A 1UTIA 2KNBB 1U3OA 3VRYA 3GBQA 2O9VA 3TVTA 4ORZA 1NEBA 2EGCA 1UDLA 4HVUA 3JV3A 2IIMA 2CUBA 1H3HA 2YDLA 4JPBW 1GFDA 1WYXA 2OAWA 2G6FX 3KFVA 2LJ0A 2O88A 2KRMA 2O2OA 2GTJA 2JT4A 4RTWA 5IHKA 3C0CA 2RQTA 2XMFA 5IHNA 1M3AA 2NWMA 2C0OA 1VA7A 1M27C 1ZLMA 1PRLC 1W1FA 1ZUUA 3M0PA 4A63B 3UATA 1OOTA 1G2BA 1UHFA 1W70A 3EHRA 3QWXX 2EBPA 1XOVA 2F2VA 4GLMA 4F17A 3UF4A 1M3CA 1CKAA 3EGUA 1GBQA 2X3WD 3EG2A 4RTVA 1UGVA 3ULRB 2M51A 1X2KA 1QWFA 2AZVA 4OMNA 2DL5A 2CH4A 1TUDA 2CT3A 4CC3A 4DEXA 3M0UA 1WA7A 1K1ZA 2HCKA 1GCQC 4D8KA 5IHIA 4AFZC 1K9AA 2J6OA 5FWCA 2PZ1A 4Z88A 1ABQA 2VWFA 2V1RA 4WCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KRT A;  2DL4 A;  1QWE A;  2KRN A;  2RNA A;  3H41 A;  3VS0 A;  1GBR A;  2KXC A;  2DL3 A;  3QWY A;  4EIK A;  1JO8 A;  2KYM A;  1OPK A;  4OMQ A;  2RQR A;  4LUD A;  1E7O A;  3FJ5 A;  2KR3 A;  1AEY A;  4K11 A;  1ARK A;  3M0R A;  2BZX A;  2O9S A;  1KIK A;  2V1Q A;  4X1V A;  2RF0 A;  3I5R A;  2I0N A;  2FPE A;  3I35 A;  1H92 A;  2MOX A;  1LCK A;  2GGR A;  2GQI A;  2AZS A;  4AFU C;  1WLP B;  1K76 A;  1JEG A;  1MV0 B;  2OJ2 A;  3EHQ A;  1GRI A;  2LZ6 B;  2M0Y A;  2K3B A;  1X43 A;  1ZUY A;  2ECZ A;  1K0S A;  2C0T A;  2RPN A;  1VYV A;  1GCQ A;  2CH4 W;  2J05 A;  3VS7 A;  2K2M A;  2AK5 A;  1AZG B;  4LE9 A;  1WXU A;  1ABO A;  2LMJ A;  2DMO A;  2KGT A;  1WIE A;  2HDA A;  1H8K A;  3R6N A;  2DL8 A;  3NGP A;  1PKS A;  1Z9Z A;  2J7I A;  5I22 A;  2JW4 A;  1SPK A;  2KT1 A;  1TUC A;  2J6K A;  1UJ0 A;  2F2X A;  4AFS C;  1BBZ A;  1I1J A;  4HVV A;  2CSQ A;  3REA B;  2DM1 A;  2K6D A;  3SHW A;  3IQL A;  1KJW A;  2BTT A;  1I07 A;  1M30 A;  2LNH B;  1SRM A;  1NYF A;  1YNZ A;  3PE0 A;  3UA7 A;  2EYY A;  2EGE A;  1BK2 A;  2KEA A;  4GBQ A;  1K0X A;  1GL5 A;  2DA9 A;  1Y57 A;  2DYB A;  2RQV A;  1E6G A;  3VS5 A;  1VYU A;  2D0N A;  4HVW A;  2OI3 A;  2W0Z A;  3H0H A;  2O31 A;  2KXD A;  2ENM A;  4D8D A;  4J9H A;  1GFC A;  4FSS A;  1NLP C;  4JJD A;  4JZ4 A;  1T0H A;  2BZY A;  2MIO A;  2SEM A;  1JQQ A;  4ZNX A;  1T3L A;  4J9F A;  1PKT A;  2F2W A;  2A37 A;  1YN8 A;  4RUG A;  1AWJ A;  2JMA A;  4JZ3 A;  2K7A A;  1BB9 A;  3I5S A;  4JJC A;  4IIM A;  2E5K A;  2CUD A;  5I11 A;  2PNI A;  5IXF A;  2YT6 A;  4M4Z A;  1IO6 A;  2JXB A;  1GCP A;  1QKX A;  1UE9 A;  2FEI A;  1KFZ A;  2ESW A;  4JJB A;  4AG1 C;  2EVR A;  2DBM A;  4J9I A;  2KE9 A;  1Z9Q A;  2EPD A;  2FRY A;  1FYN A;  1CSK A;  1RUW A;  1M8M A;  2GNC A;  2LX7 A;  2RN8 A;  1WFW A;  2DNU A;  1NLO C;  3RNJ A;  4J9E A;  5IXB A;  1WDX A;  2HBW A;  2DRM A;  1JU5 C;  5FW9 A;  2JM8 A;  4OMM A;  3EG0 A;  2LQW A;  3REB B;  4Z8A A;  4J9C A;  2DJQ A;  4OMP A;  1PWT A;  1NYG A;  2JMC A;  1A0N B;  2FG0 A;  1JXM A;  2KRO A;  2J6F A;  3PVL A;  4OMO A;  3PVQ A;  1AZE A;  2HSP A;  1NEG A;  3M0Q A;  3U23 A;  1VYT A;  2JS0 A;  1T3S A;  1OV3 A;  2DBK A;  2DRK A;  1UJY A;  3LH5 A;  1AVZ C;  1U06 A;  2CT4 A;  3M0S A;  1PNJ A;  3UA6 A;  1KSW A;  5EC7 A;  2MCN A;  1OEB A;  5L23 A;  1AWX A;  1MV3 A;  4CC4 B;  1UHC A;  2VVK A;  2DE0 X;  2P4R A;  4F14 A;  1ZX6 A;  2J06 A;  2AKK A;  3EG3 A;  1X6B A;  1TG0 A;  4J9D A;  1PHT A;  2LJ3 A;  3THK A;  1CKB A;  1S1N A;  2EYX A;  2EYZ A;  4RTZ A;  2DVJ A;  1AOJ A;  1M3B A;  1WXB A;  1RLP C;  2A36 A;  2H8H A;  2KYB A;  2X3X D;  2GBQ A;  3RBB B;  2LQN A;  2FO0 A;  1AD5 A;  2EKH A;  4HXJ A;  1W6X A;  4DEY A;  1WI7 A;  4QT7 A;  1Y0M A;  4OML A;  2NUZ A;  1HJD A;  4RTX A;  2QDL A;  1B07 A;  4CC7 A;  1X27 A;  5FWB A;  2A28 A;  1N5Z A;  1JXO A;  2CSI A;  3VS4 A;  1SSH A;  3CQT A;  2K79 A;  2FPF A;  1K4U S;  5GJW B;  2YSQ A;  4HCK A;  3H0F A;  2W10 A;  2DIL A;  4Z89 A;  1SHG A;  2ROL A;  2CDT A;  4LUE A;  1ZUK A;  2KT8 A;  1NM7 A;  2K9G A;  1AWW A;  3TSZ A;  3VS2 A;  4LNP A;  2YUO A;  4F16 A;  1SRL A;  1YP5 A;  2EYW A;  1EFN A;  2DF6 A;  3O5Z A;  4LN2 A;  4CC2 A;  2ED1 A;  2DL7 A;  2RMO A;  2YUN A;  2BZ8 A;  1AWO A;  2B86 A;  2EQI A;  2CRE A;  2L2P A;  1HSQ A;  3M0T A;  2JS2 A;  1E6H A;  1OPL A;  3NHN A;  4AFQ C;  1ZSG A;  1T0J A;  1UG1 A;  2C0I A;  1X2Q A;  2VKN A;  1YCS B;  2L3S A;  2L3Q A;  1SHF A;  3SEM A;  2ED0 A;  2SRC A;  3ZL7 C;  3VS3 A;  1RI9 A;  1MUZ A;  2D1X A;  2FPD A;  1WXT A;  2HEQ A;  4R0K A;  4RTU A;  1QCF A;  1B3Q A;  2LCS A;  4RTT A;  2EGA A;  3VRZ A;  1QLY A;  2PTK A;  1YWP A;  2RQU A;  1G83 A;  4ESR A;  1UFF A;  2LP5 A;  1HD3 A;  1U5S A;  1RLQ C;  2JM9 A;  2KBT A;  3TSW A;  2D8H A;  5ECA A;  1J3T A;  3NMZ C;  4J9G A;  2FRW A;  5HCK A;  4Y92 A;  4RTY A;  2EW3 A;  1I0C A;  1X69 A;  3H0I A;  2GTO A;  4E6R A;  3NPF A;  2DX1 A;  1X6G A;  5GJV B;  2ABL A;  4AG2 C;  1YWO A;  2ROT A;  1BU1 A;  5IH2 A;  1V1C A;  2LJ1 A;  2AKL A;  4J9B A;  3VS1 A;  1FMK A;  2DLP A;  2YUP A;  1QKW A;  2L3P A;  3EG1 A;  1SEM A;  3A98 A;  1PRM C;  1UEC A;  1ZBJ A;  2KRS A;  2RQW A;  3I9Q A;  2A08 A;  1NG2 A;  3VS6 A;  2D8J A;  4IIO A;  2JTE A;  1UUE A;  2L0A A;  2YUQ A;  1WX6 A;  1UTI A;  2KNB B;  1U3O A;  3VRY A;  3GBQ A;  2O9V A;  3TVT A;  4ORZ A;  1NEB A;  2EGC A;  1UDL A;  4HVU A;  3JV3 A;  2IIM A;  2CUB A;  1H3H A;  2YDL A;  4JPB W;  1GFD A;  1WYX A;  2OAW A;  2G6F X;  3KFV A;  2LJ0 A;  2O88 A;  2KRM A;  2O2O A;  2GTJ A;  2JT4 A;  4RTW A;  5IHK A;  3C0C A;  2RQT A;  2XMF A;  5IHN A;  1M3A A;  2NWM A;  2C0O A;  1VA7 A;  1M27 C;  1ZLM A;  1PRL C;  1W1F A;  1ZUU A;  3M0P A;  4A63 B;  3UAT A;  1OOT A;  1G2B A;  1UHF A;  1W70 A;  3EHR A;  3QWX X;  2EBP A;  1XOV A;  2F2V A;  4GLM A;  4F17 A;  3UF4 A;  1M3C A;  1CKA A;  3EGU A;  1GBQ A;  2X3W D;  3EG2 A;  4RTV A;  1UGV A;  3ULR B;  2M51 A;  1X2K A;  1QWF A;  2AZV A;  4OMN A;  2DL5 A;  2CH4 A;  1TUD A;  2CT3 A;  4CC3 A;  4DEX A;  3M0U A;  1WA7 A;  1K1Z A;  2HCK A;  1GCQ C;  4D8K A;  5IHI A;  4AFZ C;  1K9A A;  2J6O A;  5FWC A;  2PZ1 A;  4Z88 A;  1ABQ A;  2VWF A;  2V1R A;  4WCI A; 
#chains in the Genus database with same CATH topology
 4JUV A;  1M1G A;  4LDV A;  3S3N A;  2DL4 A;  2IVW A;  1QWE A;  2KRN A;  2JUF A;  3JB9 H;  4OB2 B;  2HKQ B;  2QA4 A;  3RIR A;  4MDW A;  1YJW T;  2LDM A;  3VS0 A;  5GAO p;  1PSE A;  2DL3 A;  3QWY A;  2DJZ A;  1VOM A;  1OU8 A;  2M0O A;  2XK0 A;  1TTH B;  3PMT A;  2QDY B;  3JB9 J;  4FYX B;  3M9Q A;  1XTD A;  1KIK A;  3I55 A;  2RF0 A;  2E4H A;  2AZS A;  1QP2 A;  1WLP B;  1KQS S;  1K76 A;  1MV0 B;  3QJY A;  2MMP A;  1GRI A;  4Y91 A;  1ZUY A;  1U8R A;  5GAN d;  1MNE A;  2QQ9 A;  4B9W A;  2RPN A;  2CH4 W;  3CBM A;  1IZ6 A;  3HRT A;  2HMA A;  1AZG B;  2GFU A;  4LE9 A;  2PUO B;  1WXU A;  3M53 A;  1ABO A;  3MCA B;  1NPR A;  1Q82 C;  1KK7 A;  4M77 B;  3ER0 A;  2KGT A;  1OYX A;  3TRE A;  1WGS A;  4PJO B;  4NL2 A;  2HL3 A;  1Z9Z A;  5LJ5 f;  2DAQ A;  2JW4 A;  4ZGJ B;  1VQ9 Q;  1TUC A;  1I1J A;  4HVV A;  3CCL T;  1I07 A;  1IGQ A;  4M78 F;  3PE0 A;  2DFU A;  2KEA A;  4JS4 A;  3CCQ A;  3CCL A;  3EFS A;  2DA9 A;  3HRS A;  2WSF E;  2DYB A;  2HBP A;  4XU1 A;  1E6G A;  1X01 A;  3VS5 A;  1QW1 A;  2EJG A;  2KQW A;  3O8V A;  4J9H A;  1JJ2 A;  1GFC A;  4FSS A;  2RJF A;  3RMQ A;  3VUB A;  1VQ7 T;  2A37 A;  3OW2 P;  1LVK A;  4RUG A;  4OMF B;  3CCU T;  3L2Q A;  5I21 A;  2CUD A;  3A1P A;  3X28 B;  1Q86 R;  2CGH A;  3CCU A;  3MP6 A;  3SFM A;  1Q95 G;  5IXF A;  4PJN A;  2YT6 A;  3J7A F;  1S72 T;  1SSF A;  1YJ9 T;  1X75 C;  1VQP A;  4LDW A;  4BI3 A;  1QVF A;  5GAO l;  2RO0 A;  3QII A;  3M54 A;  1VQL Q;  2JOY A;  5KYN A;  1CSK A;  4Z02 A;  1R0B G;  2HAX A;  1M8M A;  1VIF A;  2GNC A;  2RN8 A;  1WFW A;  2DNU A;  4C8Q D;  3G4S Q;  3RNJ A;  4PNO A;  3JCM W;  2KK4 A;  2QAZ A;  1KHC A;  2IG0 A;  3UDC A;  2RHZ A;  4QQ6 A;  3EFR A;  4Z8A A;  1NYG A;  1A0N B;  2K2V A;  4M7A B;  4EMH A;  4XU2 A;  1AZE A;  1QVG P;  1VYT A;  1XQH A;  2DRK A;  1NJI C;  4M77 E;  1EIF A;  3CME T;  4M75 B;  1PNJ A;  4F04 B;  4PJO E;  1Q82 R;  2M1H A;  2X4X A;  3CCE Q;  3CME A;  1B34 A;  2CS7 A;  1MMD A;  2L3R A;  2DO3 A;  2VVK A;  3ZEH A;  4PLL A;  1I8F A;  1B34 B;  2E6Z A;  3EG3 A;  1TG0 A;  4J9D A;  4DA4 A;  2CZ1 B;  2EYX A;  2EYZ A;  4RTZ A;  2DVJ A;  1BI0 A;  3J80 E;  1WXB A;  1RLP C;  1G3W A;  5GAN f;  1OX8 A;  2GBQ A;  4HXJ A;  1W6X A;  2EJ9 A;  1G8X A;  4IKF A;  5LJ3 d;  3R6O A;  4C5I A;  2QYZ A;  5GAM d;  2BE9 B;  4FYW B;  5IAY A;  1YHQ Q;  2YLC A;  1X27 A;  1ACM B;  5FWB A;  3JCM h;  2CSI A;  3EFO A;  2K79 A;  3HFN A;  2OTJ T;  3OS2 A;  5GJW B;  1WHL A;  4HCK A;  1VQ8 T;  3H0F A;  3LGF A;  4JRK A;  3HHT B;  1SHG A;  4M7D G;  2CDT A;  2XDP A;  3A8G B;  1VQ8 A;  4L6V 5;  1U1T A;  3OYJ A;  2NUT A;  2DZ9 A;  2COW A;  2QI2 A;  1YP5 A;  2EYW A;  1Q81 C;  2VXF A;  3TQ7 P;  4CC2 A;  2ED1 A;  2PU9 B;  5GMK m;  4X34 A;  5CK9 A;  2RMO A;  2NUT B;  2YUN A;  2RI2 A;  4ME7 A;  3CXC S;  1K9M U;  4E7J A;  4C8Q A;  3FLG A;  4M7A E;  2L89 A;  3NTH A;  2X9H A;  1OPL A;  3UT1 A;  3RDV A;  2WSC E;  2RJD A;  1C0M A;  1YCS B;  5GAN 8;  1M90 C;  4M75 E;  1VIE A;  3CBP A;  2SRC A;  2ZPH B;  4MMK A;  1NJI R;  2MWP A;  1D1B A;  1NZ9 A;  2JNG A;  1RI9 A;  4BD3 A;  5CVI A;  2D1X A;  2EQM A;  2HEQ A;  2RHI A;  3AT1 B;  3P8H A;  3FEO A;  3X24 B;  2FL7 A;  3HSB A;  1AT1 B;  1UFF A;  5CKF A;  2LP5 A;  4FIB A;  2D8H A;  4E7L A;  2YXY A;  4DBH A;  5ECA A;  4J9G A;  4RG2 A;  4RCC A;  1I0C A;  1M1F A;  2XG8 D;  4DBR A;  3L2U A;  1TS9 A;  1X6G A;  4L59 A;  2ABL A;  3L1A A;  1YWO A;  2ROT A;  4QVC A;  5GAO n;  5IH2 A;  3CPW S;  1V1C A;  3X26 B;  1MMA A;  2ZPG B;  4XTV A;  2Z0W A;  2ZPI B;  2QA4 Q;  1FMK A;  2VV5 A;  3CCM Q;  1K73 C;  2L3P A;  4PL6 A;  3M56 A;  5KYU A;  4WTO B;  1UEC A;  1R0C B;  2RQW A;  1NG2 A;  2D8J A;  4O5V A;  3OYB A;  1YJW Q;  2LNV A;  4L5G A;  3HRU A;  4FSX A;  1VQ4 T;  1G3S A;  4OB3 B;  3VRY A;  2O9V A;  5KYU B;  4ORZ A;  3PNW C;  4BI8 B;  3LW5 E;  3RER A;  4JPB W;  1GFD A;  4PFP A;  2LT1 A;  1D0X A;  2O88 A;  3A8M B;  4DOV A;  5KYY B;  1VQL A;  2FHD A;  4RTW A;  5IHK A;  4PFZ A;  3DLM A;  2VAS A;  2YLB A;  3E2U A;  1VA7 A;  3G4S A;  1IHV A;  4KGZ B;  5FRN A;  5J39 A;  3PTA A;  1OI1 A;  1ZUU A;  2CZ7 B;  3QHS A;  1C6V X;  4XTU A;  4A4G A;  4A54 A;  3OYL A;  1IB8 A;  1G2B A;  1W70 A;  3OMG A;  4F7U F;  2FZK B;  4F17 A;  3UF4 A;  1M3C A;  3EGU A;  3MPU B;  2EFI A;  4AMC A;  3URG A;  1W2B S;  2AZV A;  4OMN A;  5GAN 4;  4Q5W A;  5GAM f;  2JVV A;  3VJP A;  4M7A G;  1K1Z A;  4XTX A;  4PJM A;  5IHI A;  4J8O A;  3GNF B;  3CCL Q;  4M7D D;  4C92 B;  4Z88 A;  2RJE A;  4M75 G;  1ZQ1 A;  4LD9 K;  2RNA A;  4N4I A;  2RK2 A;  2COY A;  1M1K U;  1WNL A;  2O4X A;  2MAM A;  3VUZ A;  4EIK A;  2E3I A;  2KYM A;  4OMQ A;  2RQR A;  4LUD A;  2JZ2 A;  1QVP A;  3FJ5 A;  2KR3 A;  2R57 A;  2QGG A;  1VQ5 T;  4EMK A;  2O4X B;  4HA8 A;  1VQ7 Q;  2XIC A;  5C0M A;  4X1V A;  3SB2 A;  5LJ5 j;  4PKC C;  3VV0 A;  2E1H A;  2FPE A;  2MOX A;  2GQI A;  3CCU Q;  3JCM e;  2QAS A;  1YHQ A;  1VQN T;  1X43 A;  2R58 A;  2F5K A;  1VUB A;  3OYH A;  1K0S A;  2C0T A;  1GCQ A;  1S72 Q;  4M77 D;  1YJ9 Q;  3QXE B;  2AK5 A;  3INZ A;  1M2V B;  1QVG A;  2DMO A;  4PJL A;  2RD1 A;  3SWN A;  3RKY A;  1MND A;  1H8K A;  1G3Y A;  4E2F B;  1V29 B;  1PKS A;  4MZM A;  3A8O B;  1ZHI A;  5KH6 A;  5D6X A;  2P0K A;  4ZGD B;  2MYS A;  5CQX A;  2XD0 A;  1UJ0 A;  3M55 A;  4FT4 A;  4X9C A;  2CSQ A;  1WJS A;  3SHW A;  2WAC A;  4J6X A;  1KJW A;  2BKD N;  1D09 B;  1D0Y A;  2RHU A;  2OX7 A;  5GMK h;  5CIU A;  3UA7 A;  1N8R C;  4GBQ A;  1K0X A;  3GF5 A;  4XTY A;  4JRI A;  4JRP A;  2RQV A;  1NJI U;  3CME Q;  2OI3 A;  3H0H A;  2DEU A;  2ENM A;  3JCM V;  2KAF A;  4D8D A;  1HXD A;  5AYF A;  3HFO A;  2ZPB B;  5IT9 E;  1RAC B;  2BZY A;  2MIO A;  2SEM A;  4PK4 A;  4C92 E;  3QPH A;  3PIP A;  4JZ3 A;  1BB9 A;  2YRC A;  2E3H A;  1QCO A;  1BIB A;  2HQX A;  1N9R A;  2NYS A;  3CCV T;  1UB4 A;  3SD4 A;  3V7C A;  2RI3 A;  4M4Z A;  2DET A;  1YFN A;  3UWN A;  1QKX A;  1Y96 A;  1UE9 A;  1OQK A;  2ESW A;  1Y71 A;  2XKO C;  4BE2 A;  2DBM A;  3CCM A;  3CC4 T;  4IUU A;  2XU8 A;  2EPD A;  3QSU A;  4FCY A;  2EYQ A;  4R55 A;  2K5F A;  1Y96 B;  2YRV A;  1YJW A;  4J9E A;  1BCM A;  4M7A D;  4J7F A;  4M7D F;  1LJO A;  2PVG B;  4BE1 A;  4BY6 B;  1SF9 A;  1IRX A;  4XU0 A;  3LLR A;  2LQW A;  3REB B;  4XTW A;  2OTJ Q;  5CAI A;  1VQ8 Q;  3V8L A;  3FDR A;  4JS5 A;  1PWT A;  3A8L B;  5CKE A;  1JXM A;  1YIJ T;  4OMO A;  4M75 D;  4V2S A;  2K5I A;  3U23 A;  1FWZ A;  3JCM g;  2JS0 A;  1T3S A;  1OV3 A;  1UJY A;  3LH5 A;  2CT4 A;  4M77 A;  3M0S A;  5GAN j;  1Q81 U;  3UA6 A;  1WPY A;  5EC7 A;  4PJO A;  1OEB A;  5DLO A;  4FU6 A;  2VGM A;  1SG5 A;  1MV3 A;  3FC3 A;  2JTM A;  2M02 A;  5KCH A;  1WHK A;  2KDS A;  5GAO q;  3S3M A;  4F14 A;  4EMG A;  1K9M R;  3JCM P;  3RMS A;  1WJR A;  2I2L A;  4FYV B;  1QVF S;  1OUL A;  2QG9 B;  3CC7 T;  4ZN1 A;  2LJ3 A;  1VQM T;  1S1N A;  3HPW A;  1ZSZ A;  2K4Y A;  1M90 U;  3CCS T;  3CPF A;  4LD6 A;  1U1S A;  4NL3 A;  1M1K C;  1F1B B;  3V8J A;  4C8Q C;  2FO0 A;  1UGP B;  4M78 B;  5GAN 3;  1ZSZ B;  3CCS A;  2EKH A;  2BE7 D;  4DEY A;  1WI7 A;  1HJD A;  2XHC A;  3EGD B;  3NFC A;  1B07 A;  3RUX A;  2HNI A;  3OYD A;  2LCC A;  3CQT A;  1VQO T;  2P4T A;  3OYI A;  4C92 G;  2BIV A;  1K4U S;  3RR6 A;  1JB0 E;  4O6J A;  4Z89 A;  3GIB A;  3HKS A;  4A4E A;  1RAF B;  2KT8 A;  4FYY B;  2XI9 A;  1VQ7 A;  1ZA2 B;  1OZ3 A;  1NM7 A;  2K9G A;  4KT0 E;  2QEX T;  1JBM A;  1K73 U;  2E5Q A;  4LDX A;  3OS0 A;  1EFN A;  3O5Z A;  1QCN A;  2E65 A;  4A4H A;  5FU7 C;  3OYG A;  3FRN A;  3OA6 A;  2RJC A;  5HK3 A;  5HK0 A;  4OGC A;  2YWW A;  1XJW B;  1S72 A;  2B86 A;  3VYG A;  1YJ9 A;  1Q7Y C;  1WHJ A;  2EQI A;  2E6N A;  2CRE A;  2L2P A;  1YI2 T;  3JCM Q;  5LL6 S;  4M7A A;  3L2R A;  4AFQ C;  1MHN A;  1T0J A;  1UG1 A;  2EIF A;  2VUB A;  3QYG B;  2DIG A;  3N5B B;  1C1A A;  2ED0 A;  4M75 A;  3ZL7 C;  1WJQ A;  3CCR T;  3M57 A;  4J6W A;  2P0Q A;  1IHW A;  2FPD A;  1WXT A;  2GF7 A;  5GMK e;  4RTT A;  2EGA A;  1QLY A;  4FL6 A;  2HL5 C;  3CCR A;  1U5S A;  3MP1 A;  2ZCF B;  2PUK B;  1J3T A;  1W2B P;  5HCK A;  2FRW A;  2ZAE A;  4Y92 A;  1X69 A;  1LNX A;  1G3T A;  5AT1 B;  2M16 A;  1BU1 A;  3L42 A;  1UGS B;  2KMT A;  2LJ1 A;  2AKL A;  3VS1 A;  3OS5 A;  1QMC A;  2CP5 A;  4M78 E;  3EG1 A;  2RHY A;  1RAD B;  4J6Y A;  1ZBJ A;  2KY9 A;  1R77 A;  3BW1 A;  3VU3 C;  1K8A U;  2AIR B;  1M1K R;  4FT2 A;  7AT1 B;  1P92 A;  2E12 A;  1UUE A;  4IUP A;  4WF2 A;  1UTI A;  1PCX A;  3TVT A;  3LX7 A;  3HP9 A;  1O75 A;  4HVU A;  1VQ5 Q;  2CUB A;  4HCZ A;  1WYX A;  2G6F X;  5LJ3 j;  3KFV A;  2CKK A;  2E41 A;  2E64 A;  4XTZ A;  4BAC A;  2MWO A;  1RAB B;  2KRM A;  2EQU A;  3CCJ T;  3JCM d;  3BDL A;  3CD6 T;  4BB7 A;  2C0O A;  2QQS A;  4E7H A;  1VQN Q;  1W1F A;  5LJ3 h;  3CD6 A;  2Y4Y A;  4N4H A;  4FM4 B;  4A63 B;  4QW2 A;  2OTJ A;  3WVE B;  3OSV A;  5DM7 R;  4II1 A;  1UHF A;  1RAE B;  4ANJ A;  1UGR B;  2PVD B;  4GLM A;  1CKA A;  1YIT T;  2D6F A;  3BFM A;  3OYM A;  1UGV A;  3ULR B;  3QG1 A;  2LTO A;  1YIT A;  5LJ5 g;  2CH4 A;  2CT3 A;  3BY7 A;  3M0U A;  4C92 D;  2HCK A;  3MP8 A;  3F70 A;  1GCQ C;  2X4W A;  2K5L A;  4E7Z A;  1D3B A;  2GFA A;  2J6O A;  5FWC A;  1H64 1;  2PZ1 A;  1OX9 A;  1ABQ A;  4YTL A;  4QQG A;  4OB1 B;  2RM4 A;  1N8R U;  4MML A;  1D3B B;  2V8I A;  4NOY A;  1GBR A;  2Y90 A;  3X25 B;  2EWN A;  3ME9 A;  2KXC A;  2X51 A;  5GAN 5;  1M4Z A;  4M77 G;  3EH2 A;  2DVE A;  3SDZ A;  5I2S A;  1OPK A;  3MEW A;  4BDZ A;  3FIF A;  3PT9 A;  2PQW A;  1AEY A;  4PJO G;  4K11 A;  4C0D C;  1ARK A;  4C8Q F;  2BZX A;  3MEA A;  2V1Q A;  2PVO B;  4XAX B;  3I5R A;  2I0N A;  1H92 A;  3I35 A;  3KBG A;  2QQB A;  2GGR A;  4AFU C;  1WQW A;  1JEG A;  1KQ2 A;  2QGF B;  1DJ7 B;  4UC4 A;  3TU4 K;  5HKC A;  2M0Y A;  3CCV Q;  1FX7 A;  4ZTJ A;  2HSE B;  3QYH B;  4M78 G;  1KC8 C;  1QP3 A;  4LXC A;  2ECZ A;  3ZFJ A;  3P8D A;  4E7S A;  3JB9 I;  6AT1 B;  4B9X A;  1GXI E;  2LMJ A;  2OTL T;  3CC4 Q;  3VKI A;  1WIE A;  4KBM B;  2HDA A;  3ASK A;  5KYY A;  5CKH A;  2E10 A;  3NGP A;  4M7D C;  3OBY A;  2OTL A;  2J7I A;  4C0F A;  5I22 A;  2RA2 A;  5FU7 B;  4DOW A;  1VQ4 A;  2J6K A;  4AFS C;  2WSE E;  3OQ5 A;  3REA B;  2K6D A;  3JAM E;  1M30 A;  1KQS P;  1ZBX A;  3JB9 D;  1YIJ Q;  1NYF A;  1YNZ A;  1KHI A;  2EGE A;  5GMK l;  1GL5 A;  4GLK A;  3A8H B;  2BUD A;  3LYI A;  4C5H A;  4BE0 A;  3OYN A;  3DKM A;  2O31 A;  1TWB A;  4BI4 A;  2KXD A;  1Q81 R;  2D0Q B;  4ZTF A;  1W4S A;  1NLP C;  4F7U B;  4JJD A;  4JZ4 A;  1T0H A;  4OP0 A;  2DKG A;  4ZNX A;  1PKT A;  2F2W A;  1WHG A;  2LQK A;  1YN8 A;  3WXM B;  3DLL A;  2DTI A;  1TSF A;  3EGX A;  4N4G A;  4C92 A;  1N27 A;  3I5S A;  4JJC A;  2EQK A;  3CC7 Q;  1QVG S;  1VQM Q;  2E5K A;  3JCM f;  4ELZ C;  3P8B B;  4DBF A;  3G6E T;  3EGX B;  3CCS Q;  1M90 R;  2P0P A;  5GAN g;  3OW2 A;  1GCP A;  2FEI A;  1BI1 A;  1K8A C;  4DBQ A;  2EVR A;  1M5Q 1;  4J9I A;  8ATC B;  1Z9Q A;  2FRY A;  1M9S A;  1FYN A;  3OSS C;  3MEV A;  4X9D A;  5CO7 A;  1YJN T;  3G1J A;  4ZN3 A;  1WDX A;  2X35 A;  2HBW A;  1BIA A;  5FW9 A;  5IN1 A;  4OMM A;  3EG0 A;  4J9C A;  4MZT A;  4OMP A;  1TXQ A;  3V8K A;  1VQ5 A;  3S6W A;  3E9G A;  4KGX B;  2FG0 A;  4E7I A;  4AT1 B;  4ZGE B;  3M0Q A;  5FLX E;  3RKX A;  1I5L A;  2QEX Q;  2R5M A;  4QVZ A;  2V8K A;  5J26 A;  1K73 R;  1M2V A;  1U06 A;  3MO8 A;  5LJ3 e;  3H8Z A;  5LJ5 h;  1VQN A;  1KSW A;  2G3R A;  1D1C A;  4EDU A;  4C0Z A;  2EAY A;  1BYM A;  4PJO D;  1M2O A;  5DLQ E;  5L23 A;  2DXT A;  1UHC A;  2MPX C;  1Q7Y U;  2P4R A;  1ZX6 A;  4KGV B;  1YI2 Q;  2AKK A;  1V76 A;  2C06 A;  1X6B A;  5C6S A;  1PHT A;  2A3L A;  2Y4X A;  1W2B A;  3M59 A;  4QQD A;  4M78 D;  1AOJ A;  1M3B A;  2A36 A;  4JRQ A;  1KQ1 A;  3CCR Q;  1IGU A;  2KYB A;  2RI5 A;  2X3X D;  4F7U E;  2D9T A;  2LQN A;  2VXE A;  2XDB A;  3BE3 A;  1VQK T;  3DB4 A;  1AD5 A;  4PFO A;  2QXF A;  4M7A C;  4QT7 A;  4OML A;  3X20 B;  2JN0 A;  2NUZ A;  3M5A A;  5I2M A;  1VQK A;  1RAA B;  2LVM A;  4RTX A;  4CC7 A;  1N5Z A;  1JXO A;  8AT1 B;  1SSH A;  1UEB A;  4M75 C;  5CR2 A;  4RMO A;  2YSQ A;  2W10 A;  1ZUK A;  3VS2 A;  2V26 A;  2YUO A;  4F16 A;  2F5T X;  3M4G A;  2DXC A;  4HT8 A;  4LN2 A;  1K8A R;  4EPC A;  3CCV A;  2VC8 A;  5CKD A;  3OYE A;  2CZ0 B;  1Y07 A;  3CMA T;  1PD0 A;  3AHU A;  2BZ8 A;  4CRI A;  1AWO A;  3KXT A;  9ATC B;  4FW2 A;  1YCY A;  2AT1 B;  2JS2 A;  1PC0 A;  2FVU A;  2FYK A;  2LQ8 A;  3CC4 A;  3QUI A;  3CCJ Q;  3NHN A;  1ZSG A;  4JJN K;  2C0I A;  3CD6 Q;  1X2Q A;  5KYW A;  2IPO B;  3G71 T;  5GAN 2;  2L3S A;  4M7D B;  5A0L A;  2L3Q A;  1SHF A;  2LX9 A;  1HYO A;  1JJ2 S;  1N6A A;  3G7Z A;  4PJJ A;  3VS3 A;  5DY9 A;  3G71 A;  3L2V A;  1MUZ A;  3CBO A;  4R0K A;  5KYW B;  3Q1J A;  1WZO A;  3EAE A;  1QCF A;  3VRZ A;  2LCS A;  2PTK A;  5FU6 C;  1YWP A;  2RQU A;  3I55 T;  4N0A A;  1YIJ A;  1YIT Q;  1RLQ C;  3TSW A;  3CC2 T;  2H3J A;  1RAG B;  2VYT A;  1KD1 U;  4E7K A;  5LJ3 g;  5GAO m;  5GAM g;  2K57 A;  4RTY A;  5A2Q E;  2GTO A;  2QTV A;  4OB0 B;  3CC2 A;  3PFS A;  3CXC P;  2DX1 A;  3OY9 A;  4AG2 C;  3T9N A;  2FZG B;  1BCO A;  5GAN h;  2QQA A;  2YUP A;  3L2Z A;  2OAU A;  1QKW A;  4M78 A;  1RL2 A;  2YHT A;  1HK9 A;  4M77 F;  2A08 A;  1N8R R;  4IUV A;  3VS6 A;  3CC7 A;  3HL8 A;  4F7U G;  1VQM A;  1D0Z A;  4PJO F;  3EGD A;  4A53 A;  1VQ6 T;  2KNB B;  3GBQ A;  1NEB A;  4XU3 A;  1UDL A;  2F69 A;  3JV3 A;  2IIM A;  1H3H A;  1VQ6 A;  5HY6 A;  2LJ0 A;  5KCO A;  3CCQ T;  1YBY A;  4IUT A;  3MKD A;  2O2O A;  2JT4 A;  3C0C A;  2RQT A;  3HTR A;  4C5G A;  2XMF A;  2QTX A;  2HQE A;  1LPL A;  1M27 C;  1ZLM A;  3E9F A;  3CPW P;  1RAH B;  3WVD B;  2V8J A;  1OU9 A;  1VQO A;  5KE3 A;  1TUG B;  3QJ6 A;  1FXX A;  1KC8 U;  5M9O A;  2LT4 A;  1OOT A;  2X4J A;  1OZ2 A;  2NUP A;  4QVD A;  3JCM X;  2EBP A;  2LRQ A;  1I5O B;  1KQS A;  1GBQ A;  5GAN 6;  2OTL Q;  2YRD A;  2QEX A;  4KUD K;  3ZBD A;  5LJ5 e;  1VQ4 Q;  5D7U A;  4CI0 C;  2KI7 A;  2NUP B;  1X2K A;  1QWF A;  1LOJ A;  2CYZ B;  1TUD A;  1BI3 A;  1PG5 B;  2KSS A;  4DEX A;  3MET A;  4M7D E;  1WA7 A;  1MGQ A;  5GAO r;  1K9A A;  2NLU A;  1VQP T;  2O01 E;  5GAN 7;  2VWF A;  4WCI A;  3LWH A;  5EG2 A;  4KRT A;  1YI2 A;  4P5N A;  1Y7X A;  3H41 A;  3OYY A;  1PD1 A;  3FJP A;  1JO8 A;  1NPP A;  1PM3 A;  2RB6 A;  1E7O A;  4KUL A;  3M0R A;  3NTK A;  2O9S A;  2HD0 A;  5GMK i;  4M7A F;  3OB9 A;  4VUB A;  4JLG A;  1I81 A;  3DB3 A;  1LCK A;  2P84 A;  2COZ A;  1FMW A;  3D7S B;  4ELY C;  3TCJ A;  2OJ2 A;  3EHQ A;  2ZGW A;  2LZ6 B;  2K3B A;  2K3X A;  4M75 F;  1TOV A;  3G6E Q;  1VYV A;  3JB9 G;  1NE8 A;  2J05 A;  3VS7 A;  2K2M A;  2QQR A;  2EJF A;  3MEU A;  3EG9 A;  5CCA A;  1WQ7 A;  4C92 C;  3QDR B;  3R6N A;  2DL8 A;  3EG9 B;  2DXB A;  1YJN Q;  1SPK A;  1BI2 A;  2KT1 A;  2F2X A;  4OGE A;  1BBZ A;  2DD5 A;  1IRE B;  2DM1 A;  3GPL A;  3I56 T;  3IQL A;  5GAM j;  5KYX A;  2BTT A;  3H9N A;  2LNH B;  1SRM A;  3V7R A;  2CP0 A;  2EYY A;  1BK2 A;  3I56 A;  1Y57 A;  1R8O B;  2DXU A;  3CCJ A;  5KYX B;  1VYU A;  2D0N A;  2DZC A;  2CP3 A;  3BDU A;  4HVW A;  2W0Z A;  5GAM h;  1NBE B;  2E70 A;  4EMK C;  3RES A;  2FZC B;  4IUQ A;  3JRZ A;  4J5Y A;  3H6Z A;  4D6W A;  3KUF A;  2DYI A;  1KD1 C;  4BUG A;  1JQQ A;  1T3L A;  4J9F A;  1XNI A;  4XK8 E;  5FU6 B;  4Y28 E;  4KH1 B;  1Q7Y R;  1AWJ A;  2JMA A;  2K7A A;  3L2W A;  3EFO B;  4HCB A;  1MMG A;  1RAI B;  4IIM A;  4TVR A;  4RG8 A;  1BKB A;  2ZPE B;  5I11 A;  2L8D A;  5KE2 A;  1QQJ A;  2PNI A;  2CP6 A;  2MF2 A;  5GAN e;  4OF1 A;  1IO6 A;  2JXB A;  2H3E B;  1PSF A;  3SWN C;  1KFZ A;  4JJB A;  3V7S A;  2B8A A;  4AG1 C;  1VQK Q;  2KE9 A;  2DIQ A;  1ZA1 B;  2M9U A;  1RUW A;  2GCX A;  2LX7 A;  1NLO C;  1FMV A;  5IXB A;  1VQ9 T;  2DD4 A;  2DRM A;  1JU5 C;  3OYC A;  2JM8 A;  4RCB A;  4C8Q B;  2HQH A;  2DJQ A;  1VQ9 A;  1JRI A;  3OYA A;  2JMC A;  2CZ6 B;  2KRO A;  2J6F A;  3PVL A;  3PVQ A;  2HSP A;  1NEG A;  2DBK A;  1AVZ C;  3EH1 A;  3E1S A;  4LDY A;  3NTI A;  4HCC A;  2QK0 A;  2AHJ B;  2HKN A;  2X4Y A;  2DTH A;  2MCN A;  2MI6 A;  3CMA Q;  1WHH A;  2RHX A;  2JJ9 A;  1AWX A;  4A4F A;  4CC4 B;  2DE0 X;  3OW2 S;  2J06 A;  4HKE A;  1M8V A;  3QO3 A;  1Q86 U;  3THK A;  1CKB A;  1I4K 1;  1UGQ B;  3G71 Q;  3GLX A;  1AHJ B;  5CKB A;  1JJ2 P;  3GNG A;  3CXC A;  1IXD A;  3TEE A;  4MZP A;  2H8H A;  4BY6 C;  3J81 E;  3RBB B;  4IUR A;  2CP7 A;  4F7U A;  3I55 Q;  1VQL T;  3PIO A;  5FRO A;  1Y0M A;  3CC2 Q;  3QZ9 B;  1B7T A;  3G4S T;  1KD1 R;  2QDL A;  5L8R E;  2A28 A;  3VS4 A;  3OYK A;  2FPF A;  3OBW A;  5D6W A;  2DIL A;  2ROL A;  1QVF P;  4LUE A;  4N0A C;  3VYH B;  3A5Z B;  3OMC A;  4M77 C;  1KG1 A;  1AWW A;  3TSZ A;  3QBY A;  4LNP A;  3RKW A;  1SRL A;  3QKJ A;  4PJO C;  4HT9 A;  3OS1 A;  2DF6 A;  3LH0 A;  1Q82 U;  2DL7 A;  3S3O A;  4C0G A;  3CPW A;  2DPP B;  3CCE T;  5LJ3 f;  1VQ6 Q;  1RI0 A;  2RK1 A;  3G6E A;  3JSC A;  4J7I A;  4J83 A;  3UPU A;  4MDX A;  4C8Q E;  3C94 A;  3FB9 A;  3CCE A;  5J3B A;  2KVQ G;  2DER A;  4C92 F;  1HSQ A;  3M0T A;  4GY5 A;  4M78 C;  3CCQ Q;  1ZSZ C;  3JCM b;  1E6H A;  1WHM A;  3C12 A;  4QKU A;  3QDF A;  3PGG A;  3E19 A;  1VQO Q;  2VKN A;  2K3Y A;  1O9S A;  1YJN A;  2CP2 A;  3CEY A;  3SEM A;  4B6M A;  4JLI A;  3GP8 A;  4PLI A;  3LGL A;  1KC8 R;  4RTU A;  1B3Q A;  2F1L A;  4KH0 B;  2JTF A;  2GQV A;  1G83 A;  4ESR A;  3GOX A;  4FW1 A;  4JDS A;  1HD3 A;  2JM9 A;  2KBT A;  3MHX A;  5LJ5 d;  1YHQ T;  1H3Z A;  5GAM e;  3NMZ C;  4LDU A;  2EW3 A;  3JCM J;  3H0I A;  5A0G A;  4E6R A;  3NPF A;  1G5V A;  2ATC B;  5GJV B;  3C95 A;  4EMK B;  3JCM c;  3MJX A;  2HZY A;  3C4S A;  2R5A A;  4OVA A;  1VQP Q;  3LWI A;  4J9B A;  2DLP A;  5FRM A;  1SEM A;  3A98 A;  1PRM C;  1N9S A;  2KRS A;  2A0F B;  3I9Q A;  1D1A A;  2EQJ A;  4IIO A;  4DQ2 A;  4ATO A;  2JTE A;  2L0A A;  3M58 A;  2YUQ A;  1WX6 A;  1U3O A;  5GMK j;  1X6O A;  2EGC A;  2DTO A;  1K9M C;  2YDL A;  2L5Q A;  2OAW A;  3SWN B;  2MK5 A;  3QZ5 B;  2DEQ A;  2XDD A;  2FB7 A;  2ZZD A;  2GTJ A;  4KUI A;  4NS5 A;  5IHN A;  1M3A A;  4E47 A;  3OYF A;  5CQY A;  2NWM A;  2EKO A;  1PRL C;  4XQ3 A;  3JB9 F;  1TH7 A;  4R56 A;  2VB6 A;  3M0P A;  4C0D B;  2VGN A;  2DK3 A;  3UAT A;  3EHR A;  3QWX X;  1XOV A;  4A4K A;  4C5E A;  2F2V A;  4BDY A;  1EZZ B;  2XID A;  2LCL A;  2X3W D;  3EG2 A;  3M4Y A;  4RTV A;  2M51 A;  4C8Q G;  4RKU E;  2DL5 A;  2LC4 A;  2RH2 A;  4CC3 A;  1MMN A;  3CMA A;  2A7Y A;  5D6Y A;  4D8K A;  4AFZ C;  1SKU B;  4M7D A;  3PMI A;  3I56 Q;  1TU0 B;  1EX4 A;  2ZPF B;  5A0D A;  2QA4 T;  3CCM T;  1Q86 C;  2V1R A; 
#chains in the Genus database with same CATH homology
 4KRT A;  2DL4 A;  1QWE A;  2KRN A;  2RNA A;  3H41 A;  3VS0 A;  1GBR A;  2KXC A;  2DL3 A;  3QWY A;  4EIK A;  1JO8 A;  2KYM A;  1OPK A;  4OMQ A;  2RQR A;  4LUD A;  1E7O A;  3FJ5 A;  2KR3 A;  1AEY A;  4K11 A;  1ARK A;  3M0R A;  2BZX A;  2O9S A;  1KIK A;  2V1Q A;  4X1V A;  2RF0 A;  3I5R A;  2I0N A;  2FPE A;  3I35 A;  1H92 A;  2MOX A;  1LCK A;  2GGR A;  2GQI A;  2AZS A;  4AFU C;  1WLP B;  1K76 A;  1JEG A;  1MV0 B;  2OJ2 A;  3EHQ A;  1GRI A;  2LZ6 B;  2M0Y A;  2K3B A;  1X43 A;  1ZUY A;  2ECZ A;  1K0S A;  2C0T A;  2RPN A;  1VYV A;  1GCQ A;  2CH4 W;  2J05 A;  3VS7 A;  2K2M A;  2AK5 A;  1AZG B;  4LE9 A;  1WXU A;  1ABO A;  2LMJ A;  2DMO A;  2KGT A;  1WIE A;  2HDA A;  1H8K A;  3R6N A;  2DL8 A;  3NGP A;  1PKS A;  1Z9Z A;  2J7I A;  5I22 A;  2JW4 A;  1SPK A;  2KT1 A;  1TUC A;  2J6K A;  1UJ0 A;  2F2X A;  4AFS C;  1BBZ A;  1I1J A;  4HVV A;  2CSQ A;  3REA B;  2DM1 A;  2K6D A;  3SHW A;  3IQL A;  1KJW A;  2BTT A;  1I07 A;  1M30 A;  2LNH B;  1SRM A;  1NYF A;  1YNZ A;  3PE0 A;  3UA7 A;  2EYY A;  2EGE A;  1BK2 A;  2KEA A;  4GBQ A;  1K0X A;  1GL5 A;  2DA9 A;  1Y57 A;  2DYB A;  2RQV A;  1E6G A;  3VS5 A;  1VYU A;  2D0N A;  4HVW A;  2OI3 A;  2W0Z A;  3H0H A;  2O31 A;  2KXD A;  2ENM A;  4D8D A;  4J9H A;  1GFC A;  4FSS A;  1NLP C;  4JJD A;  4JZ4 A;  1T0H A;  2BZY A;  2MIO A;  2SEM A;  1JQQ A;  4ZNX A;  1T3L A;  4J9F A;  1PKT A;  2F2W A;  2A37 A;  1YN8 A;  4RUG A;  1AWJ A;  2JMA A;  4JZ3 A;  2K7A A;  1BB9 A;  3I5S A;  4JJC A;  4IIM A;  2E5K A;  2CUD A;  5I11 A;  2PNI A;  5IXF A;  2YT6 A;  4M4Z A;  1IO6 A;  2JXB A;  1GCP A;  1QKX A;  1UE9 A;  2FEI A;  1KFZ A;  2ESW A;  4JJB A;  4AG1 C;  2EVR A;  2DBM A;  4J9I A;  2KE9 A;  1Z9Q A;  2EPD A;  2FRY A;  1FYN A;  1CSK A;  1RUW A;  1M8M A;  2GNC A;  2LX7 A;  2RN8 A;  1WFW A;  2DNU A;  1NLO C;  3RNJ A;  4J9E A;  5IXB A;  1WDX A;  2HBW A;  2DRM A;  1JU5 C;  5FW9 A;  2JM8 A;  4OMM A;  3EG0 A;  2LQW A;  3REB B;  4Z8A A;  4J9C A;  2DJQ A;  4OMP A;  1PWT A;  1NYG A;  2JMC A;  1A0N B;  2FG0 A;  1JXM A;  2KRO A;  2J6F A;  3PVL A;  4OMO A;  3PVQ A;  1AZE A;  2HSP A;  1NEG A;  3M0Q A;  3U23 A;  1VYT A;  2JS0 A;  1T3S A;  1OV3 A;  2DBK A;  2DRK A;  1UJY A;  3LH5 A;  1AVZ C;  1U06 A;  2CT4 A;  3M0S A;  1PNJ A;  3UA6 A;  1KSW A;  5EC7 A;  2MCN A;  1OEB A;  5L23 A;  1AWX A;  1MV3 A;  4CC4 B;  1UHC A;  2VVK A;  2DE0 X;  2P4R A;  4F14 A;  1ZX6 A;  2J06 A;  2AKK A;  3EG3 A;  1X6B A;  1TG0 A;  4J9D A;  1PHT A;  2LJ3 A;  3THK A;  1CKB A;  1S1N A;  2EYX A;  2EYZ A;  4RTZ A;  2DVJ A;  1AOJ A;  1M3B A;  1WXB A;  1RLP C;  2A36 A;  2H8H A;  2KYB A;  2X3X D;  2GBQ A;  3RBB B;  2LQN A;  2FO0 A;  1AD5 A;  2EKH A;  4HXJ A;  1W6X A;  4DEY A;  1WI7 A;  4QT7 A;  1Y0M A;  4OML A;  2NUZ A;  1HJD A;  4RTX A;  2QDL A;  1B07 A;  4CC7 A;  1X27 A;  5FWB A;  2A28 A;  1N5Z A;  1JXO A;  2CSI A;  3VS4 A;  1SSH A;  3CQT A;  2K79 A;  2FPF A;  1K4U S;  5GJW B;  2YSQ A;  4HCK A;  3H0F A;  2W10 A;  2DIL A;  4Z89 A;  1SHG A;  2ROL A;  2CDT A;  4LUE A;  1ZUK A;  2KT8 A;  1NM7 A;  2K9G A;  1AWW A;  3TSZ A;  3VS2 A;  4LNP A;  2YUO A;  4F16 A;  1SRL A;  1YP5 A;  2EYW A;  1EFN A;  2DF6 A;  3O5Z A;  4LN2 A;  4CC2 A;  2ED1 A;  2DL7 A;  2RMO A;  2YUN A;  2BZ8 A;  1AWO A;  2B86 A;  2EQI A;  2CRE A;  2L2P A;  1HSQ A;  3M0T A;  2JS2 A;  1E6H A;  1OPL A;  3NHN A;  4AFQ C;  1ZSG A;  1T0J A;  1UG1 A;  2C0I A;  1X2Q A;  2VKN A;  1YCS B;  2L3S A;  2L3Q A;  1SHF A;  3SEM A;  2ED0 A;  2SRC A;  3ZL7 C;  3VS3 A;  1RI9 A;  1MUZ A;  2D1X A;  2FPD A;  1WXT A;  2HEQ A;  4R0K A;  4RTU A;  1QCF A;  1B3Q A;  2LCS A;  4RTT A;  2EGA A;  3VRZ A;  1QLY A;  2PTK A;  1YWP A;  2RQU A;  1G83 A;  4ESR A;  1UFF A;  2LP5 A;  1HD3 A;  1U5S A;  1RLQ C;  2JM9 A;  2KBT A;  3TSW A;  2D8H A;  5ECA A;  1J3T A;  3NMZ C;  4J9G A;  2FRW A;  5HCK A;  4Y92 A;  4RTY A;  2EW3 A;  1I0C A;  1X69 A;  3H0I A;  2GTO A;  4E6R A;  3NPF A;  2DX1 A;  1X6G A;  5GJV B;  2ABL A;  4AG2 C;  1YWO A;  2ROT A;  1BU1 A;  5IH2 A;  1V1C A;  2LJ1 A;  2AKL A;  4J9B A;  3VS1 A;  1FMK A;  2DLP A;  2YUP A;  1QKW A;  2L3P A;  3EG1 A;  1SEM A;  3A98 A;  1PRM C;  1UEC A;  1ZBJ A;  2KRS A;  2RQW A;  3I9Q A;  2A08 A;  1NG2 A;  3VS6 A;  2D8J A;  4IIO A;  2JTE A;  1UUE A;  2L0A A;  2YUQ A;  1WX6 A;  1UTI A;  2KNB B;  1U3O A;  3VRY A;  3GBQ A;  2O9V A;  3TVT A;  4ORZ A;  1NEB A;  2EGC A;  1UDL A;  4HVU A;  3JV3 A;  2IIM A;  2CUB A;  1H3H A;  2YDL A;  4JPB W;  1GFD A;  1WYX A;  2OAW A;  2G6F X;  3KFV A;  2LJ0 A;  2O88 A;  2KRM A;  2O2O A;  2GTJ A;  2JT4 A;  4RTW A;  5IHK A;  3C0C A;  2RQT A;  2XMF A;  5IHN A;  1M3A A;  2NWM A;  2C0O A;  1VA7 A;  1M27 C;  1ZLM A;  1PRL C;  1W1F A;  1ZUU A;  3M0P A;  4A63 B;  3UAT A;  1OOT A;  1G2B A;  1UHF A;  1W70 A;  3EHR A;  3QWX X;  2EBP A;  1XOV A;  2F2V A;  4GLM A;  4F17 A;  3UF4 A;  1M3C A;  1CKA A;  3EGU A;  1GBQ A;  2X3W D;  3EG2 A;  4RTV A;  1UGV A;  3ULR B;  2M51 A;  1X2K A;  1QWF A;  2AZV A;  4OMN A;  2DL5 A;  2CH4 A;  1TUD A;  2CT3 A;  4CC3 A;  4DEX A;  3M0U A;  1WA7 A;  1K1Z A;  2HCK A;  1GCQ C;  4D8K A;  5IHI A;  4AFZ C;  1K9A A;  2J6O A;  5FWC A;  2PZ1 A;  4Z88 A;  1ABQ A;  2VWF A;  2V1R A;  4WCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...