1H8KA

A-spectrin sh3 domain a11v, v23l, m25v, v53i, v58l mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
KELVLVLYDYQEKSPREVTVKKGDILTLLNSTNKDWWKVEVDDRQGFIPAAYLKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Strain in the Hydrophobic Core and its Implications for Protein Folding and Design
pubmed doi rcsb
source organism Gallus gallus
molecule tags Sh3-domain
molecule keywords SPECTRIN ALPHA CHAIN
total genus 6
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1h8kA00
1KJWA 1H92A 1M3BA 3H0HA 1ABOA 2LJ0A 2VKNA 2DBMA 1VYTA 2EQIA 1Z9ZA 2YUQA 2MCNA 4HXJA 2GNCA 2MOXA 2BTTA 4QT7A 1QWFA 2DRKA 4FSSA 1JQQA 1K0XA 2D0NA 1ARKA 5GJWB 3REAB 2CT3A 2OAWA 2I0NA 2OI3A 1M30A 1T3SA 2CSIA 4ZNXA 3JV3A 1QLYA 2DE0X 4JJBA 1MUZA 2J7IA 1GFDA 4RTZA 2O88A 2PTKA 1TUDA 1UG1A 2AKLA 2K9GA 4RTYA 3ULRB 4DEXA 2J06A 1NYFA 1EFNA 1UECA 2GQIA 2QDLA 1VYUA 2C0IA 2DLPA 2KNBB 1ZLMA 1VYVA 1AZGB 2RQTA 1M27C 4CC7A 2RQUA 3TSZA 1WA7A 3KFVA 1NLPC 1SHFA 2J6OA 1YNZA 1K1ZA 4D8DA 1NYGA 3RNJA 2DA9A 1YWOA 2H8HA 1S1NA 3M0UA 2D8HA 2DRMA 2L3QA 2KXDA 2CUDA 2O2OA 1E7OA 1PKSA 1QWEA 1PRLC 3TVTA 1KSWA 1YWPA 2GTOA 3EHRA 2EGAA 1H8KA 2JW4A 3REBB 2LMJA 3EG0A 1SHGA 2RPNA 1UHCA 2LNHB 4ORZA 2RNAA 3H41A 1OPKA 1I07A 4J9GA 2BZ8A 1GRIA 4GLMA 1JEGA 3VS6A 2BZYA 3GBQA 1GL5A 1WXBA 1G2BA 4J9HA 4F16A 4J9EA 3QWXX 1A0NB 2K79A 1MV0B 2DL3A 4LUDA 3CQTA 2PZ1A 3THKA 1X2QA 1PKTA 1ABQA 2KR3A 2ECZA 1UFFA 2JT4A 2LX7A 1BB9A 3VS0A 1W70A 3PVLA 4RUGA 1OPLA 2JS0A 3UA7A 2L3SA 4GBQA 2LQWA 2NUZA 1ZSGA 4D8KA 1RI9A 2A28A 2A37A 1T0HA 4KRTA 4OMQA 2KRNA 2NWMA 2GBQA 3I5RA 2DNUA 2YSQA 1WLPB 2ROTA 5IHIA 2FRWA 1U06A 4Z88A 2O31A 1SPKA 5HCKA 2ENMA 1UJ0A 2JMAA 4RTTA 2ROLA 2OJ2A 1AD5A 2DL4A 2JMCA 5FWBA 2P4RA 2RF0A 2KBTA 1BK2A 2J05A 2YUOA 2KT1A 1CSKA 4HVUA 2F2XA 1B3QA 2L3PA 2BZXA 1GCQA 1ZUUA 3SHWA 2RQRA 4LE9A 1UJYA 4J9CA 3I35A 3U23A 4ESRA 2ED1A 2CUBA 4J9FA 4X1VA 1WXUA 1M3AA 1SRLA 1E6HA 1UGVA 2EGEA 2FPEA 4JJDA 1AWXA 1J3TA 1WI7A 2G6FX 2FPFA 1YCSB 3VS4A 4F14A 4OMNA 4F17A 2AZVA 4HVVA 1WDXA 1ZUKA 3O5ZA 1QKWA 2J6FA 1NG2A 5IHNA 2LJ1A 3NPFA 2FEIA 1PHTA 2DL8A 1HD3A 4HVWA 1GCPA 1CKBA 4IIMA 1I0CA 2EGCA 2HBWA 2CREA 2CH4A 2EYYA 2YUPA 5I22A 5FW9A 2DMOA 4LN2A 2KT8A 2KRMA 2RQWA 1X2KA 3NGPA 1RLQC 2HEQA 2AKKA 3R6NA 1I1JA 4J9DA 1WX6A 2HSPA 1NEBA 2B86A 1VA7A 2JM9A 4LNPA 2DILA 2JM8A 1JXMA 4E6RA 2EBPA 3M0PA 1NEGA 1AEYA 1V1CA 5IXFA 3M0QA 2KRSA 1QCFA 1B07A 2AZSA 2K6DA 2PNIA 2RQVA 4HCKA 4Z8AA 2DX1A 2X3XD 1X6BA 1XOVA 1TUCA 2EPDA 2J6KA 3VS5A 2D1XA 4RTWA 1E6GA 1SRMA 4DEYA 1RUWA 2JXBA 3VS1A 1AWOA 2AK5A 2VWFA 1HJDA 3M0RA 1X43A 2HDAA 2FG0A 4RTUA 4AFUC 4JZ4A 2DYBA 2JS2A 4OMMA 4M4ZA 4IIOA 2ED0A 2DL5A 2K3BA 1MV3A 1ZUYA 2KXCA 3M0SA 4OMPA 1JXOA 1UUEA 1WXTA 4AG2C 2O9VA 1FYNA 2M0YA 1M3CA 1OEBA 1H3HA 3UATA 2W10A 2YT6A 4EIKA 1ZBJA 5GJVB 2K7AA 1KIKA 1GCQC 3QWYA 1WFWA 2L2PA 1T0JA 4CC3A 2KGTA 2F2VA 3A98A 1Z9QA 3EG3A 1YN8A 1SSHA 1SEMA 2HCKA 3EGUA 1N5ZA 2A36A 3H0IA 3VS7A 1CKAA 2V1QA 1K4US 1KFZA 2EYXA 1OV3A 1W1FA 5EC7A 4WCIA 3VS2A 5IH2A 1X27A 2D8JA 2IIMA 2KE9A 1NM7A 1GBRA 1G83A 1TG0A 3UF4A 2SRCA 3EHQA 4Z89A 2LCSA 2LZ6B 2CH4W 1JU5C 4J9IA 3C0CA 5IHKA 2SEMA 3SEMA 5L23A 4LUEA 1AVZC 4OMLA 2EKHA 3FJ5A 1YP5A 3RBBB 2DF6A 1U5SA 3TSWA 3I5SA 2EW3A 3VS3A 2E5KA 3PVQA 2RMOA 2A08A 2DBKA 4JPBW 4RTVA 1UTIA 1BU1A 3VRYA 1HSQA 1PWTA 1UDLA 4AFSC 3M0TA 2DL7A 1Y0MA 2DVJA 2KROA 2FO0A 1LCKA 4JZ3A 2KYMA 3I9QA 2EYWA 4AFQC 3ZL7C 2DM1A 2M51A 1K0SA 2VVKA 3LH5A 4Y92A 2RN8A 2F2WA 2ESWA 3EG2A 1GFCA 2O9SA 1X6GA 2LQNA 2CT4A 3NHNA 3NMZC 1W6XA 2X3WD 2FRYA 1OOTA 5FWCA 2CDTA 2V1RA 4OMOA 2EYZA 1UE9A 4A63B 3H0FA 4JJCA 5IXBA 3IQLA 2W0ZA 1IO6A 2XMFA 1Y57A 4J9BA 1WYXA 1AWWA 2C0TA 2FPDA 4K11A 2JTEA 1QKXA 5ECAA 1FMKA 4CC4B 3VRZA 4RTXA 2CSQA 2GTJA 1WIEA 3EG1A 4CC2A 5I11A 2KEAA 1BBZA 2KYBA 1AWJA 1AOJA 1AZEA 1RLPC 1PNJA 1K76A 1NLOC 2C0OA 3UA6A 1X69A 1U3OA 1GBQA 2MIOA 4R0KA 1ZX6A 1JO8A 2LP5A 2YUNA 2GGRA 1M8MA 2L0AA 2LJ3A 1PRMC 2DJQA 1K9AA 2YDLA 1T3LA 2K2MA 2EVRA 3PE0A 4AFZC 2ABLA 4AG1C 1UHFA
chains in the Genus database with same CATH superfamily
2QQAA 1KJWA 1KHCA 3CCVA 4JRPA 4A54A 1VIEA 1VYTA 2DEUA 5A0GA 4DBRA 2DRKA 4FSSA 2JTFA 1W2BP 2D0NA 5IN1A 3REAB 3OY9A 1M30A 1T3SA 2CSIA 5CCAA 4C0DC 4FYWB 1TUDA 1UG1A 2AKLA 4RTYA 4M78A 3ULRB 5LJ5d 1UECA 2GQIA 2JNGA 1ZLMA 5AYFA 4HCCA 1YBYA 3D7SB 3CCLT 4F7UA 3OYGA 2RQUA 3TSZA 3CMET 1WA7A 3PT9A 1WHJA 2J6OA 4KUDK 2GCXA 3RR6A 2X4WA 5GANj 4NOYA 3RNJA 2P84A 3R6OA 4OB2B 5GMKl 3V7RA 4EMKB 2H8HA 1M1KC 1IGUA 4IUUA 1YJNQ 1MNEA 4M7AA 2KXDA 1AT1B 3JCMb 3RMSA 3TQ7P 5KYYB 1QWEA 5KYWA 3S3NA 1PRLC 4O6JA 3ME9A 4BD3A 3OW2P 2KVQG 3EG0A 1SHGA 1RAGB 2RPNA 1VQLQ 1UHCA 4ORZA 1VQPT 1QVPA 1I07A 5GAMe 4C8QG 3CPWP 1JEGA 3EAEA 4F7UB 2BZYA 2EJFA 1GL5A 1A0NB 1M5Q1 1ZA2B 1WHKA 3F70A 3JB9I 2R58A 2L8DA 2QQ9A 4M75E 2WSEE 1QW1A 2KR3A 2EJ9A 4O5VA 2X35A 1ZHIA 4N4HA 2JT4A 4Y91A 1FX7A 2LX7A 1W70A 4M77F 4JLIA 4QVZA 2ZAEA 2L3SA 3C12A 1Q82R 2A37A 4B9XA 5GANf 3CCUT 1KQSS 2DETA 4KH0B 4LDXA 1KD1U 4M7DF 4DBHA 3KBGA 1YJWT 3CMAT 1U06A 4ELZC 4F7UE 4Z88A 2O31A 2DXCA 1X6OA 4C0FA 3S6WA 3HTRA 3GLXA 3X20B 5GANd 2X51A 2JMCA 5FWBA 5FLXE 3DLLA 1YJWA 4C5GA 2RF0A 4DBQA 2J05A 2QA4A 2GQVA 4HVUA 2OTJQ 2KK4A 4E2FB 4GY5A 2NYSA 1VQLT 3CCET 5LJ3h 4M77G 3U23A 5A0LA 3CC4T 4M78G 2CUBA 4X1VA 1D0YA 2RD1A 1Q81C 4WF2A 3BY7A 2VASA 3CBOA 1UGVA 2EGEA 1M90C 2G6FX 2XD0A 2FPFA 5CO7A 1K73R 3DB3A 2CP6A 2MWPA 2K3XA 4HVVA 3OYLA 1WDXA 1YJ9T 1K8AR 9ATCB 5GMKm 3A1PA 1RAAB 5LJ3f 2LJ1A 3FB9A 2DL8A 1GCPA 2MYSA 1VQ5Q 1KC8R 2CREA 2CH4A 2EYYA 1V29B 3JRZA 3OYJA 4LN2A 5L8RE 4OMFB 3R6NA 1I1JA 4J9DA 2RI2A 4FW1A 2YLCA 2PUOB 1WX6A 1WPYA 1NEBA 4ZN1A 1VA7A 3C95A 3NTIA 1NEGA 2EWNA 4DQ2A 4RG2A 4ZTFA 5IXFA 3M0QA 3RDVA 4Z8AA 2RQVA 3HFOA 2RHYA 2D1XA 1W4SA 1RUWA 2JXBA 1KK7A 3JCMg 3VS1A 3S3OA 1AWOA 2VWFA 3C94A 2QEXA 5GANh 1B34A 1X43A 3BW1A 2CZ6B 4JZ4A 4OMMA 2JS2A 2H3JA 3A8HB 4A4HA 1O75A 4B9WA 1M2VB 2F69A 2FB7A 1UUEA 5GAOr 4PJJA 3OMCA 5FU7C 1FYNA 2M0YA 1BI0A 3UATA 1IB8A 2H3EB 1BI3A 5GAOn 4BE0A 1TSFA 4BE1A 1WFWA 4CC3A 3A98A 2CS7A 5GMKh 1MMAA 4PJOB 3CC4A 1YITQ 2HCKA 1KQSA 4PJOD 2A36A 1CKAA 1K4US 2FVUA 1KFZA 2DIGA 2EYXA 3SWNC 1W1FA 3NTHA 1VQNA 3VS2A 4OGCA 1VQ5T 5GAMh 2JTMA 2ZPGB 1KC8C 3JAME 1TG0A 3UF4A 1WQ7A 3EHQA 4JRQA 2LCSA 2LZ6B 3OYNA 1NE8A 4J9IA 2YWWA 2SEMA 3LYIA 1VQ6Q 3JCMW 1D3BB 1KHIA 3LW5E 2CP0A 4KGXB 1U5SA 3AT1B 3OBYA 3VS3A 2LVMA 3A8GB 1KD1R 3CCLA 1VQKQ 1PD0A 5D6YA 1MMGA 5D6WA 1UTIA 4YTLA 4FL6A 3I56A 4MDWA 2DL7A 1LCKA 4A4GA 1IGQA 2DM1A 1YJNA 4ME7A 1BKBA 4IUVA 2RN8A 3BFMA 4EMKC 3AHUA 2F2WA 2ESWA 4M78D 1X6GA 3CCEQ 1WHLA 5IT9E 1VQMQ 4OB3B 2CT4A 3NMZC 1W6XA 2X3WD 2P0PA 3LLRA 3O8VA 1OOTA 3FLGA 4OMOA 2EYZA 1UE9A 1RAEB 1OZ2A 5GANg 3MEUA 3CC7Q 3OYYA 2YHTA 2KSSA 3MEAA 3IQLA 1IO6A 4E7LA 3P8BB 1F1BB 4J9BA 1VQ4Q 3TEEA 4X34A 1R0CB 3JB9J 4BY6B 2Y90A 1FMKA 4B6MA 1OU8A 3OS5A 4RTXA 1M2VA 2R5AA 4M7DE 1BBZA 3MCAB 3CBPA 4KT0E 1AZEA 1BI2A 3C4SA 3NFCA 3EFSA 1NLOC 4M7AG 3WXMB 1X69A 1U3OA 3EGXA 1YJ9A 1OX8A 2L0AA 2V8KA 2K3YA 1PRMC 1T3LA 1NJIC 2RI5A 3V8KA 3PE0A 1I4K1 4AG1C 1S72Q 3G71T 4FCYA 1YI2A 1GXIE 1H92A 3H0HA 1H3ZA 1ABOA 2YRCA 2E64A 2QA4Q 2LJ0A 4JDSA 1Z9ZA 4M77D 4C92C 3M57A 3JCMJ 4IKFA 3META 1TWBA 1IREB 1JQQA 3CPWS 5GJWB 2GFUA 3M53A 1LVKA 2EQKA 2DE0X 3CCQQ 4JJBA 3ZBDA 1GFDA 4RTZA 3I56T 2K9GA 2F5TX 3EGDB 2KDSA 4PFOA 3KXTA 2DLPA 2KNBB 4ELYC 2BE9B 2RHIA 1YHQQ 1TU0B 2RQTA 2LT4A 3QSUA 5GAN5 1M27C 4CC7A 3MP6A 1NLPC 4JUVA 3GIBA 1OULA 1X75C 2XDPA 3EH1A 2XDBA 1NYGA 4E47A 2DA9A 1PSFA 3HRUA 1S1NA 3OW2A 4ZGJB 4DOVA 1RAHB 1YIJA 2L3QA 1YITA 3OYCA 1C0MA 3CPFA 2O2OA 1E7OA 2K2VA 3JCMf 4LDVA 1VQOA 5C0MA 2EKOA 2EGAA 3EHRA 1H8KA 3JB9F 2RNAA 2PU9B 5DLQE 3OYKA 2MI6A 3V8JA 1BCOA 2VGNA 2I2LA 4J6XA 3HP9A 3SD4A 4J9EA 1FXXA 1HXDA 1QP2A 4LUDA 4XK8E 2EYQA 2PZ1A 1PKTA 1Q95G 2ECZA 4M75B 3TCJA 3JCMh 3CCUA 1Q7YR 3VU3C 3HSBA 4M77E 1WJSA 2QASA 1VQ8A 4RUGA 1OPLA 5LJ3d 3I56Q 2JS0A 2NUZA 3VJPA 1Q81U 3V8LA 3L2VA 3EGXB 1EX4A 4C8QB 3QJ6A 1OQKA 1TOVA 2BIVA 1WLPB 4OF1A 2E70A 3HFNA 1YI2Q 3OYBA 1M1FA 2QYZA 1UJ0A 2JMAA 1RADB 2BE7D 1Y96B 4FYYB 5GAOl 2DL4A 3QZ9B 3ER0A 4XTZA 2CP5A 3H8ZA 4DA4A 2QGGA 4XTYA 4PLLA 2GFAA 3G4SQ 2HBPA 1VQ9T 1VQNQ 3VUZA 1BK2A 3CC7A 2OTJT 2KT1A 2L89A 2EJGA 2F2XA 3L42A 1ZUUA 4KUIA 1Y96A 2NUTA 4LE9A 1NPPA 1N9SA 2LX9A 2MF2A 1OU9A 4ESRA 3VYHB 1UGSB 3VUBA 4BI8B 1IRXA 4A4KA 4IUPA 3CMAA 3CC2Q 1MGQA 2KMTA 1JB0E 1YCSB 3VS4A 5LJ3g 2RA2A 1YIJQ 2AZVA 3PNWC 5CKHA 1D09B 1WHGA 3A5ZB 5GAN4 3RKXA 2RO0A 3QDRB 3RERA 3MHXA 4E7HA 1G3YA 1QKWA 1NG2A 2QA4T 4HCZA 5IHNA 4C8QC 3NPFA 2FEIA 4HA8A 4IURA 1CKBA 4IIMA 2VUBA 2HBWA 2YUPA 2YXYA 1G3TA 1RLQC 2HEQA 2DXUA 1Q86C 1BI1A 1RL2A 2JVVA 1M1KR 2DILA 2FZCB 4ATOA 3I55Q 2O01E 4M75D 1Y71A 3EFOA 1QCFA 4MZMA 1B07A 4J7IA 4HCKA 1S72T 2X3XD 1X6BA 1XOVA 2ZPIB 4RTWA 1G5VA 2GF7A 4DEYA 2AK5A 3CCRA 3M0RA 2VYTA 2XU8A 4HKEA 2DK3A 4C0GA 4XAXB 2V26A 4AFUC 2M1HA 5LJ5g 2FZKB 4M4ZA 2ED0A 2K3BA 5KE3A 2VB6A 1MV3A 1ZUYA 4OMPA 1R8OB 2O9VA 1H3HA 6AT1B 4N4IA 3QUIA 2LCLA 1KIKA 3QWYA 3VYGA 1WGSA 2L2PA 5HK3A 2HQXA 2F2VA 2VV5A 1YITT 1Z9QA 2JOYA 3EG3A 1YN8A 1N5ZA 3VS7A 4C92E 1XJWB 2V1QA 5KYUA 4F04B 4C8QE 4JRKA 2EAYA 4WCIA 2RJDA 4X9DA 2KE9A 2E3HA 2E65A 1G3WA 3GOXA 4XTXA 3JB9D 3OYFA 5AT1B 2RB6A 2SRCA 1XNIA 1UB4A 4EDUA 2CH4W 1ZA1B 1QVGS 1N8RU 1RABB 4N0AA 2M0OA 3P8HA 4LUEA 3JB9G 2YRDA 2C06A 3T9NA 4OMLA 2EKHA 2X4JA 3FJ5A 3JCMe 5GAN3 1K73C 1VQ8Q 3RBBB 3OBWA 3TSWA 1VQ7A 1VQ4A 2DZCA 2RJCA 3I5SA 2E5KA 1RACB 2NUPA 2DBKA 2RHZA 3DKMA 3JCMQ 3EH2A 4EMHA 1N9RA 4AFSC 3CCST 3PIPA 2FYKA 4PLIA 5CK9A 2QTXA 1Y7XA 4XU3A 2EYWA 3M59A 2WACA 3ZL7C 4M7AE 2LQ8A 3RKWA 3LH5A 4Y92A 5HKCA 2E4HA 2DEQA 3VKIA 4QVDA 2HL5C 1K8AC 3J7AF 1NPRA 4XU0A 4PJLA 2RJEA 1VQOQ 4L59A 2VC8A 1K9MC 4PJOC 2B8AA 4C8QD 4OP0A 2LTOA 1WHMA 2FRYA 1M4ZA 3RUXA 5FU6C 2CDTA 4JJNK 4QQDA 4A63B 3UT1A 4FYXB 1TTHB 1FMWA 3V7CA 4M78E 4XTUA 5J26A 2XMFA 4BDYA 3L2WA 1W2BS 1WYXA 1AWWA 2C0TA 4K11A 4XU2A 4LD9K 3MJXA 4CC4B 3VRZA 1ZQ1A 5KYXA 5DM7R 2MWOA 2P4TA 4C5EA 4CC2A 2V8JA 2KEAA 1RAIB 2KYBA 2Y4YA 1AOJA 4AT1B 4DOWA 2C0OA 2LCCA 2LC4A 1NZ9A 2OAUA 2OX7A 5LJ5h 4R0KA 2MIOA 1GBQA 4KBMB 2O4XA 4PJOA 3OYEA 2LP5A 3PMTA 3QZ5B 2CZ7B 1M8MA 2HMAA 2QQRA 2CGHA 3QXEB 1N8RC 4M7AD 1YCYA 3EG9B 2DJQA 4XTVA 1SF9A 5GMKi 4AFZC 2ABLA 4KULA 4LD6A 2E6NA 4M75G 2KI7A 3FJPA 4ZN3A 1W2BA 2QI2A 3N5BB 3QIIA 2VKNA 3PIOA 2DBMA 1ZSZC 4RCBA 2YUQA 3ZEHA 4HXJA 2QXFA 5GAOq 3GNFB 5GAOm 1M90U 1QWFA 1TUGB 2E3IA 3M9QA 1K0XA 1K9MR 1TXQA 2RI3A 5KCHA 1ARKA 2OAWA 4ZNXA 3JV3A 1QLYA 3CXCP 1XTDA 1MUZA 3QYGB 3CC7T 2OTJA 2MMPA 4KGZB 4DEXA 1X01A 4F7UG 4PJOF 4NL2A 1EFNA 2QDLA 1VYUA 5CIUA 1VQ4T 3CCLQ 3CC2A 1I81A 3X24B 3CMEQ 3E2UA 8AT1B 2XG8D 3KFVA 2XDDA 3QJYA 1YNZA 4D8DA 3WVDB 1HK9A 3EG9A 1JJ2S 2E6ZA 3M0UA 1BYMA 2A7YA 3M54A 4UC4A 2BUDA 5LJ5j 1Q7YC 2QG9B 3A8OB 1PG5B 2CUDA 4NL3A 3M58A 1Q86U 4C92D 2PUKB 4BUGA 1VQMA 2DYIA 4JS4A 3PFSA 2DD5A 2JW4A 3REBB 2IPOB 4QVCA 3L2ZA 2LNHB 4FYVB 3H41A 1OPKA 4J9GA 4EPCA 2HKQB 4QQ6A 3VS6A 4M77C 3GBQA 2QQBA 3QWXX 4LDWA 2Z0WA 5GAMd 5FROA 5KYWB 4L5GA 3VV0A 3OA6A 3CQTA 3E9GA 3THKA 3QBYA 1YHQA 1KD1C 3CPWA 4M7DD 1OZ3A 1UFFA 3MKDA 3CCRT 2LRQA 3VS0A 2R5MA 3OYAA 3PVLA 2LT1A 3CCJQ 1MMNA 4C5IA 1Y07A 4GBQA 2EFIA 5GAMf 1ZSGA 2NUPB 4BE2A 1RI9A 2QQSA 1NJIR 2KRNA 1Q81R 2NWMA 3I5RA 4KGVB 1QCOA 5GMKe 3CCVT 5IHIA 2OTLQ 5D6XA 5M9OA 1Q7YU 1VOMA 2CKKA 2VGMA 1SPKA 2ENMA 2ROLA 2OJ2A 5CKEA 4M75A 1QVGA 1AD5A 3QHSA 1JJ2P 2QK0A 2EIFA 3CCMA 2P4RA 2KBTA 3CCEA 2QTVA 3E1SA 1KG1A 3MP8A 3FDRA 2HD0A 2YUOA 3GF5A 3L2UA 2L3PA 3SHWA 1QQJA 2RQRA 4PJOG 2CP3A 4J9CA 3I35A 1D0ZA 2ZPFB 3OYHA 1D3BA 1Q82C 5KYYA 4E7ZA 3QG1A 1TS9A 1BCMA 4ZTJA 1WXUA 1M3AA 1SRLA 1E6HA 4JJDA 2FPEA 3LWIA 1LOJA 1WI7A 4F14A 4OMNA 1XQHA 1B34B 1TH7A 4TVRA 3CCRQ 2DKGA 2K5FA 3O5ZA 4BY6C 3HHTB 2J6FA 3PGGA 1EIFA 4E7KA 2P0KA 3JSCA 4FSXA 4BI3A 1HD3A 3Q1JA 2CZ1B 1WQWA 1I0CA 2XIDA 5GAMj 3CCVQ 4MZTA 5I22A 5J39A 3G6EQ 3BDUA 4M78F 2DMOA 2DD4A 2KT8A 4PFPA 5GAOp 2RQWA 1X2KA 3NGPA 2AKKA 2XI9A 7AT1B 2IG0A 1B7TA 2B86A 2JM9A 4LNPA 2JM8A 3OYIA 2EBPA 1VQ9Q 1VQNT 1AEYA 1V1CA 4ZGDB 3S3MA 2AZSA 2D0QB 2PNIA 5LJ5f 1VIFA 3JCMV 3CMAQ 2J6KA 3VS5A 2HKNA 2D9TA 2DZ9A 2XK0A 1E6GA 3X25B 4A53A 4QKUA 5A0DA 3CD6A 1VQMT 1OYXA 1HJDA 2KY9A 4OGEA 4RTUA 1I5LA 4IIOA 1N8RR 2DL5A 2AIRB 3EFOB 3SWNB 3G1JA 1WZOA 3M0SA 3MEWA 1JXOA 4FU6A 5GAN6 1WXTA 4MMLA 1M3CA 4EIKA 2W10A 4D6WA 5CVIA 1ZBJA 3LH0A 5GJVB 2K7AA 4M77B 1GCQC 2K5LA 2M16A 1T0JA 1RI0A 2KGTA 4LXCA 3KUFA 1SSHA 4RCCA 3QKJA 4C92F 3H0IA 1VQLA 3OW2S 2KAFA 3HPWA 3J81E 1OV3A 4M75C 3QYHB 5EC7A 3G4SA 5IH2A 1X27A 2RHUA 2D8JA 2HSEB 2IIMA 1QVFA 1NM7A 4PNOA 1G83A 1U1TA 1WJRA 4Z89A 1MHNA 2P0QA 2LNVA 2O4XB 5IHKA 3DB4A 3SEMA 5L23A 2BKDN 2L5QA 4J6WA 2K5IA 2JZ2A 2IVWA 3OS1A 3CCJA 5LJ3e 2OTLT 3SDZA 4V2SA 4J6YA 1C1AA 2EW3A 2LDMA 3PVQA 2RMOA 2ATCB 2XICA 5IAYA 4JPBW 1M9SA 1M1KU 4II1A 1NJIU 1BU1A 1QCNA 2MAMA 3CCSQ 1UDLA 2OTLA 1Y0MA 3SB2A 3M56A 2KROA 2FO0A 4JZ3A 4OB0B 1LNXA 1N6AA 4FT4A 3I9QA 4AFQC 1AHJB 2K4YA 4GLKA 1FMVA 1PC0A 2L3RA 2M9UA 2O9SA 5CKBA 1H641 2LQNA 4XTWA 4Q5WA 2YLBA 3OS2A 3NHNA 4C92B 5GAN2 5FWCA 2V1RA 3M55A 3FEOA 1QVFP 3H0FA 1KQ2A 5HY6A 3V7SA 3JCMP 4C0ZA 2W0ZA 3BE3A 4VUBA 3LGFA 3GP8A 4E7JA 2E5QA 1Y57A 1M1GA 2EQUA 1FWZA 2CYZB 5ECAA 3DLMA 4Y28E 2NLUA 3SWNA 2RJFA 1WIEA 3EG1A 3M4YA 1JRIA 3J80E 4KH1B 5CKDA 1RLPC 1K76A 3TU4K 3M5AA 5GANe 2DIQA 4N4GA 4J5YA 5GAN7 3FRNA 1ZX6A 4IUQA 2QAZA 2X4YA 2PQWA 3MPUB 2HL3A 3RMQA 5C6SA 2E12A 1UGRB 4JRIA 1K9AA 3QPHA 2YDLA 3L2RA 2K2MA 2EVRA 1VQ8T 1UHFA 3HRSA 4CI0C 3G71Q 1UEBA 1M3BA 1VQKT 2F1LA 3OSVA 2EQIA 2MCNA 1R0BG 2GNCA 2MOXA 2BTTA 2EQMA 4QT7A 3HKSA 4M7AB 1U1SA 1ZBXA 2CT3A 2FL7A 2I0NA 2OI3A 1KC8U 2J7IA 3L1AA 4PJNA 1VUBA 2O88A 1ZSZA 2PTKA 2J06A 1NYFA 2C0IA 4FW2A 3GNGA 3OQ5A 1VYVA 1AZGB 1PCXA 5CKFA 1HYOA 4IUTA 2RH2A 1G8XA 2DVEA 3CBMA 4M7AC 2HQHA 2EQJA 4A4FA 2HQEA 1QP3A 3MO8A 1UGQB 4RKUE 4HCBA 2AHJB 1M8VA 1SHFA 1K1ZA 2ZPEB 5KCOA 2FHDA 8ATCB 3ZFJA 4DBFA 3MEVA 1YWOA 4PFZA 3H9NA 1D1BA 3MP1A 1BIBA 2D8HA 3CC4Q 2DRMA 2FZGB 1YJNT 5KYXB 2CP2A 1VQPA 1PKSA 3PMIA 3RKYA 5J3BA 4P5NA 3SFMA 2E1HA 2DO3A 3TVTA 1NBEB 5KE2A 1KSWA 1YWPA 2GTOA 2ZZDA 3M4GA 3EGDA 2LMJA 2X9HA 2RHXA 1YIJT 1WHHA 3E19A 1KQ1A 3BDLA 5LJ3j 3UPUA 2BZ8A 1GRIA 4GLMA 4XQ3A 2QGFB 5CQXA 1WXBA 1G2BA 1SKUB 4J9HA 4F16A 4L6V5 4QW2A 1ZSZB 2XHCA 2K79A 1D1CA 1MV0B 2DPPB 5CQYA 2DL3A 3JCMX 1X2QA 5GAMg 1ABQA 1SSFA 3CMEA 1OX9A 2KQWA 3CD6Q 1YJ9Q 2QEXQ 3CCJT 1BB9A 2E41A 3CXCS 3UA7A 4J7FA 1RAFB 1VQ7Q 2LQWA 1JBMA 4D8KA 2A28A 2DAQA 4R56A 1T0HA 4KRTA 1PM3A 4OMQA 1Q82U 4C92G 5DY9A 3OMGA 4Z02A 2GBQA 4MZPA 3FC3A 2DNUA 2YSQA 1YI2T 4LDUA 2ROTA 2FRWA 4M7DG 2WSFE 2XKOC 2MK5A 1PSEA 5D7UA 3OS0A 2G3RA 5HCKA 3JCMc 4RTTA 1G3SA 2K57A 4XU1A 2DXTA 4C92A 2WSCE 3INZA 3G4ST 3JCMd 1VQ5A 4JS5A 4FIBA 2RK1A 3PTAA 3CCQA 4A4EA 3G6EA 1OI1A 1CSKA 1MMDA 4QQGA 5LL6S 1B3QA 2BZXA 4M7DC 1GCQA 4WTOB 3CXCA 1UJYA 1KQSP 2ED1A 2COYA 4J9FA 3TREA 3OYMA 3OYDA 2ZPHB 5FU6B 2JJ9A 4BACA 4BI4A 1AWXA 1J3TA 3CC2T 4EMKA 2ZGWA 5KH6A 1VQKA 4F17A 3CD6T 2CP7A 3CCSA 2QEXT 1ACMB 1ZUKA 3WVEB 1I8FA 1VQ7T 1VQ6T 5I2SA 4HT8A 2YRVA 3A8LB 1PHTA 3CCMQ 4HVWA 4PKCC 1D0XA 4J83A 2EGCA 5HK0A 1M2OA 4C0DB 3G71A 3G7ZA 4J8OA 1I5OB 5FW9A 2X4XA 2COWA 1QMCA 3RESA 2DTOA 2KRMA 5I2MA 3LWHA 3UWNA 4ZGEB 5A2QE 3ASKA 1WJQA 2HSPA 2RM4A 1LJOA 3A8MB 2VXEA 2E10A 4E7SA 3OB9A 1JXMA 4E6RA 3M0PA 2KRSA 2K6DA 2DX1A 1BIAA 1TUCA 2EPDA 1SRMA 2DTHA 3EFRA 5FRNA 1VQOT 1VQ6A 4M78B 5KYUB 2HDAA 2FG0A 1IHWA 2PVDB 5LJ5e 2COZA 4M77A 2M02A 5GAN8 2DYBA 2CZ0B 3RIRA 4PJMA 2HNIA 4M75F 1QVGP 2KXCA 1P92A 3LX7A 3X26B 4AG2C 4RMOA 1OEBA 2A3LA 2YT6A 4M7DA 5KYNA 1VQPQ 2A0FB 4N0AC 1O9SA 4M78C 1Q86R 4AMCA 1QVFS 4BDZA 3URGA 4X9CA 4M7AF 1IZ6A 1SEMA 3EGUA 5DLOA 4NS5A 1S72A 3CCMT 2NUTB 4MDXA 2JN0A 4F7UF 5FU7B 5GMKj 1VQ9A 2QDYB 1GBRA 3G6ET 4FM4B 1D1AA 4R55A 1JU5C 4EMGA 3C0CA 1WNLA 2JUFA 2DERA 3OSSC 1AVZC 2ZCFB 4CRIA 3CCUQ 1V76A 4LDYA 3QDFA 2Y4XA 5I21A 1YP5A 2HAXA 2DF6A 2DJZA 4PL6A 2A08A 4OVAA 2V8IA 1K9MU 4RTVA 4HT9A 4FT2A 3P8DA 1M90R 1IXDA 4C8QA 3X28B 3VRYA 3HL8A 1HSQA 1PWTA 3M0TA 2D6FA 2DVJA 3E9FA 2KYMA 4BB7A 3I55T 5CR2A 3NTKA 2M51A 1K0SA 2VVKA 4RG8A 3EG2A 1GFCA 3I55A 3JB9H 2R57A 3L2QA 2HZYA 4MMKA 1K8AU 1DJ7B 4PJOE 1EZZB 1YJWQ 2F5KA 5FRMA 4JJCA 3CCQT 4PK4A 1IHVA 1YFNA 3LGLA 1K73U 2DXBA 1UGPB 2PVGB 5IXBA 3CEYA 5EG2A 4JLGA 2FPDA 5CAIA 2MPXC 2JTEA 1MNDA 1QKXA 1YHQT 1R77A 4C8QF 1N27A 1SG5A 2CSQA 3GPLA 2GTJA 5I11A 1U8RA 2VXFA 2LQKA 1AWJA 4M7DB 1PNJA 3HRTA 1C6VX 1LPLA 3UA6A 2PVOB 3QO3A 4C5HA 1PD1A 2RK2A 1JO8A 2YUNA 3FIFA 2GGRA 2DFUA 2LJ3A 4ANJA 3H6ZA 1JJ2A 2DTIA 3UDCA 2ZPBB 4E7IA 2AT1B 4OB1B
chains in the Genus database with same CATH topology
1KJWA 1H92A 1M3BA 3H0HA 1ABOA 2LJ0A 2VKNA 2DBMA 1VYTA 2EQIA 1Z9ZA 2YUQA 2MCNA 4HXJA 2GNCA 2MOXA 2BTTA 4QT7A 1QWFA 2DRKA 4FSSA 1JQQA 1K0XA 2D0NA 1ARKA 5GJWB 3REAB 2CT3A 2OAWA 2I0NA 2OI3A 1M30A 1T3SA 2CSIA 4ZNXA 3JV3A 1QLYA 2DE0X 4JJBA 1MUZA 2J7IA 1GFDA 4RTZA 2O88A 2PTKA 1TUDA 1UG1A 2AKLA 2K9GA 4RTYA 3ULRB 4DEXA 2J06A 1NYFA 1EFNA 1UECA 2GQIA 2QDLA 1VYUA 2C0IA 2DLPA 2KNBB 1ZLMA 1VYVA 1AZGB 2RQTA 1M27C 4CC7A 2RQUA 3TSZA 1WA7A 3KFVA 1NLPC 1SHFA 2J6OA 1YNZA 1K1ZA 4D8DA 1NYGA 3RNJA 2DA9A 1YWOA 2H8HA 1S1NA 3M0UA 2D8HA 2DRMA 2L3QA 2KXDA 2CUDA 2O2OA 1E7OA 1PKSA 1QWEA 1PRLC 3TVTA 1KSWA 1YWPA 2GTOA 3EHRA 2EGAA 1H8KA 2JW4A 3REBB 2LMJA 3EG0A 1SHGA 2RPNA 1UHCA 2LNHB 4ORZA 2RNAA 3H41A 1OPKA 1I07A 4J9GA 2BZ8A 1GRIA 4GLMA 1JEGA 3VS6A 2BZYA 3GBQA 1GL5A 1WXBA 1G2BA 4J9HA 4F16A 4J9EA 3QWXX 1A0NB 2K79A 1MV0B 2DL3A 4LUDA 3CQTA 2PZ1A 3THKA 1X2QA 1PKTA 1ABQA 2KR3A 2ECZA 1UFFA 2JT4A 2LX7A 1BB9A 3VS0A 1W70A 3PVLA 4RUGA 1OPLA 2JS0A 3UA7A 2L3SA 4GBQA 2LQWA 2NUZA 1ZSGA 4D8KA 1RI9A 2A28A 2A37A 1T0HA 4KRTA 4OMQA 2KRNA 2NWMA 2GBQA 3I5RA 2DNUA 2YSQA 1WLPB 2ROTA 5IHIA 2FRWA 1U06A 4Z88A 2O31A 1SPKA 5HCKA 2ENMA 1UJ0A 2JMAA 4RTTA 2ROLA 2OJ2A 1AD5A 2DL4A 2JMCA 5FWBA 2P4RA 2RF0A 2KBTA 1BK2A 2J05A 2YUOA 2KT1A 1CSKA 4HVUA 2F2XA 1B3QA 2L3PA 2BZXA 1GCQA 1ZUUA 3SHWA 2RQRA 4LE9A 1UJYA 4J9CA 3I35A 3U23A 4ESRA 2ED1A 2CUBA 4J9FA 4X1VA 1WXUA 1M3AA 1SRLA 1E6HA 1UGVA 2EGEA 2FPEA 4JJDA 1AWXA 1J3TA 1WI7A 2G6FX 2FPFA 1YCSB 3VS4A 4F14A 4OMNA 4F17A 2AZVA 4HVVA 1WDXA 1ZUKA 3O5ZA 1QKWA 2J6FA 1NG2A 5IHNA 2LJ1A 3NPFA 2FEIA 1PHTA 2DL8A 1HD3A 4HVWA 1GCPA 1CKBA 4IIMA 1I0CA 2EGCA 2HBWA 2CREA 2CH4A 2EYYA 2YUPA 5I22A 5FW9A 2DMOA 4LN2A 2KT8A 2KRMA 2RQWA 1X2KA 3NGPA 1RLQC 2HEQA 2AKKA 3R6NA 1I1JA 4J9DA 1WX6A 2HSPA 1NEBA 2B86A 1VA7A 2JM9A 4LNPA 2DILA 2JM8A 1JXMA 4E6RA 2EBPA 3M0PA 1NEGA 1AEYA 1V1CA 5IXFA 3M0QA 2KRSA 1QCFA 1B07A 2AZSA 2K6DA 2PNIA 2RQVA 4HCKA 4Z8AA 2DX1A 2X3XD 1X6BA 1XOVA 1TUCA 2EPDA 2J6KA 3VS5A 2D1XA 4RTWA 1E6GA 1SRMA 4DEYA 1RUWA 2JXBA 3VS1A 1AWOA 2AK5A 2VWFA 1HJDA 3M0RA 1X43A 2HDAA 2FG0A 4RTUA 4AFUC 4JZ4A 2DYBA 2JS2A 4OMMA 4M4ZA 4IIOA 2ED0A 2DL5A 2K3BA 1MV3A 1ZUYA 2KXCA 3M0SA 4OMPA 1JXOA 1UUEA 1WXTA 4AG2C 2O9VA 1FYNA 2M0YA 1M3CA 1OEBA 1H3HA 3UATA 2W10A 2YT6A 4EIKA 1ZBJA 5GJVB 2K7AA 1KIKA 1GCQC 3QWYA 1WFWA 2L2PA 1T0JA 4CC3A 2KGTA 2F2VA 3A98A 1Z9QA 3EG3A 1YN8A 1SSHA 1SEMA 2HCKA 3EGUA 1N5ZA 2A36A 3H0IA 3VS7A 1CKAA 2V1QA 1K4US 1KFZA 2EYXA 1OV3A 1W1FA 5EC7A 4WCIA 3VS2A 5IH2A 1X27A 2D8JA 2IIMA 2KE9A 1NM7A 1GBRA 1G83A 1TG0A 3UF4A 2SRCA 3EHQA 4Z89A 2LCSA 2LZ6B 2CH4W 1JU5C 4J9IA 3C0CA 5IHKA 2SEMA 3SEMA 5L23A 4LUEA 1AVZC 4OMLA 2EKHA 3FJ5A 1YP5A 3RBBB 2DF6A 1U5SA 3TSWA 3I5SA 2EW3A 3VS3A 2E5KA 3PVQA 2RMOA 2A08A 2DBKA 4JPBW 4RTVA 1UTIA 1BU1A 3VRYA 1HSQA 1PWTA 1UDLA 4AFSC 3M0TA 2DL7A 1Y0MA 2DVJA 2KROA 2FO0A 1LCKA 4JZ3A 2KYMA 3I9QA 2EYWA 4AFQC 3ZL7C 2DM1A 2M51A 1K0SA 2VVKA 3LH5A 4Y92A 2RN8A 2F2WA 2ESWA 3EG2A 1GFCA 2O9SA 1X6GA 2LQNA 2CT4A 3NHNA 3NMZC 1W6XA 2X3WD 2FRYA 1OOTA 5FWCA 2CDTA 2V1RA 4OMOA 2EYZA 1UE9A 4A63B 3H0FA 4JJCA 5IXBA 3IQLA 2W0ZA 1IO6A 2XMFA 1Y57A 4J9BA 1WYXA 1AWWA 2C0TA 2FPDA 4K11A 2JTEA 1QKXA 5ECAA 1FMKA 4CC4B 3VRZA 4RTXA 2CSQA 2GTJA 1WIEA 3EG1A 4CC2A 5I11A 2KEAA 1BBZA 2KYBA 1AWJA 1AOJA 1AZEA 1RLPC 1PNJA 1K76A 1NLOC 2C0OA 3UA6A 1X69A 1U3OA 1GBQA 2MIOA 4R0KA 1ZX6A 1JO8A 2LP5A 2YUNA 2GGRA 1M8MA 2L0AA 2LJ3A 1PRMC 2DJQA 1K9AA 2YDLA 1T3LA 2K2MA 2EVRA 3PE0A 4AFZC 2ABLA 4AG1C 1UHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KJW A;  1H92 A;  1M3B A;  3H0H A;  1ABO A;  2LJ0 A;  2VKN A;  2DBM A;  1VYT A;  2EQI A;  1Z9Z A;  2YUQ A;  2MCN A;  4HXJ A;  2GNC A;  2MOX A;  2BTT A;  4QT7 A;  1QWF A;  2DRK A;  4FSS A;  1JQQ A;  1K0X A;  2D0N A;  1ARK A;  5GJW B;  3REA B;  2CT3 A;  2OAW A;  2I0N A;  2OI3 A;  1M30 A;  1T3S A;  2CSI A;  4ZNX A;  3JV3 A;  1QLY A;  2DE0 X;  4JJB A;  1MUZ A;  2J7I A;  1GFD A;  4RTZ A;  2O88 A;  2PTK A;  1TUD A;  1UG1 A;  2AKL A;  2K9G A;  4RTY A;  3ULR B;  4DEX A;  2J06 A;  1NYF A;  1EFN A;  1UEC A;  2GQI A;  2QDL A;  1VYU A;  2C0I A;  2DLP A;  2KNB B;  1ZLM A;  1VYV A;  1AZG B;  2RQT A;  1M27 C;  4CC7 A;  2RQU A;  3TSZ A;  1WA7 A;  3KFV A;  1NLP C;  1SHF A;  2J6O A;  1YNZ A;  1K1Z A;  4D8D A;  1NYG A;  3RNJ A;  2DA9 A;  1YWO A;  2H8H A;  1S1N A;  3M0U A;  2D8H A;  2DRM A;  2L3Q A;  2KXD A;  2CUD A;  2O2O A;  1E7O A;  1PKS A;  1QWE A;  1PRL C;  3TVT A;  1KSW A;  1YWP A;  2GTO A;  3EHR A;  2EGA A;  1H8K A;  2JW4 A;  3REB B;  2LMJ A;  3EG0 A;  1SHG A;  2RPN A;  1UHC A;  2LNH B;  4ORZ A;  2RNA A;  3H41 A;  1OPK A;  1I07 A;  4J9G A;  2BZ8 A;  1GRI A;  4GLM A;  1JEG A;  3VS6 A;  2BZY A;  3GBQ A;  1GL5 A;  1WXB A;  1G2B A;  4J9H A;  4F16 A;  4J9E A;  3QWX X;  1A0N B;  2K79 A;  1MV0 B;  2DL3 A;  4LUD A;  3CQT A;  2PZ1 A;  3THK A;  1X2Q A;  1PKT A;  1ABQ A;  2KR3 A;  2ECZ A;  1UFF A;  2JT4 A;  2LX7 A;  1BB9 A;  3VS0 A;  1W70 A;  3PVL A;  4RUG A;  1OPL A;  2JS0 A;  3UA7 A;  2L3S A;  4GBQ A;  2LQW A;  2NUZ A;  1ZSG A;  4D8K A;  1RI9 A;  2A28 A;  2A37 A;  1T0H A;  4KRT A;  4OMQ A;  2KRN A;  2NWM A;  2GBQ A;  3I5R A;  2DNU A;  2YSQ A;  1WLP B;  2ROT A;  5IHI A;  2FRW A;  1U06 A;  4Z88 A;  2O31 A;  1SPK A;  5HCK A;  2ENM A;  1UJ0 A;  2JMA A;  4RTT A;  2ROL A;  2OJ2 A;  1AD5 A;  2DL4 A;  2JMC A;  5FWB A;  2P4R A;  2RF0 A;  2KBT A;  1BK2 A;  2J05 A;  2YUO A;  2KT1 A;  1CSK A;  4HVU A;  2F2X A;  1B3Q A;  2L3P A;  2BZX A;  1GCQ A;  1ZUU A;  3SHW A;  2RQR A;  4LE9 A;  1UJY A;  4J9C A;  3I35 A;  3U23 A;  4ESR A;  2ED1 A;  2CUB A;  4J9F A;  4X1V A;  1WXU A;  1M3A A;  1SRL A;  1E6H A;  1UGV A;  2EGE A;  2FPE A;  4JJD A;  1AWX A;  1J3T A;  1WI7 A;  2G6F X;  2FPF A;  1YCS B;  3VS4 A;  4F14 A;  4OMN A;  4F17 A;  2AZV A;  4HVV A;  1WDX A;  1ZUK A;  3O5Z A;  1QKW A;  2J6F A;  1NG2 A;  5IHN A;  2LJ1 A;  3NPF A;  2FEI A;  1PHT A;  2DL8 A;  1HD3 A;  4HVW A;  1GCP A;  1CKB A;  4IIM A;  1I0C A;  2EGC A;  2HBW A;  2CRE A;  2CH4 A;  2EYY A;  2YUP A;  5I22 A;  5FW9 A;  2DMO A;  4LN2 A;  2KT8 A;  2KRM A;  2RQW A;  1X2K A;  3NGP A;  1RLQ C;  2HEQ A;  2AKK A;  3R6N A;  1I1J A;  4J9D A;  1WX6 A;  2HSP A;  1NEB A;  2B86 A;  1VA7 A;  2JM9 A;  4LNP A;  2DIL A;  2JM8 A;  1JXM A;  4E6R A;  2EBP A;  3M0P A;  1NEG A;  1AEY A;  1V1C A;  5IXF A;  3M0Q A;  2KRS A;  1QCF A;  1B07 A;  2AZS A;  2K6D A;  2PNI A;  2RQV A;  4HCK A;  4Z8A A;  2DX1 A;  2X3X D;  1X6B A;  1XOV A;  1TUC A;  2EPD A;  2J6K A;  3VS5 A;  2D1X A;  4RTW A;  1E6G A;  1SRM A;  4DEY A;  1RUW A;  2JXB A;  3VS1 A;  1AWO A;  2AK5 A;  2VWF A;  1HJD A;  3M0R A;  1X43 A;  2HDA A;  2FG0 A;  4RTU A;  4AFU C;  4JZ4 A;  2DYB A;  2JS2 A;  4OMM A;  4M4Z A;  4IIO A;  2ED0 A;  2DL5 A;  2K3B A;  1MV3 A;  1ZUY A;  2KXC A;  3M0S A;  4OMP A;  1JXO A;  1UUE A;  1WXT A;  4AG2 C;  2O9V A;  1FYN A;  2M0Y A;  1M3C A;  1OEB A;  1H3H A;  3UAT A;  2W10 A;  2YT6 A;  4EIK A;  1ZBJ A;  5GJV B;  2K7A A;  1KIK A;  1GCQ C;  3QWY A;  1WFW A;  2L2P A;  1T0J A;  4CC3 A;  2KGT A;  2F2V A;  3A98 A;  1Z9Q A;  3EG3 A;  1YN8 A;  1SSH A;  1SEM A;  2HCK A;  3EGU A;  1N5Z A;  2A36 A;  3H0I A;  3VS7 A;  1CKA A;  2V1Q A;  1K4U S;  1KFZ A;  2EYX A;  1OV3 A;  1W1F A;  5EC7 A;  4WCI A;  3VS2 A;  5IH2 A;  1X27 A;  2D8J A;  2IIM A;  2KE9 A;  1NM7 A;  1GBR A;  1G83 A;  1TG0 A;  3UF4 A;  2SRC A;  3EHQ A;  4Z89 A;  2LCS A;  2LZ6 B;  2CH4 W;  1JU5 C;  4J9I A;  3C0C A;  5IHK A;  2SEM A;  3SEM A;  5L23 A;  4LUE A;  1AVZ C;  4OML A;  2EKH A;  3FJ5 A;  1YP5 A;  3RBB B;  2DF6 A;  1U5S A;  3TSW A;  3I5S A;  2EW3 A;  3VS3 A;  2E5K A;  3PVQ A;  2RMO A;  2A08 A;  2DBK A;  4JPB W;  4RTV A;  1UTI A;  1BU1 A;  3VRY A;  1HSQ A;  1PWT A;  1UDL A;  4AFS C;  3M0T A;  2DL7 A;  1Y0M A;  2DVJ A;  2KRO A;  2FO0 A;  1LCK A;  4JZ3 A;  2KYM A;  3I9Q A;  2EYW A;  4AFQ C;  3ZL7 C;  2DM1 A;  2M51 A;  1K0S A;  2VVK A;  3LH5 A;  4Y92 A;  2RN8 A;  2F2W A;  2ESW A;  3EG2 A;  1GFC A;  2O9S A;  1X6G A;  2LQN A;  2CT4 A;  3NHN A;  3NMZ C;  1W6X A;  2X3W D;  2FRY A;  1OOT A;  5FWC A;  2CDT A;  2V1R A;  4OMO A;  2EYZ A;  1UE9 A;  4A63 B;  3H0F A;  4JJC A;  5IXB A;  3IQL A;  2W0Z A;  1IO6 A;  2XMF A;  1Y57 A;  4J9B A;  1WYX A;  1AWW A;  2C0T A;  2FPD A;  4K11 A;  2JTE A;  1QKX A;  5ECA A;  1FMK A;  4CC4 B;  3VRZ A;  4RTX A;  2CSQ A;  2GTJ A;  1WIE A;  3EG1 A;  4CC2 A;  5I11 A;  2KEA A;  1BBZ A;  2KYB A;  1AWJ A;  1AOJ A;  1AZE A;  1RLP C;  1PNJ A;  1K76 A;  1NLO C;  2C0O A;  3UA6 A;  1X69 A;  1U3O A;  1GBQ A;  2MIO A;  4R0K A;  1ZX6 A;  1JO8 A;  2LP5 A;  2YUN A;  2GGR A;  1M8M A;  2L0A A;  2LJ3 A;  1PRM C;  2DJQ A;  1K9A A;  2YDL A;  1T3L A;  2K2M A;  2EVR A;  3PE0 A;  4AFZ C;  2ABL A;  4AG1 C;  1UHF A; 
#chains in the Genus database with same CATH topology
 2QQA A;  1KJW A;  1KHC A;  3CCV A;  4JRP A;  4A54 A;  1VIE A;  1VYT A;  2DEU A;  5A0G A;  4DBR A;  2DRK A;  4FSS A;  2JTF A;  1W2B P;  2D0N A;  5IN1 A;  3REA B;  3OY9 A;  1M30 A;  1T3S A;  2CSI A;  5CCA A;  4C0D C;  4FYW B;  1TUD A;  1UG1 A;  2AKL A;  4RTY A;  4M78 A;  3ULR B;  5LJ5 d;  1UEC A;  2GQI A;  2JNG A;  1ZLM A;  5AYF A;  4HCC A;  1YBY A;  3D7S B;  3CCL T;  4F7U A;  3OYG A;  2RQU A;  3TSZ A;  3CME T;  1WA7 A;  3PT9 A;  1WHJ A;  2J6O A;  4KUD K;  2GCX A;  3RR6 A;  2X4W A;  5GAN j;  4NOY A;  3RNJ A;  2P84 A;  3R6O A;  4OB2 B;  5GMK l;  3V7R A;  4EMK B;  2H8H A;  1M1K C;  1IGU A;  4IUU A;  1YJN Q;  1MNE A;  4M7A A;  2KXD A;  1AT1 B;  3JCM b;  3RMS A;  3TQ7 P;  5KYY B;  1QWE A;  5KYW A;  3S3N A;  1PRL C;  4O6J A;  3ME9 A;  4BD3 A;  3OW2 P;  2KVQ G;  3EG0 A;  1SHG A;  1RAG B;  2RPN A;  1VQL Q;  1UHC A;  4ORZ A;  1VQP T;  1QVP A;  1I07 A;  5GAM e;  4C8Q G;  3CPW P;  1JEG A;  3EAE A;  4F7U B;  2BZY A;  2EJF A;  1GL5 A;  1A0N B;  1M5Q 1;  1ZA2 B;  1WHK A;  3F70 A;  3JB9 I;  2R58 A;  2L8D A;  2QQ9 A;  4M75 E;  2WSE E;  1QW1 A;  2KR3 A;  2EJ9 A;  4O5V A;  2X35 A;  1ZHI A;  4N4H A;  2JT4 A;  4Y91 A;  1FX7 A;  2LX7 A;  1W70 A;  4M77 F;  4JLI A;  4QVZ A;  2ZAE A;  2L3S A;  3C12 A;  1Q82 R;  2A37 A;  4B9X A;  5GAN f;  3CCU T;  1KQS S;  2DET A;  4KH0 B;  4LDX A;  1KD1 U;  4M7D F;  4DBH A;  3KBG A;  1YJW T;  3CMA T;  1U06 A;  4ELZ C;  4F7U E;  4Z88 A;  2O31 A;  2DXC A;  1X6O A;  4C0F A;  3S6W A;  3HTR A;  3GLX A;  3X20 B;  5GAN d;  2X51 A;  2JMC A;  5FWB A;  5FLX E;  3DLL A;  1YJW A;  4C5G A;  2RF0 A;  4DBQ A;  2J05 A;  2QA4 A;  2GQV A;  4HVU A;  2OTJ Q;  2KK4 A;  4E2F B;  4GY5 A;  2NYS A;  1VQL T;  3CCE T;  5LJ3 h;  4M77 G;  3U23 A;  5A0L A;  3CC4 T;  4M78 G;  2CUB A;  4X1V A;  1D0Y A;  2RD1 A;  1Q81 C;  4WF2 A;  3BY7 A;  2VAS A;  3CBO A;  1UGV A;  2EGE A;  1M90 C;  2G6F X;  2XD0 A;  2FPF A;  5CO7 A;  1K73 R;  3DB3 A;  2CP6 A;  2MWP A;  2K3X A;  4HVV A;  3OYL A;  1WDX A;  1YJ9 T;  1K8A R;  9ATC B;  5GMK m;  3A1P A;  1RAA B;  5LJ3 f;  2LJ1 A;  3FB9 A;  2DL8 A;  1GCP A;  2MYS A;  1VQ5 Q;  1KC8 R;  2CRE A;  2CH4 A;  2EYY A;  1V29 B;  3JRZ A;  3OYJ A;  4LN2 A;  5L8R E;  4OMF B;  3R6N A;  1I1J A;  4J9D A;  2RI2 A;  4FW1 A;  2YLC A;  2PUO B;  1WX6 A;  1WPY A;  1NEB A;  4ZN1 A;  1VA7 A;  3C95 A;  3NTI A;  1NEG A;  2EWN A;  4DQ2 A;  4RG2 A;  4ZTF A;  5IXF A;  3M0Q A;  3RDV A;  4Z8A A;  2RQV A;  3HFO A;  2RHY A;  2D1X A;  1W4S A;  1RUW A;  2JXB A;  1KK7 A;  3JCM g;  3VS1 A;  3S3O A;  1AWO A;  2VWF A;  3C94 A;  2QEX A;  5GAN h;  1B34 A;  1X43 A;  3BW1 A;  2CZ6 B;  4JZ4 A;  4OMM A;  2JS2 A;  2H3J A;  3A8H B;  4A4H A;  1O75 A;  4B9W A;  1M2V B;  2F69 A;  2FB7 A;  1UUE A;  5GAO r;  4PJJ A;  3OMC A;  5FU7 C;  1FYN A;  2M0Y A;  1BI0 A;  3UAT A;  1IB8 A;  2H3E B;  1BI3 A;  5GAO n;  4BE0 A;  1TSF A;  4BE1 A;  1WFW A;  4CC3 A;  3A98 A;  2CS7 A;  5GMK h;  1MMA A;  4PJO B;  3CC4 A;  1YIT Q;  2HCK A;  1KQS A;  4PJO D;  2A36 A;  1CKA A;  1K4U S;  2FVU A;  1KFZ A;  2DIG A;  2EYX A;  3SWN C;  1W1F A;  3NTH A;  1VQN A;  3VS2 A;  4OGC A;  1VQ5 T;  5GAM h;  2JTM A;  2ZPG B;  1KC8 C;  3JAM E;  1TG0 A;  3UF4 A;  1WQ7 A;  3EHQ A;  4JRQ A;  2LCS A;  2LZ6 B;  3OYN A;  1NE8 A;  4J9I A;  2YWW A;  2SEM A;  3LYI A;  1VQ6 Q;  3JCM W;  1D3B B;  1KHI A;  3LW5 E;  2CP0 A;  4KGX B;  1U5S A;  3AT1 B;  3OBY A;  3VS3 A;  2LVM A;  3A8G B;  1KD1 R;  3CCL A;  1VQK Q;  1PD0 A;  5D6Y A;  1MMG A;  5D6W A;  1UTI A;  4YTL A;  4FL6 A;  3I56 A;  4MDW A;  2DL7 A;  1LCK A;  4A4G A;  1IGQ A;  2DM1 A;  1YJN A;  4ME7 A;  1BKB A;  4IUV A;  2RN8 A;  3BFM A;  4EMK C;  3AHU A;  2F2W A;  2ESW A;  4M78 D;  1X6G A;  3CCE Q;  1WHL A;  5IT9 E;  1VQM Q;  4OB3 B;  2CT4 A;  3NMZ C;  1W6X A;  2X3W D;  2P0P A;  3LLR A;  3O8V A;  1OOT A;  3FLG A;  4OMO A;  2EYZ A;  1UE9 A;  1RAE B;  1OZ2 A;  5GAN g;  3MEU A;  3CC7 Q;  3OYY A;  2YHT A;  2KSS A;  3MEA A;  3IQL A;  1IO6 A;  4E7L A;  3P8B B;  1F1B B;  4J9B A;  1VQ4 Q;  3TEE A;  4X34 A;  1R0C B;  3JB9 J;  4BY6 B;  2Y90 A;  1FMK A;  4B6M A;  1OU8 A;  3OS5 A;  4RTX A;  1M2V A;  2R5A A;  4M7D E;  1BBZ A;  3MCA B;  3CBP A;  4KT0 E;  1AZE A;  1BI2 A;  3C4S A;  3NFC A;  3EFS A;  1NLO C;  4M7A G;  3WXM B;  1X69 A;  1U3O A;  3EGX A;  1YJ9 A;  1OX8 A;  2L0A A;  2V8K A;  2K3Y A;  1PRM C;  1T3L A;  1NJI C;  2RI5 A;  3V8K A;  3PE0 A;  1I4K 1;  4AG1 C;  1S72 Q;  3G71 T;  4FCY A;  1YI2 A;  1GXI E;  1H92 A;  3H0H A;  1H3Z A;  1ABO A;  2YRC A;  2E64 A;  2QA4 Q;  2LJ0 A;  4JDS A;  1Z9Z A;  4M77 D;  4C92 C;  3M57 A;  3JCM J;  4IKF A;  3MET A;  1TWB A;  1IRE B;  1JQQ A;  3CPW S;  5GJW B;  2GFU A;  3M53 A;  1LVK A;  2EQK A;  2DE0 X;  3CCQ Q;  4JJB A;  3ZBD A;  1GFD A;  4RTZ A;  3I56 T;  2K9G A;  2F5T X;  3EGD B;  2KDS A;  4PFO A;  3KXT A;  2DLP A;  2KNB B;  4ELY C;  2BE9 B;  2RHI A;  1YHQ Q;  1TU0 B;  2RQT A;  2LT4 A;  3QSU A;  5GAN 5;  1M27 C;  4CC7 A;  3MP6 A;  1NLP C;  4JUV A;  3GIB A;  1OUL A;  1X75 C;  2XDP A;  3EH1 A;  2XDB A;  1NYG A;  4E47 A;  2DA9 A;  1PSF A;  3HRU A;  1S1N A;  3OW2 A;  4ZGJ B;  4DOV A;  1RAH B;  1YIJ A;  2L3Q A;  1YIT A;  3OYC A;  1C0M A;  3CPF A;  2O2O A;  1E7O A;  2K2V A;  3JCM f;  4LDV A;  1VQO A;  5C0M A;  2EKO A;  2EGA A;  3EHR A;  1H8K A;  3JB9 F;  2RNA A;  2PU9 B;  5DLQ E;  3OYK A;  2MI6 A;  3V8J A;  1BCO A;  2VGN A;  2I2L A;  4J6X A;  3HP9 A;  3SD4 A;  4J9E A;  1FXX A;  1HXD A;  1QP2 A;  4LUD A;  4XK8 E;  2EYQ A;  2PZ1 A;  1PKT A;  1Q95 G;  2ECZ A;  4M75 B;  3TCJ A;  3JCM h;  3CCU A;  1Q7Y R;  3VU3 C;  3HSB A;  4M77 E;  1WJS A;  2QAS A;  1VQ8 A;  4RUG A;  1OPL A;  5LJ3 d;  3I56 Q;  2JS0 A;  2NUZ A;  3VJP A;  1Q81 U;  3V8L A;  3L2V A;  3EGX B;  1EX4 A;  4C8Q B;  3QJ6 A;  1OQK A;  1TOV A;  2BIV A;  1WLP B;  4OF1 A;  2E70 A;  3HFN A;  1YI2 Q;  3OYB A;  1M1F A;  2QYZ A;  1UJ0 A;  2JMA A;  1RAD B;  2BE7 D;  1Y96 B;  4FYY B;  5GAO l;  2DL4 A;  3QZ9 B;  3ER0 A;  4XTZ A;  2CP5 A;  3H8Z A;  4DA4 A;  2QGG A;  4XTY A;  4PLL A;  2GFA A;  3G4S Q;  2HBP A;  1VQ9 T;  1VQN Q;  3VUZ A;  1BK2 A;  3CC7 A;  2OTJ T;  2KT1 A;  2L89 A;  2EJG A;  2F2X A;  3L42 A;  1ZUU A;  4KUI A;  1Y96 A;  2NUT A;  4LE9 A;  1NPP A;  1N9S A;  2LX9 A;  2MF2 A;  1OU9 A;  4ESR A;  3VYH B;  1UGS B;  3VUB A;  4BI8 B;  1IRX A;  4A4K A;  4IUP A;  3CMA A;  3CC2 Q;  1MGQ A;  2KMT A;  1JB0 E;  1YCS B;  3VS4 A;  5LJ3 g;  2RA2 A;  1YIJ Q;  2AZV A;  3PNW C;  5CKH A;  1D09 B;  1WHG A;  3A5Z B;  5GAN 4;  3RKX A;  2RO0 A;  3QDR B;  3RER A;  3MHX A;  4E7H A;  1G3Y A;  1QKW A;  1NG2 A;  2QA4 T;  4HCZ A;  5IHN A;  4C8Q C;  3NPF A;  2FEI A;  4HA8 A;  4IUR A;  1CKB A;  4IIM A;  2VUB A;  2HBW A;  2YUP A;  2YXY A;  1G3T A;  1RLQ C;  2HEQ A;  2DXU A;  1Q86 C;  1BI1 A;  1RL2 A;  2JVV A;  1M1K R;  2DIL A;  2FZC B;  4ATO A;  3I55 Q;  2O01 E;  4M75 D;  1Y71 A;  3EFO A;  1QCF A;  4MZM A;  1B07 A;  4J7I A;  4HCK A;  1S72 T;  2X3X D;  1X6B A;  1XOV A;  2ZPI B;  4RTW A;  1G5V A;  2GF7 A;  4DEY A;  2AK5 A;  3CCR A;  3M0R A;  2VYT A;  2XU8 A;  4HKE A;  2DK3 A;  4C0G A;  4XAX B;  2V26 A;  4AFU C;  2M1H A;  5LJ5 g;  2FZK B;  4M4Z A;  2ED0 A;  2K3B A;  5KE3 A;  2VB6 A;  1MV3 A;  1ZUY A;  4OMP A;  1R8O B;  2O9V A;  1H3H A;  6AT1 B;  4N4I A;  3QUI A;  2LCL A;  1KIK A;  3QWY A;  3VYG A;  1WGS A;  2L2P A;  5HK3 A;  2HQX A;  2F2V A;  2VV5 A;  1YIT T;  1Z9Q A;  2JOY A;  3EG3 A;  1YN8 A;  1N5Z A;  3VS7 A;  4C92 E;  1XJW B;  2V1Q A;  5KYU A;  4F04 B;  4C8Q E;  4JRK A;  2EAY A;  4WCI A;  2RJD A;  4X9D A;  2KE9 A;  2E3H A;  2E65 A;  1G3W A;  3GOX A;  4XTX A;  3JB9 D;  3OYF A;  5AT1 B;  2RB6 A;  2SRC A;  1XNI A;  1UB4 A;  4EDU A;  2CH4 W;  1ZA1 B;  1QVG S;  1N8R U;  1RAB B;  4N0A A;  2M0O A;  3P8H A;  4LUE A;  3JB9 G;  2YRD A;  2C06 A;  3T9N A;  4OML A;  2EKH A;  2X4J A;  3FJ5 A;  3JCM e;  5GAN 3;  1K73 C;  1VQ8 Q;  3RBB B;  3OBW A;  3TSW A;  1VQ7 A;  1VQ4 A;  2DZC A;  2RJC A;  3I5S A;  2E5K A;  1RAC B;  2NUP A;  2DBK A;  2RHZ A;  3DKM A;  3JCM Q;  3EH2 A;  4EMH A;  1N9R A;  4AFS C;  3CCS T;  3PIP A;  2FYK A;  4PLI A;  5CK9 A;  2QTX A;  1Y7X A;  4XU3 A;  2EYW A;  3M59 A;  2WAC A;  3ZL7 C;  4M7A E;  2LQ8 A;  3RKW A;  3LH5 A;  4Y92 A;  5HKC A;  2E4H A;  2DEQ A;  3VKI A;  4QVD A;  2HL5 C;  1K8A C;  3J7A F;  1NPR A;  4XU0 A;  4PJL A;  2RJE A;  1VQO Q;  4L59 A;  2VC8 A;  1K9M C;  4PJO C;  2B8A A;  4C8Q D;  4OP0 A;  2LTO A;  1WHM A;  2FRY A;  1M4Z A;  3RUX A;  5FU6 C;  2CDT A;  4JJN K;  4QQD A;  4A63 B;  3UT1 A;  4FYX B;  1TTH B;  1FMW A;  3V7C A;  4M78 E;  4XTU A;  5J26 A;  2XMF A;  4BDY A;  3L2W A;  1W2B S;  1WYX A;  1AWW A;  2C0T A;  4K11 A;  4XU2 A;  4LD9 K;  3MJX A;  4CC4 B;  3VRZ A;  1ZQ1 A;  5KYX A;  5DM7 R;  2MWO A;  2P4T A;  4C5E A;  4CC2 A;  2V8J A;  2KEA A;  1RAI B;  2KYB A;  2Y4Y A;  1AOJ A;  4AT1 B;  4DOW A;  2C0O A;  2LCC A;  2LC4 A;  1NZ9 A;  2OAU A;  2OX7 A;  5LJ5 h;  4R0K A;  2MIO A;  1GBQ A;  4KBM B;  2O4X A;  4PJO A;  3OYE A;  2LP5 A;  3PMT A;  3QZ5 B;  2CZ7 B;  1M8M A;  2HMA A;  2QQR A;  2CGH A;  3QXE B;  1N8R C;  4M7A D;  1YCY A;  3EG9 B;  2DJQ A;  4XTV A;  1SF9 A;  5GMK i;  4AFZ C;  2ABL A;  4KUL A;  4LD6 A;  2E6N A;  4M75 G;  2KI7 A;  3FJP A;  4ZN3 A;  1W2B A;  2QI2 A;  3N5B B;  3QII A;  2VKN A;  3PIO A;  2DBM A;  1ZSZ C;  4RCB A;  2YUQ A;  3ZEH A;  4HXJ A;  2QXF A;  5GAO q;  3GNF B;  5GAO m;  1M90 U;  1QWF A;  1TUG B;  2E3I A;  3M9Q A;  1K0X A;  1K9M R;  1TXQ A;  2RI3 A;  5KCH A;  1ARK A;  2OAW A;  4ZNX A;  3JV3 A;  1QLY A;  3CXC P;  1XTD A;  1MUZ A;  3QYG B;  3CC7 T;  2OTJ A;  2MMP A;  4KGZ B;  4DEX A;  1X01 A;  4F7U G;  4PJO F;  4NL2 A;  1EFN A;  2QDL A;  1VYU A;  5CIU A;  1VQ4 T;  3CCL Q;  3CC2 A;  1I81 A;  3X24 B;  3CME Q;  3E2U A;  8AT1 B;  2XG8 D;  3KFV A;  2XDD A;  3QJY A;  1YNZ A;  4D8D A;  3WVD B;  1HK9 A;  3EG9 A;  1JJ2 S;  2E6Z A;  3M0U A;  1BYM A;  2A7Y A;  3M54 A;  4UC4 A;  2BUD A;  5LJ5 j;  1Q7Y C;  2QG9 B;  3A8O B;  1PG5 B;  2CUD A;  4NL3 A;  3M58 A;  1Q86 U;  4C92 D;  2PUK B;  4BUG A;  1VQM A;  2DYI A;  4JS4 A;  3PFS A;  2DD5 A;  2JW4 A;  3REB B;  2IPO B;  4QVC A;  3L2Z A;  2LNH B;  4FYV B;  3H41 A;  1OPK A;  4J9G A;  4EPC A;  2HKQ B;  4QQ6 A;  3VS6 A;  4M77 C;  3GBQ A;  2QQB A;  3QWX X;  4LDW A;  2Z0W A;  5GAM d;  5FRO A;  5KYW B;  4L5G A;  3VV0 A;  3OA6 A;  3CQT A;  3E9G A;  3THK A;  3QBY A;  1YHQ A;  1KD1 C;  3CPW A;  4M7D D;  1OZ3 A;  1UFF A;  3MKD A;  3CCR T;  2LRQ A;  3VS0 A;  2R5M A;  3OYA A;  3PVL A;  2LT1 A;  3CCJ Q;  1MMN A;  4C5I A;  1Y07 A;  4GBQ A;  2EFI A;  5GAM f;  1ZSG A;  2NUP B;  4BE2 A;  1RI9 A;  2QQS A;  1NJI R;  2KRN A;  1Q81 R;  2NWM A;  3I5R A;  4KGV B;  1QCO A;  5GMK e;  3CCV T;  5IHI A;  2OTL Q;  5D6X A;  5M9O A;  1Q7Y U;  1VOM A;  2CKK A;  2VGM A;  1SPK A;  2ENM A;  2ROL A;  2OJ2 A;  5CKE A;  4M75 A;  1QVG A;  1AD5 A;  3QHS A;  1JJ2 P;  2QK0 A;  2EIF A;  3CCM A;  2P4R A;  2KBT A;  3CCE A;  2QTV A;  3E1S A;  1KG1 A;  3MP8 A;  3FDR A;  2HD0 A;  2YUO A;  3GF5 A;  3L2U A;  2L3P A;  3SHW A;  1QQJ A;  2RQR A;  4PJO G;  2CP3 A;  4J9C A;  3I35 A;  1D0Z A;  2ZPF B;  3OYH A;  1D3B A;  1Q82 C;  5KYY A;  4E7Z A;  3QG1 A;  1TS9 A;  1BCM A;  4ZTJ A;  1WXU A;  1M3A A;  1SRL A;  1E6H A;  4JJD A;  2FPE A;  3LWI A;  1LOJ A;  1WI7 A;  4F14 A;  4OMN A;  1XQH A;  1B34 B;  1TH7 A;  4TVR A;  3CCR Q;  2DKG A;  2K5F A;  3O5Z A;  4BY6 C;  3HHT B;  2J6F A;  3PGG A;  1EIF A;  4E7K A;  2P0K A;  3JSC A;  4FSX A;  4BI3 A;  1HD3 A;  3Q1J A;  2CZ1 B;  1WQW A;  1I0C A;  2XID A;  5GAM j;  3CCV Q;  4MZT A;  5I22 A;  5J39 A;  3G6E Q;  3BDU A;  4M78 F;  2DMO A;  2DD4 A;  2KT8 A;  4PFP A;  5GAO p;  2RQW A;  1X2K A;  3NGP A;  2AKK A;  2XI9 A;  7AT1 B;  2IG0 A;  1B7T A;  2B86 A;  2JM9 A;  4LNP A;  2JM8 A;  3OYI A;  2EBP A;  1VQ9 Q;  1VQN T;  1AEY A;  1V1C A;  4ZGD B;  3S3M A;  2AZS A;  2D0Q B;  2PNI A;  5LJ5 f;  1VIF A;  3JCM V;  3CMA Q;  2J6K A;  3VS5 A;  2HKN A;  2D9T A;  2DZ9 A;  2XK0 A;  1E6G A;  3X25 B;  4A53 A;  4QKU A;  5A0D A;  3CD6 A;  1VQM T;  1OYX A;  1HJD A;  2KY9 A;  4OGE A;  4RTU A;  1I5L A;  4IIO A;  1N8R R;  2DL5 A;  2AIR B;  3EFO B;  3SWN B;  3G1J A;  1WZO A;  3M0S A;  3MEW A;  1JXO A;  4FU6 A;  5GAN 6;  1WXT A;  4MML A;  1M3C A;  4EIK A;  2W10 A;  4D6W A;  5CVI A;  1ZBJ A;  3LH0 A;  5GJV B;  2K7A A;  4M77 B;  1GCQ C;  2K5L A;  2M16 A;  1T0J A;  1RI0 A;  2KGT A;  4LXC A;  3KUF A;  1SSH A;  4RCC A;  3QKJ A;  4C92 F;  3H0I A;  1VQL A;  3OW2 S;  2KAF A;  3HPW A;  3J81 E;  1OV3 A;  4M75 C;  3QYH B;  5EC7 A;  3G4S A;  5IH2 A;  1X27 A;  2RHU A;  2D8J A;  2HSE B;  2IIM A;  1QVF A;  1NM7 A;  4PNO A;  1G83 A;  1U1T A;  1WJR A;  4Z89 A;  1MHN A;  2P0Q A;  2LNV A;  2O4X B;  5IHK A;  3DB4 A;  3SEM A;  5L23 A;  2BKD N;  2L5Q A;  4J6W A;  2K5I A;  2JZ2 A;  2IVW A;  3OS1 A;  3CCJ A;  5LJ3 e;  2OTL T;  3SDZ A;  4V2S A;  4J6Y A;  1C1A A;  2EW3 A;  2LDM A;  3PVQ A;  2RMO A;  2ATC B;  2XIC A;  5IAY A;  4JPB W;  1M9S A;  1M1K U;  4II1 A;  1NJI U;  1BU1 A;  1QCN A;  2MAM A;  3CCS Q;  1UDL A;  2OTL A;  1Y0M A;  3SB2 A;  3M56 A;  2KRO A;  2FO0 A;  4JZ3 A;  4OB0 B;  1LNX A;  1N6A A;  4FT4 A;  3I9Q A;  4AFQ C;  1AHJ B;  2K4Y A;  4GLK A;  1FMV A;  1PC0 A;  2L3R A;  2M9U A;  2O9S A;  5CKB A;  1H64 1;  2LQN A;  4XTW A;  4Q5W A;  2YLB A;  3OS2 A;  3NHN A;  4C92 B;  5GAN 2;  5FWC A;  2V1R A;  3M55 A;  3FEO A;  1QVF P;  3H0F A;  1KQ2 A;  5HY6 A;  3V7S A;  3JCM P;  4C0Z A;  2W0Z A;  3BE3 A;  4VUB A;  3LGF A;  3GP8 A;  4E7J A;  2E5Q A;  1Y57 A;  1M1G A;  2EQU A;  1FWZ A;  2CYZ B;  5ECA A;  3DLM A;  4Y28 E;  2NLU A;  3SWN A;  2RJF A;  1WIE A;  3EG1 A;  3M4Y A;  1JRI A;  3J80 E;  4KH1 B;  5CKD A;  1RLP C;  1K76 A;  3TU4 K;  3M5A A;  5GAN e;  2DIQ A;  4N4G A;  4J5Y A;  5GAN 7;  3FRN A;  1ZX6 A;  4IUQ A;  2QAZ A;  2X4Y A;  2PQW A;  3MPU B;  2HL3 A;  3RMQ A;  5C6S A;  2E12 A;  1UGR B;  4JRI A;  1K9A A;  3QPH A;  2YDL A;  3L2R A;  2K2M A;  2EVR A;  1VQ8 T;  1UHF A;  3HRS A;  4CI0 C;  3G71 Q;  1UEB A;  1M3B A;  1VQK T;  2F1L A;  3OSV A;  2EQI A;  2MCN A;  1R0B G;  2GNC A;  2MOX A;  2BTT A;  2EQM A;  4QT7 A;  3HKS A;  4M7A B;  1U1S A;  1ZBX A;  2CT3 A;  2FL7 A;  2I0N A;  2OI3 A;  1KC8 U;  2J7I A;  3L1A A;  4PJN A;  1VUB A;  2O88 A;  1ZSZ A;  2PTK A;  2J06 A;  1NYF A;  2C0I A;  4FW2 A;  3GNG A;  3OQ5 A;  1VYV A;  1AZG B;  1PCX A;  5CKF A;  1HYO A;  4IUT A;  2RH2 A;  1G8X A;  2DVE A;  3CBM A;  4M7A C;  2HQH A;  2EQJ A;  4A4F A;  2HQE A;  1QP3 A;  3MO8 A;  1UGQ B;  4RKU E;  4HCB A;  2AHJ B;  1M8V A;  1SHF A;  1K1Z A;  2ZPE B;  5KCO A;  2FHD A;  8ATC B;  3ZFJ A;  4DBF A;  3MEV A;  1YWO A;  4PFZ A;  3H9N A;  1D1B A;  3MP1 A;  1BIB A;  2D8H A;  3CC4 Q;  2DRM A;  2FZG B;  1YJN T;  5KYX B;  2CP2 A;  1VQP A;  1PKS A;  3PMI A;  3RKY A;  5J3B A;  4P5N A;  3SFM A;  2E1H A;  2DO3 A;  3TVT A;  1NBE B;  5KE2 A;  1KSW A;  1YWP A;  2GTO A;  2ZZD A;  3M4G A;  3EGD A;  2LMJ A;  2X9H A;  2RHX A;  1YIJ T;  1WHH A;  3E19 A;  1KQ1 A;  3BDL A;  5LJ3 j;  3UPU A;  2BZ8 A;  1GRI A;  4GLM A;  4XQ3 A;  2QGF B;  5CQX A;  1WXB A;  1G2B A;  1SKU B;  4J9H A;  4F16 A;  4L6V 5;  4QW2 A;  1ZSZ B;  2XHC A;  2K79 A;  1D1C A;  1MV0 B;  2DPP B;  5CQY A;  2DL3 A;  3JCM X;  1X2Q A;  5GAM g;  1ABQ A;  1SSF A;  3CME A;  1OX9 A;  2KQW A;  3CD6 Q;  1YJ9 Q;  2QEX Q;  3CCJ T;  1BB9 A;  2E41 A;  3CXC S;  3UA7 A;  4J7F A;  1RAF B;  1VQ7 Q;  2LQW A;  1JBM A;  4D8K A;  2A28 A;  2DAQ A;  4R56 A;  1T0H A;  4KRT A;  1PM3 A;  4OMQ A;  1Q82 U;  4C92 G;  5DY9 A;  3OMG A;  4Z02 A;  2GBQ A;  4MZP A;  3FC3 A;  2DNU A;  2YSQ A;  1YI2 T;  4LDU A;  2ROT A;  2FRW A;  4M7D G;  2WSF E;  2XKO C;  2MK5 A;  1PSE A;  5D7U A;  3OS0 A;  2G3R A;  5HCK A;  3JCM c;  4RTT A;  1G3S A;  2K57 A;  4XU1 A;  2DXT A;  4C92 A;  2WSC E;  3INZ A;  3G4S T;  3JCM d;  1VQ5 A;  4JS5 A;  4FIB A;  2RK1 A;  3PTA A;  3CCQ A;  4A4E A;  3G6E A;  1OI1 A;  1CSK A;  1MMD A;  4QQG A;  5LL6 S;  1B3Q A;  2BZX A;  4M7D C;  1GCQ A;  4WTO B;  3CXC A;  1UJY A;  1KQS P;  2ED1 A;  2COY A;  4J9F A;  3TRE A;  3OYM A;  3OYD A;  2ZPH B;  5FU6 B;  2JJ9 A;  4BAC A;  4BI4 A;  1AWX A;  1J3T A;  3CC2 T;  4EMK A;  2ZGW A;  5KH6 A;  1VQK A;  4F17 A;  3CD6 T;  2CP7 A;  3CCS A;  2QEX T;  1ACM B;  1ZUK A;  3WVE B;  1I8F A;  1VQ7 T;  1VQ6 T;  5I2S A;  4HT8 A;  2YRV A;  3A8L B;  1PHT A;  3CCM Q;  4HVW A;  4PKC C;  1D0X A;  4J83 A;  2EGC A;  5HK0 A;  1M2O A;  4C0D B;  3G71 A;  3G7Z A;  4J8O A;  1I5O B;  5FW9 A;  2X4X A;  2COW A;  1QMC A;  3RES A;  2DTO A;  2KRM A;  5I2M A;  3LWH A;  3UWN A;  4ZGE B;  5A2Q E;  3ASK A;  1WJQ A;  2HSP A;  2RM4 A;  1LJO A;  3A8M B;  2VXE A;  2E10 A;  4E7S A;  3OB9 A;  1JXM A;  4E6R A;  3M0P A;  2KRS A;  2K6D A;  2DX1 A;  1BIA A;  1TUC A;  2EPD A;  1SRM A;  2DTH A;  3EFR A;  5FRN A;  1VQO T;  1VQ6 A;  4M78 B;  5KYU B;  2HDA A;  2FG0 A;  1IHW A;  2PVD B;  5LJ5 e;  2COZ A;  4M77 A;  2M02 A;  5GAN 8;  2DYB A;  2CZ0 B;  3RIR A;  4PJM A;  2HNI A;  4M75 F;  1QVG P;  2KXC A;  1P92 A;  3LX7 A;  3X26 B;  4AG2 C;  4RMO A;  1OEB A;  2A3L A;  2YT6 A;  4M7D A;  5KYN A;  1VQP Q;  2A0F B;  4N0A C;  1O9S A;  4M78 C;  1Q86 R;  4AMC A;  1QVF S;  4BDZ A;  3URG A;  4X9C A;  4M7A F;  1IZ6 A;  1SEM A;  3EGU A;  5DLO A;  4NS5 A;  1S72 A;  3CCM T;  2NUT B;  4MDX A;  2JN0 A;  4F7U F;  5FU7 B;  5GMK j;  1VQ9 A;  2QDY B;  1GBR A;  3G6E T;  4FM4 B;  1D1A A;  4R55 A;  1JU5 C;  4EMG A;  3C0C A;  1WNL A;  2JUF A;  2DER A;  3OSS C;  1AVZ C;  2ZCF B;  4CRI A;  3CCU Q;  1V76 A;  4LDY A;  3QDF A;  2Y4X A;  5I21 A;  1YP5 A;  2HAX A;  2DF6 A;  2DJZ A;  4PL6 A;  2A08 A;  4OVA A;  2V8I A;  1K9M U;  4RTV A;  4HT9 A;  4FT2 A;  3P8D A;  1M90 R;  1IXD A;  4C8Q A;  3X28 B;  3VRY A;  3HL8 A;  1HSQ A;  1PWT A;  3M0T A;  2D6F A;  2DVJ A;  3E9F A;  2KYM A;  4BB7 A;  3I55 T;  5CR2 A;  3NTK A;  2M51 A;  1K0S A;  2VVK A;  4RG8 A;  3EG2 A;  1GFC A;  3I55 A;  3JB9 H;  2R57 A;  3L2Q A;  2HZY A;  4MMK A;  1K8A U;  1DJ7 B;  4PJO E;  1EZZ B;  1YJW Q;  2F5K A;  5FRM A;  4JJC A;  3CCQ T;  4PK4 A;  1IHV A;  1YFN A;  3LGL A;  1K73 U;  2DXB A;  1UGP B;  2PVG B;  5IXB A;  3CEY A;  5EG2 A;  4JLG A;  2FPD A;  5CAI A;  2MPX C;  2JTE A;  1MND A;  1QKX A;  1YHQ T;  1R77 A;  4C8Q F;  1N27 A;  1SG5 A;  2CSQ A;  3GPL A;  2GTJ A;  5I11 A;  1U8R A;  2VXF A;  2LQK A;  1AWJ A;  4M7D B;  1PNJ A;  3HRT A;  1C6V X;  1LPL A;  3UA6 A;  2PVO B;  3QO3 A;  4C5H A;  1PD1 A;  2RK2 A;  1JO8 A;  2YUN A;  3FIF A;  2GGR A;  2DFU A;  2LJ3 A;  4ANJ A;  3H6Z A;  1JJ2 A;  2DTI A;  3UDC A;  2ZPB B;  4E7I A;  2AT1 B;  4OB1 B; 
#chains in the Genus database with same CATH homology
 1KJW A;  1H92 A;  1M3B A;  3H0H A;  1ABO A;  2LJ0 A;  2VKN A;  2DBM A;  1VYT A;  2EQI A;  1Z9Z A;  2YUQ A;  2MCN A;  4HXJ A;  2GNC A;  2MOX A;  2BTT A;  4QT7 A;  1QWF A;  2DRK A;  4FSS A;  1JQQ A;  1K0X A;  2D0N A;  1ARK A;  5GJW B;  3REA B;  2CT3 A;  2OAW A;  2I0N A;  2OI3 A;  1M30 A;  1T3S A;  2CSI A;  4ZNX A;  3JV3 A;  1QLY A;  2DE0 X;  4JJB A;  1MUZ A;  2J7I A;  1GFD A;  4RTZ A;  2O88 A;  2PTK A;  1TUD A;  1UG1 A;  2AKL A;  2K9G A;  4RTY A;  3ULR B;  4DEX A;  2J06 A;  1NYF A;  1EFN A;  1UEC A;  2GQI A;  2QDL A;  1VYU A;  2C0I A;  2DLP A;  2KNB B;  1ZLM A;  1VYV A;  1AZG B;  2RQT A;  1M27 C;  4CC7 A;  2RQU A;  3TSZ A;  1WA7 A;  3KFV A;  1NLP C;  1SHF A;  2J6O A;  1YNZ A;  1K1Z A;  4D8D A;  1NYG A;  3RNJ A;  2DA9 A;  1YWO A;  2H8H A;  1S1N A;  3M0U A;  2D8H A;  2DRM A;  2L3Q A;  2KXD A;  2CUD A;  2O2O A;  1E7O A;  1PKS A;  1QWE A;  1PRL C;  3TVT A;  1KSW A;  1YWP A;  2GTO A;  3EHR A;  2EGA A;  1H8K A;  2JW4 A;  3REB B;  2LMJ A;  3EG0 A;  1SHG A;  2RPN A;  1UHC A;  2LNH B;  4ORZ A;  2RNA A;  3H41 A;  1OPK A;  1I07 A;  4J9G A;  2BZ8 A;  1GRI A;  4GLM A;  1JEG A;  3VS6 A;  2BZY A;  3GBQ A;  1GL5 A;  1WXB A;  1G2B A;  4J9H A;  4F16 A;  4J9E A;  3QWX X;  1A0N B;  2K79 A;  1MV0 B;  2DL3 A;  4LUD A;  3CQT A;  2PZ1 A;  3THK A;  1X2Q A;  1PKT A;  1ABQ A;  2KR3 A;  2ECZ A;  1UFF A;  2JT4 A;  2LX7 A;  1BB9 A;  3VS0 A;  1W70 A;  3PVL A;  4RUG A;  1OPL A;  2JS0 A;  3UA7 A;  2L3S A;  4GBQ A;  2LQW A;  2NUZ A;  1ZSG A;  4D8K A;  1RI9 A;  2A28 A;  2A37 A;  1T0H A;  4KRT A;  4OMQ A;  2KRN A;  2NWM A;  2GBQ A;  3I5R A;  2DNU A;  2YSQ A;  1WLP B;  2ROT A;  5IHI A;  2FRW A;  1U06 A;  4Z88 A;  2O31 A;  1SPK A;  5HCK A;  2ENM A;  1UJ0 A;  2JMA A;  4RTT A;  2ROL A;  2OJ2 A;  1AD5 A;  2DL4 A;  2JMC A;  5FWB A;  2P4R A;  2RF0 A;  2KBT A;  1BK2 A;  2J05 A;  2YUO A;  2KT1 A;  1CSK A;  4HVU A;  2F2X A;  1B3Q A;  2L3P A;  2BZX A;  1GCQ A;  1ZUU A;  3SHW A;  2RQR A;  4LE9 A;  1UJY A;  4J9C A;  3I35 A;  3U23 A;  4ESR A;  2ED1 A;  2CUB A;  4J9F A;  4X1V A;  1WXU A;  1M3A A;  1SRL A;  1E6H A;  1UGV A;  2EGE A;  2FPE A;  4JJD A;  1AWX A;  1J3T A;  1WI7 A;  2G6F X;  2FPF A;  1YCS B;  3VS4 A;  4F14 A;  4OMN A;  4F17 A;  2AZV A;  4HVV A;  1WDX A;  1ZUK A;  3O5Z A;  1QKW A;  2J6F A;  1NG2 A;  5IHN A;  2LJ1 A;  3NPF A;  2FEI A;  1PHT A;  2DL8 A;  1HD3 A;  4HVW A;  1GCP A;  1CKB A;  4IIM A;  1I0C A;  2EGC A;  2HBW A;  2CRE A;  2CH4 A;  2EYY A;  2YUP A;  5I22 A;  5FW9 A;  2DMO A;  4LN2 A;  2KT8 A;  2KRM A;  2RQW A;  1X2K A;  3NGP A;  1RLQ C;  2HEQ A;  2AKK A;  3R6N A;  1I1J A;  4J9D A;  1WX6 A;  2HSP A;  1NEB A;  2B86 A;  1VA7 A;  2JM9 A;  4LNP A;  2DIL A;  2JM8 A;  1JXM A;  4E6R A;  2EBP A;  3M0P A;  1NEG A;  1AEY A;  1V1C A;  5IXF A;  3M0Q A;  2KRS A;  1QCF A;  1B07 A;  2AZS A;  2K6D A;  2PNI A;  2RQV A;  4HCK A;  4Z8A A;  2DX1 A;  2X3X D;  1X6B A;  1XOV A;  1TUC A;  2EPD A;  2J6K A;  3VS5 A;  2D1X A;  4RTW A;  1E6G A;  1SRM A;  4DEY A;  1RUW A;  2JXB A;  3VS1 A;  1AWO A;  2AK5 A;  2VWF A;  1HJD A;  3M0R A;  1X43 A;  2HDA A;  2FG0 A;  4RTU A;  4AFU C;  4JZ4 A;  2DYB A;  2JS2 A;  4OMM A;  4M4Z A;  4IIO A;  2ED0 A;  2DL5 A;  2K3B A;  1MV3 A;  1ZUY A;  2KXC A;  3M0S A;  4OMP A;  1JXO A;  1UUE A;  1WXT A;  4AG2 C;  2O9V A;  1FYN A;  2M0Y A;  1M3C A;  1OEB A;  1H3H A;  3UAT A;  2W10 A;  2YT6 A;  4EIK A;  1ZBJ A;  5GJV B;  2K7A A;  1KIK A;  1GCQ C;  3QWY A;  1WFW A;  2L2P A;  1T0J A;  4CC3 A;  2KGT A;  2F2V A;  3A98 A;  1Z9Q A;  3EG3 A;  1YN8 A;  1SSH A;  1SEM A;  2HCK A;  3EGU A;  1N5Z A;  2A36 A;  3H0I A;  3VS7 A;  1CKA A;  2V1Q A;  1K4U S;  1KFZ A;  2EYX A;  1OV3 A;  1W1F A;  5EC7 A;  4WCI A;  3VS2 A;  5IH2 A;  1X27 A;  2D8J A;  2IIM A;  2KE9 A;  1NM7 A;  1GBR A;  1G83 A;  1TG0 A;  3UF4 A;  2SRC A;  3EHQ A;  4Z89 A;  2LCS A;  2LZ6 B;  2CH4 W;  1JU5 C;  4J9I A;  3C0C A;  5IHK A;  2SEM A;  3SEM A;  5L23 A;  4LUE A;  1AVZ C;  4OML A;  2EKH A;  3FJ5 A;  1YP5 A;  3RBB B;  2DF6 A;  1U5S A;  3TSW A;  3I5S A;  2EW3 A;  3VS3 A;  2E5K A;  3PVQ A;  2RMO A;  2A08 A;  2DBK A;  4JPB W;  4RTV A;  1UTI A;  1BU1 A;  3VRY A;  1HSQ A;  1PWT A;  1UDL A;  4AFS C;  3M0T A;  2DL7 A;  1Y0M A;  2DVJ A;  2KRO A;  2FO0 A;  1LCK A;  4JZ3 A;  2KYM A;  3I9Q A;  2EYW A;  4AFQ C;  3ZL7 C;  2DM1 A;  2M51 A;  1K0S A;  2VVK A;  3LH5 A;  4Y92 A;  2RN8 A;  2F2W A;  2ESW A;  3EG2 A;  1GFC A;  2O9S A;  1X6G A;  2LQN A;  2CT4 A;  3NHN A;  3NMZ C;  1W6X A;  2X3W D;  2FRY A;  1OOT A;  5FWC A;  2CDT A;  2V1R A;  4OMO A;  2EYZ A;  1UE9 A;  4A63 B;  3H0F A;  4JJC A;  5IXB A;  3IQL A;  2W0Z A;  1IO6 A;  2XMF A;  1Y57 A;  4J9B A;  1WYX A;  1AWW A;  2C0T A;  2FPD A;  4K11 A;  2JTE A;  1QKX A;  5ECA A;  1FMK A;  4CC4 B;  3VRZ A;  4RTX A;  2CSQ A;  2GTJ A;  1WIE A;  3EG1 A;  4CC2 A;  5I11 A;  2KEA A;  1BBZ A;  2KYB A;  1AWJ A;  1AOJ A;  1AZE A;  1RLP C;  1PNJ A;  1K76 A;  1NLO C;  2C0O A;  3UA6 A;  1X69 A;  1U3O A;  1GBQ A;  2MIO A;  4R0K A;  1ZX6 A;  1JO8 A;  2LP5 A;  2YUN A;  2GGR A;  1M8M A;  2L0A A;  2LJ3 A;  1PRM C;  2DJQ A;  1K9A A;  2YDL A;  1T3L A;  2K2M A;  2EVR A;  3PE0 A;  4AFZ C;  2ABL A;  4AG1 C;  1UHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...