1H8KA

A-spectrin sh3 domain a11v, v23l, m25v, v53i, v58l mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
KELVLVLYDYQEKSPREVTVKKGDILTLLNSTNKDWWKVEVDDRQGFIPAAYLKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN
publication title Conformational Strain in the Hydrophobic Core and its Implications for Protein Folding and Design
pubmed doi rcsb
source organism Gallus gallus
molecule tags Sh3-domain
total genus 6
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1h8kA00
1PRLC 2DL8A 4M4ZA 3VRYA 3NHNA 1Z9ZA 2KRNA 2K7AA 3GBQA 5FW9A 3FJ5A 1ZLMA 1HJDA 4GLMA 1JXOA 1NYGA 1PWTA 2X3XD 1JXMA 1JQQA 3I35A 2DVJA 4JJCA 2RQTA 1H8KA 2L3QA 3EG2A 1W6XA 2A08A 1NLOC 2K3BA 1ABOA 2GTOA 4OMMA 3VS0A 2HDAA 4Z89A 3NPFA 4RUGA 1GL5A 3EGUA 2A37A 2BZXA 2K6DA 1Y57A 2LJ0A 2LZ6B 3VS1A 4OMQA 1OV3A 1SSHA 1M3CA 2KXDA 5I11A 1RLPC 1NEBA 2MOXA 1WFWA 2JM9A 2KRSA 2V1QA 2J6KA 1G2BA 1T3LA 2ED0A 1M3BA 2P4RA 3TSZA 2K9GA 2KT1A 2DE0X 4J9HA 3VS4A 3M0PA 1QKXA 3VS3A 2L0AA 2JTEA 2HEQA 1BBZA 3M0RA 1CKAA 2AZVA 3I5RA 4KRTA 2GQIA 4HCKA 1K1ZA 2HSPA 1WXTA 2NWMA 2JT4A 1UG1A 4RTTA 1PHTA 4GBQA 1UHCA 2ESWA 1M8MA 1U06A 1GBQA 2JM8A 2EPDA 4J9EA 1ZSGA 1E6HA 1W70A 3UF4A 2D1XA 1JO8A 4Z8AA 2AZSA 2SEMA 2W10A 3VS7A 1GBRA 1RUWA 3EG0A 1X43A 2GGRA 2EVRA 1UE9A 2KE9A 3VS5A 2CSIA 4J9FA 2J05A 1Z9QA 4DEXA 1UUEA 2ABLA 4OMNA 2CT3A 3I9QA 2MCNA 2RN8A 1X27A 3CQTA 1RI9A 5IXFA 1WDXA 3O5ZA 2JS0A 2FO0A 1LCKA 2EYZA 2FRYA 1Y0MA 3QWYA 1T3SA 4FSSA 4LNPA 2C0TA 1M3AA 2KRMA 1ZUYA 1M27C 2L3SA 1WX6A 4JJBA 1QKWA 2LQWA 1AZEA 5IXBA 2O9VA 2K79A 1JU5C 2ROLA 3M0SA 2DMOA 2E5KA 2FRWA 2KR3A 2LMJA 1QWEA 2X3WD 1ARKA 4CC4B 1NG2A 2RF0A 2DL3A 3C0CA 2YUPA 2CH4A 4LUEA 2DL5A 1YN8A 1OEBA 1NM7A 2J6OA 2DX1A 4WCIA 2EGEA 2KT8A 3PE0A 4JZ4A 3R6NA 3TSWA 4AFZC 1MV3A 2G6FX 3NGPA 3LH5A 2KYMA 4OMOA 3UATA 3H41A 2VKNA 1YNZA 2KBTA 2QDLA 1I0CA 1UJ0A 4D8DA 1N5ZA 2CSQA 1ZUUA 2L3PA 1T0HA 2RQVA 1IO6A 1FYNA 2EW3A 2F2VA 3A98A 2LP5A 2CREA 4CC2A 1BK2A 4J9CA 5IH2A 2W0ZA 1H92A 2D8JA 2GTJA 3NMZC 2FPEA 2D8HA 1UJYA 4CC7A 4F17A 1GFCA 1OPLA 3EHRA 2EBPA 2DA9A 2KROA 3KFVA 2KEAA 3UA6A 2DBMA 2M0YA 4LUDA 4RTYA 3REAB 2PTKA 4J9BA 2OJ2A 1CKBA 2YT6A 1VYUA 3THKA 2KNBB 2ENMA 1BB9A 1AWXA 2DLPA 4AFSC 4F16A 2VVKA 4RTVA 1X6BA 1K4US 1TUCA 1B3QA 2KGTA 1K76A 2DRMA 4ZNXA 1UFFA 1EFNA 2LQNA 2DM1A 5L23A 2VWFA 5IHIA 1UHFA 1GRIA 3REBB 2JXBA 1PNJA 1E7OA 1WA7A 1VYTA 2GNCA 1ZX6A 5GJWB 3RBBB 3ULRB 1WXBA 4OMPA 2EYWA 2A28A 3M0TA 1WYXA 1A0NB 2SRCA 1PKTA 1UECA 1UTIA 2HBWA 5IHKA 1HD3A 1TG0A 2FPDA 5EC7A 4IIOA 2KYBA 1W1FA 2JW4A 1YWPA 1SRMA 4AFUC 2C0IA 2YUNA 1AWJA 2H8HA 4JZ3A 1K0SA 4OMLA 2MIOA 1GCPA 2J06A 1J3TA 1AOJA 2ECZA 2DF6A 1SPKA 3SEMA 1JEGA 1K9AA 1M30A 2O31A 1X69A 3IQLA 1I07A 5GJVB 1PRMC 2RQUA 1WXUA 1NLPC 2RQWA 1U5SA 2M51A 1E6GA 1BU1A 2YUQA 4AG1C 2J7IA 2DYBA 3VS2A 4K11A 3ZL7C 2O88A 2CUBA 5ECAA 2K2MA 4RTWA 3H0FA 1ABQA 2XMFA 2BZ8A 4DEYA 1TUDA 1KIKA 3EG3A 1K0XA 2LJ1A 5HCKA 2DL4A 4F14A 1YCSB 2V1RA 1VYVA 1ZBJA 3SHWA 2ROTA 3U23A 4QT7A 1RLQC 2L2PA 4J9GA 2A36A 3VRZA 2JS2A 2J6FA 1GFDA 4LE9A 3QWXX 2PZ1A 2ED1A 3H0IA 1OPKA 2BTTA 4LN2A 2OAWA 2EYYA 1UGVA 1S1NA 4ESRA 2EGAA 4X1VA 1AZGB 2RMOA 1SRLA 1CSKA 1SEMA 1AD5A 2DRKA 4RTZA 4EIKA 3JV3A 2C0OA 2EYXA 2CT4A 1X2KA 4Z88A 2LJ3A 5FWBA 3VS6A 4D8KA 1VA7A 1NEGA 5FWCA 5I22A 2IIMA 2NUZA 4CC3A 2KXCA 2BZYA 2LCSA 3M0UA 1B07A 2LX7A 4HXJA 2HCKA 4J9IA 2FPFA 2FG0A 2I0NA 1QLYA 1AVZC 2DBKA 4ORZA 4JPBW 2CUDA 1PKSA 1X2QA 2O2OA 1I1JA 1NYFA 2AKKA 4HVVA 1UDLA 2CH4W 3EG1A 2DILA 4RTXA 1AEYA 4JJDA 2RPNA 2F2XA 2YDLA 3UA7A 4E6RA 1AWOA 1T0JA 1ZUKA 2F2WA 2YSQA 1YWOA 1KJWA 2O9SA 1HSQA 4AG2C 1MUZA 1X6GA 1XOVA 1QCFA 4Y92A 1WIEA 2RNAA 4AFQC 4RTUA 1OOTA 1H3HA 1WLPB 2B86A 2CDTA 3PVQA 1FMKA 3H0HA 3TVTA 4IIMA 4R0KA 1G83A 2EKHA 4J9DA 2FEIA 1GCQC 3I5SA 2AKLA 2GBQA 2DJQA 1MV0B 3RNJA 2EQIA 2LNHB 2DNUA 1WI7A 2JMCA 1KFZA 1QWFA 1SHGA 4A63B 2OI3A 3EHQA 4HVWA 3M0QA 2PNIA 2RQRA 1U3OA 3PVLA 1SHFA 1GCQA 2D0NA 2DL7A 2YUOA 1AWWA 1KSWA 1YP5A 2AK5A 4HVUA 5IHNA 2JMAA 1V1CA 2EGCA
chains in the Genus database with same CATH superfamily
1PRLC 2QEXQ 3GNFB 4DBRA 1Z9ZA 2KRNA 2HAXA 2K7AA 2IG0A 3GBQA 4M77D 3FJ5A 1ZLMA 4C5HA 4M7AF 1HJDA 3QYGB 2X4YA 3I55Q 1JXOA 2X3XD 4PLIA 3TCJA 2G3RA 1VQ4T 3EG2A 2CZ0B 1W6XA 5KYUA 5GAN2 4OMMA 2MK5A 1GXIE 4Z89A 2OTLQ 1R77A 3EGUA 2BZXA 3JCMh 4FU6A 3HTRA 1R0CB 2VV5A 3L2QA 1SSHA 3PIOA 1RAIB 1NEBA 4IURA 2HL5C 4O5VA 1KG1A 2MOXA 2JM9A 2V1QA 2J6KA 4PK4A 1T3LA 2DJZA 2P4RA 4J9HA 2X35A 3M0PA 3VS3A 3FLGA 2HEQA 2YLBA 5GAMg 3I5RA 4KRTA 2DO3A 4BDYA 5GMKh 1KD1U 3X25B 1K1ZA 1M90U 4R55A 3P8HA 1Q7YC 2X4XA 1PHTA 4QQGA 3MEAA 1UHCA 2CS7A 2JM8A 4RG8A 4E7IA 1WHGA 2D1XA 4Z8AA 1IGQA 2AZSA 4KUIA 4C8QF 1D1AA 4PJOF 3VYGA 3CC4Q 1VQKT 5FU6C 2SEMA 2JTMA 5FRMA 5KH6A 1RUWA 3EG0A 3JB9F 1YJ9Q 2EVRA 4B6MA 2CSIA 1UEBA 3SWNB 4J9FA 4F7UB 1YHQA 2E1HA 2GCXA 4PJOA 1RI9A 1WDXA 3O5ZA 4BY6B 3L42A 2EJFA 4E47A 4ELYC 2O01E 5HK0A 1YJNQ 1RAGB 1Q81U 1VQ7A 1XQHA 2PU9B 2DETA 2KRMA 5GAN6 1ZUYA 5CK9A 3QYHB 1M27C 2L3SA 1RAAB 1WX6A 4JJBA 3CXCP 1AZEA 4FT4A 1QVFA 2K79A 4EPCA 5HY6A 5LJ5g 3CCRT 1LOJA 2ROLA 2V8JA 4M7DC 3EG9B 1BI2A 2DMOA 3M0SA 3OW2P 3CC7A 2EAYA 3V7CA 1M1KC 2KVQG 3V8LA 3C0CA 3EAEA 1OX9A 4LUEA 3CC2A 3CMAT 3CCUQ 2XU8A 2P84A 3RKYA 5KYYB 2KT8A 3PE0A 1TOVA 4FM4B 3CCMQ 4AFZC 4FW1A 4BE0A 3JCMW 3UATA 2E65A 3PMTA 3H41A 3E2UA 1YNZA 3OMCA 5D6WA 3EFRA 2KBTA 4C5EA 1I0CA 2RHZA 4C5IA 3QHSA 1N5ZA 3CD6T 1NBEB 4PJMA 4JS5A 5CKBA 5C6SA 2F2VA 3A98A 4CC2A 2CZ1B 3HKSA 4J8OA 1H92A 2D8JA 2K5FA 2YRCA 3V8KA 1BI3A 1JBMA 3KXTA 3PIPA 2FPEA 3MP8A 4IUTA 2QXFA 2VUBA 1R8OB 4KULA 4AMCA 1Y96A 1OPLA 3BDUA 3EHRA 2DBMA 3QZ9B 5LJ3d 4N4IA 3REAB 3QUIA 1ZHIA 4C92B 7AT1B 3JCMV 4QKUA 2ENMA 5KYWA 3OYIA 2BKDN 2GFUA 2E5QA 3D7SB 1YJWQ 4AFSC 1VQ5A 1NJIU 1TUCA 2KGTA 2DEUA 4KUDK 4M7DD 5FU7B 2DM1A 1TS9A 4DOWA 4M75B 1YIJT 2JXBA 1E7OA 4M7DG 1VYTA 4M77A 2MYSA 4XTYA 4MDXA 1W2BA 3JCMP 3CCVT 5J39A 4D6WA 1C1AA 3G71Q 1KD1C 3ULRB 1WXBA 5LJ3j 1M90C 2A28A 1IREB 5KCHA 1RAEB 3CCLA 1OI1A 1M5Q1 3CCEQ 2IVWA 3CPWA 4HKEA 1UECA 1UTIA 2HBWA 2QYZA 3CMET 2NUPA 1TG0A 2FPDA 3LW5E 5KYUB 4MDWA 5GMKl 2DVEA 2JW4A 4OB0B 1YWPA 2DZ9A 3G6EA 4E2FB 1IXDA 2ZPBB 2C0IA 9ATCB 1VQ9T 2DPPB 4FIBA 4OMLA 2ECZA 4PNOA 4OB3B 1WHLA 4BI8B 1D0YA 2M1HA 2LTOA 1JJ2A 2ZGWA 4L59A 2RHUA 5GJVB 1PRMC 1Q86R 2RQUA 2JNGA 1Q81C 4EMKC 4Z02A 4JRQA 3EH2A 1PCXA 4AG1C 2DYBA 4C0DB 4K11A 3ZL7C 2O88A 5ECAA 2K2MA 4RTWA 3H0FA 4LDWA 2XMFA 5GAN8 2YXYA 5GANd 4M7AC 2DL4A 1QMCA 4JUVA 2DTIA 1KC8R 3JSCA 4PFPA 1ZBJA 3SHWA 1K8AU 4QT7A 4PFZA 4OB1B 2JUFA 3QPHA 2M9UA 1GFDA 4LE9A 2PZ1A 2ED1A 2NUTA 4XU1A 3OYBA 2OAWA 4BE1A 1YI2T 2PQWA 2DIQA 2FZCB 3CCLQ 5LJ3e 2RMOA 1S72Q 3F70A 2AT1B 2CT4A 1X2KA 3JCMd 2LJ3A 1NEGA 2QQ9A 2MPXC 2IIMA 2NUZA 2DYIA 3OQ5A 2KXCA 2LCSA 3M0UA 1QP2A 2PUOB 4HXJA 1O9SA 1VQKA 3TREA 1OQKA 3O8VA 1FX7A 2I0NA 2JOYA 1UB4A 1QLYA 4M78B 1Y71A 4KGVB 2QQBA 1N9SA 2VASA 1ZBXA 3X20B 2H3JA 2DILA 2Y4YA 3ASKA 1VQMA 4C8QC 1VQ4Q 2RJEA 4PJOC 3OB9A 2QGGA 2WSCE 5CIUA 3WXMB 1NJIC 1QP3A 4X9CA 1T0JA 3OYGA 3M4YA 1OX8A 1QVGS 1XOVA 4Y92A 3RMQA 4M7AD 2RH2A 1PSFA 2B86A 2CDTA 1FMKA 3H0HA 3L2WA 4IIMA 4R0KA 5GAMh 4JDSA 2C06A 1G83A 2QK0A 2E3HA 2FEIA 3JCMX 1GCQC 5GAOn 3CCJQ 2VC8A 1VQ7T 4M7AG 1VQPT 2DJQA 2PVGB 2LNHB 3MEWA 2DNUA 4A63B 1VIFA 4HVWA 2RQRA 4F7UF 1U3OA 3GF5A 3H8ZA 4OGEA 2R58A 4J6XA 1Y96B 3RMSA 2FB7A 3CC7T 3OMGA 3CXCS 3SWNA 4F7UA 2RJFA 4DBHA 3OS0A 4HVUA 2JMAA 2DTHA 1QVFP 2EGCA 1MMNA 5J26A 3OW2S 3NHNA 2ZPGB 1N6AA 1TXQA 1V76A 2R5MA 3X24B 5KYNA 3ZBDA 2F1LA 1OZ3A 2DVJA 2BIVA 4JJCA 2RQTA 2ZPEB 2K3BA 3G7ZA 3VS0A 5A0LA 2DZCA 1BCOA 1LNXA 1Q7YU 2A37A 4M77B 1Y57A 2LJ0A 1C6VX 2K5IA 2COWA 3RKXA 5LJ5h 5GAOq 2KXDA 3TU4K 5LJ3f 1RABB 2MMPA 2OAUA 3JB9I 1Q7YR 3S3NA 4FYYB 1WFWA 4C8QG 2KT1A 4PJOG 3CCRQ 1QKXA 2CYZB 3JB9G 2WACA 2DAQA 3M0RA 3CCQQ 2ZPFB 4N4HA 3AHUA 5GAOr 1K8AC 3FRNA 4HCKA 1YIJA 3M55A 4J83A 3CMAQ 2JT4A 1UG1A 1MMDA 3N5BB 2ESWA 1VQ5T 1U06A 3CCVA 4J9EA 3V8JA 2EJGA 1SF9A 1E6HA 1IHWA 5I2SA 2HBPA 5IT9E 6AT1B 2ATCB 1K9MU 1I4K1 5GMKe 3C95A 1WJQA 1PM3A 2LQ8A 1QW1A 5FLXE 1M1KU 3CD6Q 3CMEA 3VS5A 2I2LA 4C8QE 4OGCA 4PJOE 1Z9QA 1IZ6A 2QDYB 4C92A 1LCKA 1M1KR 1IRXA 4XTXA 5A0DA 3OYEA 4LNPA 4J6WA 4JS4A 1W2BP 4ZN3A 3KBGA 2LDMA 3A8MB 4Q5WA 4JJNK 2E5KA 4M75A 2KR3A 1QWEA 1MNEA 2X3WD 4KT0E 2RF0A 2LT1A 2YWWA 3CPWP 2K4YA 2PVDB 4MMKA 1NM7A 3QKJA 2DX1A 4WCIA 2EGEA 3JCMQ 3FDRA 4JZ4A 3R6NA 1FWZA 1ZSZA 3TSWA 1VQ6A 2G6FX 3NGPA 4JRIA 1WQWA 5GANf 1VQNA 2RB6A 2VKNA 2M0OA 1I5LA 3L2RA 3I56T 1EZZB 2CSQA 1ZUUA 1JJ2P 1IO6A 4PJLA 3DLMA 2LP5A 3L2ZA 1YI2A 1DJ7B 3KUFA 3LLRA 5IAYA 4PFOA 3L1AA 3LX7A 3M9QA 4QQDA 2DXCA 5CKDA 2D8HA 3VU3C 1UJYA 3M54A 4KH0B 3KFVA 1BYMA 4BI4A 2NLUA 1YITT 3P8DA 4J9BA 4EMHA 1ZA1B 1VQ9Q 1VYUA 1OZ2A 4YTLA 1F1BB 4RTVA 1K4US 1B7TA 3BW1A 2EQUA 3TEEA 1KD1R 4ZGJB 1B3QA 1QCNA 1K76A 1M90R 1QVGP 2DRMA 5J3BA 2LQNA 1X75C 4GLKA 1GRIA 3REBB 1BI1A 4M77E 4XTWA 2E41A 2GNCA 1ZX6A 5GJWB 4B9XA 3BFMA 1UGRB 2XK0A 3HPWA 4M7DB 2EYWA 4RG2A 1VQMT 3M0TA 2HQHA 4ZGDB 2SRCA 2HKNA 1VQPA 1PKTA 2XDDA 1D0XA 3OYYA 5D6XA 1HD3A 3GP8A 2CP2A 1K9MC 4IIOA 1Q81R 5LJ3g 1W1FA 1YBYA 1M1GA 4M78A 2YUNA 1WJSA 1BIBA 2H8HA 4CRIA 2E4HA 4N0AA 1BCMA 4OB2B 3OBWA 1JEGA 1K9AA 3SWNC 1SSFA 2VGNA 1PSEA 1HYOA 1I07A 3JB9H 2LQKA 4HCZA 4JRKA 3JCMJ 1BIAA 1V29B 1QVPA 1VQ8A 5CCAA 1E6GA 3R6OA 3A8GB 4QVCA 1OYXA 3OYKA 1VQLA 2HNIA 1G3YA 1ABQA 2CGHA 1TUDA 3OS2A 1K0XA 3FEOA 4A4EA 4XU0A 1KK7A 4FSXA 2V1RA 1QVFS 4JLIA 1VQOA 2A36A 2JZ2A 2JS2A 5A2QE 1YHQQ 1OPKA 4LN2A 1WHHA 3C12A 2EYYA 1UGVA 1S1NA 3VUZA 2OTJA 1VQ7Q 2OX7A 1AHJB 2DRKA 4LD9K 5EG2A 2CP3A 2C0OA 2EKOA 3ER0A 3VS6A 1D09B 1WHJA 3MHXA 4M77F 5LJ5d 2QAZA 1SKUB 3CC7Q 2RD1A 3CCSA 4J9IA 5AYFA 1NJIR 3E19A 1UGSB 3CC2Q 1QQJA 3OYDA 1AVZC 2QA4A 2JTFA 2CUDA 1X2QA 2O2OA 3OBYA 1G3WA 2AKKA 4HVVA 3LWIA 2QEXT 5GANg 2FZKB 3EG1A 2KDSA 2JVVA 4WF2A 1XJWB 4FYVB 4EMGA 2KQWA 3J80E 1ZSZB 3I55T 4F7UG 1C0MA 3OY9A 2COZA 1QCFA 2OTLT 1LPLA 3M53A 4OMFB 5CKHA 4WTOB 2RK2A 3QBYA 2XDBA 3TVTA 2COYA 1U8RA 5M9OA 5FU7C 1WHKA 3E1SA 4J9DA 2GBQA 4NL3A 2HL3A 1MV0B 5DY9A 2EQIA 2XHCA 3QG1A 2DFUA 2JMCA 2OI3A 3EHQA 3EFSA 2PNIA 4NL2A 5KYXA 3Q1JA 4M7AB 2A3LA 2P0KA 1WGSA 2DL7A 2RHXA 1W2BS 2YUOA 4F7UE 5A0GA 1YP5A 2H3EB 2K5LA 2KI7A 2ZCFB 1VQ5Q 3I56A 5KE3A 2DXTA 5FW9A 1VQ6T 3CPWS 2QQSA 4GLMA 5CQXA 2X4WA 4RCCA 1PWTA 4LDUA 4J5YA 1JQQA 2FYKA 4ATOA 4XU2A 1VQNT 2MI6A 2EWNA 2L3QA 4KGXB 2A08A 1ABOA 1YJ9T 5GAN5 2HDAA 3NPFA 1GL5A 2DD4A 4BE2A 3MP6A 3HRSA 1YITA 4QVZA 1PC0A 1K8AR 1Y07A 2Z0WA 1ZA2B 1M3CA 2R5AA 5I11A 1RLPC 4XU3A 3JB9J 1JJ2S 1X6OA 4MMLA 1YCYA 4C0DC 1NZ9A 1KQ1A 2RA2A 3QO3A 2ED0A 1M3BA 3NTKA 2K9GA 3VS4A 5CR2A 4DBQA 1MHNA 5GANj 2XD0A 3G6EQ 2O4XB 4N4GA 2K3XA 3ZEHA 3HFOA 3MJXA 3OYHA 3G4SA 4GBQA 3VUBA 1EIFA 4HCCA 2RJCA 2DIGA 1ZSGA 1WJRA 3BY7A 3CCMT 4Y28E 2EYQA 2VYTA 3X28B 2AIRB 3MP1A 2W10A 3VS7A 1GBRA 1X43A 2GGRA 1U1TA 1KQ2A 1UE9A 4UC4A 2E70A 3VJPA 2DK3A 2DKGA 4C92E 2ABLA 3M5AA 4OMNA 1K73U 3OS1A 3I9QA 2MCNA 2RN8A 1X27A 4KH1B 5IXFA 3HRUA 2JS0A 2ZPIB 2FO0A 4J7IA 4DBFA 3OW2A 2KSSA 4FSSA 5HK3A 5CO7A 5GAN7 4ZGEB 4ZTJA 2PUKB 2LCLA 1MMAA 1QKWA 2O9VA 3GLXA 3JAME 3FC3A 1YITQ 1JU5C 3SB2A 2R57A 4M75E 5GMKj 1Q82C 4M7DF 2FRWA 2Y4XA 3AT1B 4KGZB 2LMJA 2DEQA 4PJJA 3NTIA 1N8RU 1ARKA 4CC4B 2DL3A 2YUPA 2DL5A 5LL6S 3S6WA 3ME9A 4M7DA 2XI9A 3P8BB 1G3SA 2YRDA 3UWNA 4RMOA 1MV3A 3E9GA 2D6FA 2KYMA 3UPUA 8ATCB 1VQKQ 5GANe 1VQ8T 2M02A 3T9NA 3JRZA 2QDLA 3JCMb 1VQLT 1UJ0A 2L3PA 2QASA 1FYNA 2EW3A 1BK2A 4O6JA 3G71T 4J9CA 5IH2A 1VQMQ 4PJNA 2E6ZA 4C8QD 4PJOD 5LJ3h 2GTJA 3NMZC 1Y7XA 3JB9D 3RKWA 1VQOT 1MNDA 4QQ6A 1NPPA 2RI2A 3UA6A 2DA9A 2KROA 2KEAA 3PNWC 3TQ7P 2M0YA 4LUDA 4RTYA 3JCMe 2PTKA 1M9SA 1M8VA 2EIFA 5LJ5f 4FT2A 2NYSA 2YT6A 2V8KA 3THKA 3OYMA 2OTJT 1OULA 2L3RA 2KY9A 1BKBA 3M57A 1AWXA 3OYJA 2V8IA 2VVKA 1X6BA 2GF7A 2FVUA 3BE3A 2QEXA 2E3IA 4M77C 2RHYA 2CP6A 1UFFA 4BUGA 5KYXB 1EFNA 3CCST 3I55A 3EGDB 3GOXA 2VWFA 5IHIA 3LGFA 4C92F 4FYXB 1KQSA 2QA4T 3RBBB 3J81E 3S3OA 4JRPA 1K9MR 2OTLA 3ZFJA 3PTAA 4OMPA 3JCMc 1WYXA 1TSFA 4M75F 4E7HA 3UT1A 2LCCA 3OS5A 4HCBA 5IHKA 3S3MA 2KYBA 2XIDA 4P5NA 4M78E 3UDCA 1I81A 4JZ3A 1RAFB 1M2VB 1K0SA 1W4SA 1MMGA 1KHIA 1GCPA 4QW2A 1J3TA 1S72T 1AOJA 1K73C 3GIBA 3QSUA 1YFNA 1SPKA 2P4TA 1MGQA 3IQLA 2XDPA 3INZA 3H6ZA 1U5SA 2WSEE 2CP7A 1BU1A 1YIJQ 1IB8A 2J7IA 1RADB 3VS2A 3CC4A 5CQYA 1YJ9A 3CCVQ 2FL7A 2L89A 2BZ8A 4EMKA 4DEYA 2LJ1A 1N8RC 4MZTA 2YHTA 4LDVA 4F14A 1YCSB 4BB7A 2P0PA 4XTZA 3J7AF 1VYVA 4A53A 4M77G 1YJNA 3META 3U23A 1RLQC 2L2PA 3CMEQ 4C0ZA 4M7AA 3VRZA 3QWXX 3H0IA 2BTTA 3HSBA 4XK8E 4EDUA 3JCMf 1HXDA 3DLLA 2DXUA 5CAIA 4X1VA 5FU6B 4R56A 1AZGB 5D6YA 4BDZA 1XTDA 1CSKA 4X34A 1SEMA 1M4ZA 1AD5A 4LXCA 4DA4A 4RTZA 3CCJT 3CCUA 4Z88A 3EFOA 1QCOA 5FWCA 5KE2A 2MAMA 3CCMA 2BZYA 2LX9A 3EGXA 5FRNA 1WQ7A 2LX7A 3E9FA 2E12A 2HSEB 2HCKA 1O75A 3CPFA 2VXFA 1D0ZA 1D3BB 2FPFA 2L8DA 2DBKA 3G4ST 4BI3A 4JPBW 1PKSA 1G5VA 1BI0A 3MPUB 1NYFA 2X4JA 2B8AA 1UDLA 1VQ6Q 1Q95G 2KAFA 1WHMA 2RPNA 2F2XA 2M16A 2YDLA 3PGGA 3UA7A 3LH0A 4E6RA 1VQNQ 2HD0A 1VOMA 3X26B 2LT4A 4HT8A 2F2WA 5IN1A 3OA6A 1YWOA 4M78F 2CP5A 4AG2C 4DQ2A 1MUZA 1X6GA 4C8QA 4XTUA 1YI2Q 3C94A 1WIEA 2O4XA 4J7FA 1WLPB 2AHJB 3VYHB 3OYNA 5I2MA 1PG5B 3I5SA 4C0GA 2BE7D 2AKLA 5I21A 1SG5A 5DLOA 1YJWA 3M0QA 3URGA 4LDYA 3V7RA 4PL6A 3GPLA 5GAMd 1GCQA 4BY6C 3CCQT 4RCBA 3VV0A 1M2OA 2EJ9A 2AK5A 2XG8D 3CBMA 4IKFA 2QQRA 1G3TA 2DL8A 4M4ZA 3VRYA 3RDVA 1RL2A 3G71A 2E6NA 4HA8A 2HKQB 1NYGA 1JXMA 1B34A 3I35A 3DKMA 3QJ6A 1H8KA 3V7SA 4ANJA 2E10A 3CCEA 1NLOC 2GTOA 3GNGA 4LDXA 4C0FA 4E7SA 3PT9A 4RUGA 1LVKA 2K6DA 4PLLA 3L2VA 2LZ6B 2VGMA 3QZ5B 5GAMj 3VS1A 4OMQA 1OV3A 2EQMA 2GQVA 3H9NA 1H3ZA 3LGLA 2K57A 1VQPQ 5C0MA 2LNVA 2KRSA 5L8RE 1JB0E 1G2BA 1IHVA 1N27A 3WVEB 3TSZA 2DE0X 3CBPA 2L0AA 2JTEA 1BBZA 3L2UA 1CKAA 4IUPA 2QG9B 2AZVA 4MZMA 1NPRA 3RIRA 2GQIA 1D1CA 2HSPA 1WXTA 2NWMA 1U1SA 2IPOB 2MWOA 5GMKi 4RTTA 4IUUA 1M8MA 1GBQA 1N9RA 5DM7R 2EPDA 2LC4A 3M56A 1W70A 2RO0A 3UF4A 1JO8A 1VQ8Q 4C92C 1Q82U 1IGUA 4GY5A 5HKCA 1VQLQ 4PKCC 2D9TA 3OYCA 2KE9A 2J05A 4BACA 4DEXA 1UUEA 2HQEA 2CT3A 1Q82R 4E7KA 1WPYA 3CQTA 5LJ5j 2KK4A 2P0QA 1ACMB 2X9HA 4EMKB 4A54A 2EYZA 2FRYA 2CZ7B 4FW2A 1Y0MA 5GAN4 3QWYA 1T3SA 4ZN1A 4IUVA 2CP0A 1KQSP 4M75C 1S72A 1VQOQ 1M3AA 2C0TA 5DLQE 3EH1A 1JRIA 3JCMg 2LQWA 5IXBA 4E7ZA 1ZQ1A 1TH7A 1P92A 3EGDA 2A7YA 2ZAEA 5FROA 4A4FA 1ZSZC 2OTJQ 5GAMe 1NG2A 3M58A 1Q86U 3MEUA 4E7LA 2A0FB 2CH4A 2QGFB 1YN8A 1OEBA 4M7DE 2J6OA 3VKIA 2FHDA 3RERA 3A1PA 4Y91A 2QQAA 3EFOB 2BUDA 3LH5A 4OMOA 3CCSQ 4E7JA 3CEYA 1UGPB 1VQ4A 1KHCA 2RJDA 3EGXB 2EQJA 3WVDB 3CC4T 2QA4Q 1TWBA 4D8DA 1KC8U 2RQVA 1T0HA 3FJPA 4RKUE 1RI0A 2CREA 3FIFA 1M2VA 2DTOA 2XICA 2W0ZA 2YLCA 4C92D 3MKDA 4XQ3A 4OVAA 1YJNT 3CCJA 4CC7A 4FCYA 2RHIA 1I8FA 4F17A 1GFCA 4II1A 4KBMB 4C92G 1FMWA 2CZ6B 2EBPA 2QTXA 2XKOC 1QVGA 4C8QB 1TUGB 4PJOB 1VUBA 2OJ2A 1CKBA 5LJ5e 2KNBB 1BB9A 4M75D 2RI5A 2DLPA 2GFAA 3OSSC 3OYAA 2V26A 4F16A 2Y90A 3CCUT 4ZTFA 3SD4A 3HP9A 1M1FA 5GAOl 4M75G 4ZNXA 2E64A 2HMAA 4JLGA 3PFSA 2EQKA 5L23A 3MO8A 1UHFA 2YRVA 4FYWB 2L5QA 5CKEA 4FL6A 1PNJA 3I56Q 1WA7A 1WZOA 3QDFA 1G8XA 4LD6A 5AT1B 3LWHA 3CXCA 2MWPA 1TU0B 2CKKA 4NOYA 4OP0A 4VUBA 2MF2A 4C5GA 1A0NB 1K73R 2RI3A 4DOVA 4M78C 1B34B 1HK9A 3DB4A 1FXXA 1PD0A 4XTVA 1YHQT 3A8OB 2FZGB 4N0AC 5EC7A 3CCRA 2F69A 3A8HB 4V2SA 1D3BA 3CCQA 3OYLA 1D1BA 1SRMA 4AFUC 1H641 4ELZC 1AWJA 5GAMf 1PD1A 2MIOA 2J06A 3CMAA 2DF6A 3SEMA 1YJWT 1M30A 2O31A 1X69A 5GMKm 1N8RR 3MEVA 2JJ9A 1WXUA 1NLPC 1FMVA 3RUXA 2RQWA 1UGQB 2M51A 4NS5A 3OSVA 2YUQA 2CUBA 3G4SQ 3CC2T 5KYWB 3CD6A 1AT1B 3CBOA 3NTHA 2ZZDA 1KIKA 3NFCA 3EG3A 3FB9A 1RAHB 5HCKA 3HL8A 4AT1B 3SFMA 1Q86C 3SDZA 2DD5A 2LRQA 2BE9B 4L5GA 2ROTA 2PVOB 1OU9A 5GAN3 3CCET 4J9GA 4M7AE 2HZYA 4XAXB 3EG9A 2J6FA 4CI0C 5GAOp 5KCOA 3OYFA 4ESRA 2EGAA 1LJOA 4A4KA 1WNLA 3M4GA 4B9WA 1SRLA 1KC8C 5KYYA 4A4HA 4EIKA 3JV3A 4M78D 2HQXA 4OF1A 2EYXA 3RR6A 5FWBA 4D8KA 3PMIA 4IUQA 1VA7A 5I22A 1R0BG 4CC3A 4BD3A 1B07A 2NUPB 2X51A 4F04B 4M78G 4TVRA 2VB6A 1NE8A 2QTVA 2FG0A 1OU8A 1RACB 4MZPA 2KMTA 3HRTA 4ORZA 3A5ZB 1I1JA 5GAOm 1I5OB 8AT1B 2CH4W 3DB3A 4RTXA 3HFNA 1AEYA 4JJDA 1X01A 2K2VA 4A4GA 1AWOA 3C4SA 2QI2A 2JN0A 2DERA 1ZUKA 3RESA 2EFIA 2YSQA 1KJWA 3QDRB 2DXBA 2O9SA 1HSQA 2RK1A 2VXEA 1VIEA 2K3YA 4X9DA 2RNAA 4AFQC 4RTUA 1OOTA 1H3HA 4L6V5 3PVQA 3BDLA 1VQ9A 2EKHA 3CCLT 3LYIA 4ME7A 3RNJA 1TTHB 5D7UA 1WI7A 1XNIA 1KFZA 1QWFA 1SHGA 2D0QB 3MCAB 4HT9A 2F5TX 3PVLA 3G1JA 1SHFA 1KQSS 1EX4A 2NUTB 2F5KA 3QJYA 2D0NA 3M59A 3QIIA 5GANh 3G6ET 2RM4A 5CKFA 2WSFE 4QVDA 3A8LB 3HHTB 5CVIA 2ZPHB 1KSWA 4J6YA 1AWWA 3QXEB 2LVMA 5IHNA 1V1CA
chains in the Genus database with same CATH topology
1PRLC 2DL8A 4M4ZA 3VRYA 3NHNA 1Z9ZA 2KRNA 2K7AA 3GBQA 5FW9A 3FJ5A 1ZLMA 1HJDA 4GLMA 1JXOA 1NYGA 1PWTA 2X3XD 1JXMA 1JQQA 3I35A 2DVJA 4JJCA 2RQTA 1H8KA 2L3QA 3EG2A 1W6XA 2A08A 1NLOC 2K3BA 1ABOA 2GTOA 4OMMA 3VS0A 2HDAA 4Z89A 3NPFA 4RUGA 1GL5A 3EGUA 2A37A 2BZXA 2K6DA 1Y57A 2LJ0A 2LZ6B 3VS1A 4OMQA 1OV3A 1SSHA 1M3CA 2KXDA 5I11A 1RLPC 1NEBA 2MOXA 1WFWA 2JM9A 2KRSA 2V1QA 2J6KA 1G2BA 1T3LA 2ED0A 1M3BA 2P4RA 3TSZA 2K9GA 2KT1A 2DE0X 4J9HA 3VS4A 3M0PA 1QKXA 3VS3A 2L0AA 2JTEA 2HEQA 1BBZA 3M0RA 1CKAA 2AZVA 3I5RA 4KRTA 2GQIA 4HCKA 1K1ZA 2HSPA 1WXTA 2NWMA 2JT4A 1UG1A 4RTTA 1PHTA 4GBQA 1UHCA 2ESWA 1M8MA 1U06A 1GBQA 2JM8A 2EPDA 4J9EA 1ZSGA 1E6HA 1W70A 3UF4A 2D1XA 1JO8A 4Z8AA 2AZSA 2SEMA 2W10A 3VS7A 1GBRA 1RUWA 3EG0A 1X43A 2GGRA 2EVRA 1UE9A 2KE9A 3VS5A 2CSIA 4J9FA 2J05A 1Z9QA 4DEXA 1UUEA 2ABLA 4OMNA 2CT3A 3I9QA 2MCNA 2RN8A 1X27A 3CQTA 1RI9A 5IXFA 1WDXA 3O5ZA 2JS0A 2FO0A 1LCKA 2EYZA 2FRYA 1Y0MA 3QWYA 1T3SA 4FSSA 4LNPA 2C0TA 1M3AA 2KRMA 1ZUYA 1M27C 2L3SA 1WX6A 4JJBA 1QKWA 2LQWA 1AZEA 5IXBA 2O9VA 2K79A 1JU5C 2ROLA 3M0SA 2DMOA 2E5KA 2FRWA 2KR3A 2LMJA 1QWEA 2X3WD 1ARKA 4CC4B 1NG2A 2RF0A 2DL3A 3C0CA 2YUPA 2CH4A 4LUEA 2DL5A 1YN8A 1OEBA 1NM7A 2J6OA 2DX1A 4WCIA 2EGEA 2KT8A 3PE0A 4JZ4A 3R6NA 3TSWA 4AFZC 1MV3A 2G6FX 3NGPA 3LH5A 2KYMA 4OMOA 3UATA 3H41A 2VKNA 1YNZA 2KBTA 2QDLA 1I0CA 1UJ0A 4D8DA 1N5ZA 2CSQA 1ZUUA 2L3PA 1T0HA 2RQVA 1IO6A 1FYNA 2EW3A 2F2VA 3A98A 2LP5A 2CREA 4CC2A 1BK2A 4J9CA 5IH2A 2W0ZA 1H92A 2D8JA 2GTJA 3NMZC 2FPEA 2D8HA 1UJYA 4CC7A 4F17A 1GFCA 1OPLA 3EHRA 2EBPA 2DA9A 2KROA 3KFVA 2KEAA 3UA6A 2DBMA 2M0YA 4LUDA 4RTYA 3REAB 2PTKA 4J9BA 2OJ2A 1CKBA 2YT6A 1VYUA 3THKA 2KNBB 2ENMA 1BB9A 1AWXA 2DLPA 4AFSC 4F16A 2VVKA 4RTVA 1X6BA 1K4US 1TUCA 1B3QA 2KGTA 1K76A 2DRMA 4ZNXA 1UFFA 1EFNA 2LQNA 2DM1A 5L23A 2VWFA 5IHIA 1UHFA 1GRIA 3REBB 2JXBA 1PNJA 1E7OA 1WA7A 1VYTA 2GNCA 1ZX6A 5GJWB 3RBBB 3ULRB 1WXBA 4OMPA 2EYWA 2A28A 3M0TA 1WYXA 1A0NB 2SRCA 1PKTA 1UECA 1UTIA 2HBWA 5IHKA 1HD3A 1TG0A 2FPDA 5EC7A 4IIOA 2KYBA 1W1FA 2JW4A 1YWPA 1SRMA 4AFUC 2C0IA 2YUNA 1AWJA 2H8HA 4JZ3A 1K0SA 4OMLA 2MIOA 1GCPA 2J06A 1J3TA 1AOJA 2ECZA 2DF6A 1SPKA 3SEMA 1JEGA 1K9AA 1M30A 2O31A 1X69A 3IQLA 1I07A 5GJVB 1PRMC 2RQUA 1WXUA 1NLPC 2RQWA 1U5SA 2M51A 1E6GA 1BU1A 2YUQA 4AG1C 2J7IA 2DYBA 3VS2A 4K11A 3ZL7C 2O88A 2CUBA 5ECAA 2K2MA 4RTWA 3H0FA 1ABQA 2XMFA 2BZ8A 4DEYA 1TUDA 1KIKA 3EG3A 1K0XA 2LJ1A 5HCKA 2DL4A 4F14A 1YCSB 2V1RA 1VYVA 1ZBJA 3SHWA 2ROTA 3U23A 4QT7A 1RLQC 2L2PA 4J9GA 2A36A 3VRZA 2JS2A 2J6FA 1GFDA 4LE9A 3QWXX 2PZ1A 2ED1A 3H0IA 1OPKA 2BTTA 4LN2A 2OAWA 2EYYA 1UGVA 1S1NA 4ESRA 2EGAA 4X1VA 1AZGB 2RMOA 1SRLA 1CSKA 1SEMA 1AD5A 2DRKA 4RTZA 4EIKA 3JV3A 2C0OA 2EYXA 2CT4A 1X2KA 4Z88A 2LJ3A 5FWBA 3VS6A 4D8KA 1VA7A 1NEGA 5FWCA 5I22A 2IIMA 2NUZA 4CC3A 2KXCA 2BZYA 2LCSA 3M0UA 1B07A 2LX7A 4HXJA 2HCKA 4J9IA 2FPFA 2FG0A 2I0NA 1QLYA 1AVZC 2DBKA 4ORZA 4JPBW 2CUDA 1PKSA 1X2QA 2O2OA 1I1JA 1NYFA 2AKKA 4HVVA 1UDLA 2CH4W 3EG1A 2DILA 4RTXA 1AEYA 4JJDA 2RPNA 2F2XA 2YDLA 3UA7A 4E6RA 1AWOA 1T0JA 1ZUKA 2F2WA 2YSQA 1YWOA 1KJWA 2O9SA 1HSQA 4AG2C 1MUZA 1X6GA 1XOVA 1QCFA 4Y92A 1WIEA 2RNAA 4AFQC 4RTUA 1OOTA 1H3HA 1WLPB 2B86A 2CDTA 3PVQA 1FMKA 3H0HA 3TVTA 4IIMA 4R0KA 1G83A 2EKHA 4J9DA 2FEIA 1GCQC 3I5SA 2AKLA 2GBQA 2DJQA 1MV0B 3RNJA 2EQIA 2LNHB 2DNUA 1WI7A 2JMCA 1KFZA 1QWFA 1SHGA 4A63B 2OI3A 3EHQA 4HVWA 3M0QA 2PNIA 2RQRA 1U3OA 3PVLA 1SHFA 1GCQA 2D0NA 2DL7A 2YUOA 1AWWA 1KSWA 1YP5A 2AK5A 4HVUA 5IHNA 2JMAA 1V1CA 2EGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRL C;  2DL8 A;  4M4Z A;  3VRY A;  3NHN A;  1Z9Z A;  2KRN A;  2K7A A;  3GBQ A;  5FW9 A;  3FJ5 A;  1ZLM A;  1HJD A;  4GLM A;  1JXO A;  1NYG A;  1PWT A;  2X3X D;  1JXM A;  1JQQ A;  3I35 A;  2DVJ A;  4JJC A;  2RQT A;  1H8K A;  2L3Q A;  3EG2 A;  1W6X A;  2A08 A;  1NLO C;  2K3B A;  1ABO A;  2GTO A;  4OMM A;  3VS0 A;  2HDA A;  4Z89 A;  3NPF A;  4RUG A;  1GL5 A;  3EGU A;  2A37 A;  2BZX A;  2K6D A;  1Y57 A;  2LJ0 A;  2LZ6 B;  3VS1 A;  4OMQ A;  1OV3 A;  1SSH A;  1M3C A;  2KXD A;  5I11 A;  1RLP C;  1NEB A;  2MOX A;  1WFW A;  2JM9 A;  2KRS A;  2V1Q A;  2J6K A;  1G2B A;  1T3L A;  2ED0 A;  1M3B A;  2P4R A;  3TSZ A;  2K9G A;  2KT1 A;  2DE0 X;  4J9H A;  3VS4 A;  3M0P A;  1QKX A;  3VS3 A;  2L0A A;  2JTE A;  2HEQ A;  1BBZ A;  3M0R A;  1CKA A;  2AZV A;  3I5R A;  4KRT A;  2GQI A;  4HCK A;  1K1Z A;  2HSP A;  1WXT A;  2NWM A;  2JT4 A;  1UG1 A;  4RTT A;  1PHT A;  4GBQ A;  1UHC A;  2ESW A;  1M8M A;  1U06 A;  1GBQ A;  2JM8 A;  2EPD A;  4J9E A;  1ZSG A;  1E6H A;  1W70 A;  3UF4 A;  2D1X A;  1JO8 A;  4Z8A A;  2AZS A;  2SEM A;  2W10 A;  3VS7 A;  1GBR A;  1RUW A;  3EG0 A;  1X43 A;  2GGR A;  2EVR A;  1UE9 A;  2KE9 A;  3VS5 A;  2CSI A;  4J9F A;  2J05 A;  1Z9Q A;  4DEX A;  1UUE A;  2ABL A;  4OMN A;  2CT3 A;  3I9Q A;  2MCN A;  2RN8 A;  1X27 A;  3CQT A;  1RI9 A;  5IXF A;  1WDX A;  3O5Z A;  2JS0 A;  2FO0 A;  1LCK A;  2EYZ A;  2FRY A;  1Y0M A;  3QWY A;  1T3S A;  4FSS A;  4LNP A;  2C0T A;  1M3A A;  2KRM A;  1ZUY A;  1M27 C;  2L3S A;  1WX6 A;  4JJB A;  1QKW A;  2LQW A;  1AZE A;  5IXB A;  2O9V A;  2K79 A;  1JU5 C;  2ROL A;  3M0S A;  2DMO A;  2E5K A;  2FRW A;  2KR3 A;  2LMJ A;  1QWE A;  2X3W D;  1ARK A;  4CC4 B;  1NG2 A;  2RF0 A;  2DL3 A;  3C0C A;  2YUP A;  2CH4 A;  4LUE A;  2DL5 A;  1YN8 A;  1OEB A;  1NM7 A;  2J6O A;  2DX1 A;  4WCI A;  2EGE A;  2KT8 A;  3PE0 A;  4JZ4 A;  3R6N A;  3TSW A;  4AFZ C;  1MV3 A;  2G6F X;  3NGP A;  3LH5 A;  2KYM A;  4OMO A;  3UAT A;  3H41 A;  2VKN A;  1YNZ A;  2KBT A;  2QDL A;  1I0C A;  1UJ0 A;  4D8D A;  1N5Z A;  2CSQ A;  1ZUU A;  2L3P A;  1T0H A;  2RQV A;  1IO6 A;  1FYN A;  2EW3 A;  2F2V A;  3A98 A;  2LP5 A;  2CRE A;  4CC2 A;  1BK2 A;  4J9C A;  5IH2 A;  2W0Z A;  1H92 A;  2D8J A;  2GTJ A;  3NMZ C;  2FPE A;  2D8H A;  1UJY A;  4CC7 A;  4F17 A;  1GFC A;  1OPL A;  3EHR A;  2EBP A;  2DA9 A;  2KRO A;  3KFV A;  2KEA A;  3UA6 A;  2DBM A;  2M0Y A;  4LUD A;  4RTY A;  3REA B;  2PTK A;  4J9B A;  2OJ2 A;  1CKB A;  2YT6 A;  1VYU A;  3THK A;  2KNB B;  2ENM A;  1BB9 A;  1AWX A;  2DLP A;  4AFS C;  4F16 A;  2VVK A;  4RTV A;  1X6B A;  1K4U S;  1TUC A;  1B3Q A;  2KGT A;  1K76 A;  2DRM A;  4ZNX A;  1UFF A;  1EFN A;  2LQN A;  2DM1 A;  5L23 A;  2VWF A;  5IHI A;  1UHF A;  1GRI A;  3REB B;  2JXB A;  1PNJ A;  1E7O A;  1WA7 A;  1VYT A;  2GNC A;  1ZX6 A;  5GJW B;  3RBB B;  3ULR B;  1WXB A;  4OMP A;  2EYW A;  2A28 A;  3M0T A;  1WYX A;  1A0N B;  2SRC A;  1PKT A;  1UEC A;  1UTI A;  2HBW A;  5IHK A;  1HD3 A;  1TG0 A;  2FPD A;  5EC7 A;  4IIO A;  2KYB A;  1W1F A;  2JW4 A;  1YWP A;  1SRM A;  4AFU C;  2C0I A;  2YUN A;  1AWJ A;  2H8H A;  4JZ3 A;  1K0S A;  4OML A;  2MIO A;  1GCP A;  2J06 A;  1J3T A;  1AOJ A;  2ECZ A;  2DF6 A;  1SPK A;  3SEM A;  1JEG A;  1K9A A;  1M30 A;  2O31 A;  1X69 A;  3IQL A;  1I07 A;  5GJV B;  1PRM C;  2RQU A;  1WXU A;  1NLP C;  2RQW A;  1U5S A;  2M51 A;  1E6G A;  1BU1 A;  2YUQ A;  4AG1 C;  2J7I A;  2DYB A;  3VS2 A;  4K11 A;  3ZL7 C;  2O88 A;  2CUB A;  5ECA A;  2K2M A;  4RTW A;  3H0F A;  1ABQ A;  2XMF A;  2BZ8 A;  4DEY A;  1TUD A;  1KIK A;  3EG3 A;  1K0X A;  2LJ1 A;  5HCK A;  2DL4 A;  4F14 A;  1YCS B;  2V1R A;  1VYV A;  1ZBJ A;  3SHW A;  2ROT A;  3U23 A;  4QT7 A;  1RLQ C;  2L2P A;  4J9G A;  2A36 A;  3VRZ A;  2JS2 A;  2J6F A;  1GFD A;  4LE9 A;  3QWX X;  2PZ1 A;  2ED1 A;  3H0I A;  1OPK A;  2BTT A;  4LN2 A;  2OAW A;  2EYY A;  1UGV A;  1S1N A;  4ESR A;  2EGA A;  4X1V A;  1AZG B;  2RMO A;  1SRL A;  1CSK A;  1SEM A;  1AD5 A;  2DRK A;  4RTZ A;  4EIK A;  3JV3 A;  2C0O A;  2EYX A;  2CT4 A;  1X2K A;  4Z88 A;  2LJ3 A;  5FWB A;  3VS6 A;  4D8K A;  1VA7 A;  1NEG A;  5FWC A;  5I22 A;  2IIM A;  2NUZ A;  4CC3 A;  2KXC A;  2BZY A;  2LCS A;  3M0U A;  1B07 A;  2LX7 A;  4HXJ A;  2HCK A;  4J9I A;  2FPF A;  2FG0 A;  2I0N A;  1QLY A;  1AVZ C;  2DBK A;  4ORZ A;  4JPB W;  2CUD A;  1PKS A;  1X2Q A;  2O2O A;  1I1J A;  1NYF A;  2AKK A;  4HVV A;  1UDL A;  2CH4 W;  3EG1 A;  2DIL A;  4RTX A;  1AEY A;  4JJD A;  2RPN A;  2F2X A;  2YDL A;  3UA7 A;  4E6R A;  1AWO A;  1T0J A;  1ZUK A;  2F2W A;  2YSQ A;  1YWO A;  1KJW A;  2O9S A;  1HSQ A;  4AG2 C;  1MUZ A;  1X6G A;  1XOV A;  1QCF A;  4Y92 A;  1WIE A;  2RNA A;  4AFQ C;  4RTU A;  1OOT A;  1H3H A;  1WLP B;  2B86 A;  2CDT A;  3PVQ A;  1FMK A;  3H0H A;  3TVT A;  4IIM A;  4R0K A;  1G83 A;  2EKH A;  4J9D A;  2FEI A;  1GCQ C;  3I5S A;  2AKL A;  2GBQ A;  2DJQ A;  1MV0 B;  3RNJ A;  2EQI A;  2LNH B;  2DNU A;  1WI7 A;  2JMC A;  1KFZ A;  1QWF A;  1SHG A;  4A63 B;  2OI3 A;  3EHQ A;  4HVW A;  3M0Q A;  2PNI A;  2RQR A;  1U3O A;  3PVL A;  1SHF A;  1GCQ A;  2D0N A;  2DL7 A;  2YUO A;  1AWW A;  1KSW A;  1YP5 A;  2AK5 A;  4HVU A;  5IHN A;  2JMA A;  1V1C A;  2EGC A; 
#chains in the Genus database with same CATH topology
 1PRL C;  2QEX Q;  3GNF B;  4DBR A;  1Z9Z A;  2KRN A;  2HAX A;  2K7A A;  2IG0 A;  3GBQ A;  4M77 D;  3FJ5 A;  1ZLM A;  4C5H A;  4M7A F;  1HJD A;  3QYG B;  2X4Y A;  3I55 Q;  1JXO A;  2X3X D;  4PLI A;  3TCJ A;  2G3R A;  1VQ4 T;  3EG2 A;  2CZ0 B;  1W6X A;  5KYU A;  5GAN 2;  4OMM A;  2MK5 A;  1GXI E;  4Z89 A;  2OTL Q;  1R77 A;  3EGU A;  2BZX A;  3JCM h;  4FU6 A;  3HTR A;  1R0C B;  2VV5 A;  3L2Q A;  1SSH A;  3PIO A;  1RAI B;  1NEB A;  4IUR A;  2HL5 C;  4O5V A;  1KG1 A;  2MOX A;  2JM9 A;  2V1Q A;  2J6K A;  4PK4 A;  1T3L A;  2DJZ A;  2P4R A;  4J9H A;  2X35 A;  3M0P A;  3VS3 A;  3FLG A;  2HEQ A;  2YLB A;  5GAM g;  3I5R A;  4KRT A;  2DO3 A;  4BDY A;  5GMK h;  1KD1 U;  3X25 B;  1K1Z A;  1M90 U;  4R55 A;  3P8H A;  1Q7Y C;  2X4X A;  1PHT A;  4QQG A;  3MEA A;  1UHC A;  2CS7 A;  2JM8 A;  4RG8 A;  4E7I A;  1WHG A;  2D1X A;  4Z8A A;  1IGQ A;  2AZS A;  4KUI A;  4C8Q F;  1D1A A;  4PJO F;  3VYG A;  3CC4 Q;  1VQK T;  5FU6 C;  2SEM A;  2JTM A;  5FRM A;  5KH6 A;  1RUW A;  3EG0 A;  3JB9 F;  1YJ9 Q;  2EVR A;  4B6M A;  2CSI A;  1UEB A;  3SWN B;  4J9F A;  4F7U B;  1YHQ A;  2E1H A;  2GCX A;  4PJO A;  1RI9 A;  1WDX A;  3O5Z A;  4BY6 B;  3L42 A;  2EJF A;  4E47 A;  4ELY C;  2O01 E;  5HK0 A;  1YJN Q;  1RAG B;  1Q81 U;  1VQ7 A;  1XQH A;  2PU9 B;  2DET A;  2KRM A;  5GAN 6;  1ZUY A;  5CK9 A;  3QYH B;  1M27 C;  2L3S A;  1RAA B;  1WX6 A;  4JJB A;  3CXC P;  1AZE A;  4FT4 A;  1QVF A;  2K79 A;  4EPC A;  5HY6 A;  5LJ5 g;  3CCR T;  1LOJ A;  2ROL A;  2V8J A;  4M7D C;  3EG9 B;  1BI2 A;  2DMO A;  3M0S A;  3OW2 P;  3CC7 A;  2EAY A;  3V7C A;  1M1K C;  2KVQ G;  3V8L A;  3C0C A;  3EAE A;  1OX9 A;  4LUE A;  3CC2 A;  3CMA T;  3CCU Q;  2XU8 A;  2P84 A;  3RKY A;  5KYY B;  2KT8 A;  3PE0 A;  1TOV A;  4FM4 B;  3CCM Q;  4AFZ C;  4FW1 A;  4BE0 A;  3JCM W;  3UAT A;  2E65 A;  3PMT A;  3H41 A;  3E2U A;  1YNZ A;  3OMC A;  5D6W A;  3EFR A;  2KBT A;  4C5E A;  1I0C A;  2RHZ A;  4C5I A;  3QHS A;  1N5Z A;  3CD6 T;  1NBE B;  4PJM A;  4JS5 A;  5CKB A;  5C6S A;  2F2V A;  3A98 A;  4CC2 A;  2CZ1 B;  3HKS A;  4J8O A;  1H92 A;  2D8J A;  2K5F A;  2YRC A;  3V8K A;  1BI3 A;  1JBM A;  3KXT A;  3PIP A;  2FPE A;  3MP8 A;  4IUT A;  2QXF A;  2VUB A;  1R8O B;  4KUL A;  4AMC A;  1Y96 A;  1OPL A;  3BDU A;  3EHR A;  2DBM A;  3QZ9 B;  5LJ3 d;  4N4I A;  3REA B;  3QUI A;  1ZHI A;  4C92 B;  7AT1 B;  3JCM V;  4QKU A;  2ENM A;  5KYW A;  3OYI A;  2BKD N;  2GFU A;  2E5Q A;  3D7S B;  1YJW Q;  4AFS C;  1VQ5 A;  1NJI U;  1TUC A;  2KGT A;  2DEU A;  4KUD K;  4M7D D;  5FU7 B;  2DM1 A;  1TS9 A;  4DOW A;  4M75 B;  1YIJ T;  2JXB A;  1E7O A;  4M7D G;  1VYT A;  4M77 A;  2MYS A;  4XTY A;  4MDX A;  1W2B A;  3JCM P;  3CCV T;  5J39 A;  4D6W A;  1C1A A;  3G71 Q;  1KD1 C;  3ULR B;  1WXB A;  5LJ3 j;  1M90 C;  2A28 A;  1IRE B;  5KCH A;  1RAE B;  3CCL A;  1OI1 A;  1M5Q 1;  3CCE Q;  2IVW A;  3CPW A;  4HKE A;  1UEC A;  1UTI A;  2HBW A;  2QYZ A;  3CME T;  2NUP A;  1TG0 A;  2FPD A;  3LW5 E;  5KYU B;  4MDW A;  5GMK l;  2DVE A;  2JW4 A;  4OB0 B;  1YWP A;  2DZ9 A;  3G6E A;  4E2F B;  1IXD A;  2ZPB B;  2C0I A;  9ATC B;  1VQ9 T;  2DPP B;  4FIB A;  4OML A;  2ECZ A;  4PNO A;  4OB3 B;  1WHL A;  4BI8 B;  1D0Y A;  2M1H A;  2LTO A;  1JJ2 A;  2ZGW A;  4L59 A;  2RHU A;  5GJV B;  1PRM C;  1Q86 R;  2RQU A;  2JNG A;  1Q81 C;  4EMK C;  4Z02 A;  4JRQ A;  3EH2 A;  1PCX A;  4AG1 C;  2DYB A;  4C0D B;  4K11 A;  3ZL7 C;  2O88 A;  5ECA A;  2K2M A;  4RTW A;  3H0F A;  4LDW A;  2XMF A;  5GAN 8;  2YXY A;  5GAN d;  4M7A C;  2DL4 A;  1QMC A;  4JUV A;  2DTI A;  1KC8 R;  3JSC A;  4PFP A;  1ZBJ A;  3SHW A;  1K8A U;  4QT7 A;  4PFZ A;  4OB1 B;  2JUF A;  3QPH A;  2M9U A;  1GFD A;  4LE9 A;  2PZ1 A;  2ED1 A;  2NUT A;  4XU1 A;  3OYB A;  2OAW A;  4BE1 A;  1YI2 T;  2PQW A;  2DIQ A;  2FZC B;  3CCL Q;  5LJ3 e;  2RMO A;  1S72 Q;  3F70 A;  2AT1 B;  2CT4 A;  1X2K A;  3JCM d;  2LJ3 A;  1NEG A;  2QQ9 A;  2MPX C;  2IIM A;  2NUZ A;  2DYI A;  3OQ5 A;  2KXC A;  2LCS A;  3M0U A;  1QP2 A;  2PUO B;  4HXJ A;  1O9S A;  1VQK A;  3TRE A;  1OQK A;  3O8V A;  1FX7 A;  2I0N A;  2JOY A;  1UB4 A;  1QLY A;  4M78 B;  1Y71 A;  4KGV B;  2QQB A;  1N9S A;  2VAS A;  1ZBX A;  3X20 B;  2H3J A;  2DIL A;  2Y4Y A;  3ASK A;  1VQM A;  4C8Q C;  1VQ4 Q;  2RJE A;  4PJO C;  3OB9 A;  2QGG A;  2WSC E;  5CIU A;  3WXM B;  1NJI C;  1QP3 A;  4X9C A;  1T0J A;  3OYG A;  3M4Y A;  1OX8 A;  1QVG S;  1XOV A;  4Y92 A;  3RMQ A;  4M7A D;  2RH2 A;  1PSF A;  2B86 A;  2CDT A;  1FMK A;  3H0H A;  3L2W A;  4IIM A;  4R0K A;  5GAM h;  4JDS A;  2C06 A;  1G83 A;  2QK0 A;  2E3H A;  2FEI A;  3JCM X;  1GCQ C;  5GAO n;  3CCJ Q;  2VC8 A;  1VQ7 T;  4M7A G;  1VQP T;  2DJQ A;  2PVG B;  2LNH B;  3MEW A;  2DNU A;  4A63 B;  1VIF A;  4HVW A;  2RQR A;  4F7U F;  1U3O A;  3GF5 A;  3H8Z A;  4OGE A;  2R58 A;  4J6X A;  1Y96 B;  3RMS A;  2FB7 A;  3CC7 T;  3OMG A;  3CXC S;  3SWN A;  4F7U A;  2RJF A;  4DBH A;  3OS0 A;  4HVU A;  2JMA A;  2DTH A;  1QVF P;  2EGC A;  1MMN A;  5J26 A;  3OW2 S;  3NHN A;  2ZPG B;  1N6A A;  1TXQ A;  1V76 A;  2R5M A;  3X24 B;  5KYN A;  3ZBD A;  2F1L A;  1OZ3 A;  2DVJ A;  2BIV A;  4JJC A;  2RQT A;  2ZPE B;  2K3B A;  3G7Z A;  3VS0 A;  5A0L A;  2DZC A;  1BCO A;  1LNX A;  1Q7Y U;  2A37 A;  4M77 B;  1Y57 A;  2LJ0 A;  1C6V X;  2K5I A;  2COW A;  3RKX A;  5LJ5 h;  5GAO q;  2KXD A;  3TU4 K;  5LJ3 f;  1RAB B;  2MMP A;  2OAU A;  3JB9 I;  1Q7Y R;  3S3N A;  4FYY B;  1WFW A;  4C8Q G;  2KT1 A;  4PJO G;  3CCR Q;  1QKX A;  2CYZ B;  3JB9 G;  2WAC A;  2DAQ A;  3M0R A;  3CCQ Q;  2ZPF B;  4N4H A;  3AHU A;  5GAO r;  1K8A C;  3FRN A;  4HCK A;  1YIJ A;  3M55 A;  4J83 A;  3CMA Q;  2JT4 A;  1UG1 A;  1MMD A;  3N5B B;  2ESW A;  1VQ5 T;  1U06 A;  3CCV A;  4J9E A;  3V8J A;  2EJG A;  1SF9 A;  1E6H A;  1IHW A;  5I2S A;  2HBP A;  5IT9 E;  6AT1 B;  2ATC B;  1K9M U;  1I4K 1;  5GMK e;  3C95 A;  1WJQ A;  1PM3 A;  2LQ8 A;  1QW1 A;  5FLX E;  1M1K U;  3CD6 Q;  3CME A;  3VS5 A;  2I2L A;  4C8Q E;  4OGC A;  4PJO E;  1Z9Q A;  1IZ6 A;  2QDY B;  4C92 A;  1LCK A;  1M1K R;  1IRX A;  4XTX A;  5A0D A;  3OYE A;  4LNP A;  4J6W A;  4JS4 A;  1W2B P;  4ZN3 A;  3KBG A;  2LDM A;  3A8M B;  4Q5W A;  4JJN K;  2E5K A;  4M75 A;  2KR3 A;  1QWE A;  1MNE A;  2X3W D;  4KT0 E;  2RF0 A;  2LT1 A;  2YWW A;  3CPW P;  2K4Y A;  2PVD B;  4MMK A;  1NM7 A;  3QKJ A;  2DX1 A;  4WCI A;  2EGE A;  3JCM Q;  3FDR A;  4JZ4 A;  3R6N A;  1FWZ A;  1ZSZ A;  3TSW A;  1VQ6 A;  2G6F X;  3NGP A;  4JRI A;  1WQW A;  5GAN f;  1VQN A;  2RB6 A;  2VKN A;  2M0O A;  1I5L A;  3L2R A;  3I56 T;  1EZZ B;  2CSQ A;  1ZUU A;  1JJ2 P;  1IO6 A;  4PJL A;  3DLM A;  2LP5 A;  3L2Z A;  1YI2 A;  1DJ7 B;  3KUF A;  3LLR A;  5IAY A;  4PFO A;  3L1A A;  3LX7 A;  3M9Q A;  4QQD A;  2DXC A;  5CKD A;  2D8H A;  3VU3 C;  1UJY A;  3M54 A;  4KH0 B;  3KFV A;  1BYM A;  4BI4 A;  2NLU A;  1YIT T;  3P8D A;  4J9B A;  4EMH A;  1ZA1 B;  1VQ9 Q;  1VYU A;  1OZ2 A;  4YTL A;  1F1B B;  4RTV A;  1K4U S;  1B7T A;  3BW1 A;  2EQU A;  3TEE A;  1KD1 R;  4ZGJ B;  1B3Q A;  1QCN A;  1K76 A;  1M90 R;  1QVG P;  2DRM A;  5J3B A;  2LQN A;  1X75 C;  4GLK A;  1GRI A;  3REB B;  1BI1 A;  4M77 E;  4XTW A;  2E41 A;  2GNC A;  1ZX6 A;  5GJW B;  4B9X A;  3BFM A;  1UGR B;  2XK0 A;  3HPW A;  4M7D B;  2EYW A;  4RG2 A;  1VQM T;  3M0T A;  2HQH A;  4ZGD B;  2SRC A;  2HKN A;  1VQP A;  1PKT A;  2XDD A;  1D0X A;  3OYY A;  5D6X A;  1HD3 A;  3GP8 A;  2CP2 A;  1K9M C;  4IIO A;  1Q81 R;  5LJ3 g;  1W1F A;  1YBY A;  1M1G A;  4M78 A;  2YUN A;  1WJS A;  1BIB A;  2H8H A;  4CRI A;  2E4H A;  4N0A A;  1BCM A;  4OB2 B;  3OBW A;  1JEG A;  1K9A A;  3SWN C;  1SSF A;  2VGN A;  1PSE A;  1HYO A;  1I07 A;  3JB9 H;  2LQK A;  4HCZ A;  4JRK A;  3JCM J;  1BIA A;  1V29 B;  1QVP A;  1VQ8 A;  5CCA A;  1E6G A;  3R6O A;  3A8G B;  4QVC A;  1OYX A;  3OYK A;  1VQL A;  2HNI A;  1G3Y A;  1ABQ A;  2CGH A;  1TUD A;  3OS2 A;  1K0X A;  3FEO A;  4A4E A;  4XU0 A;  1KK7 A;  4FSX A;  2V1R A;  1QVF S;  4JLI A;  1VQO A;  2A36 A;  2JZ2 A;  2JS2 A;  5A2Q E;  1YHQ Q;  1OPK A;  4LN2 A;  1WHH A;  3C12 A;  2EYY A;  1UGV A;  1S1N A;  3VUZ A;  2OTJ A;  1VQ7 Q;  2OX7 A;  1AHJ B;  2DRK A;  4LD9 K;  5EG2 A;  2CP3 A;  2C0O A;  2EKO A;  3ER0 A;  3VS6 A;  1D09 B;  1WHJ A;  3MHX A;  4M77 F;  5LJ5 d;  2QAZ A;  1SKU B;  3CC7 Q;  2RD1 A;  3CCS A;  4J9I A;  5AYF A;  1NJI R;  3E19 A;  1UGS B;  3CC2 Q;  1QQJ A;  3OYD A;  1AVZ C;  2QA4 A;  2JTF A;  2CUD A;  1X2Q A;  2O2O A;  3OBY A;  1G3W A;  2AKK A;  4HVV A;  3LWI A;  2QEX T;  5GAN g;  2FZK B;  3EG1 A;  2KDS A;  2JVV A;  4WF2 A;  1XJW B;  4FYV B;  4EMG A;  2KQW A;  3J80 E;  1ZSZ B;  3I55 T;  4F7U G;  1C0M A;  3OY9 A;  2COZ A;  1QCF A;  2OTL T;  1LPL A;  3M53 A;  4OMF B;  5CKH A;  4WTO B;  2RK2 A;  3QBY A;  2XDB A;  3TVT A;  2COY A;  1U8R A;  5M9O A;  5FU7 C;  1WHK A;  3E1S A;  4J9D A;  2GBQ A;  4NL3 A;  2HL3 A;  1MV0 B;  5DY9 A;  2EQI A;  2XHC A;  3QG1 A;  2DFU A;  2JMC A;  2OI3 A;  3EHQ A;  3EFS A;  2PNI A;  4NL2 A;  5KYX A;  3Q1J A;  4M7A B;  2A3L A;  2P0K A;  1WGS A;  2DL7 A;  2RHX A;  1W2B S;  2YUO A;  4F7U E;  5A0G A;  1YP5 A;  2H3E B;  2K5L A;  2KI7 A;  2ZCF B;  1VQ5 Q;  3I56 A;  5KE3 A;  2DXT A;  5FW9 A;  1VQ6 T;  3CPW S;  2QQS A;  4GLM A;  5CQX A;  2X4W A;  4RCC A;  1PWT A;  4LDU A;  4J5Y A;  1JQQ A;  2FYK A;  4ATO A;  4XU2 A;  1VQN T;  2MI6 A;  2EWN A;  2L3Q A;  4KGX B;  2A08 A;  1ABO A;  1YJ9 T;  5GAN 5;  2HDA A;  3NPF A;  1GL5 A;  2DD4 A;  4BE2 A;  3MP6 A;  3HRS A;  1YIT A;  4QVZ A;  1PC0 A;  1K8A R;  1Y07 A;  2Z0W A;  1ZA2 B;  1M3C A;  2R5A A;  5I11 A;  1RLP C;  4XU3 A;  3JB9 J;  1JJ2 S;  1X6O A;  4MML A;  1YCY A;  4C0D C;  1NZ9 A;  1KQ1 A;  2RA2 A;  3QO3 A;  2ED0 A;  1M3B A;  3NTK A;  2K9G A;  3VS4 A;  5CR2 A;  4DBQ A;  1MHN A;  5GAN j;  2XD0 A;  3G6E Q;  2O4X B;  4N4G A;  2K3X A;  3ZEH A;  3HFO A;  3MJX A;  3OYH A;  3G4S A;  4GBQ A;  3VUB A;  1EIF A;  4HCC A;  2RJC A;  2DIG A;  1ZSG A;  1WJR A;  3BY7 A;  3CCM T;  4Y28 E;  2EYQ A;  2VYT A;  3X28 B;  2AIR B;  3MP1 A;  2W10 A;  3VS7 A;  1GBR A;  1X43 A;  2GGR A;  1U1T A;  1KQ2 A;  1UE9 A;  4UC4 A;  2E70 A;  3VJP A;  2DK3 A;  2DKG A;  4C92 E;  2ABL A;  3M5A A;  4OMN A;  1K73 U;  3OS1 A;  3I9Q A;  2MCN A;  2RN8 A;  1X27 A;  4KH1 B;  5IXF A;  3HRU A;  2JS0 A;  2ZPI B;  2FO0 A;  4J7I A;  4DBF A;  3OW2 A;  2KSS A;  4FSS A;  5HK3 A;  5CO7 A;  5GAN 7;  4ZGE B;  4ZTJ A;  2PUK B;  2LCL A;  1MMA A;  1QKW A;  2O9V A;  3GLX A;  3JAM E;  3FC3 A;  1YIT Q;  1JU5 C;  3SB2 A;  2R57 A;  4M75 E;  5GMK j;  1Q82 C;  4M7D F;  2FRW A;  2Y4X A;  3AT1 B;  4KGZ B;  2LMJ A;  2DEQ A;  4PJJ A;  3NTI A;  1N8R U;  1ARK A;  4CC4 B;  2DL3 A;  2YUP A;  2DL5 A;  5LL6 S;  3S6W A;  3ME9 A;  4M7D A;  2XI9 A;  3P8B B;  1G3S A;  2YRD A;  3UWN A;  4RMO A;  1MV3 A;  3E9G A;  2D6F A;  2KYM A;  3UPU A;  8ATC B;  1VQK Q;  5GAN e;  1VQ8 T;  2M02 A;  3T9N A;  3JRZ A;  2QDL A;  3JCM b;  1VQL T;  1UJ0 A;  2L3P A;  2QAS A;  1FYN A;  2EW3 A;  1BK2 A;  4O6J A;  3G71 T;  4J9C A;  5IH2 A;  1VQM Q;  4PJN A;  2E6Z A;  4C8Q D;  4PJO D;  5LJ3 h;  2GTJ A;  3NMZ C;  1Y7X A;  3JB9 D;  3RKW A;  1VQO T;  1MND A;  4QQ6 A;  1NPP A;  2RI2 A;  3UA6 A;  2DA9 A;  2KRO A;  2KEA A;  3PNW C;  3TQ7 P;  2M0Y A;  4LUD A;  4RTY A;  3JCM e;  2PTK A;  1M9S A;  1M8V A;  2EIF A;  5LJ5 f;  4FT2 A;  2NYS A;  2YT6 A;  2V8K A;  3THK A;  3OYM A;  2OTJ T;  1OUL A;  2L3R A;  2KY9 A;  1BKB A;  3M57 A;  1AWX A;  3OYJ A;  2V8I A;  2VVK A;  1X6B A;  2GF7 A;  2FVU A;  3BE3 A;  2QEX A;  2E3I A;  4M77 C;  2RHY A;  2CP6 A;  1UFF A;  4BUG A;  5KYX B;  1EFN A;  3CCS T;  3I55 A;  3EGD B;  3GOX A;  2VWF A;  5IHI A;  3LGF A;  4C92 F;  4FYX B;  1KQS A;  2QA4 T;  3RBB B;  3J81 E;  3S3O A;  4JRP A;  1K9M R;  2OTL A;  3ZFJ A;  3PTA A;  4OMP A;  3JCM c;  1WYX A;  1TSF A;  4M75 F;  4E7H A;  3UT1 A;  2LCC A;  3OS5 A;  4HCB A;  5IHK A;  3S3M A;  2KYB A;  2XID A;  4P5N A;  4M78 E;  3UDC A;  1I81 A;  4JZ3 A;  1RAF B;  1M2V B;  1K0S A;  1W4S A;  1MMG A;  1KHI A;  1GCP A;  4QW2 A;  1J3T A;  1S72 T;  1AOJ A;  1K73 C;  3GIB A;  3QSU A;  1YFN A;  1SPK A;  2P4T A;  1MGQ A;  3IQL A;  2XDP A;  3INZ A;  3H6Z A;  1U5S A;  2WSE E;  2CP7 A;  1BU1 A;  1YIJ Q;  1IB8 A;  2J7I A;  1RAD B;  3VS2 A;  3CC4 A;  5CQY A;  1YJ9 A;  3CCV Q;  2FL7 A;  2L89 A;  2BZ8 A;  4EMK A;  4DEY A;  2LJ1 A;  1N8R C;  4MZT A;  2YHT A;  4LDV A;  4F14 A;  1YCS B;  4BB7 A;  2P0P A;  4XTZ A;  3J7A F;  1VYV A;  4A53 A;  4M77 G;  1YJN A;  3MET A;  3U23 A;  1RLQ C;  2L2P A;  3CME Q;  4C0Z A;  4M7A A;  3VRZ A;  3QWX X;  3H0I A;  2BTT A;  3HSB A;  4XK8 E;  4EDU A;  3JCM f;  1HXD A;  3DLL A;  2DXU A;  5CAI A;  4X1V A;  5FU6 B;  4R56 A;  1AZG B;  5D6Y A;  4BDZ A;  1XTD A;  1CSK A;  4X34 A;  1SEM A;  1M4Z A;  1AD5 A;  4LXC A;  4DA4 A;  4RTZ A;  3CCJ T;  3CCU A;  4Z88 A;  3EFO A;  1QCO A;  5FWC A;  5KE2 A;  2MAM A;  3CCM A;  2BZY A;  2LX9 A;  3EGX A;  5FRN A;  1WQ7 A;  2LX7 A;  3E9F A;  2E12 A;  2HSE B;  2HCK A;  1O75 A;  3CPF A;  2VXF A;  1D0Z A;  1D3B B;  2FPF A;  2L8D A;  2DBK A;  3G4S T;  4BI3 A;  4JPB W;  1PKS A;  1G5V A;  1BI0 A;  3MPU B;  1NYF A;  2X4J A;  2B8A A;  1UDL A;  1VQ6 Q;  1Q95 G;  2KAF A;  1WHM A;  2RPN A;  2F2X A;  2M16 A;  2YDL A;  3PGG A;  3UA7 A;  3LH0 A;  4E6R A;  1VQN Q;  2HD0 A;  1VOM A;  3X26 B;  2LT4 A;  4HT8 A;  2F2W A;  5IN1 A;  3OA6 A;  1YWO A;  4M78 F;  2CP5 A;  4AG2 C;  4DQ2 A;  1MUZ A;  1X6G A;  4C8Q A;  4XTU A;  1YI2 Q;  3C94 A;  1WIE A;  2O4X A;  4J7F A;  1WLP B;  2AHJ B;  3VYH B;  3OYN A;  5I2M A;  1PG5 B;  3I5S A;  4C0G A;  2BE7 D;  2AKL A;  5I21 A;  1SG5 A;  5DLO A;  1YJW A;  3M0Q A;  3URG A;  4LDY A;  3V7R A;  4PL6 A;  3GPL A;  5GAM d;  1GCQ A;  4BY6 C;  3CCQ T;  4RCB A;  3VV0 A;  1M2O A;  2EJ9 A;  2AK5 A;  2XG8 D;  3CBM A;  4IKF A;  2QQR A;  1G3T A;  2DL8 A;  4M4Z A;  3VRY A;  3RDV A;  1RL2 A;  3G71 A;  2E6N A;  4HA8 A;  2HKQ B;  1NYG A;  1JXM A;  1B34 A;  3I35 A;  3DKM A;  3QJ6 A;  1H8K A;  3V7S A;  4ANJ A;  2E10 A;  3CCE A;  1NLO C;  2GTO A;  3GNG A;  4LDX A;  4C0F A;  4E7S A;  3PT9 A;  4RUG A;  1LVK A;  2K6D A;  4PLL A;  3L2V A;  2LZ6 B;  2VGM A;  3QZ5 B;  5GAM j;  3VS1 A;  4OMQ A;  1OV3 A;  2EQM A;  2GQV A;  3H9N A;  1H3Z A;  3LGL A;  2K57 A;  1VQP Q;  5C0M A;  2LNV A;  2KRS A;  5L8R E;  1JB0 E;  1G2B A;  1IHV A;  1N27 A;  3WVE B;  3TSZ A;  2DE0 X;  3CBP A;  2L0A A;  2JTE A;  1BBZ A;  3L2U A;  1CKA A;  4IUP A;  2QG9 B;  2AZV A;  4MZM A;  1NPR A;  3RIR A;  2GQI A;  1D1C A;  2HSP A;  1WXT A;  2NWM A;  1U1S A;  2IPO B;  2MWO A;  5GMK i;  4RTT A;  4IUU A;  1M8M A;  1GBQ A;  1N9R A;  5DM7 R;  2EPD A;  2LC4 A;  3M56 A;  1W70 A;  2RO0 A;  3UF4 A;  1JO8 A;  1VQ8 Q;  4C92 C;  1Q82 U;  1IGU A;  4GY5 A;  5HKC A;  1VQL Q;  4PKC C;  2D9T A;  3OYC A;  2KE9 A;  2J05 A;  4BAC A;  4DEX A;  1UUE A;  2HQE A;  2CT3 A;  1Q82 R;  4E7K A;  1WPY A;  3CQT A;  5LJ5 j;  2KK4 A;  2P0Q A;  1ACM B;  2X9H A;  4EMK B;  4A54 A;  2EYZ A;  2FRY A;  2CZ7 B;  4FW2 A;  1Y0M A;  5GAN 4;  3QWY A;  1T3S A;  4ZN1 A;  4IUV A;  2CP0 A;  1KQS P;  4M75 C;  1S72 A;  1VQO Q;  1M3A A;  2C0T A;  5DLQ E;  3EH1 A;  1JRI A;  3JCM g;  2LQW A;  5IXB A;  4E7Z A;  1ZQ1 A;  1TH7 A;  1P92 A;  3EGD A;  2A7Y A;  2ZAE A;  5FRO A;  4A4F A;  1ZSZ C;  2OTJ Q;  5GAM e;  1NG2 A;  3M58 A;  1Q86 U;  3MEU A;  4E7L A;  2A0F B;  2CH4 A;  2QGF B;  1YN8 A;  1OEB A;  4M7D E;  2J6O A;  3VKI A;  2FHD A;  3RER A;  3A1P A;  4Y91 A;  2QQA A;  3EFO B;  2BUD A;  3LH5 A;  4OMO A;  3CCS Q;  4E7J A;  3CEY A;  1UGP B;  1VQ4 A;  1KHC A;  2RJD A;  3EGX B;  2EQJ A;  3WVD B;  3CC4 T;  2QA4 Q;  1TWB A;  4D8D A;  1KC8 U;  2RQV A;  1T0H A;  3FJP A;  4RKU E;  1RI0 A;  2CRE A;  3FIF A;  1M2V A;  2DTO A;  2XIC A;  2W0Z A;  2YLC A;  4C92 D;  3MKD A;  4XQ3 A;  4OVA A;  1YJN T;  3CCJ A;  4CC7 A;  4FCY A;  2RHI A;  1I8F A;  4F17 A;  1GFC A;  4II1 A;  4KBM B;  4C92 G;  1FMW A;  2CZ6 B;  2EBP A;  2QTX A;  2XKO C;  1QVG A;  4C8Q B;  1TUG B;  4PJO B;  1VUB A;  2OJ2 A;  1CKB A;  5LJ5 e;  2KNB B;  1BB9 A;  4M75 D;  2RI5 A;  2DLP A;  2GFA A;  3OSS C;  3OYA A;  2V26 A;  4F16 A;  2Y90 A;  3CCU T;  4ZTF A;  3SD4 A;  3HP9 A;  1M1F A;  5GAO l;  4M75 G;  4ZNX A;  2E64 A;  2HMA A;  4JLG A;  3PFS A;  2EQK A;  5L23 A;  3MO8 A;  1UHF A;  2YRV A;  4FYW B;  2L5Q A;  5CKE A;  4FL6 A;  1PNJ A;  3I56 Q;  1WA7 A;  1WZO A;  3QDF A;  1G8X A;  4LD6 A;  5AT1 B;  3LWH A;  3CXC A;  2MWP A;  1TU0 B;  2CKK A;  4NOY A;  4OP0 A;  4VUB A;  2MF2 A;  4C5G A;  1A0N B;  1K73 R;  2RI3 A;  4DOV A;  4M78 C;  1B34 B;  1HK9 A;  3DB4 A;  1FXX A;  1PD0 A;  4XTV A;  1YHQ T;  3A8O B;  2FZG B;  4N0A C;  5EC7 A;  3CCR A;  2F69 A;  3A8H B;  4V2S A;  1D3B A;  3CCQ A;  3OYL A;  1D1B A;  1SRM A;  4AFU C;  1H64 1;  4ELZ C;  1AWJ A;  5GAM f;  1PD1 A;  2MIO A;  2J06 A;  3CMA A;  2DF6 A;  3SEM A;  1YJW T;  1M30 A;  2O31 A;  1X69 A;  5GMK m;  1N8R R;  3MEV A;  2JJ9 A;  1WXU A;  1NLP C;  1FMV A;  3RUX A;  2RQW A;  1UGQ B;  2M51 A;  4NS5 A;  3OSV A;  2YUQ A;  2CUB A;  3G4S Q;  3CC2 T;  5KYW B;  3CD6 A;  1AT1 B;  3CBO A;  3NTH A;  2ZZD A;  1KIK A;  3NFC A;  3EG3 A;  3FB9 A;  1RAH B;  5HCK A;  3HL8 A;  4AT1 B;  3SFM A;  1Q86 C;  3SDZ A;  2DD5 A;  2LRQ A;  2BE9 B;  4L5G A;  2ROT A;  2PVO B;  1OU9 A;  5GAN 3;  3CCE T;  4J9G A;  4M7A E;  2HZY A;  4XAX B;  3EG9 A;  2J6F A;  4CI0 C;  5GAO p;  5KCO A;  3OYF A;  4ESR A;  2EGA A;  1LJO A;  4A4K A;  1WNL A;  3M4G A;  4B9W A;  1SRL A;  1KC8 C;  5KYY A;  4A4H A;  4EIK A;  3JV3 A;  4M78 D;  2HQX A;  4OF1 A;  2EYX A;  3RR6 A;  5FWB A;  4D8K A;  3PMI A;  4IUQ A;  1VA7 A;  5I22 A;  1R0B G;  4CC3 A;  4BD3 A;  1B07 A;  2NUP B;  2X51 A;  4F04 B;  4M78 G;  4TVR A;  2VB6 A;  1NE8 A;  2QTV A;  2FG0 A;  1OU8 A;  1RAC B;  4MZP A;  2KMT A;  3HRT A;  4ORZ A;  3A5Z B;  1I1J A;  5GAO m;  1I5O B;  8AT1 B;  2CH4 W;  3DB3 A;  4RTX A;  3HFN A;  1AEY A;  4JJD A;  1X01 A;  2K2V A;  4A4G A;  1AWO A;  3C4S A;  2QI2 A;  2JN0 A;  2DER A;  1ZUK A;  3RES A;  2EFI A;  2YSQ A;  1KJW A;  3QDR B;  2DXB A;  2O9S A;  1HSQ A;  2RK1 A;  2VXE A;  1VIE A;  2K3Y A;  4X9D A;  2RNA A;  4AFQ C;  4RTU A;  1OOT A;  1H3H A;  4L6V 5;  3PVQ A;  3BDL A;  1VQ9 A;  2EKH A;  3CCL T;  3LYI A;  4ME7 A;  3RNJ A;  1TTH B;  5D7U A;  1WI7 A;  1XNI A;  1KFZ A;  1QWF A;  1SHG A;  2D0Q B;  3MCA B;  4HT9 A;  2F5T X;  3PVL A;  3G1J A;  1SHF A;  1KQS S;  1EX4 A;  2NUT B;  2F5K A;  3QJY A;  2D0N A;  3M59 A;  3QII A;  5GAN h;  3G6E T;  2RM4 A;  5CKF A;  2WSF E;  4QVD A;  3A8L B;  3HHT B;  5CVI A;  2ZPH B;  1KSW A;  4J6Y A;  1AWW A;  3QXE B;  2LVM A;  5IHN A;  1V1C A; 
#chains in the Genus database with same CATH homology
 1PRL C;  2DL8 A;  4M4Z A;  3VRY A;  3NHN A;  1Z9Z A;  2KRN A;  2K7A A;  3GBQ A;  5FW9 A;  3FJ5 A;  1ZLM A;  1HJD A;  4GLM A;  1JXO A;  1NYG A;  1PWT A;  2X3X D;  1JXM A;  1JQQ A;  3I35 A;  2DVJ A;  4JJC A;  2RQT A;  1H8K A;  2L3Q A;  3EG2 A;  1W6X A;  2A08 A;  1NLO C;  2K3B A;  1ABO A;  2GTO A;  4OMM A;  3VS0 A;  2HDA A;  4Z89 A;  3NPF A;  4RUG A;  1GL5 A;  3EGU A;  2A37 A;  2BZX A;  2K6D A;  1Y57 A;  2LJ0 A;  2LZ6 B;  3VS1 A;  4OMQ A;  1OV3 A;  1SSH A;  1M3C A;  2KXD A;  5I11 A;  1RLP C;  1NEB A;  2MOX A;  1WFW A;  2JM9 A;  2KRS A;  2V1Q A;  2J6K A;  1G2B A;  1T3L A;  2ED0 A;  1M3B A;  2P4R A;  3TSZ A;  2K9G A;  2KT1 A;  2DE0 X;  4J9H A;  3VS4 A;  3M0P A;  1QKX A;  3VS3 A;  2L0A A;  2JTE A;  2HEQ A;  1BBZ A;  3M0R A;  1CKA A;  2AZV A;  3I5R A;  4KRT A;  2GQI A;  4HCK A;  1K1Z A;  2HSP A;  1WXT A;  2NWM A;  2JT4 A;  1UG1 A;  4RTT A;  1PHT A;  4GBQ A;  1UHC A;  2ESW A;  1M8M A;  1U06 A;  1GBQ A;  2JM8 A;  2EPD A;  4J9E A;  1ZSG A;  1E6H A;  1W70 A;  3UF4 A;  2D1X A;  1JO8 A;  4Z8A A;  2AZS A;  2SEM A;  2W10 A;  3VS7 A;  1GBR A;  1RUW A;  3EG0 A;  1X43 A;  2GGR A;  2EVR A;  1UE9 A;  2KE9 A;  3VS5 A;  2CSI A;  4J9F A;  2J05 A;  1Z9Q A;  4DEX A;  1UUE A;  2ABL A;  4OMN A;  2CT3 A;  3I9Q A;  2MCN A;  2RN8 A;  1X27 A;  3CQT A;  1RI9 A;  5IXF A;  1WDX A;  3O5Z A;  2JS0 A;  2FO0 A;  1LCK A;  2EYZ A;  2FRY A;  1Y0M A;  3QWY A;  1T3S A;  4FSS A;  4LNP A;  2C0T A;  1M3A A;  2KRM A;  1ZUY A;  1M27 C;  2L3S A;  1WX6 A;  4JJB A;  1QKW A;  2LQW A;  1AZE A;  5IXB A;  2O9V A;  2K79 A;  1JU5 C;  2ROL A;  3M0S A;  2DMO A;  2E5K A;  2FRW A;  2KR3 A;  2LMJ A;  1QWE A;  2X3W D;  1ARK A;  4CC4 B;  1NG2 A;  2RF0 A;  2DL3 A;  3C0C A;  2YUP A;  2CH4 A;  4LUE A;  2DL5 A;  1YN8 A;  1OEB A;  1NM7 A;  2J6O A;  2DX1 A;  4WCI A;  2EGE A;  2KT8 A;  3PE0 A;  4JZ4 A;  3R6N A;  3TSW A;  4AFZ C;  1MV3 A;  2G6F X;  3NGP A;  3LH5 A;  2KYM A;  4OMO A;  3UAT A;  3H41 A;  2VKN A;  1YNZ A;  2KBT A;  2QDL A;  1I0C A;  1UJ0 A;  4D8D A;  1N5Z A;  2CSQ A;  1ZUU A;  2L3P A;  1T0H A;  2RQV A;  1IO6 A;  1FYN A;  2EW3 A;  2F2V A;  3A98 A;  2LP5 A;  2CRE A;  4CC2 A;  1BK2 A;  4J9C A;  5IH2 A;  2W0Z A;  1H92 A;  2D8J A;  2GTJ A;  3NMZ C;  2FPE A;  2D8H A;  1UJY A;  4CC7 A;  4F17 A;  1GFC A;  1OPL A;  3EHR A;  2EBP A;  2DA9 A;  2KRO A;  3KFV A;  2KEA A;  3UA6 A;  2DBM A;  2M0Y A;  4LUD A;  4RTY A;  3REA B;  2PTK A;  4J9B A;  2OJ2 A;  1CKB A;  2YT6 A;  1VYU A;  3THK A;  2KNB B;  2ENM A;  1BB9 A;  1AWX A;  2DLP A;  4AFS C;  4F16 A;  2VVK A;  4RTV A;  1X6B A;  1K4U S;  1TUC A;  1B3Q A;  2KGT A;  1K76 A;  2DRM A;  4ZNX A;  1UFF A;  1EFN A;  2LQN A;  2DM1 A;  5L23 A;  2VWF A;  5IHI A;  1UHF A;  1GRI A;  3REB B;  2JXB A;  1PNJ A;  1E7O A;  1WA7 A;  1VYT A;  2GNC A;  1ZX6 A;  5GJW B;  3RBB B;  3ULR B;  1WXB A;  4OMP A;  2EYW A;  2A28 A;  3M0T A;  1WYX A;  1A0N B;  2SRC A;  1PKT A;  1UEC A;  1UTI A;  2HBW A;  5IHK A;  1HD3 A;  1TG0 A;  2FPD A;  5EC7 A;  4IIO A;  2KYB A;  1W1F A;  2JW4 A;  1YWP A;  1SRM A;  4AFU C;  2C0I A;  2YUN A;  1AWJ A;  2H8H A;  4JZ3 A;  1K0S A;  4OML A;  2MIO A;  1GCP A;  2J06 A;  1J3T A;  1AOJ A;  2ECZ A;  2DF6 A;  1SPK A;  3SEM A;  1JEG A;  1K9A A;  1M30 A;  2O31 A;  1X69 A;  3IQL A;  1I07 A;  5GJV B;  1PRM C;  2RQU A;  1WXU A;  1NLP C;  2RQW A;  1U5S A;  2M51 A;  1E6G A;  1BU1 A;  2YUQ A;  4AG1 C;  2J7I A;  2DYB A;  3VS2 A;  4K11 A;  3ZL7 C;  2O88 A;  2CUB A;  5ECA A;  2K2M A;  4RTW A;  3H0F A;  1ABQ A;  2XMF A;  2BZ8 A;  4DEY A;  1TUD A;  1KIK A;  3EG3 A;  1K0X A;  2LJ1 A;  5HCK A;  2DL4 A;  4F14 A;  1YCS B;  2V1R A;  1VYV A;  1ZBJ A;  3SHW A;  2ROT A;  3U23 A;  4QT7 A;  1RLQ C;  2L2P A;  4J9G A;  2A36 A;  3VRZ A;  2JS2 A;  2J6F A;  1GFD A;  4LE9 A;  3QWX X;  2PZ1 A;  2ED1 A;  3H0I A;  1OPK A;  2BTT A;  4LN2 A;  2OAW A;  2EYY A;  1UGV A;  1S1N A;  4ESR A;  2EGA A;  4X1V A;  1AZG B;  2RMO A;  1SRL A;  1CSK A;  1SEM A;  1AD5 A;  2DRK A;  4RTZ A;  4EIK A;  3JV3 A;  2C0O A;  2EYX A;  2CT4 A;  1X2K A;  4Z88 A;  2LJ3 A;  5FWB A;  3VS6 A;  4D8K A;  1VA7 A;  1NEG A;  5FWC A;  5I22 A;  2IIM A;  2NUZ A;  4CC3 A;  2KXC A;  2BZY A;  2LCS A;  3M0U A;  1B07 A;  2LX7 A;  4HXJ A;  2HCK A;  4J9I A;  2FPF A;  2FG0 A;  2I0N A;  1QLY A;  1AVZ C;  2DBK A;  4ORZ A;  4JPB W;  2CUD A;  1PKS A;  1X2Q A;  2O2O A;  1I1J A;  1NYF A;  2AKK A;  4HVV A;  1UDL A;  2CH4 W;  3EG1 A;  2DIL A;  4RTX A;  1AEY A;  4JJD A;  2RPN A;  2F2X A;  2YDL A;  3UA7 A;  4E6R A;  1AWO A;  1T0J A;  1ZUK A;  2F2W A;  2YSQ A;  1YWO A;  1KJW A;  2O9S A;  1HSQ A;  4AG2 C;  1MUZ A;  1X6G A;  1XOV A;  1QCF A;  4Y92 A;  1WIE A;  2RNA A;  4AFQ C;  4RTU A;  1OOT A;  1H3H A;  1WLP B;  2B86 A;  2CDT A;  3PVQ A;  1FMK A;  3H0H A;  3TVT A;  4IIM A;  4R0K A;  1G83 A;  2EKH A;  4J9D A;  2FEI A;  1GCQ C;  3I5S A;  2AKL A;  2GBQ A;  2DJQ A;  1MV0 B;  3RNJ A;  2EQI A;  2LNH B;  2DNU A;  1WI7 A;  2JMC A;  1KFZ A;  1QWF A;  1SHG A;  4A63 B;  2OI3 A;  3EHQ A;  4HVW A;  3M0Q A;  2PNI A;  2RQR A;  1U3O A;  3PVL A;  1SHF A;  1GCQ A;  2D0N A;  2DL7 A;  2YUO A;  1AWW A;  1KSW A;  1YP5 A;  2AK5 A;  4HVU A;  5IHN A;  2JMA A;  1V1C A;  2EGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...