1H8SA

Three-dimensional structure of anti-ampicillin single chain fv fragment complexed with the hapten.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
218
Chain Sequence
b'DIVLTQSHKFMSTSVGDRVSITCKASQDVGTAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQYSSYPLTFGAGTKLELKQVQLQEPGGELVRPGASVKLSCKASGYTFTSYWINWVKQRPGQGLEWIGNIYPSDSYTNYNQKFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARWGYWGQGTLVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUTANT AL2 6E7P9G
publication title Selection, Characterization and X-Ray Structure of Anti-Ampicillin Single-Chain Fv Fragments from Phage-Displayed Murine Antibody Libraries
pubmed doi rcsb
source organism Mus musculus
molecule tags Anti-ampicillin antibodies
total genus 55
structure length 218
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h8sA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h8sA02
2ZUTA 3N9GH 4FQHA 4JPIA 4HK3J 3PWJA 4K7PH 1QNZH 1KG0B 1IGCH 4P5TA 1VADA 2CRIA 3FFCA 1WGOA 5E8PA 4DKDC 5AG9A 3FQXA 2O26U 4Y5VC 3UEZA 2Z93B 1ITBB 2FEDC 1FDLL 3B6SA 3MA9H 1J0YA 1L4IA 4MQXD 1R5VA 3NFSL 1BOGA 1YA5A 1NGZB 3GBLA 4NN6B 1VHPA 2C3VB 4OQTL 4HULB 5HHOB 1T83A 4ODSH 1GGCL 4L8BB 3Q3GB 3QEQE 2COQA 2WBWB 2OX5A 2WBJA 1DBJL 2VQUA 4PB9H 3NMEA 5EIVA 5HVFB 2D31B 4AL8L 4KY1H 5FFLA 1NMBL 1DEEB 3EIFA 5FM5M 1MHPL 4Z7WF 5T3XL 4EI5C 4PJ7F 4YPGB 5EWIL 3TC9A 3B9KA 1LO4H 2CUMA 4JQIL 5E4IA 5HHVL 3MRFB 4S1QH 2FCBA 4O4YL 4BFGA 5J6HA 5T1LA 2DM7A 3NCEB 4MNQB 4K9EC 1BJMA 1XGQB 4WWID 1EFXD 3QUMB 4N90E 1X5YA 1LK3L 2YXMA 4C54A 3DI3B 2CRZA 1U95B 3L5JA 3PWVA 3TT1H 4D9RD 5FK9B 4HD9A 3VGHA 2A6DA 1YMME 3UAJD 1A64A 3DHJA 4JM4L 2BK8A 3MR9B 1IC1A 1YEGH 3SE4A 3QUZB 3T3PE 1U8JB 3ULVD 5E2JA 4F57H 4W6XB 5C0FB 5EOCJ 3CFIC 4WO4C 5DVOA 3INUH 1UVQA 3LAFA 2BVYA 3DPBA 3VA6A 2VC2L 2ICWB 2JELL 4PTUB 4PJIE 5FDWB 4A6YL 5FYLL 3GKZA 4KKLC 4D2NA 2R1YA 2YD6A 4OZHE 3GKWL 5AZEL 4ETQB 1FVCB 3HMXL 2NX5D 2XWBA 3QZWA 3MGOA 3WFDH 2WLZA 1RIUH 3KS0J 5C0DB 3B8YA 4NJ9H 4F7PB 2OTPA 3I6KA 1SEQL 3DROA 3F58H 3RJDA 3T3ME 1DFBL 4LSSL 4NQEB 2VDLL 4RGNE 2HRPH 1OQOA 4I2XE 1SJHB 3BDYL 4F33A 1UEYA 2FO1A 1F3JB 1TCRB 4Y19D 2CO6B 3VWKD 5LVEA 1HINH 2GUOB 5LCVH 1XGPA 1IBGH 1RJLB 4X4YA 5IEHA 1F6FB 4NQDE 4DQOH 1U93A 1HILB 3DETD 4KUCD 1C1EH 2CKNA 3G5YB 3IFNH 3TO4B 4HKJA 4WTXA 5ESVB 2MNUA 3SO3C 4OZFG 5I1EH 3T4YB 2DWEA 5GGVH 3RWIB 1U8IA 4P5TC 4D8PB 8FABB 1NGYA 5J12B 4ZXBB 5BZWA 3WIIL 3EJYC 5E99H 4H1LH 5CD3A 4YHYC 1LO5B 5C7XL 4RFOL 2Z8VC 4XCYB 1JYVA 4JO4L 3WIHH 1MFAH 5C08A 2BY3A 2WBKA 3JWNC 2SEBA 3MLXL 1ZKAA 2O5ZL 4TN9A 5E8OA 2DKUA 1JPFA 1T83C 3VXQB 1IRAY 1A3RH 1S9VB 4OLYL 3FONB 1NDGA 5TQ0H 4CDGC 3IXTA 1BQHA 4GRWH 4M43L 4QHMA 4YDLB 4UZGA 2BVOB 4FS0A 1KFAH 5GRZA 4JFFA 2BVQB 5CEYB 1K8DB 5H35A 3B9KC 4Y5XC 1MCRA 4TPRL 1NGQL 3OX8A 5TF1L 2F53A 3GSOB 3FB5B 3BUYA 5DLML 3LEVH 4QTIL 3G6JE 4JQVA 1QKZL 2IANE 4JFPB 4O2FA 2B4CH 4CAGA 2R0WL 3PWLA 3SDXA 3LKNB 1LMKA 4MJ6A 1G6RL 1RMFH 2H32A 1KXQE 2VDKH 4JZJC 1AGFA 3P77B 3SBWA 1J1OL 1JIBA 1NGPL 4PRDB 3RIFK 5HDOA 3ZT6A 1OTSC 3SE9L 1WBZA 4JHAL 4NKQB 5HYQA 4GH7B 3QO1B 1C5CH 4ODWA 4Q9RL 1VFBB 3DUHA 5HYSA 2FD6H 5FV2A 4K7FA 4P2QA 4HIEB 3P0YL 4Y89A 4J8RB 4CADA 3G04A 4PJ5D 3UYOD 2FHFA 3QUKB 1IAIM 1RPQA 1NFIB 1KENH 4Y7MA 1P2CA 2VERN 1HHJB 4RNRA 1G9ML 5CP3A 4DVBA 4ODTL 3UBXA 4PRID 4Z78B 1UB5A 2AGJH 2AJVH 2V2WA 2VZUA 1NEZB 2ATKB 3VH8B 4NBZB 1A6VH 3KPRA 1ZHLA 3TGXA 5F88B 1E6OL 5D71L 3VE0B 4M3JA 2EIZB 4XRCB 4DKEH 1F2QA 3TJHC 5IB2B 4QRRE 2EYSA 1RSFA 3G5ZB 3MLUH 4G8FB 5HHXH 1OD9A 2G2RB 4OF8A 1LK2A 5L6YH 3BN9C 2DMKA 1FLRL 3IJSB 4NJAH 1GIGL 4GKSA 1N5YL 3AY4A 4LEXH 3WYRA 1OAYL 2W65A 3GI9L 5DVMA 2Y4SA 3T0BA 2FECI 3NGBB 3WMSA 2PYEA 4KRPB 1IILE 3R06A 4DW2L 2EYRB 3SCMB 4UT9H 5HHMB 1QR1B 2VLJA 4I0PA 4IM8A 1N8ZA 3QIWA 5T3XD 3PGDA 5HVGB 5E8NB 1VFMA 3HI6H 4OCWL 1LO2L 4AY0A 1MPAL 2OR9L 2WWKO 2AKRB 3HCVA 3VXOA 3SCMC 5KSBA 3W5MA 1KBGL 4LSTH 3ARXA 1DANT 1RUMH 2YPVL 1L9MA 2OP4H 1JGDA 1T20B 4LU5L 2P5WE 3OAZH 5JOPD 3FT3B 4OSUH 2VLRD 2EDOA 2NYYD 2VIRB 3D3VA 5HY9B 1IGTB 1YJDL 4WTZA 5IWLC 1A7BA 4TUJA 4QT5B 4MS8D 1RUPL 2NY1D 1F4HA 4PJ9A 3VU2A 2E7MA 3BDXA 1LQSR 3IVKB 4JQVC 3QIBB 2W60A 4MNGB 4YXLH 5C07E 1B6UA 3MXVH 5D1ZD 2KL6A 2XRAL 4XNXH 4G80A 5DJ6A 3U83A 3SBWC 1U8KB 5I15L 2N7BA 4HH8A 5FYLD 3LB6C 5IMOA 5JPMA 4XPHL 2AP2A 2DB8A 3HAEH 1RZ7L 5C09A 3RPIA 3V6OA 3EGSB 1ZVHA 4LVHB 4UDUA 3ZSTA 1T0MB 2Z4QB 4NZRL 4LARL 4U1NB 1MHEA 2M2DA 1QYGL 4YZFE 2JE8A 3PQYE 3B9DA 5DC9B 3MYZA 1UZ6E 4ZFFB 3HLAA 1G0XA 4S1SL 5K59E 2AK4E 4HIJA 2VZSA 4YR6A 3K8KA 2XKNB 5LGHH 1V7MH 2AJYL 3BT2L 1HK6A 4E41E 3VWJA 4RQQB 5EC1B 3ULVH 4OZIB 2PW1A 5IFJA 4FQPA 5I8OL 2WNGA 4PGDB 4WW2B 1DQJA 4ENED 5LXGH 1OT1A 4LQ1A 1U6AH 3UO1L 4X7SL 5ICXA 4GQPH 1N2RB 1CGVA 2R2EB 1GAFL 5DJ8A 3W11D 3KLHD 3KYOB 1Z0NA 3BQUD 4X9HA 3FQRB 4KK9C 4WUUA 4PJ8B 4BSVA 3OR7A 2P5EB 1XF2B 3NH7L 4JO1L 4QRPD 5K9QG 1JGVL 1MCBA 3ARDD 4M4PA 1ZLUK 1S7WB 1KJ2B 3AY4C 3CMOL 1QPXA 3CK0L 2DYPA 4RDQG 3VI3F 2NNAB 2VO5A 5C0BE 4LHUD 4PG9B 4QHKI 4OAWB 2YD9A 4FRWA 1U8HB 3KXFA 3GSRA 1EAJA 3MLWH 3EYUL 4LASL 1JFQL 3E1F1 5KVDL 5DSCB 1QSZA 5H2BB 3LH2L 4JFDE 4DGVL 3MFGB 4M6OH 4H88L 3O2VH 4OLZL 4HCRH 5M95B 2VJXA 4I0PC 3UTZA 1WT5A 5I8EB 4MQSB 1TTUA 1AHWA 5E6ZA 2RCSL 2BC4A 1OSPH 3ULUL 1ZTXL 1R24B 1T4KB 5INDB 3FOMA 3WNPA 4HPOH 5JDJA 1KJMB 2XG4A 3C09C 3QG7L 4NRXA 2JB6A 4UT6L 2WZPD 5F7UA 4GS7B 3LEXA 4JPWL 3G08B 4AH2A 4WDIA 1T5WA 1VA9A 3LOWA 5BS0A 3X12A 1FNAA 4L8SA 4P2OA 4N90D 1C12A 1WQVT 4L4VD 4PBXA 2VQ1B 4ODUB 3DBXA 5EBMB 3HE7B 4PJ9C 3SDAB 1KB5A 3EFFB 2DQFB 3D39E 5CEXA 4WU5B 3VJ6A 1KCRH 3GK8L 3QI9B 1HNFA 2C3XA 5SWQB 1BX2A 1QLRB 3VXSA 4KKAD 3THMH 1CF8L 1IAII 2MTPA 4LL9A 3HC4L 2VH5H 4GXVL 1H0DB 3NABH 1ZWIB 1XGYH 2PTTA 5K9QI 2I5YH 3ES6B 5I74B 3PP4H 3MYJA 3QI9C 1QFPA 5C2BH 1Q0YH 1X4YA 4XP5L 2PYFA 1MNUH 5SV4A 4AIOA 3TWCL 1RUAL 3N50A 4PV9A 1CFBA 4POZD 4U2ZA 5C70A 4ZS7L 4JPVL 5F7EL 2XN9E 3OQ3B 1D6VH 4JFZH 4JR9H 1RZJL 2VAAB 3RTQB 3H9SE 3LV3A 3DXAB 3IAPA 4KUZL 4Z7VB 2F54E 3VRJA 4HGMA 4LSPH 3BRFA 2FJHB 1BF2A 3ARTA 4ZFOB 3RTQC 2NR6C 5JXAH 1IQWL 3W0WB 1KOAA 3LD8C 3S96B 3DVNA 5T5NG 1JZ8A 1XIWD 2NTFB 4IHOB 3BKCL 5HDBF 1J8HA 4I18B 5IG7B 3BDBA 3JTSA 3C8HA 3QISA 3SDYH 5IVXF 4OZFA 2QADD 3VG0L 3P73A 4C83A 4F8QA 1W0WB 1SYVB 1ADQH 2VLKB 5IMLB 4F2MB 2Z31C 4R8WH 4F9PA 3DNKA 4MVBC 2FX9L 4XWOD 1KCLA 1P1ZA 4L3EB 5CZKA 4FXGA 3O4LA 4LAQL 5DJAA 1A4KA 3UZVB 5BV7H 4F7MA 1MLCA 2BNQA 5ALBL 2ZSVA 4NO5B 2J8UA 4R4BB 4RIRA 4Y16A 2GJZA 1WBYA 3K3QA 5F44A 2GK2A 3ULUF 1Y18A 3RBGA 5IR1A 2EE6A 2X7LB 2YSSA 3R1GH 4G6JH 4NUGL 3V0AC 4ZUSA 3BVNA 5I1KL 1WT5C 5JORA 1OF2A 1ONQA 1AHWC 5D2LB 4ELMF 1J11A 5E8DH 3EOYG 3ARVA 3O6FB 3NFSH 5I1AB 1KIUA 1RHFA 4OQTH 4JGUA 4S11A 5DFVC 4YHNB 1GGCH 1P69B 3UJTL 1F4XL 3CZFA 3L3GA 4LVNB 1JNNH 1PX3A 1DBJH 1PYWB 4AL8H 1XF5B 2DQTH 1HDMB 1XGUB 4NC2B 4L8SC 4P2OC 5EZLB 5GRWA 1MHPH 3P9MA 1T3FA 4PB0L 5T3XH 1EEZB 2GSGA 4G9FE 4QOKA 3U7AA 3T09A 4LVNC 2B39A 1NCBL 2HJLA 5C0AD 5F7HA 5EC2B 1NCWH 2ADIB 3MUZ1 4PJHB 1WBXA 1UA6H 3LRSA 5BMFL 5HYJA 2QLVB 5E6ID 1EMTL 5F8QC 2WQ8A 2IC2A 4YDIL 4P5KA 2DQGL 2GW5A 3U6RA 3HZYA 4UU9A 3N1PC 4WGVB 2NY4D 2XFXA 2Y6SD 4PYHA 3SQOL 1ZOXA 3HRZB 3BE1L 2HN7B 1Q9KA 3U0TA 4R96B 1AI1L 5J56B 1CE6A 3MMEA 4ZTPL 5J1AA 3FRUA 1T80A 4R2GD 4WIQA 1U8OA 1HKLL 3O2DH 3KPOA 4HFUH 3CLEH 3PWPA 2X1PA 2VC2H 2JELH 1W72B 4LCYB 4X6DF 3RVUC 3CXDL 3MRNB 5FYLH 1PAMA 5AZEH 5JOEA 4XP6L 5MERB 1A6TA 4D9LH 3GNML 4OJFL 4K94L 4S0SD 1YYLH 3KPLA 4HX1A 5D5MA 4QRRD 2NXZB 4XNMA 4FTVE 3EZ8A 2MQ0A 4XBGB 3BP7A 4S10A 4DN3H 1SVCP 3GBML 1SEQH 3X3GH 1DFBH 1FAIH 2NXYD 3FO2B 7CGTA 3TESA 4XPAH 5B8CB 4X6CB 2QQQA 5K93A 4KQ3L 3BDYH 4XNUL 4F3FB 2YD1A 3NCMA 4G8GD 2ICEB 2CLVB 4NNYA 1JGUL 3DMMB 1T66D 5TDNB 1IEBB 4L4TB 3HUJB 5E95B 4QRSB 1LP9E 5K9KA 5CILL 4WFFE 1KIQA 1Z5LA 1WTLA 3PDOB 4Y16C 5KVGL 3ULUD 4LPCA 3MRPB 1IKFL 4CJ1A 5JXEA 3BZEB 3WIIH 2LE9A 3VFRB 3TNNA 1BLNB 5IHZA 4M93C 2EC9T 4JO4H 5ITFB 1R3JB 4LIQE 1KLUB 3EUUA 5I1JL 4R0LA 4ODHH 3BH8B 3BKJL 4GRLB 1XR8B 1I3GH 4JGMA 1BM3L 4O00A 3BYTA 1X6LA 4GAFB 4OLYH 5L2KB 5SX4H 1MWAH 4JRYD 1KXTB 4PBWD 4CUCA 1MJ7H 1PG7L 3BUTA 4UINH 5C07D 1W8OA 4JY4A 2R4SH 5ACZB 1NCTA 4X6EA 1NGQH 4ZNEE 3P0GB 5BJTA 3QDGE 3GIZL 4PJGB 3SGEI 4NFCA 4QTIH 3MPCA 1QKZH 1Q9LB 1JNLL 5E24E 4A2LA 2R0WH 1WZMA 1A7NL 1WF5A 3A6BH 3DRTA 1G6RH 4U0RB 1JZ6A 2X4PB 3N85L 5GGSY 3PQYD 2H26A 3DUSB 4OF0A 5TE4H 1A7OL 3T0EE 3Q5OA 5D1QA 5DURB 5DD5L 5IK3B 5DWUL 3RZCB 3SE9H 5KS9A 2ZCHL 4JHAH 3P2TA 1JK8B 5D1XA 4FOMA 2CH8A 3V5KA 3GO1L 2CLRB 4HDIB 3SKOA 5DTFB 1XFPA 1GGIH 3ZMRA 4M6NH 2A0LD 1U8PA 3P30L 5LQBL 4PY7B 1SM3L 3WJJA 4NQCA 2HYMA 1S7XB 5KAQF 1QBLL 4YDVB 4UUJB 5ISZD 3SDDB 1J10A 1S5IL 3EO0B 4JM2A 4HJ0D 3RDTD 3SKJL 2BNRD 3GMMB 3O3BA 1E6OH 2EDQA 5D71H 4HUXA 2GTWB 1F13A 2APTA 1QG3A 3GIVB 2YPLA 5C0CE 1T22B 2VZTA 1A1NB 1F6LL 1U3JA 4D9QE 3NACL 4IDJL 3WN5B 1U58B 4QXTA 1NC2D 3DV4B 4LGPB 2ZOLB 3I3EA 4P9ML 2A83A 4PJCB 5F9AC 2A6IA 2HT2D 1N5YH 3ECBA 4H26B 5EU3A 3NIGF 4LHJB 1T1ZB 3MRBA 4PTTB 3ARUA 3X14B 5JXEC 1I1YA 1T89A 1XCQA 3VRIA 1G0DA 2CKBH 2UWEA 3HZKB 4Y1AE 4U1HA 1KCSL 5A40E 3WHE0 3BP6B 3PV6B 3UTTE 3TBYA 3S36X 3QCVH 2HLAA 4R0LC 4J3SA 2AJXL 2HFEB 2LU7A 4GSDL 4RBPH 1JJUA 5BW7A 3CSYA 3S37L 1KJVA 4TRPL 3OF6D 2F19L 2XZCL 5D6CA 4OCWH 2Q3AA 1LO2H 3RWGB 4LIQL 2C1PB 2FO4B 5ABDE 5BOPA 4HUVA 1KBGH 3M1BB 4L5FL 2W59A 1IL1A 3HS0B 4OLUH 4MD4B 1E4XI 1JGLL 2E27H 3KHQA 5I71C 3TZVB 1YUHB 3PF2A 3HAEG 4H0IA 4LU5H 4BA8A 3FFDB 4QTHA 2DI9A 3QIUD 2W9EL 4ZAKD 4EN3A 3MCKB 3RX8A 5INCB 4PR5A 4IRJD 1WWBX 2PR4H 4Q7DA 1RUPH 5ILTH 1OGAB 4MDIB 5HDQH 2WUCL 4RFNB 1QBAA 4P46B 1SVZA 3NIDE 4F8TA 3ELAT 4P2RD 3WLWC 5I19H 4PJAB 2CQVA 5ANMB 2XRAH 4DN4L 1RHHB 4EKXA 4OM1L 5D1QC 5I15H 4PP2B 1UZ8B 4WJ5A 5FO9B 4TTDD 4XPHH 1EEYB 1I7UA 1MFBL 3H9SD 3SKNB 2R23B 2GJ6E 2JCCA 4G5ZL 1K85A 4XX1E 3LS5H 5D1XC 3MJGX 1U91B 1QYGH 5DJ2B 1QLFA 1H15A 1EV2E 2K7QA 5GGVY 5J57B 1CGTA 4LOUD 4Y0GA 5GRVK 4ALAL 2YBRB 1EHAA 4Y2DB 3V7AG 3WJJC 4XPFH 2YK1L 2AJYH 1A7PL 4I3SL 4NZJA 3EYQC 2X1QA 1F4YL 4OD2B 4JM2C 5CP7B 5KOMC 4J23A 1WUNT 3QUXD 4NNXB 1OQXA 1TVBB 4GKZA 2P7TB 5C0IB 3GSWA 3UO1H 4Z9KB 3HHRB 4X7SH 2O61A 1XF4B 3F8UB 5EORL 4BQCA 2NPLX 3GMPB 1Y0LA 4HS8L 1GAFH 3ZYJA 3UTPE 1S9WB 4IMLB 5I73B 2XPGB 1NFDB 1SJEB 4UIMA 3ARQA 3NH7H 4JO1H 5JO5A 4V2BA 3G9AB 4ORGB 3SJVD 5HHOE 4BZ2L 4LCUB 4Z7UF 1MCWM 1KCVH 1A7QL 3MRKA 4PUBL 3D6GA 2OXGA 5JR1H 4YPGA 4TVSa 4LASH 4AMKL 4N0YH 3KR3H 5KVDH 3P4NA 3CGTA 2AK1L 3MRFA 2YC1B 2XY2A 3LH2H 3P4OA 2OTUB 1QR4A 3MRDA 5EU6A 3TNMB 4DGVH 3MRIB 4H88H 4MXQD 1JI1A 2NY0B 4N0FA 4MNQA 4UDTA 2RCSH 4G8IB 1PY9A 5BW7C 5I17B 4AENA 1JRHH 4CMMB 5MEOB 2MKLC 3HA0A 5SWSB 3ULUH 5FK9A 1ZTXH 2E9BA 4G9FD 4CMHC 1DP0A 1NBVL 2VR4A 4QHUB 1DJSA 4XMPL 4FQQB 5EBGA 5C0FA 5KG9B 3SHSA 5J9PB 1CE1L 1LE9A 1SJXA 5D7SL 4M6ML 4EN3C 3RHWK 5M7QA 5GGSB 4OF6A 5IKCA 4PP1D 1U8MA 4MCYB 4PTUA 1CG9B 5LWYH 2D0GA 1AQKL 4K8RL 5FUCC 4NOBA 1TZHA 1QVOA 1A6AA 4JKPH 3LN4B 1MQKL 2DM2A 4JHWH 5IMMA 2PXYB 1QRNB 4IOIA 1BD2A 3QHFH 1VSCA 4JFXB 2EDLA 2X4NA 2R1WA 2ESVD 1MRCH 3HC4H 4GXVH 4RAUA 4F7PA 3MRRB 3X11B 3V52L 3SDCD 3WXVL 1CK0L 4HXBH 4N9GB 1TPXC 3C60B 4XHJC 4ZUVA 2JJUA 4XBPB 3TWCH 4YXKH 2DJUA 1T04A 4NQEE 4ZS7H 4JPVH 4XVTL 1JMXA 1RK1B 2NY6C 2ICES 1RZJH 4XXDB 4ONOA 3M17A 3ZTNL 2PETA 3MGTB 4KUZH 4YWGH 3VGEA 2ID5A 3DARA 4MMZC 4CVZA 2B20A 1OTUD 3F5WB 3FO0H 2VXSL 4FQJL 4NN7B 2A2QT 3U46A 1IQWH 1E28B 4ZD3L 3STBA 1MVUA 4AIZA 1A2YB 1IGJB 4Z7QF 1IAKB 4KHXL 4QCIB 4GW1B 1CXFA 5DEZA 1JTOA 3BKCH 4J12A 1OWRM 3EJZD 5L9DL 2OTWB 5MI0C 3VG0H 3QA3B 1A7RL 4GRMA 5E03A 4LSRH 4BK4A 1NBZA 4N1CA 2FX9H 4RISL 1MCEA 5E00B 3MJ9A 5DHVH 4JDVB 1HQ4B 4WFHE 4RMTA 5ALBH 3C5ZD 4MQ7A 1FIEA 3MJ7B 2ZZUT 3WKNA 4YEFA 1CGSL 4PV8B 3O4OB 4ZFGL 3HR5B 2O5YH 1LEKA 4R9HA 5I1KH 5JIHA 2Y06L 1UJ3A 2ITDB 4LEOA 5FUOL 5HVWA 4K9EL 1XGRB 4BUGA 2VXQH 4M1GH 1NGXB 3GMRA 3GJFK 1D5BB 1IC5L 5CGMA 5F6IB 4KDWA 4EVNB 1K6QL 2FBOJ 5ESAB 4Q6YA 3ULSA 3ROLB 1U8NB 1FYTD 3DRQA 3QUML 3DHMA 3K8MA 1CICA 1KTLB 4YHMH 1NUFA 5I76B 3DO7B 2VSDA 4JRXD 4PB0H 1AP2B 1C08B 5CINL 5CGYD 5DQDH 1I8KA 1PKQA 2BSSA 5IFHL 3BAEL 2V2TB 2ADJA 4WV1A 3EYOB 2R8SL 5DYOA 5FYKE 2VNCA 1JHLL 3DIFB 3KLAB 1GOGA 3NFPA 4XWGL 3NZ8A 1J0JA 1MCCA 1NEZA 15C8L 1T1XA 1IEHA 4NCC1 4YDIH 5LGJB 4PJXF 3LQZB 2ZSWA 4KI5C 2DQGH 3VXMB 5F88A 2MOVA 3OGCA 3KPNB 4H1LB 5F9JB 2ITCA 1FNSL 5DHYA 3QG6B 2EDHA 5B4MC 5DMKB 3BP4A 1EEUA 2BRRL 3L7EB 3BE1H 1AI1H 3VMPA 3DX9B 5IQ9B 1CL7L 5ICYA 2BVUA 4LLMB 3QNYB 1LDPL 2VDPH 3L3JB 2ORBH 3EYVB 4UT7L 4MWFB 4PRPA 1DQDL 3QEUA 2FYYA 3OKEB 2ZCLH 3K46A 1CLZL 2BY0A 3IETB 4GRWB 4JAMA 1PY4A 4MXWL 1D9KB 1UKQA 4ZFZA 1UKSA 4PJEB 4UTBL 4NM8H 4Q58C 2Y5TB 1JWUA 2KBGA 3KHOA 5DXWA 4D9QD 3IFOB 1NDMA 3GM0A 1MCWW 1RIVH 1Z9OA 2FJGB 2W0KA 4MZ2A 3GBMH 5E94A 5JW3L 4U1LA 4GG6F 1H3XA 3F62A 5I18H 3MLTB 3IDJA 5JHDA 1S8DA 4KQ3H 4XNUH 3F6LA 4UOW1 1NCNA 5DEGA 1DE4B 3BHBA 5HHME 3MBXL 5GJTL 3QEGL 3QWQB 5CZXC 3VFSA 5GRYA 4LHUG 3L9RA 2AKRA 3L3DB 4XVUD 1MJJB 4Z5RB 1JWSB 2A6KA 5TDOA 3I50L 3UX9B 3BPCB 4FQXA 3QXVA 4CNIB 4ISVA 1RZIA 2P8MA 3CVHH 5CILH 3SN6N 3ZKMD 2MCPL 1SBSH 5CUSL 5IB5A 1OTTC 5AD0B 2NY3D 5KVGH 1FL6B 4GQ9H 5IROA 5FB8B 3ZE0F 1IKFH 3Q6FB 2APWA 4NZUL 3TVMA 4I13B 3QRFM 4PJBB 4JY6A 4URTB 5TH2B 3P4LA 3B3IB 1UJ3C 4U31A 4G42B 3RL2B 3T08A 2ZWLT 5ICZB 3FTGA 1DDHA 1C16B 1V8HA 4YIQB 4MNGE 1L0XA 3VXRB 4LVEA 1X7QB 3HZMB 3JVGA 4D0BA 5TQ2H 3OKLB 5C0JA 2NW3A 4NQTA 4LLDB 1FO0A 4R4FH 1FLTX 2R0LL 5TE6L 1CICC 5HHQA 5J11B 4DEPC 5MHSD 4LP5A 5J3HD 5DUBB 2V2XA 1P7KA 1PG7H 5ADPL 2D7TH 2YUZA 4U1NA 5EBLB 1ZLVK 3LSOB 4YDKH 1S7UB 2JF1A 1JF1A 4OFDA 4D0CB 4MDJB 4JLRA 4WV1C 5J11C 2A73A 5DGRA 1PBYA 4YHPA 3CPLB 3NIFF 2AERT 1MCLA 2HKHL 5J7CC 1CDYA 1Y6NR 3KDMB 1WIPA 1JNLH 2HRLA 4MZ3A 5EC1A 1QFWM 3VFUB 5C0GA 5E1AB 3BP5B 4OUUB 3KYNA 5FYKL 1KTRL 4OCLC 1HYSD 3N85H 4OZIE 3MRLA 1A7OH 4HUUA 4PJFF 3ARBB 1GZPA 2BDNL 5DWUH 5I6XC 3IKCA 2ZCHH 5HSFA 4P23B 1I7TB 1FJ1B 3RUGB 1T7YA 2M8XA 4J3XA 2ZUSA 4Q2ZA 4DK3A 2VN4A 3W39B 2DQDH 3ARBC 3PXJA 5GGRY 3L3IA 1QLEL 3FB7B 3L95A 2DIAA 5ID0B 3PDGA 4ONGL 3MV8D 4OB5H 2P5EE 3I3DA 1I7RB 5EZJA 1SM3H 3HPLB 2X4TB 4L9LA 1FVDB 2DTSA 2G9HA 3GM8A 4NWUL 1KIPB 3CDGA 1S5IH 3MCG1 1CLOL 1QUNA 4U3HA 5I2IA 4N8VG 4XCFL 3VXUA 4H25B 4UOJA 2BSRA 4GUPA 4PRAA 4F7CA 3SY0B 3OR6B 3RWFB 5EUOB 4EI5D 4KMTL 1VPOH 3QDJD 3NACH 4IDJH 3MO1B 1AXSB 4Z0XB 1OAKH 1PFCA 1ZT4B 1HN1A 3QB7C 1F4AA 3TBWA 2ZCKL 4P9MH 1ODAA 3VDAA 1LO0L 1U2CA 3UZQA 2EDKA 3HAEB 2G60H 3G6DH 5IROC 1UB6A 3BX7C 3OWEA 1EFXB 1AIFA 3LKOB 5EBMA 5FUZL 4XVJH 3QDMD 1KCSH 4IDLA 1FHGA 3L6FB 1ULVA 4WU5A 4R97B 1F97A 1LDSA 2BNUA 1V7NL 2BFVH 2X4QA 4E0RB 1QSFA 4HW6A 2UYLA 2OMBA 4WO4D 2AJXH 3ZE2F 3N1FC 5F9OL 1MHHB 4GSDH 3RWEA 1PLGH 1QACA 3JVGC 5GS0L 4B7LA 4TRPH 2F19H 2C4FT 2JIXA 1NL0L 1REIA 1B0GA 4WHTB 3UAJC 3QFJA 3MV9A 3QRGL 3GZKA 1ZA3B 2DLIA 4KKLD 4L5FH 3JWDL 1MOEA 1JGLH 4KV5F 1EUTA 3DYOA 3U9PL 1EO5A 3K4ZA 2W9EH 2NX5B 2R2CA 1MRFL 4WY7H 1P5VA 1NMCB 3ROOA 2GKIA 2VTFA 1JUFA 1IM9A 1DBAL 1VFAB 1BQLL 3S34L 1OCWH 4Z7VE 5DJDB 3TBTA 2YHGA 4NKMB 2E3VA 4PREB 4X80L 2Y9RT 1KT2B 4DN4H 5B38G 3SKUD 4Y19B 1OAXL 4OM1H 4P4RB 3MV7D 3W0WE 3CFJA 1L7IH 2I26N 2DQCH 4G6AC 4G5ZH 4PGBB 4O2CB 3DO3A 3KPSA 4P5TD 4JDZB 2R9HC 3FFCD 2RAMA 1HSAA 4XNQB 4MA7L 3CCHB 3EJYD 4UAOC 2VLKE 4MNHA 4Z0BH 3MROB 1UACL 4L8DB 1N4XL 1NKOA 1OGTB 2E6QA 1T7WA 4ALAH 4LKXB 5JOFB 5MP6L 1IFHL 2ERJB 4TVPE 4HS6A 2YK1H 3MUGA 1J9CT 1A7PH 4I3SH 3L3KA 1CVRA 4Z7NE 4NO5A 1CYGA 5JUEH 4LCCB 2V17H 4X6FA 1QSVA 1ZV5A 1T5XA 3HI1A 4G3YL 2WBJD 4UILH 1ZS8B 1WCBB 2AJUL 2YD2A 4U1GB 5EORH 3O9WA 3ZDZF 1P9MA 1MRDL 3BGMB 3U30B 1OM3L 3QXWA 1JZ7A 3WFBH 4Z7WB 3O6FA 5D2LE 4OZ4A 3B9KD 1N7MH 4PJ7B 5FM5O 4HXAH 3WS3A 4BH7A 3TPUA 2QQLL 4JZNB 5CJ8A 5T1LD 1VFOA 2YUXA 1I1FA 1AGEB 2R2HA 4KDVA 4BZ2H 3QWRA 1HKFA 2MHAA 2DD8L 1YC7A 1S7TB 1U8QA 1A7QH 2F8VA 3RY4A 2AXHA 3GMLB 3I85A 3SDXF 3RIAF 3RX5A 2HJKB 1T21B 1INDH 3RU8L 2EE9A 3V7MA 5IVOA 4AMKH 7FABL 1F02I 1U8LB 2AK1H 1OTSD 3IU3A 3CU1A 1UWGH 1A4JB 3WSQL 4PJHE 4FQCL 4WENB 4U2YA 4XH2A 3O2DA 3LKPA 2D03L 2V7NA 3NPSB 4QWWC 5EH1A 3OAYK 2B1HH 5TGBA 5BOZG 4GAYB 5KOVC 4K3HA 4YFLF 2AXFA 1NBVH 4NYLB 2A9ML 1GOHA 5KSVA 4LKCB 4P2CG 4PJ5B 1A14L 1WWAX 4DCQA 1CE1H 2KPNA 3PL6A 5D7SH 3DI2B 4M6MH 2LTQC 5E5MA 4BFEA 1JZ2A 3ALWA 1KEGL 4PRIB 4JANB 1AQKH 3V5DA 4I1NB 1P6FA 3OHXA 4HMEA 1FH5H 1MQKH 3K4AA 2FZ3B 4XI5C 5BV7B 4HGWA 3TJHD 1J8HE 3H0TA 1L0YA 5GGRB 4MXVE 2LAGB 1S78C 4YH6A 1JRHI 4OD1L 1HHHA 2GY7B 3BN9D 1HHGB 4PGCB 5DQJB 3IJYB 1CU4L 3QEHB 3X13A 3WXVH 4IIQB 1CK0H 2R4RH 2QQNL 1FN4A 1RUKH 1G7HB 3LPWA 3LKSA 4JREC 2ZUYA 4XVTH 2BERA 4Y5YA 5JLZB 4X6CE 2RGSA 4IIQC 4DKFL 2EH8H 1FZMA 4NIKB 1BZ9B 5C08D 3WFEH 3BZ4A 1IEBA 2QHRH 2RFXB 5IP4A 1D5ZB 1YNTB 3DGGB 3EDDA 4X7CC 3UP1A 2VXSH 4FQJH 2X4OB 4L4TE 5F97E 3HUJE 4X5WA 4TVPL 2O93L 1DQML 1K4CA 4ZD3H 5FA3B 1PQZB 1U92A 3SCMD 5L7XH 3BZEA 2I9TA 1VEOA 2VMFA 3S36L 4CVXA 1BLNA 5KSBF 1RZ8A 1SY6A 3BPOC 5L9DH 3O9WC 4YFDB 3TIDB 5E8EB 43CAA 4JFFD 1UADC 5TPWH 1D5MB 4BELD 1QSEA 3ZL4L 4I48A 2F53D 4X8JB 5DD0L 3U0WL 3S3JA 1OP5H 2VLRB 4G9DB 4H8WC 4OKVA 2OJZL 5HHNA 2VL4A 4LBEA 5L8JB 4H20L 1SYSA 3TA3A 1M71A 1JZ3A 2NY1B 4FFZH 5L2KE 2V9QA 5GGQH 4XCEA 1FFNA 1DN0A 3HMWH 5CGTA 1V3MA 3T4AB 5B39G 2IEPA 1L9NA 1CGSH 5D1ZB 4TNVK 1FL3B 1B0WA 3I9GL 3FOLA 3LB6D 5DJ0B 4C56B 1UM4H 2FATH 5CSBA 1DL7L 5DMGC 1CT8A 2Z92B 3E0GA 3T04D 1IMHC 4I0KA 2Y06H 4YZFF 5TF0A 3GSVB 5I8CB 1UXWB 1S7RB 4K9EH 5FOBA 1Q9OB 2DQIL 3A6CH 4P2QD 4PJGE 2J6EL 2H6PA 3DVGA 4TTGA 2D9QB 1BVLB 3VGAB 1IC5H 1HH6B 4YDJA 2XZAL 3AROA 2W0FB 2HJFB 2BP3A 1TVHA 2F58H 1FFPB 3PL6C 4CRPA 4EDXB 3J7HA 3QULB 3KPRD 4Q74A 4BFBD 5I1DA 3R0NA 4WU7A 2L7JA 4DZBB 4U1MB 2CDEB 5BVJB 5DJZA 1JCKA 3TYFB 2GCYB 2WK2A 2NY5H 3RI5K 3VFNB 5BCAA 4R7DA 4WFED 4HK3N 4XWGH 4KK9D 1IM3A 2WLYA 3TBVA 1W72L 4ZUTA 1MUJA 3BQUB 1ZGLM 2WIIA 1YEEL 3CJJA 3RL1A 4P48A 4QRPB 2BRRH 3ARDB 4XCCL 5KAQG 1A1NA 2W92A 4Y5YC 1RZFL 2ED9A 3PHQB 5DD3L 5D96B 4LHUB 5HHPB 2V5TA 3QHZL 1LDPH 3PG2A 2CLZA 2VKWA 3OKNB 5DD1L 1Q38A 1DQDH 1MWAB 2VLJD 4I0PD 5D7LA 3L3HA 3QIWD 1CLZH 4JRWA 2H2SC 4M02A 2DN7A 1QPPA 4ZPVB 1AXTL 4PJCE 3H7LA 5HPOA 3F7VA 3L5XH 4UTBH 2H2PC 2F5BL 4XZUB 4XPBL 1HHIA 5IBTL 3PIQB 1X5GA 4JY5L 4LLWA 4DZ8B 5JW3H 2WWMC 4JFQB 3W82A 2VN7A 3O6LH 4OCSL 1CFSB 5AUMB 5E9DA 3D3VD 4NC1C 4QHLB 3U4BL 1FRGH 1OSZB 4KQ4L 2Z35B 1G6RB 1U41A 3MBXH 1FZJA 3CFDB 4AEEA 4O5LL 3LS4L 4PJ9D 4ZTOL 5SWZA 5ENWB 3KGRA 4L4VB 3I50H 5IT2H 2Y7QA 3TA3C 1NCCL 1D5XA 3EDEA 3QFDB 2FECL 2MCPH 1KGCE 3PABA 3L5IA 2GSIA 5DMIH 4YC2B 1N0XH 3DX7B 2GQHA 2PW2B 4CU8A 3MNVB 3BZFB 2G5RA 3QI9D 5C09D 1WAAE 1G7JB 5I30L 4KPHL 3BEWB 2NY2C 1HOCA 5DEFB 1DUZB 3JWOC 2VR5A 5ANMA 3C2AH 4XP9H 1EHLL 1F3RB 4AT6B 1AO7A 2Q86B 4PJAE 4ZO7A 2GT9A 1D6EB 3ZHLA 1OARL 1QQDB 1TENA 1E4WL 2R0LH 5TE6H 3S6CA 3UC0L 1INQA 4ZS6C 5ADPH 3RTQD 5A2IH 4J1UA 2NR6D 1HSBB 3BPNB 3STLA 3T2NH 2ZJSL 5AAWA 1KPVB 3QQ9C 1UQSB 4YHOL 5IW6B 5EBWB 3CNKA 1WZKA 3FT4B 3DX8A 4O51B 3HNVH 1XIWB 5HPMB 1N6UA 2HKHH 3J8F7 2X4SB 4WUUD 4EQ2A 4OD3L 2QADB 2B7DT 2Z31D 1UCBL 4QRUB 4MVBD 4X5XA 4XAWL 2CKBB 2YPLE 4N8VB 1MY7A 2FGWL 2DYPD 2HH0L 3ARWA 2FDBP 1LO3L 2HMIC 2YN5A 1UC6A 4N0UA 4MD5B 2NQCA 3KXFD 4KC3B 4TVPD 3BEVB 5LKNA 2E8ZA 4XB8A 5IB1B 1UENA 1X3DA 2J8UF 2X1WL 3D2UA 5AYQA 2L7UA 1YYMH 2NMSA 3NCBB 3BH9A 3MREA 1NFDE 4XP4L 4EUPA 4PRNB 1YQVL 3EYSL 4ONGH 1RJYA 2DAVA 1EGJL 4H5SA 1AC0A 2P44B 3VFPA 4JZOB 1I1AB 2NZ9C 4IJ3B 2FL5B 2J12B 3KPPB 3CLFL 2R0ZL 4HUNB 2X6MA 5T5FL 5T1KA 5L2JB 5DFVD 1CLOH 3DOSA 3GMQB 1I1AC 4BFIB 5GSVB 2YUWA 2B8OT 1IARB 4LQFL 3LRHA 4Z77B 5BS0D 3RVXC 4OTXL 4P2OD 5E2WL 4CMMA 2ZKHL 3WDHA 3NVQA 4KRMB 2Q6WA 1T6WA 5JA8B 1N5AA 3LKRA 1J5OH 1ZT7B 3LCYA 5SWSE 2ZCKH 2C4FU 5HGBA 2FX7L 1JHTB 3VXSD 4B41A 4BSWB 5EO9A 1RIHL 3GSQB 5C0AB 1S5HA 5CSZB 1I4FB 3X3FL 3T65A 3TCLB 3TFKC 4KRLB 3OKMA 1P4LB 4UMGA 5E6IB 4BQ9A 1IC7L 5EZOH 2IQ9L 4GLRH 4LSDA 3WNMA 3PJSA 3IJHB 3OB0H 3LN4A 4U0QB 1A6ZA 4G6ML 5IF0B 1R5IB 3F7YB 2NY4B 4TUOA 3EKCA 4CVUA 2EEDA 3O45A 2DLEA 5F9OH 2BZDA 5B38B 3T8XB 2H32H 1QRNE 4DGIL 4R2GB 1ZT1B 5AEAA 4DGYL 1CD1A 4MD0A 4F15C 3RVUD 1FZKB 1WICA 1OW0C 1S7SA 3IGAB 3C6LA 1EX0A 1KTDB 3C60A 4QRTB 4XB7A 2QBWA 4EZMA 1OB1A 2VL5A 4R2GC 3W9DB 1TXKA 3BMVA 4NN5C 3RNQA 5IIEA 3TH3T 1I3RB 4LF3A 5FXCH 3OKOB 1J8HD 4YGVA 4J3OC 4KTEH 5D5MF 2P8PB 2AQ2A 3MJ8B 2VZOA 4JO2H 5IVXB 3EO1B 4OGXL 1EAPB 1YPZA 4G7VL 1J1PL 4QRRB 5JPNB 1J05A 1CLCA 3EAKA 1DBAH 1IAIL 3HFMH 3I6GB 4ZQKA 1BQLH 2F74B 2A38A 4WI7A 5CP3H 1S9YA 3EOAA 4XCNA 1E28A 2AJSH 2O5XH 3LEYL 3O4LD 1OAXH 4G8GB 2F8OA 4NKOB 2A1WL 2BNQD 2IF7A 2XA8H 4Y16D 5DK0B 3PGCA 5E08L 1UEMA 1I8MA 2BSTA 2IG2L 4ZYKB 4MA7H 1SQ2N 1BMGA 1CFTB 1UACH 1N4XH 1HYRC 3QXAB 4OFYA 4UTAH 5FF6A 2FIKA 2VE6B 5MP6H 3STZB 1AGDB 2ZP0T 4ELMB 1BVKA 1IGYA 1CTOA 1KEMH 4MA8L 5D2NB 5DR5L 3V0VB 2XTJD 3VW3H 1HI6B 2Q3ZA 4N1HB 5EU6E 4WFGE 1MAKA 1BPVA 4J6RL 4PV8A 1SMOA 4G3YH 4L8CA 3UTSA 2J5LB 3GSNA 3I02B 5KVFH 4HLZH 5ACMA 2OL3L 4NKDA 2C3GA 5IW1B 2FR4B 1YMHB 4JRYB 4RMSA 1IGML 2E9JA 3NPZB 1OM3H 5GS1A 3C8DA 4QOKD 1ORQA 5J8OA 3CFCH 3VCLB 4AEHL 3D18B 2D0HA 3QQ3B 5I66A 5C07B 1XT5A 5SX5K 4YUEH 5B21A 5KSAA 5HYJD 5E2VL 1MAJA 5C8JA 2CDFA 2DD8H 1ORSA 4GMSL 4QRQA 1VGKB 1H5BA 4KKNA 5KVMC 1FORL 2RB8A 7FABH 3BKML 4D94A 4C4KT 4YNYA 5KS9F 3AXLA 4FQCH 3PWPD 5CIPB 1GZQA 5D93C 3H3KA 2JKXA 2J2ZA 4CN1A 3VGDA 3KPNA 3S3SA 1IC4L 1INEH 3QXDB 3C6LC 4X6DB 2UUDK 4YO0B 3O3AA 4R90H 4ONHB 3VXME 2A9MH 4RGMB 2ED8A 2IBBA 3N9GL 4XMLL 1A14H 2P45B 1B88A 3RZWA 2BXYA 1YEIH 1G1YA 1QNZL 5AZ2H 1IGCL 2VISB 1MLBA 3SKMB 5ISZB 4RWHA 1KEGH 4ZSOB 2DS4A 1VACB 1AGBA 5F3HB 3RDTB 3D87B 2BNRB 1N3NB 2IAMA 3MA9L 4NSKA 2GAZA 1B0RB 4XVSL 4ZPTB 1YEKL 1JPGA 4NCDA 4KGLA 3NCYP 4NQVA 4OCMC 1NPUA 1KJ3H 1ND0B 2VSCA 4GRWE 4HIIA 4M61A 3KPTA 4ODSL 3GJEB 5EFIA 4PJEE 4Y4KA 5KSUB 4PB9L 1FL5A 1GPOH 2OQJA 1M7DB 2Z91A 4JFOA 5BRZA 1NC2B 5CBEB 4N0RA 4KY1L 3TJEH 2DDQH 3EOBA 5T1MB 5JXED 5JHLH 1MHCA 5T1DL 3CVIH 1LO4L 1MIMH 4CL7A 3W9EA 4BQ8A 5MENA 4KJYA 2UWEF 3BSZH 4TSBH 2XKSA 4MCZA 1X5JA 3VFGH 2VITA 2MKWA 2YEZA 4YBQC 2B1AH 5B39B 4HZLB 1JYXA 1VKXB 3DUUB 1QA9B 4U6XA 4HPYH 2EZ0C 2X4UA 4MLSA 2AABL 2X41A 4U05A 3S36H 2QKIA 1VEMA 1ZA6B 2HA1A 3RX7A 3FQWB 3FN9A 3VA2C 1FNLA 4PJBE 5GS1C 4DOHB 3IFLH 3LZFL 4ERSH 3BIKB 4KVNL 5IV2B 3HZMA 4YFEA 4B0MM 3DURB 4UQ2A 1J12A 5DD0H 4DK6A 5C9JB 5KSAC 3QIUB 4ZAKB 4IEFB 3OJDA 3BW9A 1JNHA 3VXRE 5EO0B 1KNOB 3FT2B 4ZOAA 4ZDHA 3RGVA 4IRJB 3REWA 4HS3B 4H20H 1ACYL 3WLWD 3WFDL 3C6SB 2H8PB 3E3QE 1RIUL 5HI4D 4K07A 3NZHH 1WV7T 4P2RB 3KNBA 4NJ9L 5D1QD 1ZHBB 3GMOA 2DICA 4Q9CA 1KB5H 1JV5A 2HRPL 4JG1H 3CMGA 5D1XD 1ZSDA 1K8IA 3H9SB 2JCCF 2D7QA 2DQIH 4I0CC 1Q9WA 4YX2H 5E1AA 5IVZA 1IBGL 2ED7A 3PWNB 1MH5B 1AD0B 4DQOL 2XZAH 1C1EL 4FHBD 4PGEB 5KTEH 2OI9B 3IFNL 4GT7A 4NQCD 4QHNA 3D9AL 5J6GA 1BFVL 5L0QC 4X6BA 3EYQD 2R56L 4WCYL 4WI3A 2Q76A 4JM2D 1EO7A 5F1IA 1NEUA 4K71C 3VI4E 3RUGE 4HWBA 3QQ4A 3WIHL 1MFAL 2IAMC 3VFTA 3KPMB 2YPLD 4PS4H 5DJXA 3U9UA 2FJFB 1EZVY 4HKBB 3IDGA 3CVHB 4AM0A 4S2SB 2RJMA 3H9HB 3BYYA 4HHAA 1FYHB 3E8UH 1WLHA 2YD5A 4F7EA 1A3RL 4Y4KC 5H37H 1YEEH 3BO8A 1ZGLA 4OZGB 4MSWA 4OZFH 5BZDB 1MAML 1SEBA 3SJVB 1BBJA 2DLHA 4KXZI 4HIHB 4KWUA 1BZ7B 5GZOC 2FLBT 3QHZH 2C1OB 3K74B 5EUOE 2V6HA 4WRLA 1DLFH 5DD1H 4Z7UA 1CFVL 5LAXB 1R5WB 1ZAGA 2J1KA 5EUKB 2XWJB 5TJWK 3FB8B 2IADB 1RMFL 2VDKL 4EIZC 3H7BA 3HG1A 3PNWB 3G9VA 2F5BH 1JPST 5I16B 3BKYH 1CGUA 4JCLA 5D9SB 1A6WH 1NJ9A 4G9FB 4OCSH 1AQDB 4EN3D 4NDMB 1EERB 4LAJH 3WIFB 4TQEH 3U4BH 2MSPA 2HTLC 4LPTA 3QH3A 4NQSA 5J1SC 4KQ4H 4C58B 3DGCR 5E2UH 4NPYB 4O5LH 3ULVE 1HXYA 1Z9SA 3RGVC 1KENL 1O5DT 4P5MA 3MRCB 4JHBA 3GB7B 3P4MB 1R3KB 3TLRA 1G7IA 2PO6A 3UPAA 4ZNCD 5HJ3B 1FGVH 1YN7B 2AGJL 2AJVL 1OT2A 4PLNC 4PJDA 3FO1B 3FQUA 5CHNA 5A1AA 5HVHB 4X7TB 1A6VL 4HH9A 3WHXA 3ZDXE 3WE6B 2ARJB 5CKAA 3QNXA 5DRZB 1F00I 4KI5F 2ESVB 4JVUA 5A16B 5FKAB 4XHJD 4LLYB 4DKEL 4G7YH 4R3SA 3V7AE 5EO1B 1AGCB 3SDCB 1EO8L 2XG5A 4LCWE 2NY6D 3MLUL 1NBYA 3CH1A 4U1KB 4X5LA 3VFWB 1U3YA 3O3EA 5GSRB 2AEWA 2WIMA 3VWKA 1E4XL 4NQXB 5L6YL 3FO9B 2PF6A 5HGHA 4NJAL 4PRHA 3KJ4C 4Y19E 4LEXL 1T1WB 2WM0A 4GG8B 1C5BH 2GY5A 4GBXA 4U1IA 4KH2A 3RWDB 4X4ME 1YY8B 4IRSA 2AV7B 3T77A 5CEZD 2DJ4A 4YHOH 3PWUB 1HEZB 2YRPA 1QO3B 1RURH 4KJWC 2EDJA 3CAFA 4WI8A 3SQBA 5D7IA 4ZOCA 2OZ4A 4BZ1H 1TQBC 1OAZH 3ZDYF 1UCBH 3HI6L 1A21A 2UY7A 3Q48A 4XAWH 1CN4A 3HZVA 3UTQB 2W0LA 4GMTL 2G5BA 2FGWH 1QBMH 2VXVL 4V2CB 4OF7A 2HH0H 3U2SB 4OIIH 1LO3H 2HG5A 4JJ5A 3NCJH 4OSUL 1EK3A 5ESQB 1BFOA 3G5XA 2P42B 2J4WH 4MAYA 5EU6D 3C5ZB 4Z7WE 1T1YB 3CC5B 4JDTL 4PJ7E 4XP4H 1OHQA 1YQVH 4R26H 3EYSH 2AV1A 1LEIA 1A9EB 2IQAB 2Q7YB 5DK2B 2PTUA 1BQHG 5MEQB 3V5HA 4IBLT 5E4EB 3QCUH 1RV6X 4W4NA 1OY3B 1II4E 3CLFH 2R0ZH 5CWSA 3MNZA 4LFHD 5T5FH 1PD6A 1HQRA 4FQ2L 3BGFC 3O3UN 2DLFL 1W0VA 3REVA 1O7VA 5E4EC 2IPKB 2VYRE 4LP4A 4RWYH 2P24B 4LQFH 2EYTB 1NQBA 1FYTB 1MI5A 4OTXH 1YEFL 5GGUA 2ZUWA 2UZIL 1MCQA 4IS6B 4I4WB 2HP4A 5DHXB 3VFVB 4JRXB 4NO0A 5D72L 1R3HB 4G8EA 2JJTA 5LGHL 1V7ML 1BD2D 2PO6C 3C9NA 1RULL 1HHKB 4PJ5A 4WI9A 1RIHH 4V1DA 3ULVL 3FQTA 3H3BC 1G7PB 4WHDA 4HUMB 2EDYA 3IDYB 3PHOA 4KI5D 4S1RL 2ICWJ 2HVKB 3I3BA 1IC7H 5HYSG 2AXGA 1CXKA 4TSAL 3NTCL 5B4MD 3OZ9L 2GITA 4PRIE 1H3PL 2XZZA 4G6MH 2BX5A 5FCSH 3IDYC 3MZGB 5DC0A 3VXNB 3SE3A 4KK5C 5GGRA 1OP3H 3SGDH 2XNAA 3UBXG 3F7QA 2XQYK 4QYOB 3TF7C 4DGYH 1NMAH 1EPFA 2ZUXA 1NANI 5BXFA 2A74B 1WITA 1JGEB 4M5YH 5DVKA 1GC1H 1H3VA 4NO2B 2XY1A 4GBXC 5CMAB 1LE5B 4IRSC 2FB4H 2VWEC 3IFPA 2WINA 1A1MB 1NLDL 5HGDA 1YN6A 3GJFA 5IHLB 5F7DB 3OXSB 4M6OL 3MRQA 5EN2A 1J1XL 3D85D 3O2VL 5JNYB 1T0NA 4P4KA 2KQNA 5HI5C 4RFEA 1YNTA 2D7MA 3D69B 1OSPL 3OXRB 4D3CH 5J13B 5CZXD 1S7QA 3WFHB 3LEYH 1I7ZB 4HPOL 3CFKB 4M7ZC 2DTMH 5T3XE 4F37K 3IYLW 5CKGA 4GW4B 1BWMA 3S4SA 4HLZG 1AY1L 1OTTD 1UWXH 4N5UA 2N4IA 4YBHA 1BJ1H 5E08H 4MAYC 3FB6B 4LPYA 5F8RC 3V4UL 1CDJA 1IKNA 2NY3B 3BISA 2R1XB 4XVUC 2D7PA 5JOPE 4FZEH 3NFNB 5IW3A 2DWDA 3D0VA 3LY6A 3THML 5DR5H 2AJ3B 1C7SA 2E7HA 2BOCB 4L3CA 4LLQA 4ELKB 3UBXI 3NABL 4MA1C 1XGYL 2XI9A 5F1KC 3PP4L 2EDEA 4MJ5B 5C2BL 4WTZG 2AEIT 1Q0YL 1UM6H 4OFVA 3WUWA 1CICD 3LQAH 1MNUL 4C56E 5TFSL 4A6YA 1M05B 1FGNL 3VD9A 1MFCL 3HMXA 4HJJH 3KWWB 4JR9L 2EKSA 5FYLE 5IMKA 2GTZB 3MOBL 3WEXB 2G75A 2X70A 1HH6A 2X9XA 1NAMA 4LSPL 2ATPB 3KPQB 2VZ3A 4M48H 1DBBL 3CDFA 3C8KB 2IPTL 1HH9B 5JXAL 5KVEL 1KACB 4PJXB 4XNZB 6FABL 4M7LT 5A3IC 3GRWA 1B9ZA 1XH3B 2R2BB 3SDYL 2ZNXA 3BPLC 4OGYH 2NY7L 4Z6AT 3SE3C 2AEPL 4XNZC 3OTTA 3S8WA 4NHUA 1F90L 4R8WL 4X98B 4MJIA 4Z8FL 3ARBD 5IHBA 35C8L 3V4PL 4PRPD 1M6OB 1G7LB 1CFNB 1ES0B 3O6KL 4R7NA 2JK5B 4O2EA 1Q72L 5F71A 1ZLWH 1J86A 4GW5A 2HFFA 5FGCB 4EEEA 2NW2B 1WC7A 2YPKB 3MV8B 4XMLH 4MA3B 5IOPA 2DM4A 4QRPE 5I1GL 3PHQA 5DQ9B 1QHPA 4ETYA 2D9CA 3BWUC 3QJHB 3ILQC 3R1GL 4G6JL 4GKNA 4X9IA 4P4KC 3P0VL 5E0QA 3WO3B 1X5AA 1W2KT 2IMMA 4OFIA 4GG6B 4KI1A 1RZGB 1FG2B 5E8DL 4JVWA 5JHDD 1TIUA 5TDPB 4RMQA 2D4DA 3FCTA 4QNPF 2HVJB 4XVSH 5EIIA 1YEKH 3QEQA 1FSKC 4IOFD 5FO7A 1IEAB 5EDXA 4EI5B 3AU1A 4HWUA 1S9XA 4TULL 3QDJB 3S88H 2X9YA 5CEZH 2ZG2A 2E7LA 1JNNL 2X44D 5E7BA 3OG6B 4LHQB 2DQTL 4NO3A 1QZ1A 1FCGA 3CXHK 1OSZA 5GRJL 1F2XK 4EI6A 2GFBA 1CDCA 1J0IA 5T1DH 1W0YT 3RNKB 1KSRA 5LJYH 1NCWL 5C92A 4H8WL 4N0CC 1UA6L 5JW4M 5ETUA 1Q94B 3QDMB 1CR9H 5BQ7B 3M45A 1JPTL 3CH8A 4L4VE 1M7IA 1YMMA 3F6IA 4Y4FA 3BGAA 3O3DA 4BH8A 2IALB 1T2JA 1F11A 4WO4B 1GGBL 3MFFA 2BMKB 4BUHA 2AABH 1AE6H 4WVRA 4HAFA 4UNTA 2CDGB 5DO2C 5FECA 5I1LB 4PJIA 3LZFH 3O2DL 4ZUUB 4HFUL 3CLEL 4U33A 5GPRA 3V2AR 4KVNH 3AS3A 2NY5C 5JTWA 1XF1A 4MX7B 4OZHA 3QO0A 2MFNA 3ARGA 4K55A 1IQDA 2B5IC 4XGZB 3IDNA 2BVPB 4UV7H 4D9LL 1ACYH 1KV3A 5IEKB 1CGXA 1YYLL 2RBLA 4Q6IA 1FAKT 1K4DA 1JMZA 1KPVA 4LCWD 3L7FA 4UOW0 3GSUA 1MEXH 4DN3L 1HZHH 1K2DB 3QNZA 2PCPA 4I2XA 4PJFB 4CJ0A 3X3GL 5JIKA 1FAIL 3NN8A 4G6AD 3MV7B 4XPAL 4FXKB 5IM7B 1KPRA 2R9HD 4NQDA 4FQHB 2YA2A 3SO3B 3VD7A 3VG9C 4JPIB 1QFUL 3PWJB 3ZT5A 4P5TB 5CSGA 5E8PB 1VADB 3ILPA 3FFCB 3TN0A 3FQXB 5H37G 4YHYB 3D9AH 4HKZA 1BFVH 1RK0A 3WO4C 3L5WA 3B6SB 4WCYH 2R56H 4XTRC 4HF5H 5IB4A 2QHLA 3VI3E 2QSCH 1R5VB 3VFOA 1PEZA 1BOGB 2B2XH 1L6XA 4ONFL 3SGEH 1BGXL 5DJYA 1KN4H 4W81A 2L4OA 1LNUA 4JFYA 2ARWA 2J8HA 4RMVA 2WBJB 3GSXA 1J0KA 4ODHL 1DBMH 4OKDA 1DVFA 1I3GL 1DCLA 5DRXB 4BZYA 4DTGL 1CFQA 2C3HA 3B9KB 1MWAL 2WBJC 1FZOA 4Y5XB 4FABH 2E7LC 3GMQA 1Z9MA 1MJ7L 3MUHL 3K2MC 4UQ3A 5J6HB 1MAMH 5T1LB 2FEEI 1AR1C 1M7XA 4UINL 4IRZH 4JCMA 5KN5A 4NRZA 3AMKA 4U1SA 2FLRT 4P57A 2R4SL 2IBZY 3S5LA 4N1EA 5FGRA 3PWVB 3B8SA 3G6JA 1QEWA 3CFBA 2MCG1 1I3UA 2IANA 3KJ6H 4JZJB 2A6DB 3JTTA 3GFUA 1QSFD 3VXTA 2YD7A 1CFVH 3MJ9H 4WWKA 4Y4FC 1I4FA 1C8PA 3A6BL 3BWAA 2JIXD 1UVQB 1XR9B 5C0AE 4QWWD 3V8CA 3QFJD 3MV9D 5TE4L 4X0KA 5C3LD 4LSQL 2XT1B 1AC6A 4B5EA 4FZ8L 3SE4C 3PV7A 4N8CH 2I9LA 3MACL 1AO7E 4JQXA 5DD6A 1ZANH 2R1YB 1L0QA 3N1MC 1VCAA 2XWBB 3QZWB 3JWOL 1P4IL 3MGOB 4KROC 4NZDA 1GGIL 3ARGC 4M6NL 2Y36L 1Q1JH 2XYCA 2Q1EA 3I6KB 3DROB 3UDWA 2BSED 4XI5D 2Y07H 4LVOC 4Q6IC 4F33B 4LLVA 1E27A 5DI8A 5I8KH 1S78D 4E5XA 4RGNC 4NZTH 2XWTA 1E6JH 1XGPB 1EFQA 3D25A 3K1KC 4X4YB 5IEHB 1U93B 5MEPA 4L9DA 1N59A 5HDBE 3KPSD 3EHBC 3PDDA 4HKJB 1JL8A 5IVXE 1EO8H 2DWEB 1U8IB 3Q1SL 3CXHJ 2KQMA 3T0XA 1NGYB 3TN0C 2IFFL 5BZWB 1F3DH 2KUTA 1E4XH 3WL9A 5KBNC 5CD3B 4YAQA 5C08B 2ZG1A 4U3CA 4JKKA 4G8GE 3RIFF 2VDML 4DJMA 5DK0A 4G6FD 2SEBB 3N1GC 3O8XA 5E8OB 1TZIA 2CKBL 1JPFB 2FHBA 3VDCA 5K9JH 3FJTA 3WD5L 1UGNA 2FX8L 5E7FA 2YWZA 3O9WD 3QCVL 1NDGB 1XEDA 3IXTB 3ULUE 2CK2A 5F7LB 4Y4HA 3VRLF 2AJZA 1X5XA 1DVFC 4LPXA 4NOFA 4QHMB 3CSGA 1T2XA 3I6LD 3L3OA 3Q5YA 4ELME 1F58H 4JFFB 1YJDC 5D2NE 5H35B 5DZOA 3ARFA 4OIAA 3UPRA 3OX8B 3QWRD 4GMTH 3C87A 2F53B 1TNNA 2P5WA 4OLUL 2VXVH 3PP3K 2E27L 3BUYB 3SE8H 3V8OA 5HD8C 1RUQH 1FFRA 3O2WH 4O2FB 3PWLB 1IAOB 4MMXC 3SDXB 1AXIB 4MJ6B 3OBAA 4JRYE 4YK4C 2H32B 3VCLA 3CX2A 4LPVA 1ZLSL 1WEJL 1AGFB 2PR4L 5ILTL 5C07A 2YXFA 4AQ1B 2X89D 1UH3A 5DMGD 1NC4A 4JDTH 5HDQL 3SPVA 4WWKC 1U36A 1WBZB 2AI0H 3ZE1F 4D0DA 5IJKA 5HYQB 2P8LA 5I19L 4C56D 1G9NC 4ODWB 3BJ91 2DBLL 5HYSB 2RIKA 1PSKH 3WV0A 4K7FB 4P2QB 1JTTA 4FQ2H 1I9JH 4CADB 3VMOA 3G04B 5ADOH 4JQXC 2DLFH 3PQYA 3PL6D 1P2CB 3LS5L 4RNRB 1TTGA 5EOCH 4CW1A 2V9RA 3U0PA 3FHQA 1WFNA 4DVBB 1YEFH 3UBXB 1EHNA 5CIPA 1UB5B 2V2WB 4PLJC 2AK4A 1VFUA 2UZIH 1MJUH 3KPRB 1ZHLB 3MNWA 1TJIH 4E41A 3QXDA 5D72H 3UDWC 4EJ1C 2OJEA 1FO0H 4XPFL 4HIXH 4JN1H 1KPUA 1RULH 4X6DE 2AQ1A 5I1HL 3KS0H 2EYSB 4S1RH 1JN6A 2CK0H 2QV2A 1KIRA 4NHCH 5C0NC 1LK2B 4TSAH 3NTCH 5F3HA 5ISZE 4ZUWA 1KELL 3OZ9H 4ZSOE 4GKSB 1H3PH 3G5VA 4HWEL 2BNRE 5E1HB 3S9DB 3U1SH 2W65B 3RY6A 3OKDA 3VD3A 5C0BA 5CJXA 4RX4A 1MSPA 2H2SD 3R06B 1KCVL 3VDBA 3O8XC 2VLJB 4I0PB 1N8ZB 1BIIA 3QIWB 3PGDB 4JFDA 5JR1L 2YKLH 2H2PD 2YD3A 4N0YL 3KR3L 4X4XA 1NLDH 2XACC 1J1XH 3AMLA 3HCVB 5LBSH 3VXOB 1U3HA 5KSBB 2WWMD 4Y4HC 3QIWC 3C09B 4XNYH 4OM0L 1NBQA 2I60H 1JRHL 1JGDB 4HBCL 1TETL 3UTSE 5I9QC 3C5SA 3I75A 3QBTB 5JDSA 4KJPC 3E6FA 3QWOA 4XHQA 3ARFC 5CLTA 3D3VB 1ZVSA 3IDMB 1XCTA 4Q0XH 4M7KH 5HYIA 4TUJB 4HFWA 3RAJH 3KYMA 3SGDI 2VXUH 2YA0A 3TA3D 5FHAH 5DRWA 2Q20A 5FIEA 4PJ9B 3ISWA 2W60B 5DS8A 1AY1H 5T3ZD 3DLQR 2UVFA 1RJZA 3D39A 4G80B 5DJ6B 3RWCA 4DOHE 5LWYL 1FG9C 2ZOKA 3DURA 3V4UH 4C57C 3DSFH 2EDFA 1AKJA 4JKPL 5IMOB 5JPMB 4JHWL 1XGTA 4FQLL 2QR0A 2NTSP 2NY2D 3HPJA 5IJKC 3RPIB 3G6AA 5C09B 3QHFL 5IHUL 4UDUB 4UBDC 1TVDA 1MHEB 2Q8AL 2OK0H 5BO1L 3ZZ1A 1MRCL 2ENSA 1N6QH 4HUWA 2VZ1A 4FFWC 4U6TA 3MUY1 2KZWA 3HLAB 4GJTB 1BZQK 4HXBL 4P2RE 3V6OC 2EDNA 4HIJB 3TO2A 3HE6A 2XN9A 4YR6B 3GHEH 5TFSH 2ENYA 4ZS6D 4YXKL 5J1TC 4N9OB 1BAFH 1FGNH 1MFCH 3VWJB 2F54A 2PW1B 3MOBH 3QQ9D 5IFJB 3HC3H 3GDBA 1DQJB 3V6FA 3LD8B 1YY9C 4P99A 4YWGL 5GIRA 3FO0L 4HGKC 3VWJC 5ICXB 4F7TA 1A9BA 1DBBH 5KANG 5DJ8B 2IPTH 5KVEH 5FYJL 1LEGA 4Z7OF 3TPKA 4WUUB 1KLGA 4BSVB 6FABH 2FGZA 3B5TA 2ADGA 3OR7B 3UTOA 2Z31B 3LKQA 3QUXA 1JPSH 1G7MA 4OLEA 5D7KE 2HMID 2NY7H 2CRYA 4LSRL 2DYPB 1CXLA 2AEPH 3RY6C 4P3WA 1CQYA 5F6HJ 5GISH 1F90H 4X7FC 4HJGA 3KXFB 3GSRB 4L29A 4Z8FH 35C8H 3V4PH 1L7TL 5CJXC 5D7LD 3O6KH 1S7VA 1N0LA 1EXUA 1Q72H 3AREA 3MLZL 4EOWH 4U49A 3UTZB 1YEDA 1YNLL 1AHWB 1ZE3C 2LAAA 2NZ9D 4OZGE 2BC4B 5F89A 1BHGA 3OPZL 4HIHA 4YQXL 5I1GH 3IXAA 1DUYA 3NIGE 2QL1A 4M8QA 1ED3A 3SJVE 1BJ8A 1BQSA 2XTLA 1U3HC 2O5YL 1I1AD 3FOMB 3P0VH 1ZHNA 3C5JA 1X4ZA 2MPAL 5E9DD 4NRXB 2BOBA 2JB6B 2XWJA 3RVXD 1P5UA 5IJVA 5EU5A 2VXQL 3MLVH 4M1GL 3ZKXC 3LEXB 2X09A 4AH2B 4KJQC 4WDIB 1T5WB 2X05A 5SWZD 5BS0B 3X12B 4L8SB 4P2OB 1C12B 3DBXB 4TULH 3GSNL 3FMGL 4QHKJ 5CEXB 1Q8MA 3SEPA 3VJ6B 4LPUA 3MRGA 4YHML 1NGWA 5KANI 1BX2B 4NDMA 3TFKD 5F1OB 3LDBC 3VXSB 5JW5A 1KYOK 5GRJH 4HWZA 5DQDL 3MRHA 4E42A 2PTTB 1MCJA 3MC0A 3MYJB 4H8WH 1P6AB 4LFHG 5L88L 2CIKB 2PYFB 3IS1X 1PZ5A 4QY8A 5JZ7C 3O41A 3ARZA 4NT6A 4RAHA 3NA4A 1JPTH 5DRNB 4PV9B 1AO7D 5DVNA 4HV8A 5FM8A 1VGEL 2GK0A 1TQCC 1GGBH 1DQQA 5DRZA 3GUTA 5HYEA 3GGWA 3LV3B 5H94A 5A16A 3HE6C 3UROR 3VRJB 1H3TA 4U1JA 3W2DH 3T1FA 2ESVE 5J0BA 1KF9B 1H8OA 1WFUA 4K94C 4U1KA 1CGWA 5D7JA 5GSRA 1ERNA 2VDPL 2ORBL 3DVNB 3HC0A 3V6ZA 5EPMA 1J8HB 2ZCLL 3JTSB 5F7YC 1YDPB 1D5IH 4OZFB 4BKLA 1YPZF 3P73B 4C83B 3LMJH 3MLSH 4FTVA 4TNWK 4WW1A 4Q97A 4KHTH 4NM8L 4LNRA 2OBGA 3F65A 3QSKB 1MCOH 1RIVL 1P1ZB 2EECA 1NFKA 3PE9A 4MQTB 5L8LB 4FXGB 3C08L 3O4LB 5DJAB 5I18L 1A4KB 5FGBA 1ZHKA 1NCAH 3MBEA 3ZKNC 6CGTA 4OI7A 1BEYH 2CMRH 2M1KA 3D2UD 4F9PC 3F12A 4UB0L 4F7MB 1F42A 1MLCB 2BNQB 2ZSVB 2J8UB 4RIRB 2LFGA 3O6ML 2R69L 2GJZB 4Y16B 1LP9A 1WBYB 4K3JL 1QFUH 1T7XA 2OR7A 3O11A 3B2VH 1Y18B 3AREC 1P7QA 3IDIA 2YSSB 4ZUSB 3CUPA 1H3WM 1XZ0A 3BVNB 3KAAA 1P4BL 3CVHL 1OF2B 5JORB 4M93B 1FNFA 2UV3A 1SBSL 2A77H 2CUIA 5T1KD 4WI6A 4Z7UE 4NKIH 3VXPA 4GQ9L 2RQ8A 2XTJB 4ONFH 1CIDA 4K3EH 3ZYOA 1BGXH 2WP3T 2APVA 4RA3A 1M1SA 2ICWI 3QPQC 3BJLA 3CZFB 3MRJA 4LLUA 3L3GB 3DTXA 3A0OA 4Z76A 5FAAA 2XTJC 1TITA 3P9MB 1T3FB 5F7WC 1FV1A 2GSGB 5F9WC 5FYJU 5TQ2L 4MAUL 1J0ZA 4DTGH 4QOKB 2WP3O 4R4FL 5DUML 3JV0A 1MCPL 2HJLB 1SY6H 3HI5L 1I8IB 3KYKL 1G7QA 3MOAL 1CDBA 1WBXB 2D7TL 3LRSB 5HYJB 2IH1B 4YDKL 3DWTA 4ZNEA 2GHWB 2HFTA 3QDGA 1UM5H 4P5KB 1FYTE 4HLJA 3L1OH 5C0EA 3U6RB 2DF3A 1SBBA 3HZYB 4UU9B 4KZDH 5IB3A 2XFXB 2XZQH 4JRXE 3U0TB 1Q9KB 1K5NA 4GXUM 4FQ1L 1CE6B 1G7PA 1Z3GH 3M07A 3MMEB 5J1AB 3T0EA 2VUYA 3FRUB 1U8OB 2H9GA 5T3ZH 1GGYA 3KPOB 3FAXA 3PWPB 3LN5A 4LSQH 3C6LD 1YEHL 3FQNA 4FZ8H 5ERWA 4WNQA 3P40A 3MACH 5FYJD 3FZUC 4YBLC 1A6TB 3JV6B 2DLTA 5D7JC 3JWOH 1P4IH 2DQDL 1MCKA 3WUZA 3KPLB 4HX1B 3IF1A 5K9OA 1NEZG 5D5MB 4K7PY 2APXA 4XNMB 2Y36H 4JN2A 3QJFA 4OB5L 3BP7B 4PYGA 3GHBH 3EYFA 2R0KH 3U7WH 2VWEE 5DDHA 3ZHDA 3AUVA 4JKWA 4QF1A 4XC1H 1CS6A 1TLKA 3P11L 2VLLA 4NNYB 2EE3A 5C0CA 5EIQA 4Z7QE 5FGBC 4CDHA 3MBEC 3RWHB 1AD9A 2A6JB 1VPOL 1KIQB 1X5HA 1Z5LB 2V9TA 3QUYA 2DOCA 4NP4L 2FWOA 3Q1SH 1OAKL 4OFYD 3BD4A 1HCFX 2JJWA 1KYOJ 1LD9A 2IFFH 3QAZC 4P3DA 4Y8DC 3RWJA 1WFTA 5FM4A 3BD5A 3TNNB 3DX6A 5IHZB 1BREA 1WK0A 2G60L 43C9A 5CLWA 4O9HL 4YBQD 2VDMH 3G6DL 1DANU 4NQUA 4R0LB 4Y1AA 2E7BA 4K3DH 3FB6A 1AFVL 3UTTA 5BVPL 2EZ0D 3UTSD 3VFMA 3DVFA 4XVJL 3WD5H 1G6VK 2R1XA 5EOQL 2FX8H 2CIIA 3K7UA 3H9ZA 2BFVL 2KKQA 3T2QA 4NRYA 2NLJB 1PLGL 5I71B 2E7CA 4RAVA 2H3NA 2WW8A 4JY4B 4OBSA 5KSAD 5M94B 3DVIA 1EUUA 1NAKL 4FA8A 3OKKA 4X6EB 5GRVL 2XIDA 5HGAA 3FAWA 5DJCA 4X99A 5AAMA 3WBDA 5BJTB 3OAZK 1DSFL 4HKXA 1M05A 1HXMA 3KWWA 1V3LA 4WY7L 3WEXA 2BCKA 3DRTB 4XPTH 5F1NA 1ZLSH 5EOTA 1WEJH 5MHSE 2OXHA 2H26B 3E6HA 5D1QB 3FRPA 4PRBA 1F6AA 4AG4H 4HMDA 2I07A 1OCWL 3KVQA 5KS9B 2OM5A 3K1DA 3T0EC 5JW4Q 5GRUL 1QHOA 5HI4C 5D1XB 5CBAA 3TBSA 3QDHA 2DBLH 3V5KB 1G9EA 2GJ6A 4U6YA 5ECJE 1XH3A 4PJXE 1KULA 1GC1C 1L7IL 3ZT7A 1U8PB 2IBGA 3PGFL 4M4RA 2DQCL 3VMNA 5DT1H 1ZLUH 3U4EB 4NQCB 4RZCA 2X4RA 4APQA 4KZEL 5F3BA 1JF6A 4Z0BL 4XT1C 4JM2B 1NSNL 1RVFH 1G7LA 3MRMA 3O0RL 5F70A 2IPUG 3O3BB 2IAMD 4P9HC 2CD0A 4HUXB 3S35X 4YHIA 1EEQA 2FSEA 4Y5VA 2NW2A 5D7KD 2YPLB 5I1HH 1Q0XH 5GJSL 5JUEL 5FGCE 4M62H 2V17L 3P9WB 1KG0A 1MREL 3MV8E 4Y4KD 4C55A 4JFEE 3EO9H 4UILL 4KKCC 4QXTB 5C6TL 5BRZD 2Z93A 5B22A 5DZNA 3GBNH 2A83B 1KELH 2A6IB 5EZIH 4A2MA 2P47B 4QXGH 5TDPA 3ECBB 1W8NA 4AEIL 5C6WH 3WFBL 2BJML 4HWEH 3QUYC 5EU3B 3CDYA 1N7ML 4ZO6A 3MRBB 4GG6E 4HXAL 1NGZA 5GZOD 1U9KA 2C3VA 5MEND 5HHOA 1QFWH 1I1YB 1JWMB 1XCQB 3VRIB 4L8BA 2UWEB 3RPKA 3T2PA 3B9EA 1FFQA 3Q3GA 4OF5A 4U1HB 1EJOL 4QEGA 5HYFA 1I1CA 1MCSA 2OL3B 2D31A 3TBYB 3QDJE 2HLAB 2ADFL 1DEEA 3B2UD 1T89C 3ZSSA 1INDL 3CSYB 1CDIA 1KJVB 5F1SA 2X1OA 3LQAC 4HUVB 1JZ4A 4EUPH 2VDOH 3ZE0E 1UWGL 1GOFA 3NBNA 1IL1B 4CMHB 1XGQA 3QUMA 4OM0H 3OGOE 4HBCH 2HTLD 1TETH 3VD5A 1TZGH 3MLYL 1PG7X 4P49A 3QDME 4QTHB 3RY5A 1U95A 1I9RL 4EN3B 4KK6C 2B1HL 4KK8C 2EEBA 3RGVD 4K8RC 4PR5B 2N56A 3MR9A 3QUZA 1U8JA 4X83A 2BHUA 3LRGA 1X5IA 3UYRH 1NUGA 4PJDF 2AXJA 2ICWA 4TSCH 5FDWA 3V79C 5HGGS 1FH5L 4NFBA 1I7UB 4FQLH 4ETQA 1O0VA 1FVCA 2JCCB 3NIFE 3JUZA 1TPXB 5IHUH 5IEKA 5FEBA 4YE4H 2Q8AH 5BO1H 3CFEB 5C0DA 1H15B 2KZ1B 5J89A 1CCZA 3HKFA 2NY6B 1NCUA 1K2DA 4KAQH 2R4RL 3RVWC 4NQEA 1A1OB 1RUKL 4FXKA 1CD9B 4PJFE 1SJHA 1F3JA 4FNLH 1TCRA 4APQC 3MV7E 2GUOA 2Z8SA 1RJLA 4Z95H 5B3NA 2EH8L 3WFEL 1HILA 4GKZB 4KJWD 2QHRL 3HNSH 3G5YA 3GSWB 3BFOA 4I9WD 3TO4A 2O61B 3FFCE 5ESVA 3H8NA 2ZG3A 4J4PA 3T4YA 5D7IF 5MI0B 1Y0LB 2CO7B 3RWIA 3ZYIA 4D8PA 5FYJH 8FABA 4ZXBA 3WJLA 5L7XL 2CJUL 4P59H 4C59B 1EH9A 1LO5A 3RHWF 4UIMB 5JO5B 4XCYA 5TPWL 1GGUA 3U82B 3WCYA 4NN6C 3MRKB 4KMLB 5HBBA 3VXQA 5DRXA 1SJVA 1S9VA 4Y5XA 1L7TH 3FONA 3P4NB 3P4OB 4LK4A 3MRDB 4OT1L 5EU6B 3MLZH 4FFZL 4N0FB 2BVOA 5GGQL 4UDTB 1YNLH 3HG1D 2UY6A 3HMWL 2BVQA 5CEYA 4AENB 1K8DA 3OPZH 4YQXH 1CDHA 1CVSC 4J2XA 1I9EA 4XBEH 1UM4L 2FATL 3S37X 4JZJA 4JGJA 3GSOA 1P53A 3FB5A 1IGIH 4FFVC 3VGBA 2MPAH 4JFPA 3A6CL 2W1NA 2EXWC 3LKNA 1LE9B 4X8XA 4OI8A 1QOKA 4CN6A 2VR9A 4CU6A 2B0SL 1XR9A 3ZE2E 3MUJA 3P77A 5IKCB 1U8MB 4PRDA 5JW4N 3QXUA 3GSNH 3FMGH 3QUZC 1TZHB 2PO6D 4J3VA 1QVOB 2F58L 1A6AB 1N64L 3AVEA 3QO1A 5IMMB 2LABA 3VD4A 2DQUL 4IOIB 1BD2B 1VFBA 4YGAB 3RRQA 4KV5E 3M8OH 1QRKA 4DUXA 4HIEA 2X4NB 2R1WB 4J8RA 2NY5L 1NAML 4RAUB 3QUKA 1NFIA 1HHJA 4OLWL 5L88H 4ZUVB 1G1CA 5FV1L 4KK5D 3AM8A 5GRXG 4Z78A 3VH8A 2ATKA 1T04B 1VGEH 3GRWL 1ETZB 4M1DL 4HC1A 4PRHD 4YHKH 4S1DC 3VE0A 3M17B 2EIZA 2GJJA 4CVZB 5F21B 4HT1H 4XRCA 4GBXD 3U7YH 5T33H 5IB2A 4IRSD 5B3JE 3G5ZA 3U46B 5GS2H 1MVUB 4G8FA 4AIZB 2G2RA 2P43B 3IJSA 5HI5D 3TO4C 5F96H 4BQBA 1S3KH 1EZVX 4J4PC 3D85B 1JZ5A 4GRMB 4GAGH 3TIEB 5J12C 4KKBC 2V5MA 3L5XL 4UIKH 4ZXBC 5C08E 1P7HL 3WJLC 1NBZB 4LRNH 4QXWA 1UFUA 3BZDA 1IGFH 2EYRA 1L6ZA 3SCMA 3C08H 3O6LL 1QR1A 2LVCA 2X42A 1FRGL 2EC9U 5IESL 5E8NA 4MAYD 4UB0H 3ZDZE 4EXPX 4MQ7B 2AAVA 5AG8A 3O6MH 2R69H 3AFLA 4K3JH 2KDGA 4LCIL 2VOTA 4WEMB 4JFFE 5IT2L 5IWLA 4LDEB 4YDLC 1LEKB 1P4BH 4O02H 1T20A 1UJ3B 2F53E 4LEOB 3FT3A 1IAOA 5DMIL 5HY9A 2VIRA 1GYAA 1N0XL 3GMRB 1EDQA 1IGTA 2QSTA 3ZKQD 2HTKC 2D7OA 4QT5A 1HE7A 3SDXE 5F7MC 3IRZA 4YHZH 3IVKA 3QIBA 3ULSB 1MI5D 3DRQB 3KYAA 4MNGA 4E9LA 2E9IA 1CICB 4DEPB 3C2AL 4XP9L 1QBBA 1YECH 4G6KH 3BRGC 4CBPA 4NO0D 1U8KA 1A3QA 4MAUH 1ACZA 1I8KB 1PKQB 2BSSB 4P3CL 5FKPB 5DUMH 4V1DD 1MCPH 2C7UB 2ADJB 3HI5H 4P2QE 4WV1B 3KYKH 1YEJH 3EGSA 3MOAH 5DYOB 5GXBB 1T0MA 2Z4QA 3T2NL 3NFPB 3NZ8B 4XMKH 5GZNC 4MB5A 1T1XB 4R6UA 5A3ID 2ZSWB 4ZFFA 2OS7A 3OGCB 3HNVL 1DTUA 2ITCB 5LGKA 2XKNA 3KPRE 1MCIA 5DHYB 3BP4B 3AM8C 3QCTH 5JQ6H 4RQQA 4FQ1H 3H9YA 5I6XB 4OZIA 4DAGL 1UWEL 4Z18A 1CXIA 3RVTC 5HTSA 4PGDA 4WW2A 2HAZA 5ICYB 4WFEE 5DA4A 5ID1B 1YEHH 4PRPB 3QEUB 2FYYB 1FNEB 3IB4A 1N2RA 3JZ7A 2R2EA 4OCRL 2EKJA 1TTFA 4JO3L 4JAMB 3KYOA 3OAUH 3FQRA 4ZFZB 4PJ8A 2YZ8A 1YYML 4XAKD 2P5EA 3ILQD 1XF2A 1JWUB 4P4KD 4WGWB 2WWKT 3PUCA 1NDMB 1S7WA 2XQBL 1KJ2A 3AS0A 4JFED 2J7LA 5E94B 2VDRL 5F7NC 2NNAA 1CGYA 4U1LB 4PG9A 2PYEE 4OAWA 1IT9L 3MODH 1RJCA 3IDJB 1U8HA 1E0OB 4NNPL 5JHDB 1S8DB 4M6AA 1X5LA 3NGBC 5DEGB 4KRPC 5DSCA 3BHBB 2VLJE 5H2BA 3Q0HA 3P11H 3VFSB 3L9RB 4HWBH 3W81A 2A6KB 5TDOB 2AS5M 4GAJH 5CD5C 4POYA 3HB3C 5I8EA 1RI8A 4FQXB 2CUHA 5KSBE 4ISVB 1RZIB 1WTGT 2P8MB 5IB5B 5C71A 1X5KA 1ZXQA 4NP4H 1LILA 1R24A 3IDMA 1T4KA 4IOFC 1XMWA 5INDA 3TV3H 1B6DA 1KJMA 1J5OL 3QXTA 4N0CD 3TVMB 1BBDH 4FQXC 2CPCA 2EEAA 1WZ1L 3D3VE 4JY6B 3ARRA 2LU4A 3G08A 4O9HH 3FTGB 1DDHB 5EU7C 5CZVH 2R39A 5GS0C 1AFVH 2VQ1A 3TVMC 5EZOL 5BVPH 4ODUA 9CGTA 3HE7A 4Q9QL 4D0BB 4HEPG 3SDAA 3EFFA 3T3PF 1T0PB 5EOQH 3UYPA 5C0JB 2DQFA 3QIBC 4EQ3A 2NW3B 3JWDC 1FO0B 3GMNB 3QI9A 4RBPK 5SWQA 5DO2D 5HHQB 1QLRA 2V2XB 1P7KB 4DWHA 1KCUH 2DMBA 4NUJB 1G9NL 4PJIF 2HWZL 3SOBL 2W91A 5C09E 3V6OE 4S0TD 1H0DA 1ZWIA 1JF1B 1NAKH 3ES6A 5F6HI 4OZHF 4JLRB 1H3UA 2A73B 4LVHC 4YHPB 5I0ZA 1URLA 5DA0B 1DSFH 2BVEA 1CLYH 1GGTA 1MJ8H 3ARPA 2E6JA 2VAAA 5C0GB 4KTEL 3RTQA 4CN4A 3KYNB 3T3MF 3DXAA 5GHWH 4KTDL 4JO2L 3LPGA 4Z7VA 5CJBA 3MRLB 3S7GA 1WIOA 4HUUB 4LCWB 4RRPA 3RP1A 3HFML 2FJHA 1GZPB 2OSLB 3IKCB 4L4JA 4MJID 4ZFOA 5GRUH 1RZKC 4WW2C 3W0WA 2AJSL 2O5XL 3S96A 4Q2ZB 2DQHL 4OF3A 1RY7B 4XPGL 4IHOA 2NTFA 2Z31A 5IBLC 4I18A 3L3IB 1I85A 5IG7A 1FNHA 4UAOB 2P48B 3L95B 4HZAA 4WUUE 4OLXL 1MY5A 3PGFH 1W0WA 2A9NL 1SYVA 2XA8L 4XTRD 5EZJB 2VLKA 5IMLA 4K23L 3AC0A 1UH4A 2DIJA 3MCLL 4PJ8C 4F2MA 4L9LB 1A8JH 2DRUA 2G9HB 4KZEH 3CDGB 3EFDL 4L3EA 4UTAL 1NSNH 3O0RH 3EZJB 1R3LB 4LMQI 5I2IB 3KXFE 4JJHA 1KEML 4L9LC 3VXUB 3VW3L 2BSRB 3QEQD 4GUPB 4PRAB 4F7CB 4CU7A 5GJSH 4R4BA 2CRMA 1B4JH 4RGOL 1MREH 2X7LA 2QTEA 4DFIA 5C6TH 5KVFL 3TBWB 5D2LA 1AR1D 4EUPG 2OZ4H 5ALCH 3MTRA 4AEIH 2BJMH 3CFCL 4OFPA 2R15A 5I1AA 1UB6B 1AIFB 3HTLX 4YHNA 4YUEL 3ZTJH 3G6JF 5BS0E 1EJOH 3WKML 4GS7C 1PYWA 1R0AH 2BNUB 1YMMD 2X4QB 3MXWL 4Y4FD 1XF5A 1C