1H8SA

Three-dimensional structure of anti-ampicillin single chain fv fragment complexed with the hapten.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
218
Chain Sequence
DIVLTQSHKFMSTSVGDRVSITCKASQDVGTAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQYSSYPLTFGAGTKLELKQVQLQEPGGELVRPGASVKLSCKASGYTFTSYWINWVKQRPGQGLEWIGNIYPSDSYTNYNQKFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARWGYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUTANT AL2 6E7P9G
publication title Selection, Characterization and X-Ray Structure of Anti-Ampicillin Single-Chain Fv Fragments from Phage-Displayed Murine Antibody Libraries
pubmed doi rcsb
source organism Mus musculus
molecule tags Anti-ampicillin antibodies
total genus 55
structure length 218
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h8sA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h8sA02
3BUYB 3KXFD 4H5SA 2ILLA 5J57B 5I1DA 1YN7A 2DD8H 2KZWA 3KPTA 5F7NC 2VQTA 4G80A 5GJSL 3QQ4B 4JZOB 3WNKA 1NCDL 2YBRB 4P9HH 4LVOC 4Q7DA 1P9MA 4QTIH 5ICYB 3A6CL 4NZTH 4F2MB 3KYMB 4NQXA 5CEYB 4WEBL 5E00B 2V6HA 4WFFE 4J2XA 1N5YL 4JZJC 3KHOA 1RK0A 4X9BA 5MHSD 3VXPB 4LQFH 2NZIA 3V0AC 3VFUA 1MIML 1OL0A 4JZNB 4KKCD 2EE2A 3GI8H 4PV8A 4JQVC 1M7IA 3MLVL 5F7LB 3T2QA 1CGSL 4IRJB 1LDPH 3ARBD 3EYFA 3BQUD 5D8JL 1UWEH 3CSYA 4XPAH 1P4LA 2PUQT 5KN5B 4IM8A 1OAQL 5D4QA 4PB0L 5CMAA 3FQXB 4N8CH 1OAZL 3BD4A 3NAAL 4LOUC 2BSRB 4M62L 3WFZA 3T0EA 1R24A 3IJYB 4KHTL 1C08B 4XNXH 4NC0B 5FO9B 4HIIB 4FABL 5I1KH 2R1WB 3JWDC 4PJ5B 5DQ9B 3RIFK 4MJIE 4MSWB 1QHPA 5ADPH 4WO4A 5C0AE 4U0RC 2DLFL 5ERWB 5A2LH 1N7MH 3BZEA 3SDCB 2HTKC 3QPXH 3EYOA 1A4KB 3BIAX 4S1DD 2DQIL 1J0HA 4JO4H 2MJWA 1JZ8A 3P77B 4FG6C 1FLRH 2YXFA 4IMLA 5ID0B 3G6AB 2Z92B 3VRLF 1M71A 4ODHH 3DX9A 3X13A 1KENL 5I16A 4QHMA 1UM6H 2VABB 3K2MC 3M1BA 5K9KB 5D5ME 4YHLL 2OCFD 1NGXB 5F1SA 1WFTA 1JWMA 5ACLA 4WVRA 4EI6B 4QRPE 4O9HH 3SKNA 1EHAA 4WJ5B 4HKJB 3THML 4K9EC 1DBKH 2BDNL 4BUGA 1BFOB 1BZQK 4L3EB 5FB8A 3ULUD 5FKAB 3GUTA 4LEXH 1MHHA 4YHOL 3G5YB 1EHLL 5C0EB 4HUVB 4OF6A 4KV5F 1UZ6F 4HUNB 4JJ5B 1LGVA 4AQ1B 2FEDC 1EFXB 1BQHG 4MDIB 3HNVL 3OAYH 2F19H 1NSNL 4OJFL 3VW3H 3G5VB 2A77H 5FGCE 5FHBL 1ORSB 4CN4A 2HT4D 3PWLA 1LMKA 1HI6B 5SWQA 5BJTB 5HPMB 4OLEA 4X6DA 3VFVB 1R3IL 4WUUA 3T1FB 5GGVL 3RBGA 4CW1A 3P73A 3DUHA 1JGDB 4X4XA 5EPMA 2ZSWA 4PJ9A 4F7EA 1A6TB 1E4XH 3JV6B 1GHFH 5JPMA 1A7PH 3GBMH 4NO0B 3D2UA 2BRRH 2OR9H 5E8DL 2EEAA 2HA1A 4YC2B 3O8XC 3DROA 2R0LH 3RGVD 2FEEI 1BMGA 4XWOD 4YGAB 4YHNA 3VFRA 3ECBA 3NOIA 2GAZA 1IILE 2RAMA 4NO3A 3UPAA 2H6PA 2F5AL 3NCFB 5FHAH 5LGKA 3ARPA 1HXYA 5SWSD 3B9KC 3KPPA 4UT7L 5M95B 5F7EL 2OI9C 1DEDA 4GRWH 1MWAA 2HKFH 4R3SA 3W11C 3LEXA 4Z7UB 4R97C 1EJ6A 3GMMA 1TJGH 4WW2B 4MZ2A 1E28A 1DQLL 1MVUA 3OKEA 3L5HA 1QFHA 4MB5A 4GG8B 3U0TA 5HVWA 4I77H 2OR7A 1VACA 3BGFC 3SHSA 1AQKH 3AY4C 3FHAA 2NY6D 5L88H 1U0QA 1IFHH 4OSUH 1RD6A 2O5ZL 2A6IB 3SDXA 3WD5L 1Z3GH 2RBLA 5GGTA 4PJCB 3FQRB 4PJ5E 4LP4A 4HD9A 1J1PL 4JQIH 3QP3A 4C55A 3GHEH 3S37H 2AJUL 4Y5XB 2VDPL 4YHML 1MLCB 1TQBC 1YPZF 2X7LA 3ARFB 2V5SA 4PJFA 5I76A 3H7LA 1WEJH 5FK9B 4XPGH 4ALAL 4K3JH 4YHPB 2AABH 3QULA 3TO2B 1WTLA 3V0WH 5EU4A 4P3WA 4D3CL 5I30H 2BCKA 3OKDB 3IDXH 2V17H 2X4NA 5BZWA 4FN0A 1FYTD 5IOPB 5MENE 3CCHA 3KPRB 3H0TB 3RKDD 1L9MA 3FQUB 3T2OA 2CMRL 3T0ED 4R0LC 4DFHA 4FFZL 1MH5A 3FMGH 4L3CB 5FV2A 4XVJL 4NQDA 3W2DL 3VRIA 3MJ8B 4QHUA 2XTLA 1Z2KA 4ONFH 3HUJA 4DVBA 4L3EE 1DTUA 1MJJA 1D7FA 2WW8A 1OPGL 3HI5L 3WDJA 4B41A 4XPHL 2UVFA 3TYFA 4C4KT 4ETYA 1PDKA 4L4TB 5HHOA 3G6JF 5KG9A 3VD5A 2MOVA 5EU7E 2COQA 2E7LC 4WFHD 2H9GA 1JN6A 3FO0H 5F9JA 1M6OA 3ZE0E 3E8UH 1T89C 5E6IB 2C1PA 4FQ1H 1KJ3H 3FO2B 4ETQB 3MA9H 5HHXH 1T04B 4UOW1 3I02A 4D8PB 1OCWH 1WZ1H 5IT2H 2Z8RA 4KI5F 4J4PA 3LCYA 4MDJB 5DR5L 5DEFA 2FCBA 4LSPL 4JFFA 2WIIA 1A7OL 2ZCHL 2VERN 4B7IA 2R4SH 4UZGA 1CFNA 4L29B 1QSEA 3RY4A 3GK8L 3GMPB 4LMQI 1T1XA 5DEGB 3MLWL 4PJEB 2FH6A 3AROA 2IBGA 3JWDH 4RX4D 3TBSB 2RCSH 4HZLB 1EZVX 1C12B 2E9WA 4Z0BH 3FKUS 4LLUB 3AXLA 3QFJB 4IRZH 4NNPL 3EDFA 5HGHB 4JFDA 4IOIB 5DK2A 3NCMA 4TNVF 3MRHB 3FB7B 4J3OC 4WUUD 3MNWA 4H0IA 2YN5A 2J8UF 3HNTH 2DQFA 2Z4QB 5DRZB 3D2UD 1QPXA 3DETC 3I3EA 3NA9H 2X4OB 3QCTH 1VPOH 2KZ1B 3RNQA 4L8DA 2VDQH 3H3PL 4YDVA 5DYOA 4EQ2A 2LE9A 3QHFL 1IM9A 3LHPL 2APWA 4IMKA 3RHWK 2R56H 1VEOA 5KOVC 2GTWB 4XNMB 3SOBH 2ZUWA 4K8RH 5GRJH 3F58H 3RBSA 4WGWB 5DUPH 1AGCB 3GKWH 1OTSD 2EKSA 1QA9B 3C08H 5DDHA 4K9EH 1RZ7H 1A21A 1AGBB 3QG7L 4PJ8B 5TF1H 2R8SL 1HHKB 3L3KA 5HXMA 1JZ2A 1S7UB 2GK2A 1X3DA 4FRWA 1MF2L 2G5BB 4PBXA 5H2BA 3VFSA 2BMKB 2B4CC 1SYVA 3H3KA 1T7ZA 3BXNB 5CKAA 4O2EA 4OGYL 4GAYB 1VSCA 3KPRE 4PJGF 3BGMA 1QFWL 2DTML 4NKOB 2D0HA 2O5YH 1J05B 4J7RA 4PIRF 2OK0H 4MNHB 1PEZA 2H32A 4P59L 3MLXH 2BVPB 4QCIB 5E8PB 1JFQH 2WWMD 3MV7E 1YEEH 3LB6D 4X4ZA 3QUXC 3OAZK 5F1OB 2AK1L 2D4FA 3Q5YA 4TQEH 4CGTA 1F00I 3WNMA 2UYLA 3ABZA 5GISL 4YXKH 2PYEB 4XCYB 2DDQL 1FNSH 2Y5TB 4G9FA 4RNRA 5F96H 4FA8A 3MA7A 2NX5A 2FNBA 2MWCA 3TBWB 1RQ5A 1LILA 1II4E 1F58L 3MRJB 4OD3H 3W0WB 4F7MA 3JV0A 1MHPH 3QXAA 3HI1B 1J5OL 4L4TE 2D03H 2L7JA 5DD0H 4FFWC 1G9MH 1QTYT 4DGYL 1H8OA 4JY6B 5CEXA 4J3VA 3HZKB 3LRHA 4W6YB 1S7SB 1RU9H 5EOTA 3H9HA 3EHBC 1KNOB 2LAGB 3JWOC 5HVHC 1OTUD 3KYAA 5D7LA 4U1HB 4JN2A 1QP1A 4KI5C 1RFDL 4HS6A 4HC1L 3S96B 4NQDD 3HLAB 5CZVH 1G7LB 2NQCA 3ARRA 4XNYL 2D0GA 1FNAA 5GIRA 1TPXB 2EIBA 5ANME 3OBAA 2PYFB 4Y4FC 3JTSA 1EMTL 4DFIA 3IDNB 2EC8A 3GM0A 4LEOA 4MD0A 2CK2A 2HRPL 4JO1L 1OP3K 2YUZA 4Y2DA 2DKSA 1NDMB 3WJLC 4WTZA 3WS6C 4PV9A 2I27N 2NY5C 3LKPB 2YN3A 3FQWA 3P4LA 4AJ0A 3L6FA 5HHOD 1F4XL 4ONOA 2IAMB 1KPVA 3EDJA 1FL3B 2MHAB 1UJ3C 3N1QC 1I8MB 2LU4A 2AP2A 3QFJE 4ZUTB 1MPAL 3UJTH 4F15C 2MCG1 4X9GA 1Q9WA 2DMKA 2JIXA 1IM3B 1KC5H 3FT2A 4DTGL 1AGFA 3S9DB 1NUFA 2BOBA 2HAZA 3QRGH 1MCPH 3MRGA 4LCYA 4YLQT 1K6QH 3UTPD 1OD7A 1PX4A 3U9PL 2XI9A 4J4PD 1MEXL 2FX7H 5TDPA 5C71A 2NR6D 4JFFD 3ZDZE 2EDXA 4Z77A 4GQPH 5CJXC 3DV4A 1BF2A 3OL2A 4I48B 3E1F1 5CBEA 3X11A 5EBWB 1NBYB 4PG2C 3MRIA 4KRNA 5DJCB 3KR3H 4ZD3L 4PGZA 1XGPA 2HKHL 3UPRA 1SMAA 4ZOBA 4I0PC 2QADD 4LARL 5I1CL 5E5MB 2ZSVA 3T0XA 2QJDA 1IMHC 5EN2B 1X4YA 2DM4A 4PJDA 1JRHI 5F70A 3WV0A 4OLXL 4V1DB 4JFDD 1OAXL 5JXEC 4PGBB 1QVOB 4DZ8A 1AO7A 4RA3A 4RGMB 3TBYA 4PTTA 1KEGH 4YHZL 2BVEA 5TGBB 2BP3A 4FQXA 4M1CD 5CIPH 3E3QE 3N06B 1RURH 3OX8A 4C4KO 3IAGC 2R9HC 3O9WD 4HF5H 2EDOA 1GGYA 3LV3A 4F9PA 4PRPA 3A67L 1UQSB 1NKOA 4L9DA 4OCRH 4KK5C 3BUTA 4KTYA 4YX2L 4J6RL 3PDGA 1R5WA 5D1QC 2WBJA 3CPLA 4JFEB 1XR9B 4LQ1A 3S3SA 3WUZA 1FO0H 4JPWL 4XPFL 1NC2B 4KGJA 3UCRA 3MV8A 4XNZC 4OCXH 3BE1H 2R1XA 3VGGA 2A0LD 2WBKA 1GZPB 2XZZA 5IQ9A 1JK8A 3DV6B 5EG6C 1NMAL 3NVQA 3KGRA 1BLNA 3VWJD 4TUKL 1YA5A 4C83B 2X10A 4UINL 1T20A 3AB0B 3Q6GH 4N0UA 5J3HC 5F8RC 1MHEB 3ZDYF 3EOYG 5MI0C 2GI7A 4HHAA 2I9TB 3BGAA 2X4UA 2RQ8A 4FQCL 4ERSH 1UENA 4GG6F 3SJVD 9CGTA 5I71B 1FFNB 3CLEH 5FEBA 4JQXA 4HH9A 1ZGLA 5I0ZA 2IH3A 4P46B 4OZ4A 4TUOA 3RPIB 4LHUA 3RWFB 2IANA 1WCBA 3PNWB 5E8EA 5EU6B 3C09B 4GRLB 1BBDH 3IFPB 3LN4B 4JANB 3U9UB 2MKLC 2Z91A 2NX5D 1N3NB 4BH7B 4O2CB 2N1KA 4HZAA 4O51A 2P1YA 2H26B 1IAIH 5I75C 1C7SA 4OTXH 5AZ2L 4ZUWB 1HH9A 1SEBA 2XZQL 4NNYB 4YE4H 1CBVL 2X1XR 4ZUUB 4A6YH 1I7ZA 4OF8A 5D7LD 1KXTB 3O81A 5TH2A 2A6DB 5HD8D 1YEGH 2ZG2A 4XAWH 2PO6B 5C0BD 1YQVH 3MCLL 4LDLB 2B4CH 3VXUB 3IKCA 4AM0A 4KHXH 3QWOB 2GJ6A 1KYOK 4ZNEE 5I1GH 4X7SH 2DWDB 3ARGA 2W65A 4ENED 3PHOB 5GRVK 4MXWH 1NGQL 2Y6SC 1MFDH 4Y2DD 1JNNH 1DQML 3TWCH 1U8QB 4YDLC 2DQEH 3VU2A 4PJ7E 2ARJQ 2VIRB 1TFHA 1GGCL 1PKQB 1CLZL 1MRCL 1UC6A 5CEZH 5IMMA 3WHXB 5TJWK 5JDJA 3Q2CA 1F3DH 4MNQA 3GMLA 3LKRA 4V1DE 12E8H 1JMXA 4Y7MA 4I18A 4G6MH 5EORL 3ULVF 1FG2B 3SO3C 4PY7A 4LPVA 5E2UL 4DUWA 2YPKA 5I73B 5JIPA 3PV6B 4NQVB 4E42A 3BEVB 3IDJA 2YKLH 4PJXF 4P5MA 2MCPL 2Q7NA 3VA6A 1B0RB 4P5TA 3BDYH 2K7QA 2OJZL 2UY7A 2XXMB 4F7CA 3QUYA 3C2AH 3MO1A 5TDNB 2X40A 3JWOH 2W9LA 2Z8SA 5C08E 1S78D 1BBJA 1AXSA 1EEZB 2OP4H 5DZLA 3ROLB 3K46A 3CUPB 1AGEA 3D69A 4MA8L 4KK9D 4WFGD 1SVZA 4Y16B 5E2JA 1QHOA 1H3XA 1DFBH 1VADB 2VDOL 1YY8A 5ADOH 3VRJB 5JHDD 1AO7D 2E6PA 5EBMA 2NXYC 4OGAC 2BY1A 2CSPA 4M8QB 5EDXA 5DLML 5I1AB 3QDME 1RZFL 1VFBB 2HLFC 4FQXD 3LKNB 4RGNC 2NY5H 4DKFH 1INDL 5HTSA 4WU7A 1AD0B 1AIFB 2ICCA 3HZYB 2IEPA 2NY2C 3OAYK 4WENB 4PRPD 4P2OA 2DRUA 3Q3GB 1YNTB 3I3DA 3SBWA 3RUGB 3AY4A 3VD3A 5IMKA 2AGJH 5HY9B 4ZPTA 2A6KB 1K5NB 3FFCD 3TJHC 1TQCC 4UILL 3TEUA 5IB2B 1L9NA 2XNAB 5DT1L 3H3BC 4QRTB 3BZFA 3MV8D 1ES0B 3ARDA 2AXHA 4GFTB 5E4IA 1PAMA 3DMMB 1KXQE 2VLRA 4RAUA 3KDMA 3FJTA 2DL9A 4L4VB 1B0WA 1O7SA 3BZ4A 4XC3H 4U31A 5LAXB 2JTDA 3P0GB 3KAAA 3VXNB 5D9SA 5FGSA 3UTZB 4M6AA 1MCCA 4OZIB 4I5BB 4FTVB 2XTJC 4YDIL 4IS6A 2NXZD 5A2FA 1XGTA 5J11C 1S9YB 2OMBA 3MRNA 3IU4H 2BK8A 5IJVB 2NY0C 2W9DH 1RVFH 4RISH 2QSCL 1H9VA 2PTTB 5DA4A 4Y4HB 5TQ2L 4UB0H 4S1SL 2YWZA 1ZLUH 1NGWA 4PRAA 4LOUD 1FN4B 2XPGA 2J1KA 4UDTB 5MEOA 4G6KL 1I7RA 3FOMA 3PWPE 3AS0A 5CSBA 4M03A 3MRPA 4NRYB 2CK0L 4G8IB 4LHUD 2IAND 3HE7A 1F3JB 4KUZH 2A74B 3BH8A 3RVTD 2VAJA 1I8KA 4KXZH 1U3HA 2HH0H 1IL1B 3M07A 1EZVY 4BFGA 5JR1H 3BPLB 3NZHH 1NLDL 5I8CB 2GSIB 2VH5L 4U7MA 5I0DA 2Q6WA 2VE6B 1INQA 4HAGA 1ZV5A 2CR6A 5CIPA 3CXDL 5L7XL 1BZ9B 4K7PH 3FOLA 2F54B 2AJZB 2W07A 3ULVC 2D31A 3SDDC 1KGCE 3HMXH 3IFOB 1U8NA 5EULV 2AEIT 3QEGL 1GRWA 4WHTB 1XCQA 4Y4KC 5T3XH 5FYKL 3QO0B 3ZE1F 3DLQR 4NSKA 4K8RD 1KOAA 3MUGB 1M1SA 2GJ6D 4RFOL 5CS7A 3ARGD 4OKVB 3ET9F 1KTDA 4CN6A 4P57B 3IRPX 4MQSB 5EU5A 4LSTL 5JNYA 5DFVC 3QIWA 4CADB 3EO1A 4XP1H 5HYFA 5J06A 4K7FA 1NDGB 1JHLH 3WIHL 1BFVH 5HDBE 3OKKA 5KTEH 4MD4B 5L8KB 2QHRL 1K2DA 4HJJH 4FZ8H 2EICA 5KS9A 3QXWA 1IEBA 1T03L 4MNQD 1WBZA 1N6VA 1DE4B 5JQHC 1DVFA 1H5BA 1RZIB 4X6CB 1E6OH 2H1PH 5AAWA 5HHNA 2OZ4A 5D1XA 4LPCA 1NAMH 2B5IC 3B5TA 3GJEB 1HHHA 3VGAC 3H6JA 4XVUC 4MJ5A 1T3FB 1BAFL 3P0VL 4X98B 2M2DA 4G8GB 4HWEH 1QLEH 1WAAE 3ZDXF 4AMKL 3PIQB 5J13B 1FAIH 1P2CA 2GCYB 3WJJC 3TESA 5EO0B 3LQAL 3F7PC 1WK0A 6FABH 1T1ZA 1CF8L 4ZXBC 3QUYD 3MZGB 1CZ8H 5C0DB 1PG7X 3PHQB 2IFGA 4DCQA 1JPST 5K9JL 2PW2A 4YBLB 5ESAB 4IRSA 2DAVA 1X7QA 1G7MA 3SE8H 4NJ9L 3LEVH 1I85C 3WHE1 1JI1A 5B3JE 3BW9A 4L4VE 4CVZA 4IDJL 4KKNA 3ULSA 3LS5L 2UWEF 1YC8A 4N8PA 3C9NA 5DJZB 1JPGB 5DVOA 4NCDA 2DICA 1UKSA 2AQ3A 3HNSL 4EIZC 1UKTA 3NZ8B 4LCUB 4OZIE 3O4OB 4UAOB 2NZ9C 1CVRA 2DMCA 1YDPA 3OXSA 2AXFA 2HVJB 3NIGE 2ZUSA 4P2OD 1N4XL 3RDTC 3D85A 3PL6A 2DF3A 1OB1A 2CRZA 4PRHB 4GSDH 5CSZB 3KXFB 3N85H 4WV1C 5E95B 4PB9H 5T3ZE 3ARDD 3K74B 5A16B 4M6NH 3VG9B 4ODTL 2X41A 4E5XA 2Z31C 1A4JA 1S7VB 1VB9A 2VLRD 2AJVH 4OLZL 5GZOD 4PJAF 5J1AB 3NFSH 3HA0A 4CL7A 3BI9X 4GMTL 1CK0H 4U7SA 4PLKC 3D3VD 3VD9A 1QLRA 2NNAA 2BVQB 2HT2C 4FQ2L 4PRNB 4I3SH 1R5IA 2FRGP 3STBA 3GMOB 3G6JA 3TT3H 5L9DH 4U3XA 4KAQL 2EDJA 4S1RH 1DQDL 3P30H 3ARBB 2Q76B 1RULH 4H1LA 5DUML 4D0DA 1CS6A 3BQUB 3QPQC 5F1NA 5CFHA 3HC3L 3I75B 5D6CB 4WHDA 1L7TH 3BP6A 1QUNA 1KN2H 5K59E 1U8HA 3IS0X 3INUH 3HE7D 3MJ7B 3GJFB 4NWUL 1LP9F 2QSTA 1I9IH 1UYWH 4JREC 1U3HD 5KVGL 3SY0A 1U9KA 1ZTXH 4M1GL 1IGYA 4EBQL 1SJEA 1UFUA 1GPOL 1R3KA 5F3BA 1FV1B 4OCNC 5FYLH 1IAII 3X3FH 2NW2B 4ODSL 1QBLH 4XNQB 3WJLA 2J4WH 2ADJB 5I2IB 4H25B 1LO3H 4S10A 1A6VH 3MV01 1REIA 4KKBD 4X6CE 5ENWB 1WLHA 3CDGA 3V5HB 4LLVA 5HGGS 1MCHA 1INEH 5EWIH 3FN0L 4XVTL 5F7FA 2WBWB 3C8DA 2WANA 4IJ3C 3WN5B 2APFA 2IADA 2O26U 5CBAB 15C8H 4FQIH 2EIEA 2DQTH 2FX8H 2J8UA 3GSNH 4XCEB 3OB8A 4LKXB 5GS1C 4NO5A 3C60C 1T6VN 3QIWD 3DRTB 1C16B 2PR4H 5FYJH 1OSZB 5GJTL 5H94A 4PP1C 4M43L 2QQNH 5EZOH 4JB9L 1QQDA 1XF5A 5EUKB 4Z76B 2HWZH 4MQXC 3BWUC 4Z7WF 2VUYA 1KCVL 1I9RH 1MWAL 2I5YH 2KBGA 3T0DA 3CVHH 5LKNA 1YEHH 4PG2A 1RZJL 1DQQA 5JORA 4DKAA 5T1LA 1XEDA 1ZWIB 5D1XD 4PBVC 4PRDB 3BEWB 4HKBB 1J0YA 2CLVA 3SE3A 1JPSL 1B4JH 5ALCL 5GGTL 4KPHL 4P4KA 4FFYL 1KTRL 4PLJC 4GQ9L 1KSRA 2PXYA 2DBLH 3MLTA 5F7DA 2UZYB 1MREH 4POUB 2FZ3A 3CSGA 4NP4L 4PRHE 3O6LH 1ZHNA 1OTTD 2DQUL 4J1UA 3KXFE 1I1FB 2LTQC 5C9JB 1XFPA 3CK0H 4OGZA 3JV4A 5GZNC 4UIMA 2WINB 1EEYB 2CXGA 2ORBH 4TVPH 4XB8A 3VXOB 4AEHL 3QO1B 5JIHA 4ZNCD 3TZVA 4I2XB 2YC1A 2Q86A 3T0AA 3OJDB 3FO1B 4GKSB 5HGDA 4BZ1L 3HMXA 4K94L 3RGVB 1FFOA 4D0BA 3WLBA 4G7YL 4NQCD 3V5KB 2C1OB 2X4PB 2A9NL 4RIRB 4AG4H 3IS1X 3IFNL 5SWSB 3R06A 3D85D 3PL6D 3S88L 3GI9H 1GC1C 4RGOH 3DURA 4U4BA 4Z7VF 1F3DJ 1H8NA 4O02L 3MCKA 5AYQA 1U8OA 4JGUA 4H5SB 4XMKH 5I1DB 1YN7B 5D6DC 1MCEA 4G80B 5FKPA 5CGYC 2HVKA 4TTDD 1JGLL 2JJVA 3HMWL 5CEZD 4QXUH 4NQXB 4DKDC 2NY6B 2DD8L 3LKSA 2VDML 1C1EH 1H15A 1RK0B 2YZ8A 2EEDA 2EDFA 4L1HA 4XXCC 1Z5LA 4NZTL 3L5WA 4LAJH 4HS8H 3VFUB 1NAMA 4Z95L 1V5JA 4X8JA 4PV8B 1CDYA 5D93C 3V0VA 1M7IB 4QT5A 2EECA 1FIEA 4MD5A 3PWNA 4LQFL 3QQ3A 3EYFB 4FFWD 5B22A 3U7YH 4QXGH 4P5KA 1DCLA 1EERB 3CSYB 4JG0H 5KW9H 2H2PC 1P4LB 3GI8L 1BPVA 3HC0A 1M05A 5CMAB 5I1EH 3DVIA 5AYUH 1NFKA 1T5XA 1FYTB 1U8MA 1P6FA 1TCRA 1QD0A 4UBDC 5B4MC 5F7HA 1FCGA 1TZIB 3MFGB 3MUZ1 5FDYA 4OCYH 2PN5A 3OXRA 3T0EB 1R24B 4EI5A 4YR6B 3VXTA 1CDGA 4N8CL 2VTFA 3NACH 1CU4H 3DVGA 5GRVL 1U58B 3GHBL 4WO4B 1OGAD 4XNXL 2OYPA 3BZEB 3EYOB 1HOCB 4YXHL 2UV3A 3MNZB 3CFCH 5ADPL 3I6LE 4R2GC 4POZD 2X1WL 4JDZA 1BP3B 1IEAA 1MNUH 4IMLB 4Z7OE 5D2NA 1M71B 3DX9B 3X13B 1N7ML 1FIGL 4ZTOL 5I16B 2HRLA 3QPXL 4QHMB 5EH1A 4GW4A 5LJYH 2ZNXA 4JO4L 3L3IA 4YZFE 5IVXA 1TCMA 5FUCC 3M1BB 1FLRL 1JWMB 1IQDA 4H20H 3SKNB 3ZTNH 4XXDA 2X70A 5IBTL 3H42H 3P11H 5FYKE 5T1LD 5FB8B 1JNHA 1KT2A 4GJTB 2E27H 4I2XE 4M7ZB 1I3VA 1MHHB 4OZHA 2AQ2A 3D0LA 4X4YA 4EUPH 5IROA 5LCVH 4DOHB 3O45A 1X5AA 3RU8H 5BV7B 4Y5VC 3EBAA 3TFKC 4P4KD 2GJJA 3WFCL 3F6LA 4QO1A 4XC1H 5L0QB 2PXYD 4LEXL 3PWLB 4Y8AA 5KZCD 4OD1L 3U79A 2EKJA 1NBZA 5SWQB 2CLRA 5IVZA 4PJIE 4X6DB 1A3QA 5AEAA 4WUUB 2F19L 3FB8A 3MODH 4U1GC 3VGBA 3VW3L 3P73B 2A77L 4X4XB 1H3TA 2ZSWB 5EPMB 4PJ9B 4F7EB 4GW1A 3TN0A 4WDIA 3TZVD 5JPMB 4JGMA 4YBQD 1TJIH 3D2UB 4GAGH 4LLAA 2F8VA 3ALWA 3MRDA 3DROB 5AUMA 4WWKC 3QSKB 2KQNA 4PGCA 1N59B 3WE6A 2BSSA 1J18A 4YHNB 3WLWD 3ECBB 2HTLD 5T3XD 1E4XL 1MQ8A 4R6UA 5TE4H 2GAZB 5INCA 3GBML 4Z8FH 5DQJA 4ONGL 4NO3B 2OR9L 2H6PB 1HXYB 1YEJH 5IBLD 3KPPB 4RQQA 3WSQL 2Z8WC 2R0LL 2EZ0C 4JPIA 3GSNA 5D7JA 2V2WA 3BYTA 1KULA 1J9CT 1MWAB 4R3SB 5IEHA 4W4NA 4JVWA 3GMMB 3V6OC 1P84J 1MVUB 3OKEB 1TZHA 5EZJA 4ODUA 3U0TB 5HVGB 1VACB 4G6FD 3DO7A 1YJDH 4CDHA 2SEBA 2QR0A 3B2UD 2HKFL 1G7QA 1NGPL 3CVHA 1TJGL 2DQHH 4X7EC 3OJVC 2C9AA 3ZZ1A 3T0EE 2H2SC 4HUXA 4TNVK 1IFHL 5C2BH 4PJBE 1T0MA 4WUKL 1J86A 1QACA 1FORH 1I8LC 2X7LB 4ZAKA 4PJFB 1OD9A 4PTUA 4OT1L 3EJZC 4GKOA 4HXBL 5KSAA 4KDTA 1IQWH 1DQJA 1HN1A 3QULB 1X5XA 3O3AA 2JB5L 4LVHB 3GHEL 5EU4B 3S37L 1X5ZA 5IFHL 2BCKB 1JNLL 2X4NB 1QOKA 3QDGA 1OLLA 5BZWB 5HYSA 5HI4D 1WEJL 1DSFH 3CCHB 3FT4A 3HR5A 4XPGL 4PJXA 4K3JL 2AABL 2DM3A 3RVXC 3V0WL 1A9EA 1I7UA 4X4ME 4EI5D 1GC1H 5FECA 2FO1A 3IDXL 1MH5B 3WXVH 5I8EA 3T1WA 4K71C 1ZLUK 1JV5A 5A3IC 1Z6JT 4NQDB 4PY8I 3JVGC 1GOFA 3VRIB 4F33A 4P99A 4QHUB 4I9WE 4QHKI 3NCYP 4ZDHA 3HUJB 3TO4C 4DVBB 2NLJA 2XACC 2QBWA 1CL7H 1MJJB 2E8ZA 2YS4A 3BISA 4FXKA 4QRQA 1I75A 5ETUA 1DL7H 1P1ZA 5C6WH 3L3JA 2EDDA 2K1MA 1HSBA 2ED9A 3TYFB 3ROOA 2F58H 5HHOB 5KG9B 2CUIA 2Y06H 2H9GB 1JN6B 4LVNC 1M6OB 5HYJA 3V4PH 1F6AA 1CDIA 4LSRL 4JE4B 2C1PB 3TGXA 3D18A 2N7BA 4X6DE 1JTTA 2QV2A 3I02B 3FO0L 3QXDA 3U82B 1GAFL 2ZUTA 5DEFB 4JFFB 2WIIB 4YEEA 5FOBA 3CNKA 5C0RH 4FQ1L 1KJ3L 3MFFA 5SWZA 3FN3A 3QHZH 2HJKA 1CFNB 1EV2E 2BHYA 3OKMB 3BYYA 5IT2L 1F4YH 1T1XB 1L0YA 1F8TH 3MACH 4ZPVA 2XXCB 3P4OA 2DJ4A 2XZAL 3C2SA 1A6WH 2R4SL 4XP4H 2HLFD 4RMRA 4OAWA 2QADB 3AXLB 3BUYA 4RGND 1NAKL 1OWWA 4LU5H 4XZUA 4PY8J 1EBPA 4QHKJ 2ESVD 2W1NA 3C6LA 2NY2D 4JFDB 3S5LA 2DI7A 1T0PB 5DK2B 2BRQA 1A02N 5D7IF 1P84K 1YN6A 4JO2H 5DRNA 3RKPA 3MNWB 3NCBB 4Z0BL 1TXKA 5FYLD 5HI5D 3TN0D 3TJHD 4R26H 2DQFB 4RFNB 5FDWA 2CJUL 3O9WB 4KMTH 1OAYL 1PLGH 3SDXE 3RNQB 3ILPA 5E9DE 4L8DB 2FECI 5DYOB 5ICXA 1IM9B 2AAVA 1F6LL 4N90E 5CZXD 3S5LG 4M6MH 4YEFA 1VFOA 2GTZA 3EO0A 1G7PA 3UTOA 4YWGL 3NA9L 1D5XA 4LP5A 3IGAA 3QCTL 1VPOL 2EKSB 5ID1A 2VDQL 4PJFE 2XTJD 2OXGA 5DDHB 5D7JD 4U6VH 3ORJA 5DFTA 1C7TA 3OMZA 1OP5H 4XP6H 3L3KB 3SOBL 2NY0D 4K8RL 2ICWA 5FYJD 1GGTA 3RVUD 3F58L 4MHHG 1B6DA 3G5XA 4OZGE 3BJ91 5H2BB 3VFSB 2EO1A 3S98A 3GKWL 4Y0GA 4HKZA 3C08L 2C3GA 3SDAC 4H8WC 5C7XL 2Y07H 4U3CA 3L3DA 3CSPA 4O2EB 1RZ7L 4R4NC 4IOFC 5TF1L 3BGMB 1Q1JH 4NQEE 2YA1A 5F1IA 5DGQA 3P2TA 1RIUH 1AFVH 2H32B 2IWGA 3SJVB 2OLDA 5J56B 4MSWA 3UAJC 1M7DA 2R1YA 3RTQC 1U3JA 1R0AH 4LRNH 5IW3A 2VLJE 5F9WB 3T4AA 2G2RA 4EUPA 2O5YL 3GB7A 1PFCA 1N5AA 5I8OL 3SDCA 4ZAKD 3TCLB 5IQ7H 3HUJE 1XF2A 2UYLB 3MLXL 1JFQL 4G9FB 1U3ZA 4RNRB 5KSAD 3MXVH 1YEEL 3MA7B 4TOYH 2NX5B 4X5LA 1OT2A 1YEIH 4MA1B 3MV11 2BNRA 1FAKT 5TE7L 3QXAB 1ZVYA 3K7UA 4TQEL 5I74C 5HHOE 3QDGD 4YXKL 3GMQA 4F57H 1FBIH 3CLFH 3EO9H 5CEXB 5E2WH 2VXSL 4LL9A 4TVPD 5EOTB 3H9HB 4OD3L 4GBXC 4L8SC 1MHPL 5H37H 2BX5A 4F37F 5D7LB 2GY7B 3O6FC 4JN2B 2QLVB 3WMSA 4HS6B 1G9ML 1VGEH 3SQBA 1CQKA 4RWHA 4JM4H 1RU9L 3ARQA 1L0XA 4PUBH 2CDEA 5GIRB 1AH1A 5J12C 4JFFE 4MHHI 3VCLA 2HFEA 3TA3C 1RZ8A 2AJSH 3PQYA 1J8HA 3JTSB 4C57C 5JOPD 1U41A 1QRNE 4LEOB 4MD0B 5CZVL 4GRWB 1QSEE 1DANT 4Y2DB 2UWEA 5E1HB 2GY5A 4PV9B 3FQWB 4KRMB 3L6FB 3QQ9D 4K3DH 4APQA 5J8OA 4GAFB 3G5VA 4LSVH 4N5EC 2FR4A 3BWAA 2VOTA 5HYJD 2ICWI 4XVUD 2ZKHH 2ZPKH 3GRWH 3HRZA 3DX8A 3FZUC 3NIFF 3IDGA 1Q9WB 1QLFA 2GK0B 2HT3C 2JIXB 4JCLA 5DMKB 3FT2B 1ACZA 3GO1H 1AGFB 2BOBB 3MRGB 4LCYB 2E3VA 5TDPB 2AVGA 2OS7A 5DJAA 1UA6L 4ZQKA 4Z77B 2V9TA 2GITA 1KC5L 1JHTA 5B3NA 3DV4B 3QRGL 2EE3A 1MCPL 1I9EA 3GM8A 1NL0H 1K6QL 2EXYD 3CFKB 1QFWM 5CBEB 2FX7L 4K07A 3MRIB 4X6FA 3PXJA 5INDA 3TT1H 1XGPB 3UPRB 5I6XC 4P2RA 2LABA 2ZSVB 3S35X 4E0RA 4NC1C 3C6LD 3OTTA 3X14A 1JPFA 2UUDH 3KR3L 4N0YH 1PG7H 4DZ8B 1AO7B 3TBYB 2ZJSH 4PTTB 3BKYL 5JDSA 1NMBH 4FQXB 2X1QA 1IGMH 3DTXB 3UTSA 4UV4L 4CU8A 2MQ0A 3OX8B 4AEIH 5I8KH 3GGWA 3LV3B 4PRPB 1T2QH 4KKLC 1X5GA 2ICWJ 2XN9D 2DIBA 3O6MH 5CD5D 1SQ2N 1R5WB 1RURL 1J12A 2APVA 2WBJB 3CPLB 2YRLA 5ELIA 1FE8H 6CGTA 4HF5L 2VDNH 3MV8B 4KFZC 2R1XB 3BAEH 2IC2A 4J3WA 4OCRL 3K0WA 5IQ9B 1JK8B 1NFDE 2A83A 2J7LA 3K8KA 4G9FE 3ARXA 2NX5E 1BLNB 1G9NC 4K23H 3DNKA 5DURD 4U1SA 4OCXL 1ACYH 3BE1L 1D5IH 1D9KC 1MCWM 1T20B 3QPQD 4N0UB 2NXZB 5SX4H 4HHAB 1CFSA 1PYWA 2X4UB 4AEEA 3LDBB 4CU7A 2BNQA 5D7LE 2BHZA 3Q6GL 4X7DC 2JCCE 4HH9B 1ZGLB 3QEQA 1U95A 5L2KA 1KCKA 2IH3B 1VFAA 5C0JA 1NCCH 4K3EH 3U46A 1YEDA 4OZ4B 3WUWA 3PG2A 4TUOB 2EYSA 3AREC 4OIIH 2OZ4L 1S5IH 3B5HA 3W81A 4LHUB 2FSEA 4ERSL 2IANB 4L8CA 1WCBB 1H3GA 5D7KE 3C5JA 5E8EB 4RRPA 3CLEL 1IGTB 2ZUXA 2Z91B 3SKMA 3ARTA 4Z6AT 2YK1L 3PJSA 1ERNA 2BNRD 3PGFH 1K8DA 4Y1AE 1H3VA 4R4FH 5D5MF 1BBDL 2FL5A 5EUOE 5K93A 1HH9B 1SEBB 1SJVA 5BW7C 4FXLA 4XGZA 3F7QA 4RRPG 2R29H 1I7ZB 4QHLA 5E03A 1Q0YH 1QPPA 2NYYD 2P7TA 2WUCH 4GS7C 4D9QE 1CN4A 4HSQA 1WBYA 5TH2B 5EIIA 3CMOL 1L7IH 1IAIL 2DBJA 3QIUC 3L1OH 4YE4L 4N9OB 4PP1D 4LPTA 1XGUA 3RWEA 3IKCB 4AM0B 4LSSH 2GJ6B 1CL7I 3PQYD 1J8HD 4H8WH 1EDQA 3ARGB 2W65B 1FFPA 4S0TD 1YEGL 4XAWL 4HPOH 5JIIA 3MRRA 2ATKA 4NPYA 4KHXL 4APQD 4N9GA 4DEPC 3QDJD 4X7SL 4MXWL 5IMMB 2BVYA 3GBNL 1MFDL 1JNNL 3TWCL 1UCTA 4WFGE 4MNQB 4PJDE 1ZXQA 2DQEL 4N0CC 1B3JA 3GMLB 3LKRB 2V2TA 1I3RA 1TNNA 3FRUA 4I18B 2B0SH 2IFFH 4Z7VA 1AO7E 4PY7B 5CEZL 3WEXA 2Y72A 2YPKB 3RWHA 4E42B 3IDJB 4P5MB 3GZKA 12E8L 1DLFH 4P5TB 2UZXB 4U1LA 2LVCA 2CO6B 4F7CB 1WF5A 3QUYB 3LEYH 3MO1B 1A1MA 1NCWH 1NMCB 1BX2A 4OM1H 3ZKMD 5BS0E 1WZMA 4MZ3A 1K8IA 3LMJH 2YKLL 4NM8H 4KQ4H 1CDBA 1BBJB 2ZCLL 3MLZL 3MV9A 4ZSOA 1KUMA 5KVDH 3I2CH 1MJUH 4B0MM 1AGEB 3D69B 4WFEE 5IBUB 4OCSH 4X83A 5FXCH 3V9FA 1YY8B 5JOEA 5TQ0H 3C8HA 4OKDA 3VXSA 3NABH 5EBMB 5E4EC 3GDBA 2OP4L 2VZSA 4BSWA 1LVEA 1WV7T 4ELKA 4WU7B 1DFBL 5CJ5A 2YD2A 3MRFA 3HE6A 1CD9B 5CGYD 1K3ZA 3KS0H 4P2OB 3ZL4H 1GOHA 5EB9A 3MREA 4DKFL 5IMKB 1S7WA 4ZPTB 2EH7L 4KTDL 5H37G 4Z7NE 3BZFB 5F9DC 3ARDB 2HP4A 3OQ3B 4U1KA 2IANE 2VLRB 4RAUB 3B5GA 3KDMB 2AGJL 1LO4H 3AC0A 3SKJH 3BZ4B 4G6JH 3GRWA 4JPKH 1OQOA 2ADIA 1EGJH 3WKNA 5D9SB 3D3VB 5ACZA 3NPSB 4XX1E 5C07A 4CRPA 3U0PB 4IS6B 1FQ9C 1XGTB 3MRNB 1KELH 4XC3L 3T3PE 1JIBA 4YHYC 3PV7A 5D1ZA 2BNQD 3FRPA 3SGKA 3K2UH 1F4WL 3OKOA 4G6AC 1E6JH 3QEQD 2YUXA 1NGWB 5I9QC 4PRAB 4KK8C 5L2KD 1RUKH 5MEOB 3IU4L 1I7RB 3FOMB 1F4HA 1UH2A 2VXQH 3MRPB 1RVFL 3OG6B 5DS8A 3HE7B 1DP0A 3BH8B 5F71A 3ZHDA 1I8KB 5GRWA 2GJ6E 1RZKH 4MS8D 4UB0L 1I3GL 1U3HB 4AIOA 1KBGH 5DGRA 2V9QA 4NKMB 4JDVB 1IKFH 1BFSA 3GIZL 3ZE0F 2W38A 4KUZL 5CKGA 1HKLH 3R0NA 2Q6WB 1INQB 4DGIH 5A2JH 2VKXA 5CIPB 3VFNB 2W9EH 2YWYA 3FOLB 1W8NA 1WT5A 4MNQE 5JR1L 2D31B 3EOAA 2KPNA 3NZHL 2EYTA 1U8NB 1EAPA 1XCQB 3KPLA 5CSGA 5B39A 1G9NH 4OLYH 3DO3A 4NSKB 4G8FA 5TE6H 3SPVA 2HJFA 3GSWA 4KRPC 5EBLA 3HMXL 1KTDB 4JFPB 2HMID 5EU5B 5T3XL 5JNYB 4IRJC 3QIWB 3EO1B 1BVLA 1IBGH 4K7FB 3LS4H 2M8XA 3RP1A 3OKKB 1SY6H 1MY7A 1K2DB 4LCIL 1OHQA 2MTPA 2WZPD 5KS9B 1T66D 1IEBB 3QUMA 3PXHA 2PCPA 4WW2F 1WBZB 4FFVD 3S3PA 1DVFB 1H5BB 4F7PA 1JHLL 4Q9BA 1BFVL 5KTEL 4NWTH 5F6HJ 3QDHA 5HHNB 4FZ8L 3LIZL 4KDVA 3LPFA 5D1XB 2L0DA 1RIVH 1HHHB 4DGVH 4P2QD 4MJ5B 3G6DH 1EX0A 1IGJA 3O11A 1J1OL 1E6OL 5E99H 2X4QA 3MRMA 3QJFA 1P2CB 3V4VH 5BOZG 3TJEH 5GQBA 1T1ZB 1NAML 1DDHA 5JA8B 4KJWD 4OLVL 4DAGH 4QHNA 3SGEH 2VRAA 1AY1H 2X09A 4HWEL 1QLEL 4DCQB 1T5WA 3QXUA 3MV9D 1FAIL 4Q9RH 4G43A 1FZMA 3VH8G 2PW2B 5FUCE 4P48A 2WLZA 6FABL 1X7QB 3O2DH 1G7MB 1CZ8L 2VLRE 1WC7A 4CAGA 2VSCA 3IDYB 5BRZD 3BW9B 4DN3H 4CVZB 1LQSR 1YPZB 3ULSB 3VXSD 5B8CA 3C9NB 3K4DA 1XGQA 4MAYA 4X7TA 3EW3B 3DRQA 3SE8L 3VE0A 3LEVL 1ZHBA 3QFDA 3QHTC 1YDPB 3OXSB 1Y6NR 3VRLE 3HE6D 4ISVA 4LSQH 4QOKD 4XAKD 3KJ6H 3U4BL 3PP3H 2OL3H 3D85B 3PL6B 4R4BA 4ZOAA 3U7WH 1MCSA 1OB1B 3IF1A 3DGCR 2CQVA 4DK6A 4JKMA 2J6EA 3VG0H 3PNWA 3S6CA 3VGHA 5EU6A 4B7LA 1AC0A 4E5XB 1A4JB 1K9TA 3U9UA 1MI5D 4D9RE 1B88A 1E4KC 4GSDL 4GT7A 2AI0H 4M5YL 3N85L 4O2CA 4PB9L 1S9VA 3Q1SH 1IC4H 4P23A 4M6NL 1ZAGA 3QEHA 3EJZD 2AJVL 2NNAB 5C07D 4ZUWA 4ODXA 5JZ7C 5EO1A 1R5IB 3NFSL 4JJHA 1ZLWH 4ZUUA 5K33A 2ZOLA 3DXAA 5SX4I 4OZFA 1HQ4A 3G6JB 5GRZA 2Y7QA 1CK0L 5DZNA 5D1ZD 3RFZC 4ZTPH 4LLDA 3BN9C 3NBNA 4UNTA 3BKCH 4H1LB 2PO6A 2XY2A 2Y25A 4D0DB 4I3SL 5F1NB 4YC2C 5ILTH 1TIUA 3TT3L 5L9DL 4NKDA 3BP6B 2F8XC 1Y0LA 3QWOA 1U8HB 5HVHB 5GSVA 5FYKU 3P30L 5LWYH 1V3MA 1J10A 1RULL 5D2LA 3RVVD 3U1SH 5GS0H 3V6OE 1VDGA 4X5WA 4HWBH 1KN2L 1IGYB 1SJEB 3INUL 1QG3A 1R3KB 5GHWH 5F3BB 1U8JA 1UYWL 3SQOL 2YPLE 4WW2C 5KS9E 2CPCA 1EXUA 2Z93A 3CDCA 1ZTXL 2O93L 1OGAB 2YD8A 3CDGB 1DQTA 4RFEA 4LLVB 1XH3A 1BHGA 3ZDZF 3WFEH 1UB5A 3CH1A 2EDKA 3TCXA 5BQ7A 3BPNB 1CYGA 1QBLL 1A3LL 2J4WL 3ZE2E 4F15B 1DBMH 2IADB 1LO3L 5D7IA 5J6GA 5FUOH 1A6VL 2YD7A 4Y5YA 5HHPA 2J8UB 4RA0C 5FA3A 3D39A 3W5NA 4NO5B 5EWIL 4Y5XC 3IJSA 3ARFC 5CJBA 4ONHB 4XH2A 1W72H 5H94B 1EEZA 1QQDB 1XF5B 15C8L 4FQIL 2QQLH 2V7HA 1D6VL 4O5LH 3MLUH 1CGYA 1HCVA 1EGJA 2Q8BH 4MAUH 1VEPA 1VADA 5EC2A 2BJMH 5TFSH 2PR4L 3VRJA 1DQQB 4HWNA 1Q9LA 2IGFL 5JORB 1U2HA 4HT1L 5T1LB 2QQNL 5EZOL 4KZEH 4F58H 5IG7A 3AMLA 2I26N 3FCTA 2B39A 3WYRA 1I9RL 4JM2A 2FB4L 2I5YL 4OB5H 3CVHL 5FA4A 1YEHL 4M02A 4KJYA 1JTOA 3BN3B 4O58H 3IFLH 1QEWB 2CLVB 4ZYKA 5LGJA 4P4KB 1HIMH 4FMFA 4PRIA 1MCOH 2PXYB 4MXVE 4KVNH 5F7DB 2FZ3B 5CP7A 3EFDH 4U1MA 1ZHNB 3CFIC 4J1UB 2OR8A 5KVFH 4Y8DC 3MYJA 1B4JL 4FXGA 3JV4B 1KEMH 4UIMB 5DVLA 1RIHH 1MREL 5IWLA 4M4RA 3BRGC 3TZVB 1KCRH 3R8QA 3QIBA 1BEYH 1BZ7A 4JEGB 2YC1B 4XNZB 2Q86B 3CK0L 4YUEH 4I5BA 4FTVA 4MAYD 1GGIH 5HGDB 5E6IC 5DK0A 1FFOB 3E6FA 4TVPL 4UT9L 3WLBB 4D0BB 5IJVA 3KPNA 5JOFA 1S7TA 4N0FA 2GW5A 3T2NH 3BD3A 3G5ZA 2Q8AH 1D9KA 1G7IA 3R06B 4EN3A 3SDAD 3DURB 1KIQA 2FECL 3H9YA 4HJ0D 4L8BA 2IF7A 3MCKB 1U8OB 1HILA 4AG4L 3VXRA 3D9AL 5EOQH 3V7AG 3S97C 5FKPB 1AQDA 2HVKB 1EVUA 3GI9L 4RGOL 5LGHL 1DJSA 2V9RA 3EYQD 1I1AA 4G6FB 3DVNB 2H3NA 3CX5J 1ITBB 4XMKL 5H8DA 3LKSB 2DLHA 4OFPA 4P23D 1H15B 1MCFA 3QNXA 1Z5LB 1BFTA 3VGDA 1Q9OA 2J5LB 4OUOA 3AS1A 3L5WB 2VDRL 4QXUL 3C87A 3DXAD 1NAMB 1L0QA 4X8JB 4N5UA 3V0VB 2E9BA 1MLBA 1C1EL 3P40A 2ZZUT 3PWNB 4MD5B 1TVBA 3OV6A 2WWKO 3QQ3B 2ZG3A 3TBVA 3EYVA 3C8KA 1U8KA 4HS8L 4HKXA 4U1IB 1WWAX 2P45B 1U8PA 1M05B 2F53E 1NPUA 4LPYA 2XWBA 3U7YL 4PJ7F 4QXGL 1J0JA 1A1NA 1JPTL 1U8MB 1TCRB 2V5RA 5FGBA 2EH8H 5T33H 3O2DA 5KW9L 1ZEAH 2XQYG 5C0ND 3KS0J 3OXRB 4PJ8C 2E7CA 5JW4R 4EI5B 3VXTB 5I1EL 3AU1A 4U1NA 2ITCA 5J1SC 2NCMA 5AYUL 1HZHH 5HHME 1BVKA 3DVGB 1FGNH 2XRAL 5F88B 4LSUH 3E3QC 3QI9A 4TSAH 1VESA 3DARA 2AQ1A 3I6GA 1RSFA 4N5ED 3EUUA 2QSQA 3NACL 3D6GA 1LE5A 1CU4L 3DSFL 2OL3A 4KUCF 4KZDH 4NHCH 3BESR 3BMWA 4YO0A 5C9KA 4ZO8A 2DMBA 1YEFL 4JDZB 1IEAB 3RX8A 2XKNA 5D2NB 4NBYB 4I0CC 3D39D 4GW4B 3PGDA 1N64H 3L3IB 3CFCL 5IVXB 1DN0B 1AXIB 5IIEA 1FNHA 5E2VH 5A2IH 3MRKA 3VXMA 1MNUL 3QG6A 1AE6H 4ZODA 3NCCB 1IQDB 4XXDB 2X70B 3RWIA 4UV7H 2FBJH 4M1DH 2ERJB 3QNZA 2Z8VC 1XF4A 4X5XA 1JNHB 1KLUA 2HLAA 4W6XB 3IXTA 4WI7A 4HQQH 1UB6A 3D0LB 4X4YB 3O45B 3H42L 3P11L 1KJVA 3U83A 4C56A 4XMLH 2JKXA 2E27L 3IT8D 5L2JA 1Z9LA 1N6QH 3CDFA 1TPXC 4RGNB 3LKOA 1URLA 2ZP0T 3SGEI 5LCVL 3T0WA 1NBZB 3RU8L 2CLRB 1JF5A 2ESVB 4BK4A 2NY2B 1KIRA 3RI5K 1S9XA 3G9VA 4HWBA 4JHAH 3FB8B 4F3FA 4CVXA 2IAMC 2IQ9H 4GW1B 3TN0B 4WDIB 1JP5A 4MA3A 1KCSH 3S35H 3QIBD 2W0PA 1NUGA 3T2PA 3S34H 1T0NA 4PRNA 3MRDB 5AUMB 4PGCB 1IGCL 3MODL 1AI1H 3CSBA 3WE6B 2BSSB 1OAKL 3TPUA 2YA0A 2JK5A 3CMGA 5FCUH 5INCB 3FT3A 2YUWA 2VLMD 3OAUH 1TJIL 5DQJB 2VZ3A 4GAGL 3H9ZA 4M7LH 3K1DA 5D5MA 1D9KD 1JVKA 4RQQB 3WFHA 3K8LA 2F9BT 2FHCA 1JGVH 3IYLW 2ED7A 4JPIB 2XTJB 3GSNB 4OFIA 5D7JB 2V2WB 5TE4L 5J11B 3CFBA 3QZWA 1D6EA 2R69L 5IEHB 3VXRD 2NY0B 4Z8FL 4OM0H 4DN4L 1YEJL 4NC1E 4KU1A 1TZHB 2DYPA 4ODUB 4AZ8A 1I4FA 2D0FA 1AR1C 1I1AD 5IMOA 3DO7B 2SEBB 1KB9K 2QR0B 1G7QB 3CVHB 4JN1H 1LK2A 1WGOA 5DO2D 3QZWG 3C5ZA 4HUXB 4P9ML 3WNLA 5FUZH 3DYMA 3TV3H 4RGMC 1YJDL 1FPTH 3A6CH 2VDKH 3I85A 1T0MB 2Q1EA 2DQHL 4WEBH 4ZAKB 4HPYH 5SV3A 1VKXA 4PTUB 4LF3A 2HFTA 1IKNA 5KSAB 1DQJB 5C2BL 3O3AB 2ARWA 1A2YA 1FORL 3D25A 1JUFA 1T1WA 5D2NE 3QDGB 5HYSB 5HDBF 3HTLX 5IB5A 1OSZA 2WP3T 1E4JA 3FT4B 3HR5B 5IGXL 4IIQA 4PJXB 3VGEA 1IQWL 4XCNA 1A9EB 1I7UB 5IVXE 3KJ4B 5FECB 2D7MA 5KJRH 2CRIA 5ISZA 5I8EB 1OAQH 1T7VA 1JV5B 1DSFL 2AS5M 3NH7H 4HLZH 1X5LA 4XT1C 3QI9D 4F33B 1OAZH 3P4MB 1O5DT 4FQHB 5HI3C 4ZDHB 1QFPA 2NLJB 4XB7A 4XVSL 5ETUB 4FXKB 4QRQB 5DMIH 1CDUA 4KHTH 3L3JB 4U2YA 1WAAF 4U6XA 1CTOA 1T83C 4OZHE 3B8SA 4FABH 4U6YA 4AIXA 1HSBB 5I71C 3ROOB 2D9QB 4P46C 5EZLA 3UBXA 1CL7L 1TETH 3V6FA 1XMWA 5HYJB 5T1KA 1T80A 2EC9T 1F6AB 3C09C 4NJAL 4GRLC 3TIEB 2DQIH 1TNMA 1U93A 3VXMD 4TN9A 3NFNA 3NGBB 5ICZA 3D18B 5B3JF 1U36A 2Y06L 1HQRA 3VXOA 3QO1A 3QXDB 2R39A 1JMZA 1KENH 1MAKA 3V4PL 2XICA 3UBXG 2W0LA 5IM7A 2XIDA 1TJHH 5FOBB 1PZUB 4W4OC 3OJDA 4OZIF 1A6UH 3MFFB 5MEQA 5SWZB 2HJKB 2C3VA 5C1MB 1MCKA 4F37K 3F7VB 3NIGF 3QH3A 1JWUB 5MENA 3QUKA 4ZS6D 4C56D 1JYVA 1KTKE 4ZPVB 3P4OB 4GW5A 1PW3A 2BDNH 2OTWA 2ZG1A 4OAWB 5F7UA 2A6JA 4XZUB 5JXAH 1MCNA 1LO2H 5GS0D 2NTFB 4AH2A 3B9DA 1OSPH 3V6ZA 3C6LB 3CU1A 2NY4D 3S5LB 3MACL 5FFLA 3ME0A 1N2RB 1YN6B 3CGTA 1TVDA 5DRNB 1A6WL 1IT9H 4XP4L 2BSED 3B6SA 2XKSA 3L95A 1NSNH 2XQYK 5FHBH 2EDRA 4YGVA 5FDWB 3D87B 1SYSA 4U33A 5IFJA 3ILPB 2EE6A 3EGSA 3LN5A 5ICXB 2VJXA 2X4TA 2XN9B 3RWJA 2XA3A 1CIDA 4QY8B 5GGVH 3EO0B 2GTZB 1NCNA 1G7PB 5I73C 2EXWD 4DK3A 2R15A 3MJ9H 1FNGA 4KMTL 1D5XB 3IGAB 1PLGL 4M3KB 5ID1B 5IB4A 1D5BA 4HS3A 4RCAA 5K59F 3OG4B 4QRPD 4F8TA 3Q6FA 3ZKND 4FHBD 3B3IA 1EFQA 1PX3A 2WIMA 4L5FH 2ICWB 3UBXI 5IR1A 4NT6B 3G5XB 4TRPH 2P5EE 3RZCA 4K7PX 5DURB 2DYPD 1FYTA 4HKZB 1TZIA 3QDGE 1NKRA 3L3DB 4UT7H 5F7EH 1B90A 4JAMA 1K3IA 4YR6A 4WCYH 5F1IB 4Y16C 3FQTA 2WNGA 4KK6C 4AEFA 1E4WH 3C5ZD 2C3XA 5E7BA 1JJUA 1M7DB 1U58A 2R1YB 2AEPH 1DQLH 1LEIA 4X6CF 3B43A 4UDUA 1RUQL 3T4AB 2G2RB 4EUPB 1Q1JL 3GB7B 3BHBA 1MFBH 1N5AB 4BA8A 1RIUL 1AFVL 4QRRE 3RWGA 1XF2B 1S7QA 3U0WL 1HOCA 3MNZA 3A6BH 2R4RH 3RIFF 1R0AL 5JOPE 2ITDA 4LRNL 3ARUA 5DMGC 3MRBA 5F9OH 5HGAA 4BZ2H 1SMOA 2BNRB 4DKEH 1J1PH 3HPLA 3PDDA 5IQ7L 5JHLH 1IE5A 3GMQB 2VDPH 5MERA 4HV8A 3FAXA 3MXVL 1BM3H 4PLNC 3DMMC 4TOYL 5HYJE 1T2JA 4NN6B 4IHOA 1IC1A 5DC0A 1YEIL 3IDMA 4KRPD 2PW1B 5ISZD 1OW0A 3PWUB 1BQHA 5GRYA 5GS1B 4ZO6A 4FS0A 1FBIL 3CLFL 3EO9L 4JKPH 2Z0BA 5E2WL 2CDEB 3DHMA 3VCLB 2HFEB 1RZ8B 2EYRA 3L5IA 5LVEA 3PQYB 1J8HB 4NZUH 5SWZE 1HXMA 1F2QA 1MCIA 2BSTA 4FFZH 1CICA 2PKDA 1VGEL 5I1JH 2APXA 4XVJH 4JM4L 1C5DA 5C86A 2UWEB 4Y4HC 4RX4A 4PUBL 2BVUA 2K7PA 4W70A 4M9PA 4APQB 1K85A 1XR8A 2AJSL 2FR4B 3BWAB 4KH2A 5GGQH 3PABA 5SX5H 3QDJB 1A3RH 5IW6A 3M8OL 1MJ7L 4XTRC 5T1KD 1JRHH 2ZUQC 3HRZB 3MV7A 3QBTB 3DX8B 3U30B 5J6HA 3IDGB 2ARJA 1QLFB 4HEME 2BOCA 2R2HA 3DIFA 4LSVL 1SJXA 3BPLC 3EFFB 4Y19A 3RY6A 4CU6A 1FRGL 2LFGA 3GRWL 2Q3AA 5DJAB 4ZQKB 3DUUA 2GITB 1N59A 1AHWA 1JHTB 4NGHH 2NY3D 3GO1L 3LD8B 1V3KA 3M17A 2DQGH 1TITA 3GJFK 4XP9H 1T7XA 5MEND 5GGRA 4RBPH 1EUTA 4X6FB 4JO3H 5INDB 5DR5H 4NO2A 3D48R 4NBZB 4P2RB 5KSBF 2ZCHH 5IHZA 4E0RB 1NL0L 3DX6A 1HSAA 5ITBH 3X14B 5DFWH 1JPFB 3GK8H 3TT1L 4KI1A 4LIQH 5ANMA 5JDSB 4OQ1A 4XMPH 3UTSB 1XZ0A 1RMFH 4HUMB 5M7QA 3WCYA 1LP9B 4N0YL 1PG7L 4OF7A 4NNPH 3EDDA 3PP4L 1DUYA 3GGWB 1MAMH 4U7KA 1NMBL 1WZLA 4W81A 3CXHJ 2CIKA 5E7FA 4LLWB 3LZFH 5I8KL 3MROB 4XPTH 4L9LA 1T2QL 4Q6IA 2A9MH 3O6ML 1YYMH 4HLZG 3R1GL 3SKUD 3H3PH 2A83B 4NC2B 4P4RB 4JFYA 5D71H 1FE8L 4FOMA 3BN9D 2VDNL 4NKIL 3RZCD 2DTSA 4U1SB 3BAEL 5GRUL 4NIKB 2ZUYA 3L3OA 3MLPA 1N8ZA 4YBLC 5HDQH 2R8SH 1CFSB 1PYWB 4KJPC 3DSNA 1BOYA 2BNQB 1D5IL 5FO7A 3QUML 1X5IA 2VR4A 2ICES 3QEQB 5DXWA 3VWKC 1U95B 5L2KB 1VFAB 5C0JB 3U46B 1BWWA 1YEDB 3WUWB 2IPTH 2EYSB 1V05A 1CE6A 4TUJA 4MGXA 3O4OC 4UNVA 2FSEB 4UAOC 3W39A 1QFWH 4L8CB 3C5JB 3ILQC 4ORGA 3LOWA 4Z7OF 4YBHA 4P59H 2FGZA 3V8OA 5HHQA 3SKMB 2Y1VA 4K3EL 3PJSB 2AKRA 4OIIL 1CIUA 1S5IL 2VXUL 1K8DB 4YZFF 4EVNA 2ZWLT 3NTCH 3PWJA 3IDIA 5BVJA 1X4ZA 2FL5B 3VG9C 4J3SA 5DHXB 5GISH 3SCMA 3UZEA 3L9RA 4HWZA 4XGZB 5AWNH 3PGFL 1WICA 4QHLB 5IB1A 5KSUA 1A0QH 2VMFA 2P7TB 4WI3A 1F58H 3MBEA 2E6QA 4WEUD 4R4FL 2AJXL 1WBYB 1CCZA 5EIIB 1J5OH 2F5BH 3MGTA 2BVTA 1MFCH 3OGOE 4HAFA 4ZOCA 4UT6L 1XGUB 4WEMB 3RWEB 4DGYH 3AAZA 2R29L 1Q0YL 3OKMA 2WUCL 3X3GL 1QZ1A 2YUVA 3MJ9A 4KKCC 1NFIA 1FFPB 1Q9KA 4NZJA 3UP1A 1CICD 1L7IL 1Z0MA 3NCYS 4NN7B 5HJ3A 3ARBC 1PD6A 3L1OL 3MRRB 3OKLA 4HC1H 4S0SD 3BQUC 2ATKB 4NPYB 5GGUA 1PEWA 5IJKA 4LSSL 4N9GB 5IF0A 3FB5A 4XNYH 2CO7B 3FQNB 4PJIF 1RHFA 4TULH 4P2RE 3AMKA 3DX7A 1YNLH 2XY1A 2J6EL 3B4NA 1ZT1A 4HPOL 3MV7D 3L3GA 4Z7UE 3ZYZA 4JO1H 2HRPH 2V2TB 1IJ9A 1I3RB 3SE4A 3FRUB 4Z7VB 1CE1L 1T21A 1IGFL 3WEXB 4DQOH 2R0ZH 4Y19D 3JTTA 3RWHB 1F4XH 5JIKA 5JW4Q 4KGLA 5IHUH 4P2QB 3O9WA 3UTSE 4ZG1A 3VDAA 3STZA 1MPAH 2B0SL 2IFFL 3VI3E 4U1LB 3RA7L 4PJCE 2P43B 4HIXH 1A1MB 3QUZA 1BX2B 5C0IA 5DHVH 1A5FH 1NCBL 3CXHK 4QGTA 4UI2A 1K8IB 5KSVA 4S1DC 3PGCA 4HXAH 3U9PH 1DLFL 5I15L 3U2SA 3MV9B 4ZSOB 3WN5C 1MHCA 4YPGA 5I1HH 3MNVA 1UWGH 4LCCA 2D7NA 3RHWF 3WNNA 3H7BA 4FQLH 1NCWL 4OM1L 3VWJA 5BRZB 3LMJL 4NM8L 3HZMA 4O00A 4KQ4L 5E1AA 1V7NH 3VXSB 4Q0XH 1DZBA 2L7UA 4ZD3H 4BSWB 4ZNEA 1MJUL 3NCJH 5C6TH 4JPVH 4ELKB 1RJYA 4OCSL 3E0GA 4LARH 5JMOC 4KY1H 5TQ0L 3MRFB 5T3ZH 3TM6A 1QSFA 2NY7L 3HE6B 3SJVA 1IGIH 4Z18A 5EC1A 4OLXH 2BNQE 4PJBF 1F11A 1Q94A 3MREB 2JJSC 1S7WB 3QEQE 43CAA 3CH8A 3IXAB 3TCLA 5DD1H 2ADGA 1QYGL 3UXFA 2VL4A 4U1KB 5I66A 4JFQA 1MI5B 3IAQA 1YECH 2Z35B 4XCCH 2V5YA 4PREA 4YX2H 3PF2A 1EK3A 2HT4C 3TVMC 1CLYH 1X6NA 2ADIB 4PJHA 1GSMA 4JPWH 3S8WA 4PBWD 1Q0XH 5EFIA 5ACZB 4OV5A 5C07B 3HAEH 4KTEH 2BHUA 2JJTC 5CZKA 1LO4L 3BPOB 1BF8A 2NMSA 3SKJL 2ZOKA 3VFGH 4G6JL 4JPKL 4ZFGH 5D1ZB 4WWID 1NMAH 5C08A 1EGJL 3S4SG 5L6YL 3ISWA 3OKOB 2C26A 5LBSH 4WU5A 5C0BA 3CFEA 5AD0A 4UINH 4HUWA 3I50H 3GFUA 2FX9H 3AUVA 5HDLA 3RGVC 1KELL 4XWOC 5I1IL 2X9YA 4KROD 3CDYA 1RUPH 1OM3H 5DS8B 1DANU 1MCJA 1G1YA 1E6JL 3QWQB 5H35A 1T6WA 3QDMA 1RUKL 1MCDA 5DJYA 4PJEE 3ZKQD 3O3EA 2VXQL 4LRIC 3HS0A 3RJQB 2I07A 4HJGA 4CVUA 2CH8A 3T3ME 1RZKL 2VITA 3DYPA 4JFXA 3SCMD 1KBGL 3KHQA 3UDWA 4WGVB 1P9MC 5IESH 2YMXH 2GK0A 5DMKA 1MCWW 3S36X 3EOAB 1IKFL 2NY6C 3MPCA 2EYTB 4LSDA 3MBED 1HKLL 3OHXA 1EAPB 4DGIL 3KPLB 4LVNB 2RHEA 5B39B 1BIHA 2W9EL 4G8FB 4BH8A 2DLIA 5BOPA 3LQAC 3SPVB 2NY1B 2HJFB 3GSWB 2XZQH 5EBLB 1CBVH 1WISA 4J8RA 4ESKA 5JLZA 3REWA 4ZMAT 3CFKA 1BVLB 5FM4A 5TE6L 4OCMC 4E41A 3HC4L 2FD6H 4ZSOE 5EZIL 3QUMB 4HIHA 2PCPB 1IBGL 35C8L 4K7PY 3VMPA 4F7PB 5JHDA 3G08A 3O6KL 3PWPA 4TVSa 4XWGH 5CAYB 3DTXA 2VKWA 3GIVA 3T0EC 4A2MA 3O41A 4Z7QE 5IB3A 4YNYA 1CLOL 3SDXF 1OGTA 5IEKA 1IGJB 5CJQH 3O11B 4NWTL 2J12B 2X4QB 4WO4C 3MRMB 3QJFB 1BQSA 4GXUM 4XAKE 3BRFA 1U8IA 1UACH 1DDHB 1ORQA 1V7MH 4DGVL 5EORH 3FFCA 4QHNB 3QUZD 5E2UH 1I9JH 4JZJA 2IBZX 1PBYA 4PJFF 3QYCA 3DVFA 1T5WB 3WDIA 3ZSTA 1A6ZA 3V4VL 4G43B 2MCPH 1FZMB 2PYEE 4I3GA 4OZGF 3K4ZA 4JQVA 4DAGL 1WC7B 3EYUH 1JZ4A 1CGXA 2QL1A 3W0WE 1AY1L 2VN4A 5IMLA 3UTTA 1WWCA 1IVLA 1T22A 4KWUA 5B8CB 1XGQB 3KYKH 4MAYB 8FABB 3KLHD 4X7TB 4BQ6A 3O2DL 3DRQB 3VE0B 1XF3A 5C07E 1ZHBB 2ED8A 2R2BA 1NANI 3H2WA 3LQZA 4G42A 4OI9A 3QFDB 5CD3A 4DN3L 3L3HA 4G8EA 1QSFD 4ISVB 1AJ7L 1CT8A 2VDOH 1ZANH 2QKIA 3AS3A 1NCUA 5CGMA 1ONQA 4R4BB 3IF1B 3MRCA 3I6KA 4DUXA 3HUJF 1RZFH 4LFHG 5I18L 1INDH 5IVNA 1FNEA 4MJ6A 4QTHA 1IGTA 1G6RH 2OL3L 2BERA 2XWJA 4X0KA 1D5MB 5JW3L 4AK1A 4HGMA 5L0QC 3KLSA 4NCC1 1S9VB 4P23B 4K2UH 4KUCD 1VEMA 4UILH 1WAAA 2P8MA 3QEHB 1JBJA 4R9HA 2WUBH 4ODXB 4U49A 5EO1B 2ZOLB 1P53A 3DXAB 4OZFB 1S9KC 1HQ4B 2AI0L 2Y7QB 3T65A 3F65A 4HMCA 1MFAL 4PJ9C 4LLDB 1IC4L 4OFYA 5C08D 5I74B 4Z0XA 1JF1A 1QSVA 1IARB 4W6WB 2FIKA 3BVNA 1KJ2H 2P44B 4NKDB 4RAHA 1Y0LB 4MWFA 5DHVA 4ZTPL 5GSVB 1QFWI 3VI4E 4U05A 1MRDH 3BKCL 5D2LB 1KN4H 3QDMD 1AKJA 2DI9A 4X5WB 4BFBD 1EJOL 5TQ2H 1EO7A 1UM5H 3O2WL 4Q9QL 5E08H 1U8JB 3U1SL 1RZJC 3WFBL 5GS0L 4RWYL 3E2HB 1EXUB 4M93B 2W60B 2Z93B 1OY3B 1GOGA 4LAQH 4FQPA 8CGTA 4HWBL 1P4IH 4RFEB 1XH3B 4PRBA 1NLDH 1UB5B 3CH1B 2VH5H 3DHJA 5BQ7B 2BZDA 4GRLD 3DGGA 4DUVA 1B9ZA 5J6GB 5D7IB 1HCFX 2WWMC 3P9MA 4Y5YB 3CXDH 1LK3L 5HHPB 4AT6A 5L7XH 1KPUA 5FA3B 1RPQA 3D39B 3WFEL 4HMEA 3IJSB 4JFEE 1PSKL 3P4NA 3BJLA 4XH2B 1DBML 5FYKH 1C5CH 3O8XA 2E7HA 2V7HB 4E41D 4LVHC 3LH2H 4H26A 4EIGB 5EC2B 1GGBH 3HAEA 2FATH 3B9KA 5I19H 1Q9LB 3PWPD 4K94C 4NYLA 1YZZA 4ELMF 5IG7B 4Y89A 2YD1A 3MLUL 3Q5OA 3FCTB 1OAUH 1S3KH 2Q8BL 2XWTB 4JM2B 1RUAL 2BJML 3KYOA 5FA4B 2VZVA 4KJYB 1T03H 4ZYKB 4KZEL 5LGJB 4F58L 4NHUA 2XYCA 5SX5K 4PRIB 3HAEG 1B2WH 4UU9B 1BOGA 4TSCH 5FM5O 2AV1A 2VXTL 2FWOA 2VL5A 4OB5L 5CP7B 4O58L 1BIIA 4U1MB 2K3TA 3IFLL 5E5RB 4H0GA 5E8OA 3GSRA 3MYJB 4FXGB 1HIML 1NFDF 5EU6E 1MCOL 1KGCD 1KTLA 2FBOJ 4EXKA 1H3PH 1FYHB 2UY6A 1RJZA 3MUJA 3MR9A 3EFDL 4E9LA 3UTTD 5KVFL 3QIBB 3D3VA 1BZ7B 3UJIH 2BFVH 4X80H 4JRWA 1KEML 4OFVA 3U0PA 5DK0B 3E6FB 2P8PB 1JZ3A 4RBPK 3KPNB 1KCRL 3DOSA 3DXAE 3GSXA 5JOFB 2NPLX 1S7TB 4N0FB 4NJ9H 2JCCF 5EA0H 1UXSA 1BEYL 3G5ZB 4ODWA 4J4PC 4YUEL 2GYSA 1D9KB 1G7IB 4EN3B 2NR6C 5DVNA 3EAKA 1KIQB 4L8BB 5F89A 5D70H 2ZCKH 4R0LA 1HILB 3VXUE 3ULUL 3VXRB 4YDKH 3MUY1 3JXAA 2DB8A 3FHQA 1AQDB 2Q8AL 3QNYA 4WI4A 5HVFB 5D2LE 5DQDH 3VWKA 1I1AB 4NKMA 4JDVA 1M4KA 2H3NB 4HDIA 2QADC 2EEBA 3NMEA 4S11A 5EOQL 5BCAA 1PKQE 2HTKD 5C0CA 5EUOF 4P2CG 3QNXB 2V7NA 1Q9OB 1OWRM 1ETZA 3VFNA 2YD4A 3LSOA 4FG6D 4KKAC 3RWCA 2RJMA 1EO8L 3OPZH 4KRLB 5LQBH 3JUYA 4M1CC 1NBQA 7FABH 5L8LB 1SJHA 1MLBB 4OFYD 2E7LA 4RFNC 4GMTH 3HZVA 4OCWH 1QO3A 3KWWA 3BFOA 1TVBB 1T89A 2CGRH 3TBVB 4ZO9A 4YXLH 3EYVB 3C8KB 1A14H 4JY5H 1U8KB 1YNKH 4HKXB 3OR6A 1FO0A 5HHVH 4IMKC 2YXMA 1U8PB 5IK3A 4JFPA 1FNFA 1L6XA 4KAQH 1JZ7A 1LEGA 1XGRB 2XWBB 1HNGA 4U1JA 1A1NB 3D39E 1DQDH 1AKJD 3KPMA 2VDLL 1PGRB 2A0LC 2XA8H 2HFFA 3AU1B 4U1NB 2ITCB 1A7RH 4N1CA 4PJDF 1BVKB 4NWUH 5F21B 5DSCA 4PGEA 2EH8L 4MLSA 4PLOB 1ZEAL 2FEDD 3GSOA 3QI9B 4XRCB 4NDMA 5KSBA 4XBEH 4NM4H 3I6GB 1WWWX 5T3ZD 1GL4B 1LE5B 3BKML 4XTRD 3L5XH 2OL3B 1FGNL 2VISA 1U92A 1KCLA 4R90H 5ITFA 4YO0B 1I7TA 4LSUL 5CINH 1FH5L 3L7EA 4ODSH 1KPRA 4GLRI 3ZKXB 2XKNB 4H0HB 2PNDA 5F9WC 3NPZB 3X12A 1P5VA 4G7VH 4PRIE 3PGDB 3RUGE 1G6RA 1V3LA 4KZDL 4NHCL 3WIIH 3BMVA 5IIEB 3FN0H 3MRKB 3O8XD 4XVTH 3FAWA 3VXMB 3RAJL 4XPBL 3B83A 4YHKH 2CKBH 3QG6B 3VJ6A 1UXWA 4MA1C 1F90H 5TDOA 3LRGA 3RWIB 1N64L 1YPZA 3HHRB 3QNZB 1A8JH 3B9KD 1CD8A 5E2VL 1XF4B 2AEQL 1Q38A 4X5XB 4A6YA 2VZ1A 1KLUB 2HLAB 5GJTH 2X1OA 2ADFL 3IXTB 1NUNB 1AE6L 3JSSA 4M43H 2VZUA 4FTVE 1VHPA 1UB6B 3W11D 4NQCA 4UV7L 2FBJL 1T2XA 4M1DL 4O4YH 3VDBA 4M5ZH 1KJ2A 3PE9A 4QXWA 4UUJA 1KJVB 5HD8C 4C56B 5JW4M 3KPQB 2GUOA 1XCTA 5E4EB 5L2JB 4JFZL 2XFXB 2FEEL 2G60L 4HQQL 25C8H 5C92A 4JY4A 4Z7NF 3LKOB 1OP9A 4ENEC 4CMMA 4YQXL 2NY4B 4ODVH 4XMLL 1KIRB 2VNCA 3VXRE 4HH8A 1S9XB 4Y2DC 2FDBP 5I17A 1JPSH 4KPHH 4XBPA 3BX7C 4F3FB 4CVXB 1R3LA 4GQ9H 3QUXA 3N9GH 4MA3B 1TMCB 5ESQB 1HEZA 1TTGA 1EPFA 1T0NB 2DQUH 4JHAL 1DLHA 3T3PF 3TPUB 3MOQA 1CFVH 2JK5B 2VXVH 2FJFA 5ABDE 3FT3B 5FV1L 2F54E 3WKMH 1KCSL 3S35L 3ETBF 3QCUH 3FL7A 5D5MB 3WFHB 3MLSH 1MCQA 1AI1L 2C3HA 3GMRB 4QRPB 2MNUA 5FCUL 3CFBB 3QZWB 4GOSA 1D6EB 3SKOB 3ZHKA 2DWEA 3OAUL 5T1DH 4PGDA 1G9EA 1S5HA 4G7YH 1MJ8L 2A9NH 3BP4A 5JMRA 2DYPB 5BV7L 5FCSH 3N1GC 1I4FB 3VWKD 4X99A 5IMOB 3QR2A 5CLWA 2AXGA 5EOCH 4Y4FA 3U6RA 4O02H 5C0CD 2VUOA 4KK9C 4OM0L 1LK2B 1RUMH 5D96B 3BPCA 4HUUA 4C54A 1FZOA 3C5ZB 1UWXH 3WS6A 3DUSA 1N26A 1SBSH 3HMWH 2VN7A 4TSBH 1P7KA 5ALBH 4PRHD 1OGAA 4FQXC 4JN1L 4D9LL 1X9QA 4PJIA 3S7GA 1UJ3A 4R96A 4G9DA 2FHBA 1S9WA 1VKXB 5C2UB 1X5FA 2VDMH 4HBCL 4LF3B 4OQTH 2EDTA 5C09A 3QB7C 5FUZL 3TV3L 5F6IB 4F9PC 3VFWA 5TF0A 1FPTL 3BIKA 2VDKL 4G8GE 1IAOA 1A2YB 3HKFA 4Z95H 3D25B 2WBJC 1Z9OA 4HPYL 1JUFB 1T1WB 3O0RH 1CDCA 2IPUG 3BDXA 2IBZY 2QQKH 4ONHA 2AJYL 5IB5B 4IIQB 3BP7A 3JWNC 1JGUH 4XCNB 3TIDB 5CJXA 4KQ3H 3WFDH 4JRXA 4LCWA 4KRPB 3VXME 1NGYA 5ISZB 2B1AH 1UZ8A 5DJ6A 3MX0A 1NCAH 4MCYA 3MOAH 3WO4B 1S7XA 4I0PA 1OF2A 2NXZC 2MQ3A 1J11A 3UROR 5KJRL 2Y36L 2FLRT 2IPKA 4X6BA 3LDBC 2VSDA 2YD6A 4U6XB 3MQIA 5JXEA 4G5ZL 3NH7L 4U6YB 1QEWA 3EZ8A 3IDUA 3V52H 4JQXC 3GHBH 4QRUA 4C56E 4OFDA 5EZLB 3UBXB 4PJGA 4FQQA 3HFMH 5DMIL 3V6FB 3ULVH 2DIAA 3BT2H 4I3RH 5T1KB 3DETD 3RVTC 4PP2A 1U93B 4A2LA 3NFNB 4YXHH 4PJBA 5ICZB 5DWUH 2W0KA 5CWSA 1JZ6A 5T5FH 1TETL 5D1QA 1HQRB 1FIGH 4ZTOH 4YFLI 1OLZA 5IM7B 5MEQB 2VZTA 2IG2H 5HGBA 2B7DT 5MHSE 2NY3B 5LXGH 4Q2ZA 2C3VB 5B38A 1N6UA 1ZMYA 1ZT4A 2XOTA 3QH3B 4DW2H 1LO0L 5MENB 4JGJA 3QUKB 5GS3A 1ZLVH 1TJHL 5IBTH 2GKIA 4GW5B 1A6UL 4X4MA 1FCCA 1FL6A 2OTWB 4ZFOA 4K8RC 2A6JB 2K9UA 1UEYA 4N1EA 5KVEL 4AH2B 3F6IA 3ARGC 3MJ6A 3V6ZB 3V4UH 1GIGH 4ZS7L 2HN7A 1KFAH 2QHLA 1CTNA 5B38G 4BM7A 2H32H 4BKLA 3DVNA 3O3DA 5JXAL 3B6SB 3WFCH 2X4SA 2OJEA 1LO2L 3L95B 3QUXD 1OSPL 2P48B 2ZUUA 3I6LD 3OKNA 2R0WH 4YGVB 4OD1H 4P9HL 4BELD 1SYSB 4QTIL 3RRQA 5IFJB 1IT9L 2B2XH 3EGSB 3LN5B 2X4TB 3RWJB 3MXWH 5JPNA 4I18C 2BVOA 3N1MC 2IJ0C 3TH4T 4M6OH 4TPRH 3TVMD 4JR9H 1FNGB 3FFDB 5IB4B 1D5BB 4HS3B 1TLKA 3TNNA 2V2XA 3EHBD 4P5TC 3N1FC 4U1IA 2JB6A 3Q6FB 2P42B 3B3IB 2YOCA 1HK6A 1LDPL 3QUYC 5IR1B 3MJ9L 4KI5D 5FYKD 1NMCC 1FSKB 3RZCB 4ONGH 4YK4B 1UWEL 5DK3A 4R8WH 2CKBA 2I25N 4XPAL 3WSQH 4JAMB 4L5FL 4B53A 4Y4FD 5KS9F 4TRPL 2GIYA 3FQTB 1G9MC 5F88A 4CMHC 1QNZH 5ISZE 5FO8A 1LEIB 4NQSA 4UDUB 3V95A 2EDBA 2X1PA 3BHBB 4WCYL 3RIAF 5I1KL 4F80A 1NGPH 3ULUE 2EDEA 3RWGB 1E4WL 1S7QB 4R7DA 4FQJH 3ZE2F 1VFUA 4XBGA 5C09D 2AEPL 2ITDB 4P2OC 1HDMA 1ZHLA 3MRBB 4MYWB 5HGAB 3V79C 3SBWC 1ZSDA 4OF5A 1N0XH 1MFBL 1IAKA 4LNVA 4TTGA 3HPLB 4WUKH 1LD9A 2AW2A 4NRXA 5BMFH 1HKFA 3A6BL 5E9DA 2M1KA 5MERB 1DN0A 2R4RL 3ARDC 4HV8B 4LVEA 4OT1H 5F9OL 4IHOB 1IC7H 4HXBH 4JRXD 4LCWD 4ODHL 1FNLA 3IDMB 4BZ2L 1A7BA 5GZOC 4DKEL 5C6PB 4NFBA 2JB5H 4HX1A 1UM6L 4OIBA 1BQHB 1ADQH 5JHLL 3GSVA 4D94A 5IFHH 4Q9CA 4I0KA 1JNLH 4PR5A 3ZT7A 1BM3L 4NCC2 4F7TA 5K9OA 4I8DA 4ACPA 4LKCA 4NNXA 3NPSC 1AR2A 4I0PD 4DJMA 5J1TC 3NIDF 3EYSH 4I4WA 2EYRB 4CNIA 4OZGA 4O9HL 5E0QA 3S36H 2NW3A 1HXMB 1YQ2A 1CXEA 2BSTB 1J1XH 1CICB 5JXED 4JKPL 1DBKL 3I3BA 1C5DB 3RWDA 4MXVF 5GGSA 2X4RB 5SWSE 1XR8B 4NQEA 4JVUA 1ZA6A 3PABB 4NZUL 3T4YA 5IW6B 2DJSA 1L6ZA 5DRWA 3HE7C 1KIPA 2R9HD 2ESVA 5I1JL 4GG6A 4GAJH 3MV7B 2VLJA 4XCFH 5J6HB 4LHJB 1U3HC 2ARJB 4WO4D 2BOCB 4KK5D 5DF0A 2R2HB 3DIFB 5GGQL 5D1QD 2G9HA 3T04D 4QNPE 3EJYC 1A3RL 4Y19B 1JRHL 2CRMA 1A22B 4OGXH 3IJHA 3DUUB 4P3CH 1AHWB 1ZGLP 4LSRH 1WITA 3DWTA 2C4XA 3M17B 1GHFL 4M61A 1MVFA 2AV7A 1A7PL 4KKBC 2DM2A 4OQTA 1NC4A 5GGRB 2BRRL 1ZVSA 1CDHA 1GAFH 5J3HD 4NO2B 4NGHL 4MJ4A 1KB5H 5CUSH 2DQGL 5IHZB 1G7HA 5EIVA 3DX6B 4XP9L 1HSAB 5FHAL 3CC5A 3QIWC 4JO3L 4X9HA 4I9WD 3GSUA 5ANMB 2VO5A 1FYTE 2IPUK 4F9LC 2XZAH 4JKWA 4J3XA 1K4DA 1XZ0B 5ITBL 1QRNA 3RNKA 2X44D 4XHJC 1NAKH 5F7MC 3CZJA 1DUYB 5MEPA 4LIQL 1DVFC 1H5BC 4I77L 4L4JA 5AZEH 43C9A 1AQKL 3FN9A 5GSRA 5L88L 4OSUL 4AY0A 4XMPL 1E0OB 4U3HA 2CIKB 5D1XC 1RMFL 4YAQA 1NCTA 1Z3GL 4HEPG 4I13B 1MAML 4L9LB 2CJUH 4RMVA 4MXQC 4Q6IB 5LG1A 1OAYH 4JQIL 2FGWH 5DA0B 3SDDA 4MB4A 4PJ9D 4JFYB 2A38A 2H8PA 4JRYA 2J3SA 4D0CA 1RHHA 3LZFL 4Y4KA 4ZFFA 2XKUA 4R7NA 4XPTL 1OTTC 2AJ3A 1BQLH 2XT1B 1OARH 4WFHE 4YWGH 2A9ML 3QXTA 1YYML 5DZOA 2Y5EA 4ZUSA 3L3OB 1N8ZB 5SV4A 1MFEH 5I30L 4IRSC 5D71L 1NH6A 1BJMA 1U6AH 2V17L 2Y6SD 3ESUF 3IDYC 3TPKA 4HFUH 5FO7B 3REVA 2O61A 3HCVA 3P9WB 3P4MA 3H8NA 5C0FA 4FQHA 2X9XA 5C7XH 3EDKA 3BSZH 5HDQL 1DBJH 2VWEE 4GUPA 1CE6B 3FMGL 4TUJB 1S7RA 4KROB 1LNUA 4Q58C 3W39B 3AM8C 4Z5RA 4ORGB 2CUHA 2EDQA 3MLRH 1I1CA 1A1OA 1HNFA 4EKXA 4DOHE 5CCKH 5HHQB 4ONFL 3PL6C 4ELMA 5AAMA 2IPTL 2B20A 2AKRB 2EC9U 3JBG7 4EVNB 5JW5A 2WQ8A 2OMNA 3PWJB 5E9DD 3IDIB 5I8OH 5BVJB 5IHBA 1J8KA 4ZUVA 3TIEA 4N90D 3SCMB 1MELA 3L9RB 4TTDC 4HWZB 3WJJA 3VFMA 5DC4B 1ULVA 3GNMH 4HGKC 3RJDA 5CJ8A 5IB1B 1FVCA 5KSUB 4ZXBA 4WUUE 3MBEB<