1H8SA

Three-dimensional structure of anti-ampicillin single chain fv fragment complexed with the hapten.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
218
Chain Sequence
DIVLTQSHKFMSTSVGDRVSITCKASQDVGTAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQYSSYPLTFGAGTKLELKQVQLQEPGGELVRPGASVKLSCKASGYTFTSYWINWVKQRPGQGLEWIGNIYPSDSYTNYNQKFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARWGYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection, Characterization and X-Ray Structure of Anti-Ampicillin Single-Chain Fv Fragments from Phage-Displayed Murine Antibody Libraries
pubmed doi rcsb
source organism Mus musculus
molecule tags Anti-ampicillin antibodies
molecule keywords MUTANT AL2 6E7P9G
total genus 55
structure length 218
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h8sA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h8sA02
2V7HB 3Q5YA 1S9VB 3L3IA 4KJWD 3NN8A 3I75B 3LKRA 2EO9A 4JG1L 1LO3L 3V52L 5DJ2A 5EFIA 4PJ7B 1KIUA 2JK5A 2P49B 5K59F 3EOAA 2MKLC 4O58H 4ZTPL 1O5DT 2E9BA 2BOCB 2QQQA 1N64L 3SKNB 5D1QD 2RAMA 4OCYH 3IU3B 4O9HL 4WEUD 1XT5A 3P0GB 4MDJA 4I0KA 3LOWA 3HMXL 1EAPA 2APBA 5DTFA 1IILE 4P46A 1F5WA 4DGVL 2AJXH 4JO1L 2GITA 2V5MA 1JZ3A 1NBQA 3FQTB 2FD6H 2P8LA 4Y1AE 1KLUB 5IMLB 4XPFL 3QI9B 4FMFA 1FZMB 4MAUL 5IBTL 3GJEB 5AYUH 5MERA 3E3QC 1MLBB 3BE1L 5C2BL 4EI5D 1CFVH 3EOTH 1N8ZB 3GI8L 3FAXA 2F58H 4DOHB 1KXQE 3H2WA 1GHFH 2ENYA 4PRIE 4JM4L 4BM7A 5DVMA 5BW7C 2A6DA 4PRPD 7FABH 1N0XL 4J4PA 3RZWA 4YAQB 5EA0H 1UWXK 3JWOC 3GHEL 2P24A 3PUCA 4ZAKC 1KIRA 1BIIA 4KKCD 3L3GB 3AGVA 2E7MA 3ZL4L 1Q1JH 4Y19B 3EDEA 1KEMH 4CJ0A 1G0DA 2WWKO 1SJEB 4PJCB 1E27A 4O2CB 3VI4E 2JCCA 1MUJB 2ZUUA 5DHVA 5MEND 4PRPE 4RDQG 4XAKD 3QDGD 3LPFA 4PJEE 1MRCH 3BN9D 4LSTH 3BI9X 3V6OE 2WSKA 2C4FT 2HKHL 4MVBD 5FM8A 2F8VA 1A4KB 1I8KA 1UM4L 2X4OA 4TPRL 3VD5A 5GS0L 5EBMA 4LLWA 4PS4L 1E4JA 1E6JH 4L4VA 1IKNA 1AFVH 3JWOL 1SYSA 1PG7W 1S3KH 1YEGH 3DTXA 2OR9H 4PJ5D 4V1DD 1LO5A 1AR1C 5T1MA 3T3ME 2BRRH 4P2RD 1BJ8A 5BV7H 5BZWB 1FC1A 3BPNC 4YHNB 1EIBA 3B6SA 2R56H 3C5ZD 3QUMB 4HWZA 4N9OB 3TVMD 1A3RL 2B0SH 1BJ1H 3DMMC 5IQ7H 3ARDD 5I1DB 4UDUA 2OR9L 2VDLH 5ANMB 2VLRB 3OB0H 3QXDB 4AIOA 4NT6A 3QUMA 1YN6A 4HXAH 3FT2A 4WWID 3MFGB 5I1HH 3LKRB 4EQ2A 3TYGH 1IL1B 2BC4B 4WY7H 3SE8L 5JR1H 5A2FA 3IU4L 3AAZB 4Y19A 4EXKA 3V7MA 3VMPA 1FYHB 3DNKA 4R4BB 1CXEA 1P4BL 3IKCA 2PYEE 3T65A 4POZD 5TDPB 5ILTH 4W6YB 3WIIL 4CNIB 3BKYH 2EDHA 2H1PL 1MFNA 4LPYA 3TNNB 3J8F7 5ITFB 2VLKE 1YJDH 4TNWF 5KS9F 3F7RA 3ZDZF 3NAAL 2PO6D 1NLBL 2AXGB 5K9JH 1I75A 4ODVH 3WJLC 4LARL 1LP9F 3NTCH 5I2IB 1W8NA 3P2TA 1HH9B 4YGVB 1F58L 1S9YA 4XNZB 1YA5A 4OLUL 1P53A 2X5PA 2N7AA 1IC7L 4J8RA 2P5EA 5E9DE 1BIHA 1XCTB 3C6LA 4R7NA 2ED9A 3CDYA 1FIGL 4XAWH 2UUDK 4XP9L 2R8SH 4ETYA 2NPLX 2QADD 2A6DB 4HKBA 4O02L 1NGXB 3MBXL 3QQ3B 1VKXB 5DXWA 4MQXD 1YYLL 1MCKA 4UT7H 1DDHB 1W0WB 2JB5L 3I6GB 4ZOEA 5IJVA 3WFEL 1G9EA 1XGYL 3AM8A 3GMPA 4U33A 4H5SB 2VXVH 2GSGA 2VLMD 1U8HB 4GKZA 4NNPH 3SDAB 2J8OA 3IDNA 2I9LA 2E8ZA 1C12A 1M6OB 1DSFL 4QY8B 5F1OB 3UTSB 1BFOB 1CGTA 3CMOH 1SYSB 5HYFA 4YPGA 4OF7A 3LDBC 1MNUH 3QUMH 2D7PA 5HHVL 1JGDA 3QDME 4FP8H 5KW9H 1SY6H 1XGRA 3JBG7 3BH8A 1JNLL 1BOYA 5F70A 4ZYKA 4W6WB 4CW1A 1JNHB 1S7WB 3K2UL 2GT9B 5AYQA 1HEZB 5HYIA 3PP4H 4KQ3H 3BH9B 4Y1AD 4XXDA 4KMLB 5HGAB 1FLRH 1NFDA 5IKCA 4TQEH 2J4WH 4S1RH 5ERWB 3UYRL 5D9SB 1ZANL 1YN7A 4NT6B 1MRDL 3QHZH 3S3PA 1JZ6A 3BH9A 5EC1A 4M5ZH 6FABL 1K4CA 1OAKH 3SQOH 5KJRH 1GZQB 5B39B 5GGVY 4XPFH 3K4ZA 4N0FB 4R3SB 3W39A 3HZVB 1DEEA 1UFUA 1CFSB 3N1PC 4R2GB 1AO7B 5JNYB 3QQ4B 1PEZA 5ID0A 3FMGH 4KK5D 1MCPH 4IRSC 4XBEL 3IDYB 4HUUA 2WQ8A 3LEXB 1NJ9B 3OZ9H 4X5LA 3TBYA 2FYYA 2FGWL 1RUKL 4OGAC 2DN7A 5E2UH 5DRXA 1Z0NA 3C5SA 1D6VL 3NZHH 3OAYH 3P40A 4LEXH 1P5VA 2JIXB 3ARDC 3B9KD 4PGCA 2D0FA 5IHZB 3I84A 2HLFC 3RVUC 4JB9L 5I8KL 1QSEA 5C9JA 3SY0B 1XGRB 3T0DA 3BP6B 3MLXH 5DT1L 5F9AC 4DUVA 2VN4A 1HIML 1Q1JL 2Y23A 4M5YH 4U1KB 2F5BH 2CQVA 4D3CH 1X5YA 2VR4A 5JIHA 3MV8A 3QUXC 2FB4L 2PYFA 5IUSA 3EAKA 4HIXL 4Y89A 3QXAA 3QI9C 3QWRA 1QFWL 4WO4C 1JE6A 3PDOA 4P5MA 3BO8B 4HF5H 2Q86A 5JPNB 3NCCB 5F9OH 5IJVB 1VFBB 2P42B 1CQKA 1BLNA 5I8CB 1DBMH 3VWJA 3NCJH 3V6FB 5GGRY 1WIOA 4Y16A 3X3GL 3CVIH 5F97E 5E03A 3RDTB 3FHAA 3WHXA 5IVXE 3UTTA 4Q9BA 3U9UB 2IBGA 4YBHA 1AHWC 2V9TA 3ME0A 3BQUD 2M1KA 1EH9A 5DRWB 4MXWL 4P5TD 2FX9L 5I73C 2IC2A 4IRSA 1FSKB 2G60L 1DVFA 3JUYA 4Z7UF 4G8GE 4Y2OA 3INUH 3O4LD 5CP7B 1NCDL 3MV9E 4HC1L 3OMZA 2IPKA 2ADIA 2AXFB 4GUPB 2VOTA 3IJSA 4QTIL 4Z7WF 2VLKD 5FV1L 3RY6C 2IALA 4MQSB 1J86A 4LLDB 5E8PB 3U1SH 2CGRH 4LSTL 1AC6A 1ZA3B 3LZFL 3SDCC 3LS4H 4WFGD 1EJOH 1N8ZA 4V2BA 1YEJH 3OKEB 3K3QA 4R9HA 1EEYB 1II4E 5CBAB 2YWZA 4F7TB 4DN3L 1NKRA 5E1AB 3WD5H 4KRPD 4NOBA 5GHWL 2DQEH 3BIKB 2E8YA 4QHNA 1MFDL 1S9WB 1IGYA 3PV7A 1CK0L 2Z0BA 5LCVH 4DEPC 5BS0D 1C5BL 3ZE0F 5CEXA 4HUUB 3BKJH 1R3HB 4MLSA 3DRTA 2Z31D 3HAEG 2X1WL 3DX8A 3HMWH 1FLRL 1UZ6F 5IQ7L 4YE4H 3IAGC 4GW5A 4Z0XB 3VFGL 1OGTB 5DQJA 4DGIH 1LHZA 4TNVK 4YHML 3VFSA 1AI1L 3A67L 4HV8A 5F1NB 3ALPA 1AQDB 2FJFA 2R1XB 4CVUA 4EN3D 3RWIB 4ELMB 4JREB 3QPQD 1CD1B 4M1GL 1KCVL 3T8XB 2H2PC 4YK4B 3TZVD 1AQDA 4TUKL 4XBGA 2IADA 5L9DL 3VFGH 3MV8B 1DFBH 3D87B 4OZHA 4WEMB 1FG2A 3Q5OA 3CXHJ 3PWUA 5B22A 5J9PA 4GMTL 3RWCA 5D2LE 5E99L 1RHHA 1RK1A 4DJMA 5DJ2B 3VRIA 5CEZL 4HGMA 4AG4L 5IR1B 3FO2A 3TBTA 4JGUA 5I8CA 1H5BA 2OZ4H 4JKPH 4K7FA 4PG9B 3HNSL 5JXAL 2VDQH 2XQBH 2EXYD 1CWVA 3FRUA 4UTAL 1OTTD 4XCNA 5TE7L 3QO1A 5J8OA 1XGQB 1OAZH 4JM2C 2ESVD 3DETC 3U0PB 3STLB 1CU4L 1ZANH 3GMMB 4YH6A 1UVQB 3FN0L 4Y5XC 3HS0B 5ITFA 4WNQB 5JQ6L 3U0PA 1WSST 2FNBA 4YHOH 3MUGB 2IPKB 4NQUA 1N2RA 4RWYL 3BEVB 15C8L 2KQMA 4HPYL 4MQXC 1PKQA 3G5YB 4HBQA 5T1KB 3NH7H 5SV4A 5KSBE 1NMAL 2FJFB 1D5MA 2VAAB 3AREC 4UQ2A 1Z9SA 2XKNA 2PR4L 1RUKH 4NN6B 3HRPA 1FZMA 3O6ML 5D1ZC 3DRQA 1T5XA 1CG9B 3WE6B 1A7QH 2J88L 4YHYB 2OI9C 1HHKA 3ULUE 1A6ZA 1DUZA 4HQQL 4A6YH 3FONB 5C6TH 4U1LB 3I3DA 1AGEB 5I16A 2XY1A 4P2CG 3MFFB 5M94B 4RFOL 25C8L 3MRDA 4JR9L 3VDAA 1F2QA 4HD9A 1T5WB 4ORZC 1KFAH 4UMGA 3ZYZA 3IKCB 3PL6D 4JHAL 1T21A 3C2AL 2F8XC 4WFHE 1CGXA 4X7TB 4Z7VA 1IM3B 1HXYA 2F53A 2DQTH 1BM3L 4E5XB 3IU3A 4UIMB 4P23D 4PJIF 4D9QE 3B8YA 1TZHA 1CGSH 1FCCA 2OJEA 3GSOB 4G42B 5E6YA 3FB5B 2PNDA 5A1AA 1ZHNA 2J6EH 1BHGA 3V0VA 4BFIA 1ZTXL 4I3SL 4OLYH 4MA1B 4PJGE 3TM6A 3GJEA 4K55A 1QEWB 3O3AB 4MD4A 3H8NA 4OIBA 4ZAKD 5GS0H 5LXGL 3ZKQD 3JTTB 1DZBA 3TGXA 5INCA 4JY6B 2NYYC 4HUNB 3WFCL 1PVHA 1CIDA 5GRUH 2GT9A 2CR3A 3TA3C 4XP6H 1I8LA 3ARTA 1VADB 4BSWA 2OTUA 4KKLD 5GISH 5HGAA 1DUYA 2DKSA 3OPZL 4UU9A 5JIKA 5F6HI 1OT1A 1EGJH 4L8BB 4QO1A 3S37L 1VACA 4JG0L 5E8DH 4OTXH 1H3GA 2C4FU 3HI5H 5DMKA 5L88H 4Y0GA 1J8HE 1EVUA 4F33A 3CUPA 2VR5A 5C0IA 4KTYA 5FUZL 3W9DB 4F2MA 4X4ME 3TPKA 4HXAL 5IB1A 3P3YA 4KZDH 3REWA 5E5MA 1AKJD 4Z7NE 2YRZA 3U6RB 5FHBH 1VEPA 2Q87A 5FYLL 2X4RA 1J8HB 1WBZB 4U3HA 1F6FB 1FORL 5GHWH 2P8MB 4ZSOB 4ZYKB 3T0VA 5LVEA 5IG7B 1RZGB 4HS8L 1KNOA 4KJWC 5GSVB 2XPGA 3HHRB 2AJUH 1J8HD 1UA6L 3OKYA 2GJ6B 4UV7L 3RU8H 1G6RA 3FB6B 5DD5H 1N5YL 3OBAA 4I13B 2X10A 1OSPH 2PYFB 4LRNH 3VDCA 2KH2B 3QRGH 2BCKA 3DVNA 1I1AB 3QXDA 4PGZA 3D2UA 2HVKB 3UZQA 4GKZB 3SDAA 4WTXA 1CCZA 4Q0XL 5CINL 5HY9B 4X6CA 4XVSL 4LU5L 4EBQH 4KK8D 5I15H 1P5UA 3IFOA 1J18A 4P2QE 3DI3B 4FTVA 1NLDH 2AJ3A 2B5IC 4ZOCA 2DQJL 2DKMA 1M7DA 2FZ3B 4HWBL 2PXYD 4HKJA 2NY7L 4IEFB 5E94A 5DD1L 1CFNB 4JDVB 4NUJA 4PJEB 4I18A 1A6AA 3HPJB 4FQHA 2OZ4L 1PZ5B 1CLCA 5ETUB 3UTSA 1JWMA 4NNPL 4JFFE 4YHYC 1S7WA 4PJDE 3REVA 4BZ1L 5GGTL 5EIVA 4XRCA 2VZSA 1CVSC 4AG4H 1OARH 1P6FA 4EZMA 1I4FB 2FLBT 3S5LG 5KANI 5J11B 5D72H 4FFVD 1F4WL 4U1KA 1OY3B 3LMJL 3ARGD 1YPZF 3TA3B 3WO3B 2B39A 4WHYG 2X4SB 1UGNA 4RISH 3HCVB 3IJHA 1DQJA 4I3GA 3EO1B 5DK0A 1I9JH 3O6LH 4JZOB 4DGVH 4UU9B 4RBPH 2VDPH 1BM3H 2DMBA 4NHCL 5E0QA 5I17B 3DUUB 1A1NA 1JNLH 2ITCA 2RB8A 1E4XH 2EYTB 1V7NH 4XXDB 3OWEA 4NZUL 3A67H 3TIEB 3U30B 4BFEA 4X98B 5E1AA 1MCOL 4LIQH 2L7UA 5HHQA 3CUPB 4QRPB 1RMFH 1YEIL 3RAJL 3LB6D 1GHFL 3RA7H 2CIIA 4R3SA 1I7TB 1SJHA 3EGSB 4KGJA 1F11A 2DBLH 1C16A 5DWUL 2B0SL 4JFDE 1U41A 3NPZB 2Z93B 3AS2A 4PBWD 3MBEC 2ESVE 4P5KB 5HVGB 3WKMH 2OL3L 4M02A 4YR6B 4UIKH 5CJQH 1GGIL 4MJIB 2Q6WB 1AGBA 3BW9A 1T3FB 4ZSOE 3SDXF 2A6JA 4MS8D 3IU4H 5FYLD 3U0WH 2EKSB 2OI9B 3W82A 2IMNA 2R0KL 1QFUL 4EDXB 1X9QA 2JCCF 4OCWL 3EUUA 1A6PA 4O9HH 5E5RB 4F8QA 1ZE3C 4OZHB 5KTEL 5CJOH 2YZ8A 5C09A 4NQXB 1NUFA 4MS8C 1MHPL 2IPTH 2VABB 4KFZC 2DI9A 1T7ZA 4ZPTA 2YN5A 1BQLH 5F3HB 4Z8FH 3DUSA 4TN9A 3MRKA 5IMKB 1UXWA 4G5ZH 4GJTB 1Y6MR 1T83A 5KVDL 2DMCA 3PWLA 3I6LE 5I8OH 1CXIA 5F8QC 2Z35B 3KPMB 3UO1L 4JB9H 5DI8B 1E28A 1R3KB 3BWUC 3QUXB 1GCFA 4OCRL 5FO9B 4I48A 1NGYB 5D7LD 3UTZB 5GRUL 3U9UA 1L7IH 4OFKA 1OAUL 1RD6A 3SGJA 3CSBA 4M6OL 5C1MB 4WY7L 5CZKA 5DK2B 3CNKA 3MUHL 3QZWG 2DD8H 2DI8A 4OFPA 4MJIA 3FQTA 2XT1B 2KZWA 5D1ZD 4L3AA 1T2QL 4R0LB 3EJYC 1OWRM 3T8XA 1OQXA 1NGZA 1RIUH 5ABDE 4ZAKB 3OKEA 2ZP0T 5JW5B 4TRPH 1RJLA 3T1FA 4NZTL 5K9OA 1UB5B 1WT5C 1K4DA 5KG9B 2EDYA 5EU6E 4JRXB 1U3ZA 1GZPB 1U8NB 4JQVC 4QOKB 4R7DB 2D03L 1XEDA 4WU7B 3EOYG 1I3UA 1XF3B 4RRPA 1F58H 1EHNA 5EU5B 1K6QL 5AWNH 1YEEL 3RY5A 2B7DT 4DFIA 4KHTH 5C0BA 3VXOA 1CDHA 1KLGB 2R4RL 4RMTA 5FM4A 3EYSH 1XGQA 2HRPL 2JCCB 5SX4H 4WWKD 3UBXA 3WIHH 3N1QC 5GZND 3UXFA 1KCSL 4NHUA 3W5NA 5EZOH 1SQ2N 3L3KB 5CZVL 4UTBL 2NY2C 2NY3C 1UZ8B 1R3HA 3NCYS 4LRNL 1BAFH 2R4RH 3AXLB 3HR5B 4AEHH 4BUGA 2CUMA 3MGOA 4GBXA 5GRWA 3VXSE 5GGVL 1ZT4B 3X12A 1URLA 1GH7A 2AJSH 3KLSA 1AGFB 1KJ3H 4L9LA 4Y4FA 5H35B 5B8CB 3C5ZA 1IGML 3SE9H 4UTBH 1FVCA 3F7YB 4M4PA 3ARFD 3VFWA 3P73B 3QG6A 3VGGA 3T2NL 1FO0L 4KKNA 2B2XH 2HFGH 4FRWA 4WCYL 3F7YA 3KPSB 3D9AL 1D7FA 2Q3ZA 2QSVA 4N8VG 5IR1A 2XTJE 4POZC 1LEKB 2G75A 1HHJB 2BSSB 1U3YA 4ZD3H 2VLRA 3WUWG 5BRZE 4NWUH 2YC1B 5T3ZD 3VG0L 4EQ3A 3QA3B 3DX6A 1ZHKA 2R0KH 2R23B 1S9VA 1SYVA 2YD3A 2ZSVB 4Y5YC 1WZLA 3E6FA 1AHWB 1MCQA 4L1HA 1EZVY 5T3XL 2DLGA 4G3YL 2EYRB 4HS3B 4NM4H 2WINA 3JV5A 4OFDA 4ZPVB 2OMNA 2VUYA 5D5MF 3D69A 3O6MH 3GMOB 3MREA 4K3GA 3CCHB 1PX3A 4G6ML 4X8JB 4P0DA 1KXVC 1CN4A 1JF5A 2AXGA 5BOZG 5FOBA 4BH8B 4EDWL 3KPPB 5HYSB 4RGMB 1B88A 3N1FC 5GIRB 5SWZB 2P8MA 4ZSOA 1LDSA 4DW2H 43C9A 1HNGA 4LEOA 1MWAB 3JWDH 2PW2A 1Q72L 2JJTA 1RURH 4JG1H 3RY4A 4KI5E 3E0GA 2N4IA 1JHKL 5EU6B 3O6KH 1ONQA 4LHJB 3U2SB 5C0JB 4U3XA 5CCKH 4HJJL 2ADFL 4Q9RH 2ICWI 4NZRL 1XZ0B 5DFTA 1OWWA 3QHFH 3OTTA 4WO4D 2D0GA 3WHE1 5D7KD 2DQHH 2YMXL 3VGBA 5JPMA 1FNEA 3AREB 4JY5H 1UACH 3VA6A 2WW8A 3U30C 1G7JB 4NKQB 1ETZB 2WLZA 1IGCL 2W0KA 4XHJD 4GW4B 1FNEB 2NY2B 5C6WH 2FATH 4HUWB 2J8UA 5D7JD 1L0QA 3BQUB 4N1CA 4WFFD 3TH4T 4S2SB 2BXYA 4HS3A 4Y16C 2XACC 4XNYL 4BFGA 4ELKA 3B9AA 5IK3A 4HQQH 4X4YB 4Z76B 3L7EA 3UC0L 1A3LL 4NNXB 2VTFA 3RZCA 4U0RB 4OCLC 2CO6B 1GJIA 2MFNA 1ZT1B 1KC5H 2DWDB 4HCRA 4LLQA 2DIBA 4KU1A 4M03A 5IMMB 3MLYH 4I3RH 1WWCA 4JGJA 5GS0D 5I6XC 3RZCB 1KJVA 4S0SD 5EIQA 1FV1B 1MQ8A 5J9PB 3O9WC 3GIZL 2MSPA 1MHCB 2EC9T 2HAZA 3DGCR 2HWZL 1AD9A 3QQ3A 4F37K 1NC2B 2Y07L 4FQ1L 4GOSA 4PRIB 1J05A 4JANA 3RY6A 2YSSB 4QYOB 2ADGB 1VEMA 1BFVH 2BFVH 1AFVL 5D93B 5ANMA 1ZOXA 2DI7A 1TPXB 2IPUK 3QEGL 4X6CE 3TCXA 1UH4A 3VXUD 1T5WA 1DEEB 1G7IA 1VACB 1QBBA 5GRXG 1I7ZA 4PB9H 2NZ9D 1MAMH 4HIXH 1H3PL 4JVWA 1S3KL 1FGNH 5E2TL 5TGBB 1FDLL 4X7TA 2ID5A 3QIWA 2WWMD 1MWAH 4R4BA 2F54D 2IMMA 3MLUL 1WBXA 1PZ5A 3MQIA 4L3EA 2OP4L 2HN7A 3V4UL 1SMAA 5HGBA 2ICEB 5DJDB 1H3VA 1Z3GL 5JLZB 3EYUL 1KN2H 1WBXB 1NGPL 1QFOA 3H9HA 2HT4C 3T77A 1N6QL 2E3VA 1HOCB 2NNAB 4FFWD 4P2YA 1TVHA 3UPRB 1HE7A 1RZJC 1TQCC 1B9ZA 5J1SC 5I74B 1NAKL 1HQRB 1U58A 3B6SB 4UB0H 1NH6A 4Y4HC 5I1IL 1CU4H 1TVHB 3UPRA 3GIVB 2HVKA 1G7HB 2Y5EA 3NIGF 3T4AA 1EUUA 2HH0H 1AQKH 4O51B 3JXAA 3MRPB 4X98A 2HJFB 2R69H 3BO8A 4TTGA 4OFYD 2EDRA 4PLOB 4KROB 4TVPH 5GGRA 3BZ4A 1QQDA 4HIIA 2ZJSH 4G6KH 3TN0D 4R8WL 4PJAB 4NZTH 5IFJA 2CXKA 4K8RD 2A9NH 4GS7C 2ESVB 2AI0H 1E4XI 5KOMC 4Z7UE 2Z4QA 1DBBH 2CLRB 4F7CA 4I48B 2P5WB 4HLZH 4MVBC 3V52H 5L0QC 4PRNB 5DJ6B 2R8SL 3V5KA 3AUVA 3CVHB 1A9EB 2BNUA 4P3WA 3CX5K 5E6ID 3VWJC 3GBML 2HG5A 3DJ9A 3GSVA 2DLIA 5FDYA 5C0EA 4HXBH 5LWYH 5KBNC 1JPGA 3CFJA 2A83A 3AMKA 3GSWB 4H20L 1A7PH 4XMKL 4KTEL 3UZEA 3WXWL 5BVPL 2JELH 1MHCA 4G6JH 4J8RB 4TTDD 5GSVA 1S7RA 3MUJA 5H8DA 4P4KD 3V5DB 3KYMA 1IQWL 1P84K 1UM4H 1HQ4A 4GW1A 1K4DB 4FQCL 1FE8H 3BPOB 1D9KB 2KDGA 3O9WD 1BVKA 4JLRB 1U8NA 2UVFA 3N0PB 3G9AB 4Y4HA 4NJ9L 5IV2B 1B3JA 4FHBD 4LCCA 4JGMA 2L0DA 1L7TL 1KB9K 4JZJC 5B3JE 5DI8A 1W2KT 1D6EA 1K2DA 4JFDD 3FRPG 4HK0A 3W0WA 1JZ2A 5C0ND 5IB3B 4J3XA 3QP3A 3B9KB 2V2XB 4G43A 3QDAA 2Z31C 1KTKE 2YEZB 4X5WB 4HJJH 3C8KB 2Y6SC 1U8KA 2CLRA 2VLJD 4UT9L 4WW1B 3MXVL 5D6DC 1OW0A 5TQ2H 1OT2A 2YKLH 4ONFH 1G7LB 3MJ9A 4L8CB 4J12A 3HR6A 5GRJL 3Q1SH 1HOCA 4JKWA 4HCRH 3CSYA 5TJWK 1XCTA 4GRWB 1NPUA 2W0FB 2A1WL 3VXSA 5GS1C 3RVTC 2NTFB 5HPMB 4X6DE 2XFXA 3T0EB 5AG8A 3ARGC 4JQXA 1C08A 1PYWB 1JK8A 3BZEA 2H1PH 3R8BB 1KT2B 4YNYB 3T4AB 1JHTB 2E9WA 1FLTX 5C7XH 2NY6D 3RWCB 4XNYH 5J56B 4ZFGH 4G6AC 1HSBB 1BVKB 1NMAH 2KBGA 4M8QA 4YNYA 5IROC 1HI6B 1RPQA 1DTUA 1JMXA 1GZQA 1W72L 3NN8B 5B39A 5LXGH 1JGUL 3DO3A 5J11C 5BV7B 3LEYL 1E4KA 4JPVL 5IFAH 2CSPA 3A6CH 1BD2D 3HLAB 1Q9LA 3D5OF 4H26A 1ERNA 2O5ZH 1MHEB 3F7VA 3VGAB 4JDVA 4XVJH 2FBOJ 1MREH 4HULB 2EH7L 3OAUH 5GXBB 1RULL 4M1CC 2NXYC 4LGSB 5DJCB 4PRNA 4Q9RL 1NMCB 3VWKD 1UVQA 1JUFB 3LS4L 1HSAA 2VQ1A 3PHOA 1H8SA 1B0RB 2ZPKH 3TA3A 2ICCA 4UDTB 4BJLA 3BP6A 1P2CB 1A6WH 5HGGS 2D7TL 2WUCH 4NN6C 4OLVH 2MPAL 1R3LA 4OLXH 2HKHH 3CDCA 2YPKA 5DRNA 1AXIB 5AD0B 1A5FL 3IB4A 4IOIB 4X9BA 2ZCLL 3EDDA 3K8LA 3AMLA 4TSAL 3NABL 2XTLA 2Q8AL 3QIUD 3ALXA 4U1NB 1DBAL 5HVWA 1P7QA 4P23C 5C8JA 3BRGC 1EO8H 1Z6JT 5KVGL 4R4NC 4F80A 1AGEA 1N5AA 1GZPA 1HXMB 4PGDA 1JI1A 3AREA 3IKKA 1J1OH 3QIUB 3EGSA 3SDDD 3W81A 2X4UB 4UV4H 5DJZA 1UA6H 4JFFB 4IHOB 4PJBE 3FT3B 3U48A 1F42A 5DK3A 3BJLA 4N9GB 3LRSB 4P5KA 3KXFD 1A3QA 1KEGH 4FQ1H 3KR3L 5GS2H 1Q0XL 4FQXC 1T04B 1PBYA 1TZGH 3BEVA 1PG7H 2EDQA 3CFBA 1IAIH 3FZUD 1IGIL 32C2B 2F54E 1XH3B 3OKLB 1EHLL 4PJGF 2IANA 5FO7B 4CBPA 3WIFB 3IJYA 2Y36L 2FBJL 1HILA 2A9NL 2E9IA 5ID1A 4MX7A 1AGDA 2EC9U 3BUYB 1QYGL 4YXKH 5C09B 1AR2A 4YHNA 1MFBL 3X14B 4DFHA 4XNUL 5KS9E 5LCVL 4F37F 2P4AB 3KS0J 4BELD 1NLBH 3DSNA 3HA0A 2OTUB 4KVNL 5DRNB 2B1AH 5HTSA 5J1AA 2NXZD 3LCYA 4U7SA 1NDMA 3DX7B 4JDZB 3MCKB 5ITBL 1TFHA 3BGFB 5EU5A 1ZLWK 1CIUA 2A9ML 1T0MA 3NFSL 1FNSH 4HJGB 5JUEH 2UY7A 2VDKH 1HIMH 3HUJB 1KB9J 5D1XC 2A1WH 3QBTB 4XNQA 2LE9A 4A2LA 3O8XA 4R4FH 1J11A 5HGHB 4HJGA 3MBEB 4YBQD 3NMEA 3A6BL 4CKVX 4CN4A 1ZS8A 3WNMA 4CNIA 4OZFA 3NPSC 3ULSB 4XCNB 1FNHA 1PY4A 3MV8E 2ZUSA 1FGVL 3L7EB 1JV5B 4NRZB 5EC2B 5FK9B 2A0LD 1M1SA 1T4KA 3VJ6B 2X1PA 5AUMA 1A6UH 1KN4L 2QEJA 4E41E 1AH1A 1RUAH 2OX5A 3MACH 1NCAH 4DTGL 5JOPE 2HT3C 2NR6C 2FECI 5FYJD 3QO0A 1PKOA 2QQKH 4OLWL 4U4BA 2YPLA 2CK0H 4YHLL 1DUYB 3BD5A 1SVCP 1GOHA 4RX4A 3BMVA 4AT6A 4JKLA 3IDXH 3IETB 4AIXA 1LNUA 3K0WA 3IDMA 4EEEA 1BF2A 1DLHA 4XPHH 3JV6A 1I1AA 1B6UA 5BZDA 5I8KH 4JO2L 5MENA 4PJGB 4FFZH 4P3DA 3BISA 1LO2H 1FVDA 1NAMB 4O2EB 4OM1H 4FQIH 4JFFA 3DLQR 4XMKH 3WXWH 3IFOB 2A6IB 2UWEE 1WFNA 2IH3B 4X83A 4S1DC 1I1YA 4Z78A 1NEZG 5E2WL 4MSWA 3UPAA 2Q76A 3OKOB 1BFOA 1Z9LA 1WAAF 4IRZL 3SBWC 1I1YB 4Z8FL 4TVSa 3TH2T 32C2A 1T1XA 4MB3A 3RI5F 1T1YA 3C5JA 2LVCA 3DYMA 1N2RB 4XZUB 4GLRH 3L5JA 4P23B 3X3GH 4JPVH 2DS4A 3LEYH 2JLLA 2AGJL 1AGDB 2ZUWA 4YEEA 4D9QD 2WP3O 4MCYA 3V0VB 4BFIB 4QRRB 1E6OL 1RSFA 1CDJA 4QRTB 4XH2A 1YY9C 3GSNL 3MNZA 5I30L 1HHJA 2DTMH 4UIKL 4NGHL 4XHJC 1GIGH 1WJ3A 4DZBB 5E2VH 4X4MA 4JFQA 1VADA 4BSWB 5JHLL 4NQED 4PG9A 4KQ4L 3VFOA 3LH2H 4FXLA 1D5BA 1OP9A 2W65A 1NGQH 2UZIL 2E7LC 3VCLB 2R1WB 2FZ3A 5DMKB 2AV7A 2IBBA 4R2GC 3I9GH 4CGTA 3GIZH 4S10A 2CRZA 4JAMB 4PJXA 5SWSA 4X8XA 1LILA 3GJFH 2YA0A 4LP5A 3U9PH 3IXTB 1A47A 1WBYA 1Q94B 1UENA 2FCBA 3S35H 5L8KB 3DYPA 3V7AG 4LL9A 3RGVD 3MUZ1 3OXSB 4S1QH 1UQSB 5CJBA 2ATKA 3IAPA 1NCUA 5GS2D 3RL2A 2C1OB 5F88B 4JFEA 2CLZB 4LCCC 3ARFC 4JZJB 3SE8H 4HX1B 5DEFA 3DUUA 4BZYA 5HHXL 2X9YA 5SX5K 3KPSD 5D1QC 5F7EH 4NO5B 5JQHC 1J0ZA 4OM0L 3FCTA 1OAUH 5BMFL 5GGVH 4K7PH 3AY4A 4KZDL 3P4MB 2DQDL 4WVRA 3MRDB 1WUNT 4ZS7H 2I07B 5D1XA 4QTIH 2NW3A 4P3DB 4TUKH 1TNNA 5FAAA 2AP2A 2X6MA 5IB4A 2CDEB 1G9ML 1OW0C 2ORBH 1V7ML 4LHUA 2EZ0C 3T2NH 5ADPH 2C1PB 1RZ7L 5D1QB 1MIMH 1KPUA 3FQUA 2G5BB 2H8PB 2R0WL 5MP6H 4QRSB 5DJXA 4GO6B 3IFNL 3IFLL 4UILH 9CGTA 2BVUA 2D03H 2XG5A 3QCTL 4PLKC 4OLZL 1R5VA 4RZCB 1JZ4A 5GGUB 4QRSA 1X4XA 4W70A 5DEGA 4JPWH 5L8JB 3GBLA 1HZHL 1U8IA 2EKSA 3MV9D 3MLPA 3QI9D 4R6UA 3AFLA 4KGLA 5DSCA 2VUOA 3V4PH 4FOMA 3K46A 1OLLA 2PCPB 1C5BH 2AQ3A 5B8CC 1A9EA 1BZ9A 1JL8A 4G80A 3I2CH 4BH7A 4XPAL 5E6IC 4DGYH 5FYKH 1N26A 2PCPA 1I7UA 2YWYA 3EJYD 4KPHL 2VABA 1G6RB 2HTKC 4RQQB 3V6OA 3OV6A 4RWYH 5JORB 43CAB 2AW2A 3FRPA 4PB0H 5CBAA 3OX8A 5F89B 4AH2B 3BIAX 4B7LA 2JF1A 4LKXB 4Y5YA 3V0AC 3VWJB 3PWPB 5EZIL 3E2HC 4I0PC 3KYOA 3GEWB 5A2IH 3IRPX 1D9KA 2VDML 4G43B 4CVXB 5C3TA 4QHNB 3TIEA 4KJQC 4WI2A 2RR3A 2F8OA 4GRLC 4PRHB 5JZ7C 4XCYB 2JB6B 2R29H 4DOHE 1ED3A 1S5HA 1EFQA 4R26L 4KUZH 2YPLE 4MNHA 4QT5B 4M62L 4MQTB 1Q8MA 4OSUH 4QXGL 1HHHA 4HK0B 3SJVA 3GO1H 2HN7B 3Q6FB 4G7YH 1WBYB 4F7CB 4NHCH 2GUOB 1QSED 2OXHA 5E4IA 3HR5A 1MF2H 1MI5B 4WRLA 1CT8A 1W0VA 1KNOB 2NNAA 3TO4D 3QT2A 4XPHL 1Q9OA 5ACLA 4NQCA 4O58L 4ZTPH 1PW3A 5K9OB 5HBBA 1DE4A 2HP4A 5DVKA 2AJYH 4HKXB 4F9PA 4XI5C 2VLRE 5EDXA 1OAYL 4Z7NF 3ARSA 4YBQC 4P4RB 2I60L 3M17B 4LVOB 1QLRA 2DTSA 4PBXA 1P4IH 2NY4B 5ADOL 4XVJL 5CUSH 5IB4B 4NC0B 4XHQA 1T66C 3VFPB 5F3HA 1PLGL 2CRYA 4X7DC 2AJ3B 3AROA 3TT1H 2O26U 5DT1H 2ZUYA 1PKQE 1VESA 1WVZA 1RURL 3FQUB 3BT2H 2ED8A 4NUJB 4TSCL 4ONGL 3WLWD 3ABZA 3C8KA 5TH2B 2EYRA 4MDIA 2W9DL 1JPTH 2WWMC 1G9NC 2P44B 4GKSB 4KJYA 4LCIH 1EHXA 4KQ4H 2HG5B 3GSVB 5C0EB 4UNTA 1PAMA 4MQ7A 1B4JH 4RGNB 3HZMB 4TSAH 3SCMB 3TWCH 1H3PH 4QHLA 3PHOB 3TO2A 1JPTL 3LN5A 1JGVL 1I3RB 3MCLL 1E0OB 5J4MA 4PJHB 3ECBB 2BY0A 2H32H 1MRFL 2G75B 3LY6A 1PYWA 3ZSTA 5FECA 5J3HC 5IB2A 4F9LC 1TDQA 1FYTA 1M71B 2XWTA 4DN4L 3OGCA 4NPYB 3MRKB 4M7JH 1IGTB 3IT8D 3NFPB 4GG8A 4YDVB 5T5NG 2F53D 2KL6A 4M1CD 1RZ8B 4JRXD 1A7NH 3U4BL 2PTVA 3Q6GL 5TE6L 1OGAE 1CFQB 2D0HA 5BV7L 2M26A 3NACH 4PJ5E 5HGHA 3HC0A 5EZJA 2XIDA 3D18A 5MI0B 4MWFA 4AEIL 1A9BA 1FFPA 3LB6C 4Z78B 1WGOA 1YEDB 4K7PY 3OKNB 2QKIB 5IFHL 5HHXH 2DMKA 4ZFOL 4OQ1A 1CICC 4EN3A 4CADB 3IXAB 2BJML 4Z7VF 4WI8A 4LCUB 1F90L 4JE4B 4QGYA 1ZK9A 1Z2KA 1OTUD 1T03H 1YEIH 2VZ3A 2H3NB 3TYFA 1U36A 5J06A 2DQCL 3WIIH 1KJ2A 3KLHD 1P2CA 2VZUA 5IMMA 4Y4FB 1JMZA 2FX8H 2BVPB 1RZ7H 2HRPH 2DBLL 4DKEL 1JCKA 4J3TA 2ZCKL 4HJ0D 1HILB 5DS8B 5JHDB 2OL3B 5HYQA 4M7LH 4XCEB 3OSKA 2XA8L 1FFOA 3KJ4B 4UUJA 4HAGA 4NC2B 3MRHA 2CRIA 3PJSB 1J05B 4M1DH 2YKLL 4MYWB 1YPZB 4ONFL 1HCVA 1GL4B 3OF6A 3ZDZE 4UQ3A 1IL1A 2BC4A 2RFXB 5KVEH 1G6VK 3TV3L 4IJ3C 2D7OA 4R2GD 1FGVH 4OLUH 4ZUWB 5JHDE 4A6YB 3DARA 4GKNB 1YECL 3HC0B 1QLFB 3PQYA 1I1AC 3G6DH 4JQIH 1B6DA 3DX8B 3OR7B 3N1GC 3EOBB 4PJBA 3PG2A 2X1QA 3CFKA 3L3OB 3FB5A 4KJYB 2O61B 5C08D 2IBZX 1L7TH 1IM9D 4UOW0 5F96H 2CRMA 4HJ0C 1BF8A 1KF9B 3IDIB 3HI6L 4XC1L 1AIFB 1LO0L 3HUJE 1I85C 3DI2B 4HKZB 3C5ZB 5IVNA 2NY4C 1DQQA 1OSZB 1U8MA 2CJUH 4FABL 4HT1L 5FB8B 3IDGB 4IOFC 2BNQA 2XZCH 4K8RL 5D6CB 4UINH 1MIML 4Y19D 3PGCB 3DVGA 1QO3A 3QG7L 4PFEA 2AV1A 3UX9B 1YN6B 4WUKL 4Z7OE 1WIPA 1LEKA 5LKNA 1T5XB 2A77L 5TDNB 5HHOA 2BP3A 3B2VL 1FVDB 3THML 2HT2C 4GG8B 4BZ2L 1S7SB 1F4XL 2V7NA 3PL6A 4YHLH 1OLZA 5FA3A 3ZE0E 2D2OA 3P4OA 4K7FB 3GMRB 4ODTL 2VLJE 4Y7MA 3U0TA 3BJ91 1CICA 4RNRA 4H5SA 1ZLSH 5KN5A 4RGNC 5DD6A 4LSQL 1GAFL 4KMQA 5F9WB 4K8RC 4WI4A 2CUIA 4AJ0A 5ISZA 2FR4B 4PG2C 3GUTA 3ZTJG 4P2RB 2HKFH 3IXTA 4Y5VC 4OZFB 1EERB 4HWEL 5EU4B 4WFED 1UB6A 4GRMB 4G8FA 3D69B 4HC1A 4P2RA 4QRRA 3TYFB 2NY3B 3NZ8A 5E8NB 4KDTA 1KENH 5IK3B 1R6VA 1CXKA 1MJ7L 3HE7D 4JFEB 3SDYL 1D5XA 2V9QA 3HZKB 1QNZH 1MCNA 4R26H 5J6GB 3WNPA 3GM8A 4LQFL 4LCYB 3HC4L 2J5LC 5TFSL 2VXUH 4PR5A 2X9XA 2E6JA 3S96A 3NZHL 3Q5TA 5J12B 1BEYH 3TBSB 1U8JA 3G5XA 4LCWA 3CFDA 2IAMD 3PWPA 1N4XL 4APQD 5CZXC 1RUQH 3RWJB 2H32A 3RWDB 1P7KB 2QHLA 4LDLB 5IB5B 1MHPH 3MRNB 4PRHA 2X4NA 3WFCH 1HYSC 3ILQD 4QT5A 4XVTH 3WFBL 1I8LC 2P8PA 3MNWB 3MZTA 2A73A 3OAZH 1CS6A 1EUTA 3C60C 4U6YA 2BMKA 5FOBB 4XMPH 4K23L 4OI9A 4Y88A 2X4TA 2CLVA 4I8DA 4Y1AB 4DKDC 1KELL 1J8HA 4OCRH 1UCBH 5CEYA 4J1UA 2Q8BL 2VH5H 3DMMD 3MO1A 3P77B 4G8EA 2BNQB 1T7YA 5DA0B 3DXAE 3OAZK 5D9SA 1CF8L 1Q0XH 4P3CL 2P47B 2PTUA 4QCIA 3INUL 3DETD 4Q7DA 5F7YC 3RL2B 4FFYL 4RAHA 3QCVH 4ODSH 5T1LA 3GGWA 1QSFD 4YDJA 4NQDD 1H9VA 3QXAB 3DV6B 1CGWA 1NGWA 3SGKA 1JRHH 4XX1E 4XGZB 1A7BA 3DUSB 5IBUB 2W9LA 1F90H 4U6VH 4NFDA 1OP5K 5F6IC 5I75B 4XC3H 4NRXB 5IBLC 1SJHB 4NNYA 2HTLC 1DQLL 4ODXA 5HY9A 1YY8B 3VG9B 4F8TA 4JREC 2FR4A 5DZOA 5JA8B 1HHHB 4JFHD 2BVEA 2DQIH 4K3EL 3QFJB 2FH8A 1JHLH 2ARWA 4GG6E 4FZEH 4PY7A 1T20B 5ESAB 2VDOL 1DLFL 5DF0A 5EN2A 4Z7QF 4DN3H 2EDFA 3CZFA 4IRJC 3I02A 1YEEH 4O02H 4G80B 5IW6B 2JJSA 4YBLC 2VXTH 4QXUL 2VSDA 3S37X 3HRZA 1S7VB 5J0BA 3VXUE 4XNXL 4N0CC 4FNLH 4H88L 5IG7A 2J6EA 4LASH 3C2AH 4Y1AA 1YPZE 3BKJL 3ROLA 4OUUB 1ZEAH 1YMMB 2XKUA 2AK1H 4DEPB 2WV3A 1IC4H 1QG3A 2YZ1A 3AY4C 5EO9A 4NKDA 3L6FA 1FAIL 4RAUB 3VGEA 4KUCF 1KG0A 1NFDB 5IKCB 3DV6A 1QBAA 1AJ7H 2ERJB 5D4QA 4QHKJ 3B43A 2RQ8A 5CSGA 3K8MA 3X13A 1KGCD 1HN1A 3MC0A 5F96L 3I50H 2MTPA 2GFBA 4Z7WB 2H32B 3X17A 4QEGA 3M45A 4P2QD 4EUPH 2H9GB 2M8XA 5JNYA 5LGJA 3KPRB 3GI9L 2AAVA 4XNUH 5EA0L 4WUUA 1E4WL 4NHUB 5D7JC 4WV1A 3OKKA 2OM5A 5CP7A 2AERT 1FFNB 1A14L 4KRPC 1DANU 1E4XL 2YD7A 4Q58C 2VISB 5SWZD 5C0RL 4AENA 1CLOL 2PYED 5D8JL 5B8CA 4ZUTA 2VLJB 2HMID 1IVLA 2VNCA 3FFCE 4CW1B 2FJHA 3ZDYE 3SY0A 2JJSC 5IVOA 1Q9WA 4F58H 2R0ZL 2G9HB 1UM6L 1DQJB 5KZCB 5BS0A 4PRPB 4HIHA 3QR2A 4KK9C 2MNUA 3BZFB 1P7QB 4HLZG 4HLJA 3C6SB 1S8DB 4JCMA 5F72S 1TJIH 2BVTA 4GAYB 4GSDL 4UOJA 2CDGB 4Z77A 2EKJA 4BQ9A 1T6VN 2LU3A 1GXEA 5F7KC 5ID0B 5SWZE 2IPUG 3ARUA 3O4LB 3HUJA 3WL9B 4RMUA 3OPZH 4IRSD 3L9RB 4M5YL 3UTQA 3VD3A 4OZGE 5FUCC 3MRIA 1U3HD 1MCCA 2VE6B 1I3GH 5JTWA 3BP4B 3NPSB 4ZUUA 3QUXA 2DQHL 5F1SA 3L9RA 4I2XB 3ULUF 2A6KB 1YNLH 3PQYE 2IPTL 1JV5A 3O45B 2V5RA 4MJ4A 4NRZA 5EC2A 4GG6A 4JKKA 3QNXB 4LF3A 5GZOD 4YQXL 2IANE 1XR8B 3DV4B 3KWWA 1D5MB 1DBML 3BFOA 4YHIB 2GCYB 4UAOB 3QNXA 5KSAA 3ARYA 3C8HA 2EIZB 5F9OL 1MWAL 1OD9A 4HUVB 2AEQH 2HYMA 2Y4SA 3SCMA 3S4SA 1NC2D 1RHHB 1RK1B 5C07D 1FFOB 1DBBL 4UUJB 3QJFA 4PRID 5BS0B 3ARWA 3G9VA 1S9XB 5J1TC 2H6PA 4TOYL 3VXMA 1HZHH 3MRBA 5K9QI 1L7IL 5D7JA 3PWLB 1U6AL 3RL1A 3VXMB 1XIWC 4ERSH 4L4TA 3N85H 2L4OA 3KPRA 1JYXA 5I9QB 3TN0C 2AEPL 3BEWA 4HPOH 4LVOC 3FB7B 1OAXH 3EOBA 5JXED 3CXDH 2NY5L 4H8WC 4Y5XA 4YPJA 3QCVL 4WW1A 5AZ2L 3MREB 5E8DL 4UIMA 4U1IA 4DZ8B 4XVSH 1UKQA 3T4YB 1MI5A 3GRWL 5DZNA 2HA1A 4X4YA 1EPFA 2AEPH 1EEZA 1MI5E 1TCRB 3ARFA 1KPRB 2ADIB 2AXFA 2PW1B 4GUPA 3BRDA 1KPVA 2R4SH 2VKXA 1MAML 4LGRB 1QZ1A 3ARGB 2X7LB 4HIEA 5HPMA 4S1SL 2NXZB 5HI3D 1QEWA 5ECJE 4Z95H 3IYLW 3L95B 3SE4A 4OT1H 3PWPE 5J7CC 3QEHB 3Q48A 1FBIL 1A2YA 3S36X 4TULH 4ALAL 4OQTA 4ENEC 4JPKL 2YD5A 2W9EH 4BFBD 2EH8L 1MCSA 1QACA 1WTGT 3VXRE 4IIQA 3HE6C 1MFCL 4F7MB 5C0RH 4KAQH 3L3HB 5CEZD 3C5ZC 3MV7D 3HB3D 4UQ3B 4LVHB 1Z0MA 5DJZB 3F7PC 4GRLD 5IB5A 4I0PA 2XN9E 4WGWB 1TETL 1CE6A 4LOUC 1HSAB 4K9EC 3QRGL 5FUOL 4GG6B 1H3TA 1IFHL 4LMQI 5GRZA 3OR7A 4YFDB 5E6IB 4OZIE 3LS5L 1JF6A 1A7OL 1G9MH 3HS0A 4Y2DD 2YRLA 4FXGA 5BZWA 2ZG1A 3UTOA 4XNZC 3KVQA 4YHIA 4DVRL 1MFDH 2BSTB 4LSVL 2MJWA 5MERB 4MAYA 1KJ2H 4WENB 5F88A 2O5ZL 3L3DB 4XTRC 2CMRH 3G04A 1QPXA 4CDGC 3QEQE 5HYJE 3X14A 3PABA 2VC2L 4Z0BH 3FT2B 2V7NB 3SE4C 4PJEF 3RVVC 1OARL 2GAZA 4JY4A 2DQGL 4WI7A 5DURD 1MJUH 2NW2B 4KVCL 5GRYA 3BKCH 4PLKD 2I07A 4TPRH 4XGZA 2NY0C 2VZTA 4D0CA 1FRGH 35C8H 4NQCE 4OZGF 1T0MB 5D70H 1CLZL 2R9HC 5T3ZL 2AV7B 4PJ8A 1CLOH 5D8JH 4DW2L 5BVJA 1KCVH 4C56B 5E5MB 4YHZL 4FFWC 2W92A 4TUJB 1CICB 4RNRB 2FWOA 4FQCH 2UVEA 4G5ZL 3ULSA 4OD2A 1F6LL 5T3ZH 5L7XH 1YEHL 1C7TA 4K71C 1MCOH 3PF2A 4LIQL 3O6FD 3IJYB 4G42A 1AD0B 5IW6A 3ZKSD 3RTQC 5T1DL 4I77L 3STBA 3LPWA 1JPGB 1VB9A 2Y5TB 3DURA 2R0LH 4WUUE 4Y4KB 5TQ0L 4IIQC 1LDPH 5EU3B 2XICA 1IGCH 1XCQA 3CDGA 3PABB 1BGXH 1Q38A 2OL3H 4KTDL 4N90D 2D31B 3IDMB 4Y4KD 3UBXI 4FQXD 1KG0B 4BSVB 5JOFB 1P7KA 1A6WL 4KK8C 3MFFA 4FFVC 5DGRA 1S7SA 1TJGH 1U8PA 1IC5L 1VFAA 3QQ4A 4YQXH 4RMWA 3CFDB 4CL7A 3S34L 1BOGA 2HLAB 3SDDC 1NFDE 2XXMB 1EAJA 1JGLL 4XVUC 4P46D 1BQHB 5EUOB 5AUMB 4K94C 4KK9D 4EXPX 4CRPA 5I1CL 3QAZB 1AXTH 4KKCC 5DSCB 1QRNA 2XZAH 2A9MH 4XBEH 4C57C 5B3NA 5E8NA 3KHOA 4OFIA 4W81A 3NIDF 3UP1A 4K2UL 3EO1A 5DK0B 3HFMH 5K33A 4Q74A 3KJ6H 1YEFH 4PJAE 5C07B 1YQVL 3D3VD 1XGYH 4XH2B 1C08B 3P11H 2C1OA 4OGYH 1KYOJ 3HE6A 4FMKA 4JFZH 4XCFL 5F89A 4AH2A 1S5IH 3CDGB 4P4RA 4LNRA 4NO3A 1NCDH 4OF5A 4OFYA 3SKOA 3VE0A 3KDMB 4N8PA 2B4CC 3R06A 3UMTA 2DICA 1KULA 5JDSA 1LO4H 5I1EH 2HJFA 2X70A 3P9LA 5BXFA 4CAGA 4E42A 3I6GA 3S98A 5CJXC 1CR9H 3PWNA 3DSFH 5HHPB 1U8KB 2OXGA 3DXAA 4N1HB 3QPXL 1A6TB 4E42B 4C4KO 5HDQH 3HC3L 3UTZA 2N1KA 2CKBL 2R2EB 3T3PF 3HNTH 3SO5A 2WK2A 1F45A 3O4LE 3PE9A 2BVOA 2XA3A 2GKIA 2PO6A 1VENA 3QUZB 1VEOA 5T5FL 4QGTA 4LF3B 3SDAC 2HH0L 3DURB 1DE4B 3H9SB 3VU2A 4KAQL 4EI5B 3G08A 5E8PA 4OCYL 1MY7A 1IBGL 3FQXB 5I1AB 5E8OA 3HI1B 1HNFA 1GGCH 3JWNC 3VFRA 1O7SA 2J8UE 4PLJC 3ZE1F 5JPNA 1JVKA 3QUKB 3G5XB 3V9FA 4LSRH 4TNVF 5C0CB 1KN4H 2MWCA 2P46B 3V6FA 1D5BB 2AK1L 4XWGH 4LCWE 1VCAA 1C5CH 2EYTA 4M6AA 2FSEB 2ICES 3VXRB 5CD3A 1JNNH 1MELA 1VHPA 3WEXA 3RWDA 5B3JF 1JGEB 4MNQA 3RQ3A 5C0FA 4QOKE 1XF2B 1KGCE 1MCWM 4AY0A 1U8HA 4U7MA 2PTTA 2VC2H 1IQDB 4BKLB 2ADFH 2VZ1A 2C4XA 2EIDA 4G9DA 5E00B 4N8VB 5EUOE 2BVQA 3I2CL 3BKCL 2BDNL 3K74B 4JJ5B 1WWAX 4F15B 5IM7B 1MSPA 4Z5RB 4MQ7B 1BFVL 1LO2L 1OTSD 3UDWC 2QTEA 1BBJB 3C60D 4RRPG 3V7AE 1I4FA 4V1DB 4ZFGL 4QRUA 4Z5RA 5D2NE 2FH6A 2YD4A 4ODTH 5GZNC 3VFWB 4ETQA 3MMEA 4ODWB 4KMTL 3CZJA 4W4OC 2NTSP 3WFEH 4LK4A 5C0BD 3DX9B 1BZ7A 5HI5D 3TP4A 2WIMA 1MFAL 5IWLA 3P4MA 4GAFB 1TZIA 4PRHE 4PJCE 4M62H 1U8LA 4O4YH 2DM4A 4J3VA 4EN3C 2F15A 2EDLA 5EC1B 1HXMA 3D25B 4PGDB 3OX8B 3D2UD 3DX7A 1JPSH 1TZIB 4GAJL 3H3PL 4JRYE 4NZDA 2RFXA 1UM5H 3FRUB 2R23A 3NGBC 3BPOC 5A3IC 5D7LA 3AU1B 4MA3A 4U1MB 3D39E 3QFJA 1NCWL 3WXVL 2I5YL 2JB6A 5LGJB 4U0RC 1CTOA 4YZFE 5B4MC 2DAVA 3TT3L 3UCRA 2ZSWA 1GIGL 2X2YA 4PJIE 2SEBB 3RBSA 3MCLH 8FABA 1UACL 4WNQA 1H3XA 4YFLF 4FXKB 2Z8VC 5IF0B 4PV8B 5MHSE 3WBDA 3QPQC 1JWSA 1TLKA 3B2UC 5E08H 2R2BB 1INDH 3EO9L 4NSKB 4XBGB 4LOUD 2VAAA 5L0QB 4ZUTB 5EG6C 5CLTA 3TIDB 2DYPA 2E7CA 1EO5A 3I85A 2IFGA 2NTFA 3JSSA 2I26N 4WJ5A 3RA7L 2NXYB 1MCEA 1BQSA 3BT2L 5IP4A 3L3JB 3NTCL 5CHNA 3PGDB 4IRZH 5AEAA 3BHBB 3NFNA 5K9JL 3C6SA 1KCSH 1LNUB 1U8LB 5L2KE 3VXPA 1WCQA 3NCBB 3WDJA 3HMXA 5IWLC 2ADJA 5DRZA 1KC5L 3BHBA 2BOCA 3NFNB 4OIIL 4QRQA 4RGNE 4N90E 4NPYA 1ZHBB 5L2JB 3UJJH 2Y7QA 5GISL 1IGYB 3BPNB 3O4LA 4KUCD 4DGYL 4ZPVA 4WV1B 3GSNH 5TDOA 5DVLA 2F53B 2XN9A 5I30H 3BQUA 4LLAA 4KKAC 2AEQL 3GNMH 2Y7QB 2FJGB 3MRGA 3O2DL 4MDIB 4ZUUB 2PF6A 2VAJA 4NKMA 1CT8B 1S78D 5FOJA 1JUFA 4OAWA 4FXKA 5E99H 3MYZA 4YUEH 3ZTNL 5L2KD 4KKAD 1V3LA 3TBWA 4ZD3L 3CFBB 2VWEE 1RK0B 2GY7B 1FZOA 4XB8A 5DGQA 2A74A 4X6DF 4JO4H 3DO7A 4UBDD 3E8UL 2R0WH 4QHLB 2J8UF 2ZKHH 1HHKB 3GRWH 5EU6A 1J9CT 12E8H 1R3LB 4MXQC 1OVZA 3WIHL 4WHYH 4QXGH 1X6NA 5ICYB 4YAQA 4M9OA 1SBSL 3BP5B 5C07E 5D5ME 3LV3B 3IS0X 1MJJB 4TNWK 3OL2A 1N6QH 4LAJH 2Y06L 1KELH 3OQ3B 4I1NB 3QUYA 3BD4A 1N5AB 2X44D 4WHCA 2IFFH 5C0DA 1W8OA 1BAFL 3SDXA 4H88H 3N1MC 3I75A 2YC1A 3BYYA 3RU8L 3GBNH 5IHUL 4X0KA 3MRNA 2HMIC 2LU4A 3RTQB 1TZHB 3MA9H 3EFDL 2YS4A 3KJ4C 4XPGH 4N9GA 1SEQL 4LGPB 4MJ2A 4UT7L 4ZS7L 3R8QA 1VGKB 3BDXA 3FFCB 5MEOA 2APXA 3W9EB 2WINB 2BHUA 5T1MB 4ACPA 4U1GC 4HV8B 3ROOB 1ACYH 5CCKL 2I9TB 5KVEL 4U7KA 4HFWA 4LDEB 1OTUC 5EB9A 3S4SB 4LCYA 2FO1A 1FSKC 4J23A 4F9PC 2NY1C 3GSNA 5KZCD 3MLRL 1X5IA 1G9MC 3IDGA 2VL4A 4UTAH 4K3DH 1DLFH 1M71A 3FO1B 4U6HB 4XTRD 3GSNB 5ICZB 5MEPA 2DBJA 5DC9B 4ZQKA 3HG1A 1P7HL 3VXRD 4OGXH 5DJAA 3ARBD 5C0CE 4PRDB 3QA3A 1ZHBA 2LAAA 1KIRB 3DROA 5BW7A 2DIAA 3WUWA 4WV1C 4WO4B 5C9KA 1UKTA 1ADQA 4NP4H 2EE3A 5DR5L 2XRAL 4PRDA 3PIQA 2W0LA 3KXFE 1QLFA 1L6XA 5D1QA 4L29A 2C9AA 3LN4B 1N3NB 4XCCL 5IBLD 3GMMA 4RMRA 1IM3A 1HXYB 1T20A 2HFEA 1ORSB 1N6UA 4HF5L 4YC2B 4OLWH 3RIFK 1OAQL 1T4KB 5ETUA 4JM2F 5I1KL 3W0WE 1GC1L 1QFPA 1RK0A 4J1UB 3FL7A 4LPTA 1MJ8H 1JPFA 5TE6H 4NZRH 5HGDA 3QHFL 2C3VA 2R1YA 2HT3D 3HNSH 2DM2A 3DWTA 2C3VB 2R39A 2V9RA 4FQIL 1HQ4B 4GW1B 4NM8H 4QRTA 5J6GA 3PHQB 3RNKB 3D39B 2QHRH 3GMLA 1U42A 2E9JA 2GAZB 1NL0L 4P2QA 4DK6A 1XCQB 4YDIL 5CIPH 4OGZA 5ESQA 3B4NA 4JANB 4OFVA 3GMLB 4JO1H 4KY1H 3BWAB 1NCNA 1KSRA 1KCUH 1YY8A 1KENL 1INDL 1FJ1A 2VDPL 1ZLUH 4KMTH 4F3FA 4GW4A 2APFA 1A6TA 3I3EA 3RGHA 1KIQA 5BRZD 5ISZB 3OG4B 1YNKH 1ZVSB 4KHXL 3CSGA 6FABH 3I02B 4M6ML 7FABL 3CFCL 2OCFD 1GPOH 3H9SE 2E27L 4AEEA 5IESH 3OR6B 3TV3H 2F54B 3KG5A 1HKLH 1PLGH 4P59H 4R97C 1BZ9B 1G7MA 4WWKC 3LD8C 1TQCB 4GAGL 1JYVA 3LEVL 4EUPA 1TVBA 3G04B 3SHSA 5FUZH 5E2JA 1RIVL 4Y5VA 4MXWH 1QA9B 1NC4D 1I3GL 2H41A 1BZ7B 4PTTB 3TBVB 1ZSDB 4JRYA 4ENED 3MLXL 3SGDI 4F7EB 5DEZA 4KDTC 3SE9L 5BXFB 2YSSA 4WGVB 3X3FH 1QFUH 3FB8B 2AK4A 3RVVD 4IRJB 2QQLL 3KJ6L 4UT6L 4LARH 4PS4H 3CPLA 1QUNA 2IBZY 1TTFA 1KN2L 4LQ1A 1OQOA 3HNVH 3W9DA 4C56A 3MV7B 2R4SL 1EFXB 3CC5B 2ENSA 3PDGA 2MCPH 1FL5B 4ZXBD 4Z6AT 3CPLB 2DDQH 2C3WA 3P0YH 2GSGB 5JMRA 3MBED 1X5LA 4I5BB 2B4CH 3V6ZA 2ZCLH 1SBSH 1UB6B 1ZGLP 5I1IH 4PJXB 1M7DB 1X7QB 3WJJA 1MHHB 2GJZA 3DXAB 3NGBB 3O2WL 4G6FD 3M8OH 1T1WA 3C6LD 2ATPB 3Q6GH 1DBJL 4P46C 1OGAB 3QQ9D 5CIPA 4QRUB 1QRNB 3QEUA 3S88L 1S9YB 1BMGA 2Z92A 4EI6A 1YJDC 1A7RL 1KACB 4G6FB 3BX7C 5CIPB 4P2OB 1VPOL 3C6LB 3NA9L 2YR3A 4LLUB 4OIAA 5DUBA 2UYLA 1CVRA 4HGWA 2Z92B 4HMCA 4C56E 3RX8A 1S8DA 3GMQB 4PJ9B 1RVFH 5FECB 4AL8H 2VYRE 2DOCA 2FD6L 4P2OD 4LFHG 1IGFH 2YK1L 4QXTB 2B20A 5I1GL 4EUPG 1CDUA 3GDBA 3QIBA 1JJUA 3BPLB 3IGAA 3X13B 4BZ1H 1H15A 3QDJB 1MY5A 3F7VB 2B1HL 2CGRL 4LHUB 5HHMD 1XMWA 2EIBA 5HI3C 3RTQD 2XYCA 1AO7D 5IM7A 1YYMH 2IQ9H 4A6YL 3MRCA 3OHXA 4JFDB 2QQNH 1PQZA 3SO3C 4NC1E 1BBJA 3OG6B 2P5WA 2Q20A 4GRWE 1A1MA 4WUUB 3THMH 5F7DA 3MPCA 1JGDB 1KTLB 4GBXB 2OZ4A 4OAWB 5D7LE 3TO2B 4PGCB 1P7QD 4GKOA 1SBBA 5LQBH 1ZAGA 3LHPL 1G0YR 3P73A 4WJ5B 4YE4L 2B5IB 3DECA 2LQRA 3RUGB 4AENB 4V1DA 1F3DH 3BXNA 4IMKA 4JQIL 1NDGB 4ZFOA 4PD4K 1LMKA 3RWHA 1JBJA 5DJ8B 2YUZA 3HUJF 3JWOH 4G9FE 1ACZA 3TVMA 4Y4HB 1MJ8L 3MRBB 5EULV 2ADJB 3PJSA 1QSVA 1ITBB 1GC1H 2GI7A 5E9DD 5LGKA 1LWRA 3F12A 4PJDF 3QULB 5H2BB 5B38B 3RGVC 5H37G 4E41D 5ALBH 4WFGE 4NWTL 5L9DH 1BLNB 5HHOE 1EV2E 1X5HA 4ZUWA 2VXSL 5H94B 3MJ6A 1MEXL 5TQ0H 4PP1D 3B9KA 1A22B 1ED3B 1S5HB 5CP3H 1Q0YL 4NJAL 1EBPA 4QHUA 3MZGB 5DO2D 3JVGC 2R2EA 1NUNB 2K9UA 4H26B 4LAQL 1UM5L 3GHEH 2V17L 4LCUA 3OGOE 4IRSB 3QXTA 5FK9A 4JJ5A 3ZT5A 4FFZL 1AXSB 3QFDA 1QLEL 1LO3H 3MA7B 3ARRA 1PY9A 4JO2H 4OGXL 3WMSA 3BKMH 2CK2A 5DK2A 3GSRB 3S34H 5L88L 5DO2C 3MLWH 3LVEA 1I3VA 3MNVB 2ORBL 3BYTA 3MROB 1B0RA 3RJQB 4J4PC 4MJ5A 1TPXC 5CUSL 1RZFL 4YBLB 4ZAKA 1U91A 3BAEL 1KLFA 3MMEB 1CK0H 2AK4E 3ARDB 4POUB 1WEJL 4RAUA 1A6VL 3C8DA 3QDMD 5I75C 1NDGA 2V7HA 4AZ8A 4O5LH 1MLCB 4QHMA 2P48B 5C0CA 3M17A 1GGTA 3QRFM 4U6HA 4XMPL 3HG1E 4LHUG 5L2JA 1UXWB 3LQAH 5IROA 3UYOD 4BQ8A 3GK8L 1KBGL 3VXNA 1KXTB 5IVZA 4I18C 2AGJH 3BMWA 5T1DH 4AM0B 3VW3L 5HDBF 3DROB 1F6AB 4U1HA 3DVFA 2X9WA 3HFML 1E28B 3JUZA 1IQDA 3FQRA 3D0VA 5IEHA 3EYFB 1IJ9A 3CX5J 2NZIA 1DBKL 4OB5L 2GITB 4OIIH 1JZ5A 2CO7B 3CCHA 4F7PA 3RIAK 3ESUF 2B2XL 1HINH 3X11A 4OD2B 1X4ZA 4DKEH 3G5YA 1PKQB 4OZGB 4IMKC 3LIZL 4Q0XH 3IF1B 3GSQB 1A4JA 1MWAA 2RIKA 2R2BA 1CTNA 5ELIA 4PY8J 2NCMA 3H9SD 5KSBF 4MD0A 5LAXA 2R1YB 4P4KC 3RKDD 5I66B 1L0XA 3MLUH 1OPGH 1XZ0A 5EZOL 4IOIA 5FGCB 4OLEA 2PETA 2VSCA 1ZTXH 4I3SH 1EXUB 4YXLL 1TTUA 4F7TA 5BZDB 3HZYA 3MRLB 1FYTB 3H7BA 4H8WH 5HVHB 1E27B 2ZUQC 4N8CH 5ACZB 2F9BT 5E8EB 3H0TA 4I9WE 1RY7B 4CN1A 1AC0A 3D85A 4ZTOL 2Q8BH 1L4IA 1TZGL 2WM0A 3LEVH 1FYTE 4MJIE 2QSTA 1A7OH 5D7KE 5JZ7D 5HPOA 2Q76B 2BOBB 3EOAB 5IEKB 1NUGA 2VZOA 3FQRB 3QQNA 4PTUB 3GRWA 1T80A 4QNPF 3MR9A 1Q72H 1AQKL 2FRGP 2IGFL 2K1MA 1NUDA 5T5NF 1LO5B 2XOTA 1J88A 1H3WM 3G5VB 5DUPL 5F1NA 1RZIA 3FZUC 2NY0B 3T0WA 4EBQL 2MHAA 4JKPL 4ELMA 5DUMH 3VI3F 1KLUA 5IMLA 2Y5TA 3HE6D 2XWBB 5DYOB 1QSFA 3BPCB 2Q7YB 5CEZE 4UZGA 4E0RB 2MCPL 4G8GD 1RJCA 2MMXA 4B7IA 3V6BR 1FAKT 3TNMB 4Y2DB 1U93B 3FQNA 4OCNC 4PIRF 5ENWA 3IVKB 3TT3H 1G7PB 1IEBA 1YC7A 3LV3A 1KCRL 4D9LL 3WDHA 2APTA 1U92A 5CZVH 3EHBC 3D2UB 5B38G 4LSPL 2RCSH 3H7BB 3VFNA 4WW2C 3FO1A 1VFMA 4EOWL 4FNLL 1BIIB 4KQ3L 3L3HA 2X05A 4QF1B 3JV6B 1A02N 3WSQH 5IJKC 4RFEB 4ZQKB 3PWJA 1AI1H 5IB1B 2IH1A 2BRQA 1BBDL 3EYFA 4YJZL 4ODXB 5LQBL 5IBTH 2YBRB 3BAEH 3UJIL 4HK3J 4LPCA 4KPHH 1DQMH 3PQYB 2ESVA 1M4KA 1U0QA 1Y0LA 4HFUH 5IEKA 5EO0A 4GXUN 4PJ8B 4CMMA 2YXFA 3EJZC 1R3JB 4U6YB 3FHQA 3QEQD 2R15A 5HYJD 4X5XB 2HVJA 5CGTA 2BY2A 3B83A 4PPTA 2GYSA 2DWEA 3F6IA 4GBXD 1JWMB 3GSQA 5EWIL 3ARVA 1R5VB 4LLVB 4RZCA 5C71A 1DVFD 4B50A 4MMXC 4X6EA 4U3CA 3QAZC 2X7LA 4IBLT 4M6NH 2YPVH 4PJIA 5I18H 1T1XB 2F19H 1TTGA 3N9GH 1L6ZA 4OD3L 3WFHA 5D1XD 1JNHA 3WV0A 2VL5B 2A83B 3GSWA 4GMSL 4JG0H 1X5FA 2VLKB 1Q0YH 1PDKA 4NJAH 3DIFB 3D39A 5ICYA 3L3DA 4GQPH 5F7UA 4KY1L 3HAEA 4U1GB 3CMOL 4I4WB 1A1NB 1QO3B 2CKBB 5ENWB 5D5MA 3GMQA 4PJ9A 1HINL 4L4JA 1ZV5A 1PD6A 3N9GL 2XNAA 4JY4B 1MVUA 3SBWA 4XWOC 4I4WA 2WUCL 5L7XL 4LBEA 4E41B 4PJCA 4JO3L 4YHOL 1MFEL 1D6EB 1WV7T 5D7IE 3UYRH 5D96C 4R0LC 5ESQB 3NA4A 5C0IB 4F33B 1GRWA 4XCYA 5SWSD 1GGUA 2P7TB 4KWUA 5FM5M 4ONOA 1D5ZA 3JWDL 4BSJA 4BUHA 3NIFE 1MOEA 2Z31A 4YK4C 5DEGB 4PGBA 3WLBB 4ZO6A 5TE4L 3ILPB 4P48A 2HVJB 1JP5A 5E7FA 3ZKNC 1CFTB 5C86A 5K59E 4OV5B 1ZHNB 3CVHL 4FXGB 4TSBH 5IHZA 2I9TA 3VW3H 1SHMA 5D7IB 5BMFH 2H26A 3M1BB 4JFZL 1NAML 3O3EA 1QA9A 1T7XA 4XP5L 1WBZA 3O4OC 4HPOL 2V5YA 3SDCD 2I5YH 2ILLA 2AJZB 2NY1B 4KHXH 4RFOH 1X5ZA 1IEAB 4S11A 1CDIA 3RWFB 1D5XB 1KTRL 2UYLB 1Z9MA 2VLKA 2YPLD 3MODL 4ETQB 5HVFB 3IS1X 1CXLA 4TSCH 2P5EB 1SM3L 5J3HD 1GGIH 1V3JA 4PJFB 1B0WA 1DEDA 3FB6A 3QNZB 1PZUB 5GJTL 4N0FA 3W39B 3JTSB 4LCIL 2FBJH 1VKXA 3QIBB 1UXSB 1MVUB 3LKPB 1JNJA 3CFIC 5FUCE 2BNRB 1H5BC 3CH8A 4JFFD 2Q3AA 4HIJB 1G0XA 3WL9A 2BXZA 3NVQA 4RGOL 2ZUQB 3T65B 3ES6A 1MHEA 1KUMA 5F3BA 1ZKAA 1G7QA 2VQTA 3ELAT 1S7QB 2GTZA 2QJDA 2DWEB 3H42H 1REIA 5F7EL 2GIYA 4UV7H 3UZVB 3GSXB 1YMME 4TOYH 2EXWC 1YEFL 2ERJC 3ILPA 5EOTA 3V5HB 3ZE2F 4PJ5A 1I8MB 3ZKMC 3O0RL 3DGGA 2EE6A 1BX2B 5CMAB 3S37H 4HUKB 1YECH 2HJLB 5BJTA 2V2TA 1KT2A 5IHUH 3CMGA 4FZ8H 5FGBC 5EORH 3QUZD 4PJXE 3RVXC 3EDJA 1VGEH 2ZG2A 3QUYC 3Q2CA 5AZ2H 2X4PB 4LSSL 1IAIM 3RWGB 2X41A 4PV9A 4M7KL 5DVOA 3EIFA 4UILL 2J8HA 5EO9B 4PYHA 2P45B 1MH5A 2AEIT 3RWEA 5HDQL 4GQ9H 2AK4B 3AS0A 1UXSA 4OGAD 3MLTB 3VGFA 4D0BB 4P2OC 3P9LB 2D4FA 2X70B 3LKQA 4FP8L 4AM0A 2FX8L 1KCKA 3RWEB 4PJ8C 4PJAA 4OBSA 3UBXB 3PWNB 5EZJB 5JIPA 3LKOB 1Y6NR 4MNQB 3KPSE 4Q2ZB 4MMZC 1I9JL 3O6LL 2VITB 5IB3A 4I5BA 4XXCA 5E7BA 1CDBA 1BGXL 4ZNCD 4PJEA 2W9EL 1CD9B 2W07A 2N7BA 4AL8L 1DN0A 5DQDL 2VDNL 5DJ6A 1XR8A 5CILH 2BVOB 2ATPA 2RHEA 2ICWA 2FATL 5A16A 2JB5H 1GAFH 1S7VA 1XIWD 3EDFA 4KXZI 3O2VL 3TBWB 4TVPL 2FHCA 4FG6C 5I8EB 3S97C 1SEQH 1Q9OB 1NANH 5DHYA 4MD0B 2FGZA 3I6LD 3UJIH 4JRXA 3H3PH 2YXMA 3TVMB 3KYMB 3MGAA 4NQDE 3L3JA 1HH6A 4LLUA 5DUBB 2FJHB 2AQ1A 4LVNC 4XAKE 1A0QL 4F15C 1DN2A 4KI5C 3L6FB 2BSRB 3BZEB 1JFQL 4KKBD 3O9WA 3ARXA 4YDVA 4GH7B 5DUPH 3QCTH 4NOFA 5D7IF 2APVA 4PJHF 4P9MH 2J12B 1IGMH 4KC3B 3L5IA 5ANME 5GRJH 2FSEA 4F7MA 3FN9A 4Q6IC 1JZ7A 2V17H 4JJHA 5FYJL 3TN0A 4HT1H 3HB3C 4JM4H 4DUWA 2ZSVA 5C6PB 4NO0D 5I71B 1R3IH 3VFPA 4KJQD 2F58L 3QULA 4XPBL 2V2XA 1UJ3A 4PYGA 2N56A 4HZLA 3L5WB 4HH9B 1S7UA 3MA7A 3VXTB 2OTPA 4OCSL 3W11D 1BFSA 5ALBL 5CJ8A 2PO6B 2R0ZH 2FEEI 3GMOA 3VJ6A 3ZL4H 1TCMA 4YDIH 3VXTA 1AGBB 3QI9A 3SQOL 5KJRL 2VISA 4BK5A 4XBPA 4M5ZL 3EYQC 2GEEA 2EXWD 4NQCB 5LAXB 1C8PA 1AR1D 1I8IB 3GSUB 3VFVA 3FKUS 5FKPB 3WYRA 4LSQH 5GS1A 5A2LH 5C0AE 5HYQB 2X1OA 3QPXH 2APWA 4MA7L 3VRIB 5IQ9A 3BKML 4ZO7A 4ORGB 4JFPA 2EH7H 2H2PD 1N7MH 4LKCA 4MD5B 4DKAA 2BY3A 3L3GA 5I1KH 3AM8C 4EDWH 4U1NA 4P59L 1NAKH 3CSPA 5CSZA 1QP1A 1MJ7H 3QDJA 4JQVA 1AP2B 4K3JL 1LDPL 1B4JL 4PREB 1FH5L 2GHWB 3RBGA 3SDAD 1DJSA 1QBLH 4MA1C 3WHXB 2R0LL 3VXUA 4OGYL 5F9WC 3VXOB 3ULVD 1AKJB 1NCCL 1U8QB 4XB7A 4Z9KB 3Q3GB 1MCRA 4K7PL 4ONHB 3MUGA 4X8JA 2DL9A 3U36B 5EBMB 1A4JB 5JR1L 3LH2L 1DN0B 3L3KA 3RVXD 2ZSWB 4UT6H 5GRVK 1M05B 2XN9B 1XGPA 3BP7B 3Q3GA 1QBLL 1DBAH 4L3ED 3SKUD 3QNYA 1DCLA 4IS6A 4M00A 1IZJA 3EYVA 3SDCB 3VFSB 2NZ9C 4L3CB 4JEGB 4PJIB 5M95B 3C9NA 1S9KC 3WNNA 3U4BH 3RWIA 4OJFL 1YMMD 1KPVB 1OHQA 3FN3A 4AT6B 4B5EA 2DQTL 4PJHA 1UH2A 3BUTA 4MX7B 3ARDA 5EU3A 1DR9A 4U1LA 4M93C 5I1DA 3DPBA 4RFNC 3R0NA 4ZUSA 3C09B 5IESL 1KYOK 1NMCC 3LSOA 5F44A 4D0CB 3VA2C 3VXPB 1U8JB 4HWUA 3L5XL 4LEXL 4ZO8A 2JELL 3U0TB 2AJSL 4RFEA 4B41A 4RA0C 1J8KA 5HD8D 4D8PB 1BD2A 1FPTH 3DOSA 5BRZA 4OCMC 5DD5L 1RIUL 4WHDA 1AY1H 4JN2B 3TWCL 4XPAH 4PREA 4L5FH 1T2QH 2IJ0C 4XP1H 3OKOA 5I19L 4OZIB 4IHOA 2DB8A 2FWOB 2Q1EA 3L5WA 3LN4A 1SYVB 3RDTD 3QXWA 4UBDC 1NKOA 3F8UB 2JTDA 4JAMA 4PJCF 4Y5XB 4NN7C 4BQBA 1FZKA 3U1SL 4MDJB 4XC3L 1YDPB 3WNKA 5DMGC 3NCYP 5JDJA 2QQLH 3B9DA 1RMFL 2F74B 3IDXL 3TA3D 3U79A 1NC4A 3JV4B 3VG0H 2PXYC 4OD1H 2LABA 4HW6A 3O3BA 5JW3H 3DSFL 1RIHL 3OAYK 2CLZA 4JY5L 4N0UB 1UWEH 3LKNA 5SWQA 1MCFA 3WUZA 5JHDA 1ZGLM 4LRIA 3C08H 4MAYB 2V5TA 1BBDH 4KV5E 3VWJD 3KR3H 1ZSDA 1S7TA 3QNZA 3FQNB 3RX5A 3TJHD 5EUKB 2HKFL 2WBJA 1F4WH 5E9DB 1RV6X 5FF6B 4XP4L 4NCDA 2UZYB 1UJ3C 1N6VA 3H0TB 3MV01 3SDDA 1QR1B 3HG1B 1T03L 2LFGA 2WIIB 3ZLQC 2OJZH 1KJ3L 3PV6A 4MCZA 4NBZB 2EYSB 1IAOA 3CC5A 4AQOA 4P2RE 1N5YH 5E4EC 2EO1A 4RBPK 1QPPA 4ZODA 1U95A 1EAPB 3PV6B 4MCZB 4KH2A 1QYGH 2QSCH 5BV7C 5D1ZA 1HH9A 2A77H 1FG9C 5GGUA 3M1BA 1T1WB 1JFQH 3MJGX 4LU5H 4JZNB 4EKXA 4BH8A 1FNFA 1TITA 2KUTA 3JVGA 1R3IL 4MA8L 3WFDH 3LKSA 3FJTA 5FYJH 4CU7A 5FHAH 4JRWA 2Y6SD 1QSFB 2VLLB 4EI6B 1Q9KA 4X6BB 3K1DA 4MJ6A 1FRGL 35C8L 2BERA 1IKFH 4MCYB 4EJ1C 3L7FB 1IC5H 4U0QB 4OUOA 4JHAH 2VL5A 3DVNB 3UTTE 5IVXA 4YC2C 1YN7B 4ODHH 4NKDB 3VFRB 2ZOLB 2X4PA 2A0LC 5HHOB 1P9MA 3SN6N 4WEBH 4YFLI 4HMDA 4L8BA 1X44A 2QADC 4JFQB 4LVHC 1ROWA 1YEGL 1ES0A 4NQVA 4PP2B 5C0FB 3MRFA 2AJYL 2P5WD 5SV3A 3G6AB 2Z31B 1G7IB 4YDLB 2EYSA 3FQWB 4EIZC 4K7PX 2HT4D 3FFCA 5EN2B 3KXFB 4TUJA 2AJVL 2UUDH 3MRCB 2VITA 1IE5A 3BDYH 1TJIL 4OZIF 3REWB 3WS3B 1ORSA 1QSEE 4JFXB 2Y06H 5D2NC 1JPSL 3VWKA 3C5JB 1NC4B 1FH5H 2I24N 3UO1H 1EHAA 2YD6A 3HI5L 1RUPH 4EI5A 4WI3A 2OMBA 1BFTA 1T7WA 4UNVA 1LP9A 3OZ9L 4H1LH 1RZGA 3PNWA 3MJ7A 1A8JH 3QIUC 4HWZB 3VH8B 5JORA 4PBVC 1FGNL 2ZWLT 5DQ9B 3HNVL 1K4CB 3RWFA 2NX5E 4Z7QE 3L5HA 3WJLA 5F7NC 3RPIB 2BSRA 1WAAE 3GJFA 4P2QB 2HFFA 4WW2F 3QFJD 4Y16D 1E6JL 2J7LA 3VD7A 4KJPD 5H2BA 4NQSB 4HS8H 3PIQB 2AABL 2DLTA 1KJ2L 1FJ1B 1QFWH 4PP2A 4GS7B 3T08A 3TF7C 4GRLB 4Q6YA 1WEJH 3QHTC 1CFBA 1EFXA 2J88H 4FS0A 1OPGL 3SOBL 4YX2L 4X80L 1FIGH 3NA9H 3ES6B 4DN4H 4RAVB 2X4RB 1YMHB 1INEL 1GVIA 4LIQE 4GKSA 4L8SC 4PY8I 3O45A 4ODBD 1NFIB 4LHQB 3WFHB 1BZQK 3OR6A 2H26B 5IW1B 2XKSA 4Y4FD 3EDKA 4MJ6B 3MOAH 1JRHI 4LLYA 4IOFD 5FYKE 4J6RH 3VD4A 3BN3B 4Y5VB 3P30H 3AVEA 4HFUL 4HDIA 4OB5H 2X89D 5DLML 3V5DA 2HRLA 1IAMA 1ORQB 1EK3A 2LTQB 1WF5A 5KVFH 4NO3B 4LHUD 5HHMB 2ICWJ 1MCLA 4IRJA 4OLVL 4K23H 2YPVL 3U4AA 4HUXB 2D7TH 3J7HA 3V4PL 1NMBH 2BNRA 3ORJA 1WITA 3CD4A 3AS3A 4Z0BL 3TCLB 5CWSB 5JO5B 3ISWA 2H8PA 4Y4FC 2SEBA 1I7TA 3MJ8A 3WD5L 1A3RH 2PTTB 4QTHB 1PFCA 2WBJC 3C08L 4X6FA 3T0XA 3REVB 1K3ZA 2BK8A 3ULVC 2OK0L 1GGCL 3WSQL 3D6GA 2VDQL 2XQBL 1FE8L 3IF1A 4OTXL 5LGHL 2Q6WA 4L8CA 5ICXA 1Y6KR 2JIXD 1I9EA 3K81A 4G9FA 4NN5B 4IM8A 1P4BH 4J2XA 2A2QT 4K94L 2UY6A 1P9MC 4J3OC 3WFZA 4JFPB 2AI0L 4H1LB 1QTYT 5I66A 3PXHA 2BJMH 5E2UL 2AJVH 2GTWA 5B21A 3JTSA 2BHZA 2W60A 3T0ED 2LU7A 2P1YA 4X99B 4KRMB 5EWIH 4JDZA 5IVZB 3ARBB 1WC7A 3C2SA 3QH3A 4M8VA 5DJ8A 5AYUL 2Q86B 2O5XL 4N0YL 2NLJB 2CMRL 2NY2D 5E70A 1HDMB 3MLRH 1JN6A 1YY9D 1RIVH 3RPKA 5D72L 1NJ9A 5L6YH 5C70A 2ZCHL 5EZLA 4X0KB 4P57B 4XP9H 3AXLA 1DQDL 1KB5H 5AAMA 4TQEL 4DZ8A 5FO9A 1IARB 1IGJB 1U9KA 1CE6B 2E7LA 3VMOA 2RCSL 2CDFA 2FLRT 4IDJH 4QRRE 5TPWL 3O6FC 4BQ6A 4O2FB 1T3FA 3MGTB 4DAGH 5KSAD 3QDMB 1RI8A 2UZIH 4FQJH 5JW4M 4TTDC 2EE2A 5I15L 3QXVA 5ICXB 2XWBA 2P43B 4PJ9C 4Z7UB 4HDIB 4OQTH 5I0ZA 3MROA 3U7WL 1MCPL 4PRPA 3DVGB 1QFWM 4ZMAT 3OKMB 1Z3GH 1J0KA 3U7AA 3QJFB 4D9RE 2F19L 2ZG3A 3NH7L 4QOKA 4HUXA 3D85B 1DFBL 3U7WH 1SJEA 5E08L 3H9YA 5FCSH 2NLJA 4QF1A 3WUWB 3ZYIA 3GI8H 3HLAA 2VDLL 5BVJB 1JN6B 1AP2A 3P9MA 3CFKB 4LPXA 3VDBA 1NBVL 1RUML 4L29B 3SJVD 3DYOA 1NCTA 3O4OB 4LLWB 3IDIA 5E4EB 5E6IA 4KRLB 1NCBH 4X5XA 1KTDB 4GW5B 5A16B 1OAYH 1AXSA 3QFDB 3CLEH 4RSVA 1FL3B 5I74C 2PYEA 1OSZA 1ZT1A 5I8EA 4HFWB 4N0CD 5A2KH 5FFLA 2ZJSL 2HTLD 3NOIA 1AD0A 4G6KL 5DC4B 1JPFB 1DQLH 4JFYA 4PRAB 1CD0A 5D6CA 2DYPB 5SWQB 1U6AH 4ERSL 5IIEB 1YNKL 4A2MA 2X09A 3QG6B 4NQDB 2FGWH 4ZOAA 1DLHB 1KB5A 4I0CC 3QUYD 5E5UB 2EIEA 3WNOA 3UAJD 3PL6B 3F12B 4CU8A 3CVHH 1I9IH 4KI5D 3HE7C 1D5IL 2VERN 2W9DH 1UJTA 3WS6A 3MOAL 1I1RA 1J5OL 1MCBA 3RL1B 3VCLA 1MPAL 3NCEB 5GSRB 3VFTA 4Q9QH 5F9JA 2UWEF 1NSNH 5K9KB 4FQ2H 4B0MM 3CU1A 5GSRA 4MJID 3VI3E 3EZ8A 1LO4L 4X6EB 3KYAA 4PJBB 2BNRE 1BQLL 3QDHA 4LLQB 1AGFA 5I2IA 2M2DA 4PUBH 2EZ0D 4U1SA 5D7IA 1I1FB 5JXAH 2EECA 2DQIL 4K3EH 3B5GA 4KVCH 1UYWH 4V2CB 2B4CL 3ROOA 5ILTL 3MRRB 4JZJA 5E6ZA 1NMBL 3H42L 4ZUVA 2NQCA 8CGTA 2AKRB 4NQEB 3SEPA 1MLCA 4ODVL 4QHMB 5T3XH 3VMNA 4GFTB 2EDDA 4NYLA 4YHKL 5CJ5A 2NY6B 2D7QA 2JJWA 2ZUXA 4JRYB 4C56D 3AAZA 1JWUB 2W65B 1DDHA 1W0WA 5FCUL