1H8TD

Echovirus 11
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
68
structure length
60
Chain Sequence
b'GAQVSTQKTGAHESIIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMVKSLPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ECHOVIRUS 11 COAT PROTEIN VP1
publication title Determination of the Structure of a Decay Accelerating Factor-Binding Clinical Isolate of Echovirus 11 Allows Mapping of Mutants with Altered Receptor Requirements for Infection
pubmed doi rcsb
molecule tags Virus
total genus 1
structure length 60
sequence length 68
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1h8tD00
1R084 1RUG4 1VBB4 1RUF4 3J8F4 1PO14 4Q4Y4 2RS54 1PO24 1EAH4 1VBA4 1AR64 1PIV4 1BEV4 1AR94 1RUE4 1HRI4 1VBD4 2R064 2RS34 2RS14 4Q4V4 1HXS4 1AL24 2RR14 2X5ID 1RUI4 4PDWD 1R094 2HWC4 1MQTD 2HWB4 4Q4W4 1NA1D 1AR84 1ASJ4 1Z7S4 4GB34 1VBE4 4RHV4 1H8TD 1RUC4 1PVC4 1RUJ4 1RHI4 2RM24 1AR74 1EV14 1VBC4 1RVF4 4Q4X4 1D4M4 1OOPD 1NCQD 3JD74 1COV4 1K5MD 1RUH4 1RUD4 1RMU4 1VRH4 3JBG4 1HRV4 2R074 2RMU4 1POV0 2R044 2PLV4
chains in the Genus database with same CATH superfamily
3J8F4 3P4PA 1PO14 1XHZA 1PO24 2WQYA 2WDVA 2R064 1AR94 1VBD4 2PYLA 2B76A 1KFYA 1AL24 1RUI4 1NA1D 1ASJ4 1VBE4 3P4SA 4YTMA 1NENA 1H8TD 1RUC4 3AEAA 1AR74 3AE2A 1RVF4 2R7FA 1D4M4 3AE5A 1NCQD 3JD74 4YSYA 3SUCA 3FI7A 1RUH4 1VRH4 3GQKA 1HRV4 1XI1A 3AE7A 3AE4A 2RMU4 5C3JA 2RM24 2PLV4 1R084 3SFEA 4YSZA 3ABVA 1XHXA 1EAH4 2H89A 1VBA4 1AR64 1BEV4 2RS14 5C2TA 1HXS4 3VR9A 4YXDA 1NEKA 2WU5A 1R094 4Q4W4 1L0VA 3VRAA 3AEEA 2EX3A 3SFDA 1RUJ4 1PVC4 1RHI4 4YT0A 1OOPD 3AE6A 3GQHA 1COV4 1K5MD 3JBG4 1RUD4 1RMU4 1YQ3A 2R044 3P4RA 2WDRA 2PZSA 1RUG4 4YTNA 2FBWA 2WS3A 4Q4Y4 2RS54 1PIV4 3AE8A 1HRI4 4Q4V4 3CIRA 3AECA 1ZP0A 4KX6A 3AEDA 4GB34 2WDQA 4RHV4 3VR8A 1EV14 4Q4X4 2H88A 2PW9A 2WU2A 4YSXA 3AEBA 1VBB4 1RUF4 1KF6A 3AEFA 1RUE4 2RS34 3AE3A 2WP9A 2RR14 2X5ID 4PDWD 3AE1A 2HWC4 1MQTD 2HWB4 2PY5A 1AR84 1Z7S4 3P4QA 4YTPA 1ZOYA 1VBC4 3AEGA 2PYJA 3VRBA 2ACZA 1YQ4A 2R074 1POV0 3AE9A
chains in the Genus database with same CATH topology
1R084 1RUG4 1VBB4 1RUF4 3J8F4 1PO14 4Q4Y4 2RS54 1PO24 1EAH4 1VBA4 1AR64 1PIV4 1BEV4 1AR94 1RUE4 1HRI4 1VBD4 2R064 2RS34 2RS14 4Q4V4 1HXS4 1AL24 2RR14 2X5ID 1RUI4 4PDWD 1R094 2HWC4 1MQTD 2HWB4 4Q4W4 1NA1D 1AR84 1ASJ4 1Z7S4 4GB34 1VBE4 4RHV4 1H8TD 1RUC4 1PVC4 1RUJ4 1RHI4 2RM24 1AR74 1EV14 1VBC4 1RVF4 4Q4X4 1D4M4 1OOPD 1NCQD 3JD74 1COV4 1K5MD 1RUH4 1RUD4 1RMU4 1VRH4 3JBG4 1HRV4 2R074 2RMU4 1POV0 2R044 2PLV4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R08 4;  1RUG 4;  1VBB 4;  1RUF 4;  3J8F 4;  1PO1 4;  4Q4Y 4;  2RS5 4;  1PO2 4;  1EAH 4;  1VBA 4;  1AR6 4;  1PIV 4;  1BEV 4;  1AR9 4;  1RUE 4;  1HRI 4;  1VBD 4;  2R06 4;  2RS3 4;  2RS1 4;  4Q4V 4;  1HXS 4;  1AL2 4;  2RR1 4;  2X5I D;  1RUI 4;  4PDW D;  1R09 4;  2HWC 4;  1MQT D;  2HWB 4;  4Q4W 4;  1NA1 D;  1AR8 4;  1ASJ 4;  1Z7S 4;  4GB3 4;  1VBE 4;  4RHV 4;  1H8T D;  1RUC 4;  1PVC 4;  1RUJ 4;  1RHI 4;  2RM2 4;  1AR7 4;  1EV1 4;  1VBC 4;  1RVF 4;  4Q4X 4;  1D4M 4;  1OOP D;  1NCQ D;  3JD7 4;  1COV 4;  1K5M D;  1RUH 4;  1RUD 4;  1RMU 4;  1VRH 4;  3JBG 4;  1HRV 4;  2R07 4;  2RMU 4;  1POV 0;  2R04 4;  2PLV 4; 
#chains in the Genus database with same CATH topology
 3J8F 4;  3P4P A;  1PO1 4;  1XHZ A;  1PO2 4;  2WQY A;  2WDV A;  2R06 4;  1AR9 4;  1VBD 4;  2PYL A;  2B76 A;  1KFY A;  1AL2 4;  1RUI 4;  1NA1 D;  1ASJ 4;  1VBE 4;  3P4S A;  4YTM A;  1NEN A;  1H8T D;  1RUC 4;  3AEA A;  1AR7 4;  3AE2 A;  1RVF 4;  2R7F A;  1D4M 4;  3AE5 A;  1NCQ D;  3JD7 4;  4YSY A;  3SUC A;  3FI7 A;  1RUH 4;  1VRH 4;  3GQK A;  1HRV 4;  1XI1 A;  3AE7 A;  3AE4 A;  2RMU 4;  5C3J A;  2RM2 4;  2PLV 4;  1R08 4;  3SFE A;  4YSZ A;  3ABV A;  1XHX A;  1EAH 4;  2H89 A;  1VBA 4;  1AR6 4;  1BEV 4;  2RS1 4;  5C2T A;  1HXS 4;  3VR9 A;  4YXD A;  1NEK A;  2WU5 A;  1R09 4;  4Q4W 4;  1L0V A;  3VRA A;  3AEE A;  2EX3 A;  3SFD A;  1RUJ 4;  1PVC 4;  1RHI 4;  4YT0 A;  1OOP D;  3AE6 A;  3GQH A;  1COV 4;  1K5M D;  3JBG 4;  1RUD 4;  1RMU 4;  1YQ3 A;  2R04 4;  3P4R A;  2WDR A;  2PZS A;  1RUG 4;  4YTN A;  2FBW A;  2WS3 A;  4Q4Y 4;  2RS5 4;  1PIV 4;  3AE8 A;  1HRI 4;  4Q4V 4;  3CIR A;  3AEC A;  1ZP0 A;  4KX6 A;  3AED A;  4GB3 4;  2WDQ A;  4RHV 4;  3VR8 A;  1EV1 4;  4Q4X 4;  2H88 A;  2PW9 A;  2WU2 A;  4YSX A;  3AEB A;  1VBB 4;  1RUF 4;  1KF6 A;  3AEF A;  1RUE 4;  2RS3 4;  3AE3 A;  2WP9 A;  2RR1 4;  2X5I D;  4PDW D;  3AE1 A;  2HWC 4;  1MQT D;  2HWB 4;  2PY5 A;  1AR8 4;  1Z7S 4;  3P4Q A;  4YTP A;  1ZOY A;  1VBC 4;  3AEG A;  2PYJ A;  3VRB A;  2ACZ A;  1YQ4 A;  2R07 4;  1POV 0;  3AE9 A; 
#chains in the Genus database with same CATH homology
 1R08 4;  1RUG 4;  1VBB 4;  1RUF 4;  3J8F 4;  1PO1 4;  4Q4Y 4;  2RS5 4;  1PO2 4;  1EAH 4;  1VBA 4;  1AR6 4;  1PIV 4;  1BEV 4;  1AR9 4;  1RUE 4;  1HRI 4;  1VBD 4;  2R06 4;  2RS3 4;  2RS1 4;  4Q4V 4;  1HXS 4;  1AL2 4;  2RR1 4;  2X5I D;  1RUI 4;  4PDW D;  1R09 4;  2HWC 4;  1MQT D;  2HWB 4;  4Q4W 4;  1NA1 D;  1AR8 4;  1ASJ 4;  1Z7S 4;  4GB3 4;  1VBE 4;  4RHV 4;  1H8T D;  1RUC 4;  1PVC 4;  1RUJ 4;  1RHI 4;  2RM2 4;  1AR7 4;  1EV1 4;  1VBC 4;  1RVF 4;  4Q4X 4;  1D4M 4;  1OOP D;  1NCQ D;  3JD7 4;  1COV 4;  1K5M D;  1RUH 4;  1RUD 4;  1RMU 4;  1VRH 4;  3JBG 4;  1HRV 4;  2R07 4;  2RMU 4;  1POV 0;  2R04 4;  2PLV 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...