1H94A

Complex of active mutant (s215->c) of glucose 6-phosphate dehydrogenase from l.mesenteroides with coenzyme nad
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
485
structure length
485
Chain Sequence
b'VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDSIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLCEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEAQEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
publication title Nadp+ and Nad+ Binding to the Dual Coenzyme Specific Enzyme Leuconostoc Mesenteroides Glucose 6-Phosphate Dehydrogenase: Different Interdomain Hinge Angles are Seen in Different Binary and Ternary Complexes
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase
total genus 168
structure length 485
sequence length 485
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h94A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h94A01
4GGPA 1PZEA 4ESOA 4OKIA 1DLIA 2ZYGA 1EE2A 3VH4A 2ZB8A 4ZRMA 3PJDA 3WMWA 4DIOA 2DTDA 4W7HA 2DBVO 1Z82A 3EY4A 1H5QA 4GGOA 1M66A 3GZNB 3TL2A 2NTNA 1O0SA 3OHSX 2FSVA 3K8ZA 4R01A 3DOOA 3ZU5A 1YL5A 3E9MA 1SB9A 1P9LA 1ZUD1 4ALLA 3BYZA 4NBVA 3S8MA 1W4ZA 3PHJA 4K6FA 2VWHA 1LSOA 1PZFA 3GEDA 5A4DA 1EE9A 3DZKA 2Z95A 1GUYA 5M6DA 3GVHA 5U4QA 4BNTA 1JKJA 3WWZA 5I7EA 4Y98A 4IBOA 4MVJA 3ST7A 3B70A 1WLYA 2AHRA 4CV3A 4FFLA 3JYNA 3TFOA 2QYTA 4R69A 4YCAA 2HO5A 4F46A 1ZO8A 5A9SA 1B26A 5DP1A 5JPIA 3UOGA 2WYWA 1SO8A 3EZYA 5DBFA 4FFNA 4NU5A 5KCZA 3K5PA 3B20A 1TXGA 1BW9A 3ZZNA 1J49A 3IOYA 3FNGA 4OYRA 4XIYA 2DT5A 4B4UA 3DWFA 4DYVA 4QECA 3P7MA 5A9SB 3VPXA 4EW6A 2PFGA 5G4LA 4B79A 2WEKA 4E2WA 1E7MA 4CM8A 1E1NA 3RC1A 3WBFA 1PWXA 4GPD1 3RC7A 4YXFA 4L4SA 3ZHBA 4ZA2A 2ZYAA 1EZ4A 3D64A 1NYTA 2B35A 3WOHA 1D4FA 3JD0A 1HRDA 4BHTA 2CVZA 1QXSA 4OOFA 3GG2A 4IDCA 2ZATA 2Q46A 4BMVA 1EUZA 4ALIA 4ZJUA 1IPFA 1VSUA 2GPTA 5G4KA 4IDGA 4Y9DA 3RBXA 1E77A 2GYYA 4Q3BA 4G81A 4KTVE 3DBLB 5F21A 3O26A 1F06A 3HDJA 3R6DA 2UUOA 3I52A 4DPLA 4E6PA 3T7EA 3MOGA 5G4KB 2X9GA 3MTGA 3E5RA 3JQ6A 3AI1A 1KVQA 3D5QA 3FF4A 4M1QA 1KY5A 3D3WB 5A04A 4W9NC 2VCYA 4I08A 1H2BA 1ADFA 1QSGA 4N5NA 3W8DA 4D0SA 2NU8A 2Q22A 1CQJA 3GGGA 4N54A 5F5LA 3KVOA 3W4JA 3GPDG 1Y5RA 4J1TA 4GMGA 3S2EA 1VJ1A 3W8FA 4XDYA 5AXAA 2PV7A 1HDYA 4CLRA 3AW9A 7ADHA 5L4LA 4A26A 5EJ2A 4D3DA 5BSGA 3PWSA 1VL6A 2GR9A 1PJCA 1C0PA 3ZGYA 1NQAO 4R16A 4E13A 1JW9B 4EJ0A 5IDXA 3NUGA 2JCXA 1N1GA 4XR9A 5KNLA 3JQBC 4PZEA 4KUEA 4TRNA 3ZWYA 4EUFA 3VH1A 4J9VA 4DMLA 1N8KA 1YJQA 1IZ0A 1O5IA 1PGJA 3UICA 1T2EA 4RQTA 3OJOA 2EKPA 3MWEB 2EGGA 4EUEA 2YQ5A 4DREA 4KQXA 1QYWA 4N5LA 3FR7A 4PG5A 2IDZA 3LF1A 2H9IA 1GQQA 3H9GA 3UFXA 4ZICA 1X7HA 2EKLA 2I5PO 1YDEA 1BMDA 1HWYA 1TT5B 2NQ8A 3S55A 4YRAA 3IMFA 4OMUA 1IY8A 1ZBQA 3PLRA 1XEAA 3QVTA 4OQZA 3RFTA 2PD6A 1UDBA 3AI2A 3F1KA 1R6DA 1SAYA 3RJ9A 1TEHA 5HTOA 3I9MA 2IXBA 4R5HA 4A27A 4J90A 3OFSA 3ITDA 3L6OO 3VVCA 4BNWA 1BSVA 3OJLA 2JKVA 2YHIA 1A72A 4M55A 3DBRB 4YJGA 5G0SA 2B37A 4YAJA 3DXFA 1KVUA 2EXXA 1LRLA 5TF4A 3I1JA 1DIHA 2XAAA 2I66A 1GZ6A 1GEGA 4YJGB 3G0OA 4A10A 4XRRA 5GMOA 1NASA 3V8BA 4MIEA 3NTOA 3QV1A 3WGYA 1BG6A 3O8QB 2BF7A 3IDSA 3E8XA 3QQPA 3H5AA 1HKUA 1OFGA 1U2GA 3A4VA 5B12A 1HDXA 3QW2A 5CAEA 2Q2VA 2J3HA 2HJRA 4R1SA 4FC6A 1VI2A 4CQLA 2A9FA 4BO4A 2FZWA 4MIYA 2X7HA 5AXDA 3HDYA 4R68A 1YO6A 1ISFA 1X0XA 3NT5A 5IZCC 4DQVA 4ZVVA 3GNQA 3U09A 2A4KA 2Q50A 4W99A 4NK4A 4U6QA 4RVUA 2RH4A 1SPXA 4UVIA 1MFZA 4RCVA 1RKXA 3KTDA 2ZTMA 5ES3A 3JCZA 4BB6A 1K2WA 2GRAA 1EVIA 1RYDA 1JLLA 3GVCA 1YBMA 1VSVA 3WYCA 3NEPX 1GL3A 4W6ZA 1CJCA 4UVGA 2FWMX 4Z6KA 4BNGA 1HXHA 1R0KA 3KYCA 3EHEA 3WSWA 1ZMTA 3ZWXA 5I9NA 4J49A 4IJWA 2Q3EA 1ID1A 1PJ2A 2BRUA 2O2SA 1C1DA 1CDOA 1U8XX 4E5PA 4YACA 2IYOA 2Y1CA 2PR2A 5G0VA 1Y8QA 2VT2A 1ADGA 4W82A 3FBTA 3KB6A 1Y9AA 3D3EA 3GUYA 4MVJH 3WBBA 1NQTA 1AGNA 3Q11A 4GMFA 1WPQA 3ZU3A 3I4FA 4Y6PA 3T4XA 1C1DB 2AG5A 1Y8QB 3L07A 3F5QA 1JKFA 1YB4A 3GG9A 4IXTA 4WEOA 3U9LA 2W2KA 4BO1A 3U4CA 1DFIA 3UXYA 2GDZA 4EEZA 3KV3O 3D0OA 1HDRA 4K6CA 1N1EA 2GZ1A 1SB8A 3JQAB 4IS2A 3GNTA 3MJCA 5KVSA 2ZYDA 4PLGA 2HMTA 4UEKA 2RIRA 3TRIA 2IE0A 2UUPA 3WLEA 4YVFA 3WS7A 1Q2XA 5CDGA 3DONA 4BNLA 1AHIA 1PGNA 1UZMA 1RPNA 1RYEA 1ONNA 1QP8A 4JK3A 3A14A 3JD4A 4TKLA 2QQ5A 4KP7A 5FEUA 1I33A 5EPOA 4XR4A 3HE3A 2GSDA 2O48X 2Y1OA 4R54A 1UXGA 1BXZA 1MA0A 5TJHA 5EN4A 1JU9A 3SJUA 4NZ9A 5JDIC 3CXRA 4OL9A 1MUUA 4RL6A 4N18A 1SMKA 3L6EA 5BQFA 3CPSA 2YHUA 3H4VA 5KVVA 1R4NA 3JTMA 2ZQYA 4P38A 1G6KA 1BVUA 3ETDA 2CMDA 4J2HA 2JCYA 1P3DA 4WLFA 2NQTA 3WWYA 4Q3AA 5TGDA 3VKUA 1XA0A 4DL9A 4PN3A 3L4SO 4H15A 3CE6A 1ZVMA 4NHEA 2D2IA 4RDHA 3UVEA 5KIAA 3W8EA 2QRJA 1F8FA 1UUFA 3A9WA 5CEJA 5JAMA 1K6XA 3RCBA 2JL1A 2O3SA 1LLCA 3D7LA 3HN7A 3KLMX 2DPGA 3AOGA 2Y0CA 4YJHA 5BSHA 3AM3A 4MIOA 1YBVA 3PQFA 1KEVA 2EHDA 2WE8A 4YT8A 2EF1A 4RPKA 1ISJA 3PRJA 5J23A 2VYVD 4BNYA 2OGUA 2B36A 5L7WA 1OC4A 4KQWA 5L4SA 4HUJA 4PZCA 4LN1A 4GSKA 2RCYA 3EGOA 5EQDA 1GZ4A 3SJ7A 3RI3A 2RHCA 4FGWA 4PLPA 1E7SA 1UDCA 1GU7A 4JP3A 3UKOA 3WGGA 1E3EA 4MVJF 1YONA 4FN4A 4LCJA 4RLHA 1YKFA 5DOZA 4BNMA 2Q1UA 1DAPA 1UJMA 3NT2A 3NGLA 4WKGA 5THKA 3MWDB 3VDQA 4L74A 1QORA 1PJQA 5LDGA 2GN9A 3BAZA 3C24A 3UN1A 4JBHA 4YB8A 3W1VA 2IODA 3ROMA 5DF1A 1ISMA 3KO8A 3OJ0A 2SCUA 3VPSA 3UCXA 3VZQA 3DFZA 1K0UA 5TIIA 1I5RA 3VTZA 3RUEA 1E3JA 4D44A 3ANNA 1ENPA 1KIFA 4EBFA 1I01A 1OBFO 3OIDA 1LLDA 2HDHA 3ENKA 3QWBA 4IMRA 1ADBA 3DZBA 4J16A 3QE3A 3Q3CA 1XSEA 1BRMA 3I9LA 3LSYA 3W4KA 4JQCA 4Q39A 2X6TA 3JQEA 4YJDA 1W6UA 1LC0A 4TZKA 1UAGA 3WB9A 4CUZA 3WYEA 4CMIB 2VOJA 1GUZA 3Q9NA 5C5IA 2O3TA 4IDAA 5ICMA 4JN6B 5EQFA 3QWIA 2Z1NA 4WOJA 4YWJA 1C1XA 1R16A 3S1LA 2PA3A 4J4HA 5GZ1A 3GHHA 5HWSA 3VPGA 5KJCA 1P1IA 3Q2KA 2Z1MA 2TMGA 3FCOA 1H93A 4JBGA 4MP3A 3SX2A 2FY8A 4ND1A 4YJFB 3PZRA 1T25A 2P5UA 4BO0A 2VZ0A 2BD0A 2B69A 4FDAA 2IZZA 1I3LA 2NTVA 1DFHA 1N2SA 2NUAA 3GA0A 3KHUA 4CR7A 4WECA 4I5DA 1T2DA 4DPMA 4KZPA 5A9TA 2YV1A 1MG5A 4YQZA 5TT1A 2AEFA 5C7OO 3H8VA 2ZJ1A 1U2DA 4JCOA 4PLHA 4YRDA 2BMAA 5HA5A 4BKRA 1V3VA 4NFSA 1Z7BA 1MC5A 2CNBA 2EKQA 1EVYA 3TZ6A 3OIFA 4PIVA 4DLBA 2X0IA 4JNKA 4RF5A 1X14A 4TRRA 3GC6A 3T7CA 3UH1A 2OHXA 4WGGA 1BXGB 1NTOA 1LNQA 3HFSA 4PRLA 3PHGA 4RF4A 4NFHA 3TZQA 5EMHA 4A73A 1RM4A 4HFJA 5IJZA 1S7CA 3OQ1A 2PKQP 1XKQA 3GK3A 3A1NA 1ML3A 1TT7A 3ZV4A 1N9GA 1PQPA 1V8BA 5A02A 3NX4A 4CM9A 2UVDA 3KEQA 1K6JA 2FR1A 1GAEO 1TLTA 1EBUA 3E1KA 2JFFA 5CDTA 1MGOA 5JO0A 1BDMA 2VRCA 1GDHA 4GX2A 2EP5A 2BELA 1DLJA 2C5AA 4CM5A 4DPKA 2VWQA 1CYDA 3RUIA 2WD7A 3GVIA 5A1TA 4TRJA 3P5SA 4AJJA 1DRUA 1X13A 5C7IO 1HSZA 4OH1A 4HADA 4HKTA 3O9ZA 1WZIA 1MV8A 3KEOA 3D4PA 3L4BC 3ZWNA 3PFFA 3M6IA 1NWCA 2JD1A 1P0CA 2X9NA 5JY6A 4FFPA 4XYBA 2P68A 3ZV6A 2VNSA 4CMKA 3U3XA 5JLAA 3B1KA 1E3WA 3HSKA 2X58A 4P22A 1MB4A 3WXBA 2O50A 3INGA 3Q9UA 2PKRA 1AXGA 1NR1A 3E9QA 3JQ8A 3RAJA 4CQMA 2CDAA 1NX6A 1A5ZA 1DXYA 2EEZA 5C3MA 1ZFNA 2PY6A 1CIVA 3PJGA 1NFFA 1KY4A 1HDOA 2NSDA 2CDBA 1E3WB 3BMNB 4NJMA 2WM3A 4DVJA 1M67A 3AUSA 5B4VA 1Y9EA 1DFGA 4CR6A 1PGQA 3CZRA 4JLWA 1MG0A 4CQMB 3KXDA 4D79A 2B83A 3NDIA 3PGXA 4B4VA 3OIGA 4IIUA 4L4XA 3VH2A 1NR7A 1XDWA 2D8AA 5HRUA 1PR9A 2CFCA 1YXMA 3ORFA 4NJMB 3ZNQA 1XGKA 5KJ6A 4EI2A 2YY7A 1E6EA 1FK8A 5JAIA 3G49A 1H9BA 2AQHA 1HETA 2RAFA 5JC1A 4WPGA 4FSHA 1PTJA 3DB2A 3BXXA 2F1KA 1Q0QA 5HBRA 2ILTA 3C1OA 2Y1FA 2WSBA 1X7DA 4I1IA 3NTQA 1LSJA 1QKIA 2V6BA 1PJ4A 1F17A 2B4TO 2VQ3A 4XB1A 1A4UA 5I8ZA 3V2GA 3UAGA 2GASA 4PVDA 1QYVA 4X54A 4CMGA 3GGPA 4W9NA 1YBAA 1E1MA 2Y0EA 2CF5A 4J91A 1AN9A 2VUSA 4RZIA 4BGVA 5L45A 4U0JA 3WLFA 1YWGO 2O23A 3I6QA 1GR0A 2NLOA 5LCXA 4H3VA 3JYQA 4QO7A 2X5KO 3CEAA 3INTA 4MPDA 1LLUA 5L40A 1YDWA 1U4SA 2AQ8A 4E4YA 2EW2A 2NM0A 4C4OA 2BH9A 3UCFA 2PK3A 3CH6A 3F9IA 3L77A 2BFAA 2GGSA 5BSFA 3QJ5A 4QTZA 1D1SA 3GUCA 4DC1A 3H9UA 4J1SA 5K6AC 2PZJA 5G0TA 1PEDA 2NTJA 2DU8A 3R3JA 5BSEA 4UREA 4FIZA 3F47A 3GPIA 3V1UA 4AJIA 2PGLA 4XQGA 4CMEC 3LDHA 1JKIA 4GX1A 4J9UE 1I24A 3QRWA 2A35A 2YZ7A 3EK2A 3G1TA 3OQ6A 4ZHSA 4ALNA 1OOEA 2W2LA 4J7XA 3VZPA 1V3UA 2CDCA 3DBHA 1C0IA 4DGSA 3AU8A 1OI7A 2YYYA 2A94A 1GQYA 3I6IA 4R9SA 3MZ0A 5MGBA 4R41A 5KJ1A 1L1FA 4XYMA 4RQUA 2Y1DA 1QV6A 1LA2A 3I83A 1U28A 1OZAA 4JROA 4JP2A 5DT9A 1KOLA 3WGQA 1JAYA 4XQ9A 5HS6A 2BGKA 1AUPA 1DEHA 8LDHA 5KKCA 1UXHA 1R15A 1WDKA 4J0EA 5DBIA 2A92A 2OZPA 1FDUA 3CINA 5ENVA 4Z3KA 4Z3DA 4HXYA 2HQ1A 2Y66A 4DIFA 4OM8A 1PJSA 2P9CA 3RUFA 5FFFA 3ANMA 1SBYA 3OEWA 1B8VA 1VRWA 5I7SA 3MJTA 2F00A 4FPXA 3RKUA 3JQAD 4D41A 1ONOA 3ULKA 1T26A 1X7GA 2C5EA 2JAPA 3JQFC 2YFHA 1I2CA 3GMSA 4WCFC 4CM6A 5CG1A 1DAOA 2JCVA 2V65A 3HDHA 2HJSA 4DIBA 4LMPA 3WGTA 1N5DA 3F4LA 1R4MA 2NVBA 2X0NA 4CLEA 5ILGA 1M2WA 1B2LA 4PLZA 4FOSA 3OJFA 1T1SA 2HCTA 4WJZA 4PLVA 3GOHA 4HFRA 3JQGA 1BW9B 4BO7A 2Y68A 3VZSA 1RM0A 2E4AA 2ZB3A 4IPTA 1R4MB 4CPDA 2HUNA 4CM7A 1NHGA 4ROSA 5IZCA 1VLLA 4NBUA 2V6GA 3C7DB 4H16A 1DPGA 4QX6A 3H7AA 1QYXA 4CM8B 1YS4A 3TL3A 1ZJYA 1DJQA 4Z0TA 5CDSA 9LDTA 5I9MA 2GO1A 4CL8A 4D7AA 2IZ0A 4EJ6A 5F1KA 3GZ4A 4JIGA 4NIMA 4TSKA 3QWHA 1ARZA 4PG8A 3ADPA 3AM4A 3EMKA 4AJHA 4O5OA 3WYBA 1VL0A 5JAZA 3GLQA 4UVHA 1EEHA 3U5TA 3EW7A 1L7DA 3NDRA 1V9LA 2DUWA 1VL8A 4ND3A 1E7YA 3C1TA 4QO8A 3NTRA 4YA6A 3F46A 2AE1A 3NKLA 3ZNNA 4JJFA 1IUKA 1L7EA 3KUXA 1PIWA 4CV0A 3WTCA 4QSMA 3DZJA 1P45A 3WQQA 3RROA 3H9JA 3CTMA 3RFXA 2HMUA 1E6UA 1H94A 4J4TA 4RJTA 4I9HA 1U7TA 3WQRA 4IDBA 2HMVA 1HSOA 5EL0A 2HKIA 1MLDA 4GX0A 1YRLA 2PWZA 1CETA 4Z9XA 1ZK3A 4ZQEA 1NPDA 2GLXA 3DFUA 1P44A 4RPLA 1P1RA 1CWUA 3ABIA 4XZ3A 4JXKA 1PL8A 5COBA 4CLRB 2C2YA 3SC4A 5IFLA 3DR3A 1PJTA 1XR3A 2Y93A 9LDBA 1XG5A 4F45A 3AUUA 1LDNA 3ZCXA 4XA8A 1QMGA 4MDHA 2VTEA 8ADHA 3QVWA 5IDWA 3KETA 4RVDA 4BL5A 3OA0A 4ONEA 3RSHA 3WGZA 3WJAA 4ZU3A 4L76A 3SEFA 4CJXA 3U4IA 5JDIA 1WZEA 1I10A 3WGHA 3QSGA 2HSDA 4LVCA 1GTMA 5AYVA 3ENNA 3WIDA 1VM6A 1O94A 3ZWWA 4FB5A 3ZI0A 5ITVA 3QY9A 1R12A 3TNLA 3PWZA 1O6ZA 4AJ4A 4U5QA 5F1PA 1KERA 1B15A 4DRYA 4IIVA 5BT9A 4B3IA 1MX3A 4R5MA 3RIHA 3ZNPA 1EVZA 4TKMA 4IY1A 3VZRA 1EQUA 4WCDA 5KJFA 3I4CA 2IEBA 1UDAA 2DUUA 4ITUA 4E21A 1O8CA 4RVSA 1I32A 2O7QA 1U3TA 2C29D 1Y81A 4FD3A 5JCJA 4ALJA 1GYQA 2YHIB 1VKOA 3KSUA 3PI7A 2ZTUA 4HWKA 3PYMA 1Z74A 3W6UA 4LGVA 3IC5A 4L8VA 1EMDA 3I9KA 2YUTA 4GX5A 3HB4X 3HNPA 5B4UA 1G0NA 2GZ3A 4YT4A 1H9AA 3OP4A 2EW8A 3ZU2A 4FBGA 2AG8A 1ZNQO 4YAKA 2JHFA 2V6FA 4I5GA 3K92A 4MVJG 1DIBA 4OOEA 4OAQA 4D42A 1FXSA 1SEPA 2DQ4A 2RHRA 2POQX 4ALMA 4C7KA 2DFDA 4ND4A 3JQ7A 1PSDA 4CQLB 2ZJ0A 2FZEA 5C7LO 2GUGA 4WLNA 1LBEA 3LK7A 4G65A 4TRMA 1JQBA 2P9EA 2EG9A 1Y8RA 5DCUA 3E9NA 4NBWA 4JX8A 2VYNA 4KOAA 1I30A 4MVJI 1VPDA 2I9PA 3LC1O 1BWSA 1NQ5A 3DMTC 5DNAA 3BHMA 4JJIA 3HG7A 4M49A 3SLGA 4W4TA 3ROPA 1Y8RB 3N58A 1CEQA 2O7SA 2IXAA 2C0CA 4GLOA 4NG5A 3JQDA 1Z73A 4RZHA 2J3IA 4YRBA 5JMPA 4AG3A 1JVSA 5KVQA 2NU6A 3KYCB 1Z7EA 3H3JA 3HB5X 1Y6JA 4YR9A 4U0KA 5IZ4A 4GKBA 1KETA 1A71A 1P1FA 3ZWOA 5JO9A 4AJPA 3QA9A 3P2YA 3NJ8A 1XQ1A 2R2GA 3AFMA 3DAFA 3OEYA 4UVEA 4AICA 2E6UX 2HK7A 2Q1TA 1JWAB 4LISA 3JD1A 1XLTA 1ADCA 3R1IA 4ZQBA 2ZQZA 2CVOA 4YDRA 2DTEA 1E7WA 2O3QA 2WYUA 4PLFA 1HEUA 2W2KB 3RASA 1UZLA 2D1YA 5I7FA 4E12A 2IYPA 3VVBA 1AE1A 3BTSA 2EGHA 1NP3A 1AXEA 4U8GA 2O3UA 2LDBA 1PJ3A 1FMCA 4KDFA 3RU7A 4B7CA 3BMCA 4UEJA 1DIGA 1UZNA 2PZLA 3GT0A 1ZIDA 4II3A 1CQIA 5JMWA 1MC4A 2JD2A 2WD8A 3U0BA 4DBZA 4R3WA 1GY8A 1NAIA 1E3IA 2I67A 1QG6A 2JFGA 2C2XA 1E6WA 3SLKA 3BMCB 5ENDA 3N74A 4ND5A 3FD8A 4S3MA 1NFQA 1OMOA 1WXDA 2CD9A 3PQDA 3TF5A 1XELA 1DOHA 3F3SA 4E32A 1Q0HA 4DWVA 5IN5A 5T57A 2Y67A 4J3FA 4YEDA 3X2FA 1R4NB 2E37A 4IXWA 4OIMA 1LDYA 1N92A 3VPHA 5THQA 3WICA 3NV9A 2BHLA 3QHAA 2VUTA 4TWRA 2V7PA 4DBVO 3Q6IA 5A9RA 4BGEA 4XIJA 3LYLA 4BV9A 5BNIA 4YBZA 1D7OA 4XJTA 1J6UA 1KYQA 1MFPA 4AFNA 2P5YA 2OUIA 3L9XA 4K26A 2Q1WA 2PH5A 1PZHA 3ETEA 5HM8A 3K2BA 3P2OA 4F3YA 1QLJA 3L4BA 2W8ZA 1HLDA 2WE7A 5JYEA 3PXXA 4PLCA 4K1LA 5H82A 3PWKA 1O9BA 2D3TA 4YJHB 5JBIA 1IZ9A 1ZKMA 3INRA 4AJEA 3EC7A 3ROKA 3TZCA 2PTGA 4R1NA 2O2YA 1X15A 4L73A 3PDJA 3BTUA 4QEDA 2GNAA 3HDQA 1T2FA 1E0DA 4HX5A 2XXJA 1DC5A 1M6HA 2X4GA 4B8ZA 2XXBA 4BKUA 1JVBA 1DIAA 4M54A 4FGSA 5BNFA 1MXFA 3DZIA 1KVRA 3VTFA 3ZHXA 3FBGA 2IRWA 2ZIZA 5HS4A 2P2SA 5KWEA 3ICCA 1KEPA 4RVFA 4O63O 4GWKA 3QWFA 1G1AA 1K3TA 4RPGA 4Z0PA 5A06A 1HDZA 3PP8A 1F8GA 5DOVA 5TS3A 2C07A 1T2AA 4ZRNA 4EJMA 3AI3A 1ZEMA 4BUCA 1C3VA 3DTYA 3JQ9A 1YQGA 4YT2A 1W0CA 3FTPA 4FW8A 5KJEA 4XQCA 5JYAA 4DQUA 3GF4A 5B4TA 1E5LA 2J5KA 4OGWA 2C59A 4MKRA 2I3AA 1HDCA 5C37A 3UW3A 3RJ5A 1NXQA 3W6ZA 4D3FA 3IUSA 5I8WA 1F0YA 1V3TA 2C82A 3DMYA 2B5WA 4PG4A 1GUFA 1IOLA 2ZCVA 2B4RO 4G5HA 3ZU4A 2DBRA 4IJVA 2DVMA 3GMDA 3NRCA 4RVGA 4HBGA 2QHXA 3GHYA 3DHYA 5ITWA 4IGFA 4WLEA 2PKQO 3GVXA 1C1XB 2OMEA 4GL4A 1DHRA 2HRZA 1HYHA 4QT0A 4MVJD 4MP8A 2HU2A 4Q3DA 3TFQA 1WMBA 2BKAA 4RORA 4E0BA 2BFPA 1SOVA 4TMFA 3WFIA 2NVUA 3DHEA 1I3KA 1ISHA 1ZK2A 3KRTA 4CV1A 4EYEA 3GDFA 4CM1A 2Y99A 3GRKA 3IUPA 2HMWA 3C7AA 2XF8A 2Q45A 4MVJE 1DDOA 1XHLA 2UDPA 2Y0DA 2CZCA 3FNHA 5TC4A 5K6AA 1N7GA 1UXKA 5AXCA 3PYXA 4RGBA 2PLAA 3U49A 1A9ZA 2PGJA 2NACA 2IEDA 4ZQHA 1I8TA 2Y1GA 3VHRA 1E92A 5JXWA 3QVXA 5JW6A 1QLHA 1T24A 1ENZA 1TI7A 3FWNA 1U3UA 1PS9A 5DBGA 3S2GA 4J4BA 2DBQA 1PZGA 4WLOA 1ISIA 1BXKA 3QIVA 4OXYA 1IULA 5U1PA 4BO6A 3PEFA 1LRJA 4BO2A 2DM6A 1FDVA 3P19A 1X0VA 1N9GB 2PNFA 4IZHA 4YPOA 3HN2A 3EVNA 2OORA 2VT3A 4U7WA 4B4OA 4MVJP 3EDMA 2QG4A 4NMHA 4P8RA 1QV7A 2J5RA 2Y1EA 3I9OA 3RWBA 2VHYA 1J4AA 1LSUA 2UYYA 2ZKLA 4O1MA 4HV4A 4XRGA 3C1AA 2G1UA 3DOJA 5JFOA 3U4HA 3AWDA 4AJKA 5JNLA 3I9NA 2P4QA 3V2UA 5MDHA 2G76A 4PG7A 2BI8A 2J3KA 3LC2O 3PQEA 4WE3A 1GADO 5FYDA 3TN7A 1I3MA 1ULUA 2DTXA 4I5EA 3D5TA 2VHXA 3GGOA 2WD7B 3M1AA 3V1TC 2EP7A 4B3JA 5JS6A 3ZDFA 4Q3CA 3ONEA 1HLPA 3BMOA 5JYFA 5TJ9A 4E2ZA 4NNJA 1PGPA 4DLLA 4E2YA 1B3BA 2GD1O 1QYCA 3JQFA 1IYZA 5A5FA 1LEHA 3HUDA 1LDMA 1EFKA 4WCFA 3TQHA 2VN8A 3C7CB 3PFWO 1KEWA 4O0LA 1RM3A 5JE8A 3JD2A 1PQWA 2Q2WA 3JYLA 4I5FA 4Q3EA 1YVEI 3K30A 2VOEA 4XQEA 3ZNOA 4Y67A 5JY1A 3BMQA 3CSDA 1HE2A 4D45A 3JQ8B 3I23A 3O03A 3FHLA 1E1LA 3SXPA 4M89A 1T1RA 4XWYA 1FJHA 1H6CA 2CUKA 1GYPA 1T4BA 1MP0A 2Y05A 2CY0A 1DO8A 3M2TA 1JA9A 1KBZA 2WMDA 5A05A 3EYWA 3FTNA 3MJ4A 4D46A 3COSA 3DZGA 3SC6A 1GZ3A 3RUDA 5CEEA 3IKVA 3S2FA 1NHWA 2YV3A 4NFYA 4E5MA 4YAEA 3IJRA 4R9RA 4GQAA 3DHNA 5GZ3A 3D4NA 3H65A 1UXJA 3WG9A 4S1VA 3OMLA 5LC1A 1Q7GA 3EAGA 4NQZA 5T6BA 3CIFA 2J3JA 3KOUA 3M2PA 4KTTE 4A0SA 1P1HA 4Q9NA 1BTOA 4LRTB 5TRTA 1U5CA 3I9JA 4RV9A 3GQVA 4ID9A 1RWBA 4PRKA 4E3ZA 2FPGA 5ILOA 4Z9FA 4WLVA 3BTVA 4RF2A 4JJGA 2OO5A 1WDLA 4H7PA 5CPBA 1IPEA 5ADHA 3JSAA 3FI9A 2R00C 3FNFA 4UUPA 1NVGA 4LSWA 5BNTA 3GDOA 2G17A 1LQTA 3DOCA 2H63A 3GDGA 2Q99A 4CLHA 3PJFA 1M76A 5K0ZA 3K9QO 3NT4A 3DBVO 4B4WA 5CP8A 1Z75A 2PGDA 2JAHA 3IAHA 3BA1A 3F4BA 4J1NA 3LU1A 4URFA 1I3NA 2VYVA 2VHWA 1PX0A 4BGUA 2UV8A 2AQIA 4XCVA 5DULA 4BGIA 4D3SA 1B0AA 2PD3A 2TMDA 2X1HA 1YB1A 3WR5A 3NDJA 3WFJA 3JQBA 1DC6A 2QIOA 1NVMB 1WWKA 3ADOA 1DB3A 4ZQGA 3FPLA 2JHGA 3GN1A 4AJ1A 1ZK1A 3K2EA 4DC0A 2E82A 4IDDA 1OC2A 4GVLA 3S2IA 4XGIA 1NFRA 1ZXBA 3PHIA 1NQOA 4W7IA 1YB5A 1M75A 5F1OA 1DSSG 3TJRA 4CMHA 3OETA 1ZZEA 2AW5A 2J6IA 3E48A 3HWRA 4M8SA 3ZWAA 3TZHA 4PLWA 3OSUA 4MP6A 5L9AA 4ZD6A 2Q2QA 4IM7A 4I8XA 5GY7A 1VE9A 3I5MA 3DBHB 2YFQA 5CPFA 5DN9A 1UXIA 1GQ2A 3UF0A 4GKVA 5ER9A 5L53A 1HE3A 2PD4A 3CZMA 5LDHA 1PS0A 4WUVA 4D0RA 1NBOA 1YQDA 5T8KC 4G2NA 3HQ4O 1CERA 3NJ4A 4YAIA 4Z0HO 1PU2A 2X9VA 3MOIA 3RBZA 1WP4A 1EBFA 3FPCA 3X2EA 2DPHA 1ZK0A 2DAPA 5TLSA 4E30A 5DZSA 4YYZA 2J8ZA 4INAA 1JTVA 4WASA 4KUGA 2V6MA 4XD2A 5B37A 4O6VA 4R51A 3FRJA 3R0IA 1GD1O 4MVJM 3ASUA 4EZBA 1W8DA 1PL6A 2O4CA 3OBBA 4OSPA 1ZJZA 4IQ0A 2XOXA 3QP9A 2CVQA 2G5CA 3A28A 4O59O 5GZ6A 2FOIA 2W4QA 3ETGA 4PG6A 5DDIP 4J0FA 1HZJA 1U7HA 1ULSA 2FSSA 4BV8A 4E5KA 1I36A 4RLSA 1LDBA 4QFCA 2I76A 1IL0A 4HFMA 3IL2A 2WWRA 3KLPX 4J1QA 3VDRA 2AEJA 4OQYA 3LT1A 4AJLA 5JAQA 4CMCA 1GV0A 1LQUA 3EUWA 2RBEA 4FS3A 3WMXA 4IGEA 4CMBA 1ORRA 1V6AA 5KOIA 3GEMA 4J7CA 3JQGB 2QW8A 3VPFA 1PWZA 3OA2A 2YV2A 1KC3A 2BGLA 3IQDB 3ZH2A 4XKJA 1PL7A 5U9CA 4PCVA 3L9WA 1ZSVA 4FFRA 5KKAA 1WVGA 1M6WA 4U6SA 5EERA 3AOEC 4WK6A 2BFOA 3OECA 1EFLA 3PZBA 1LSSA 3DBLA 3H3FA 4R1UA 1Q0LA 3DMTA 5H81A 3TPCA 3TWOA 4IDFA 5TX7A 7MDHA 3CKYA 4CMJA 1TB4A 4PLYA 3IP3A 4TZTA 3LT0A 2OL4A 3LT4A 4M86A 1J5PA 3DAPA 3H2ZA 1H6AA 1A9YA 3ZWVA 4BKQA 3D3WA 1YH3A 2NVWA 1Y5MA 5CEFA 2R6JA 5IF3A 4LSMA 1WW8A 4XB2A 4IJUA 3MCVA 1H0KA 2Q49A 2H6EA 1E3SA 3H9QA 2C20A 1UH5A 2NADA 3AFNA 3GNSA 4EUHA 1U8FO 4A03A 5JDCC 4LCEA 1HZZA 2OBNA 3WQSB 3RC9A 3ROQA 3FR8A 4L0QA 3I3OA 5L4NA 3H5RA 5COAA 2OP1A 4OSOA 1Y7TA 5L7TA 3KSZO 1YGYA 4J6FA 2X86A 3KSDO 3V1YA 3IKTA 3F6YA 4BOYA 5TT0A 4RDIA 2WTBA 3C85A 3KYDA 4MOWA 2YJZA 3F5SA 4NJOA 3LZ6A 1YL6A 4FR5A 2W90A 4DTIA 4KDEA 4HNGA 5A3VA 5EESA 5CDYA 4OHUA 3FWZA 3LQFA 2FPIA 1ZMOA 1FDSA 3NAQA 2EJVA 3OICA 5T5QA 6ADHA 1XU9A 2QRKA 1UAYA 3KYDB 2FMUA 4OJNA 4CODB 1TT5A 4IDEA 5ICSA 2D5AA 4GH5A 5IG2A 3RFVA 3VAZA 4FJ2A 5IDQA 1RJWA 3QVOA 4XGNA 4IJKA 4GSLA 4B7UA 3E82A 3AK4A 1LDEA 2FR8A 3IIEA 3PVZA 4BNIA 1P77A 4RF3A 4IMPA 1H6DA 1LLQA 5G0WA 2HK9A 4YAGA 5A03A 5FWNA 1P0FA 1LU9A 4UEOA 1XU7A 4NDNE 4B8WA 4F6LA 5IXSA 3VH3A 3PPIA 3KM0A 4R4JA 5FF9A 3MTJA 2YDXA 3LLVA 3CMCO 1H6BA 5T73A 1SEVA 3DBRA 1YOVA 1DHTA 3ZWPA 2FHSA 1U5AA 5JSFA 3KZVA 3RUCA 1GCUA 4I9UA 1DC3A 1PQUA 3OJEA 2P4HX 2HLPA 1NPYA 1QYDA 2FPPA 4OXKA 1P31A 1DRVA 2EERA 3FN4A 1WDMA 2YQ4A 1YOVB 3V2HA 3SBOA 2E49A 3GVPA 3VOSA 4NBTA 1E1KA 3DO5A 4R3NA 4FC7A 4P4LA 3O8QA 1HYGA 2D4AA 2G82A 3D1LA 4CR8A 2C7VA 5IDYA 2HMSA 3ZHZA 4BO3A 3BHJA 1KVTA 3TDKA 3AJRA 2QZ9A 1O89A 3QLJA 1SC6A 2GN4A 5ER6A 1SZJG 2B4QA 1B8PA 3WTBA 2QX7A 1V0JA 1BDBA 2PH3A 4BQPA 1SNYA 1LUAA 3ICPA 4HFNA 4EEXA 2FR0A 3AY7A 3BZUA 4DQXA 1ZH8A 4BO9A 1LTHR 4QUKA 5T67A 1TVEA 1G0OA 3RVDA 4LMRA 4MKZA 4CM4A 3JQ7B 4C7JA 4ZGWA 5A5EA 3DAGA 4KUHA 1A27A 1EUCA 1YQXA 1OAAA 2VHZA 4CM9D 1EDOA 1FDTA 3SVTA 3DQPA 2PZKA 4PLTA 4FOOA 3T4EA 6LDHA 4BQRA 1F14A 3BIOA 1AHHA 1LDGA 1X1EA 2J5QA 3BTOA 2O3RA 3V5NA 3M1LA 4GBJA 4CM4B 1NNUA 4NI5A 2VRCD 3DZFA 2I6TA 2OBYA 3HFGA 1EUDA 4PZDA 3EZLA 4D43A 2QRLA 1W73A 1XYGA 4B3HA 2X5JO 1HF3A 3IS3A 4IZIA 1ONPA 1N7HA 4EDFA 2D59A 3AUTA 4E5NA 4CUKA 1UP7A 2AEMA 3PTZA 4MO2A 3PHHA 4IS3A 3MJSA 4BVAA 4IUYA 5A3JA 3NGXA 3PHLA 4TVBA 4JGBA 4Q3NA 3O4RA 3RUAA 3JQAA 1E7QA 4IINA 3C3XA 3L0DA 1KEUA 4DXHA 1KS9A 3QVSA 4K28A 2X8LA 1PGOA 1UP4A 3EVTA 1ZK4A 3ON5A 1FF9A 4RO0A 3PK0A 4HP8A 4CQMD 4P4NA 1BGVA 1LXCA 1S6YA 3DC2A 3LT2A 3WNVA 2ZB7A 5CDUA 2BLLA 3WDSA 4LK3A 3PDUA 5DCYA 2I3GA 3MEQA 3CMMA 2H5LA 2YW9A 3E5MA 5DP2A 1I0ZA 1JDJA 3VC7A 5L51A 3Q2IA 2P9GA 1ZXLA 5K9ZA 1EDZA 3KBOA 1YE3A 1EK5A 3PJEA 1ZEJA 3ONFA 2QZZA 1LC3A 2GCGA 1BHSA 2BFMA 2B5VA 4QFDA 3ZWMA 2PZMA 2IZ1A 3OQBA 4BNFA 2NNLD 4OKNA 2GN8A 3DEYX 4RPHA 4EGFA 1ISGA 4ZQFA 5L7YA 3F1LA 1IHXA 5CG2A 4CM3A 2HK8A 3N7UA 1EK6A 1P33A 2JJYA 3HHPA 5IAAA 3HJAA 3AU9A 3UCEA 2ZB4A 3G1UA 3RU9A 3JV7A 1P1KA 4N5MA 4LVUA 1VJTA 5EIOA 4AJ2A 2C54A 2RH8A 4FJ1A 3K73O 1LJ8A 2EWMA 2FP4A 1GCOA 1HDGO 3GH3A 4KWIA 1D8AA 5DCWA 3GEGA 1K5HA 1IE3A 3DDNA 2ET6A 4WNIA 4AL4A 4Y8VA 2NV6A 2GF2A 2ZTLA 2GERA 3ASVA 3LVFO 2WYVA 2ZK7A 3MJVA 5L95A 2VWPA 4DA9A 1XQ6A 3DL2A 4DUPA 2JD0A 1VC2A 5EINA 4TROA 1PS8A 1F12A 2Q4BA 4XJSA 3K6JA 1HYEA 3B6ZA 5G0UA 4BO8A 2BGMA 1A4IA 4F6CA 1Q1NA 3LLSA 4ZN6A 5IXYA 2X0JA 4OO3A 2QYSA 4GAEA 3WNQA 3QWAA 1R0LA 4I9NA 5AOVA 4DYDA 1YJ8A 1B3RA 3ANLA 3RBVA 1NAHA 3A06A 4MJLA 2FRDA 4BS9A 4KMSA 3Q0EA 3JD3A 1R0SA 5KTKA 3TSCA 3ZV3A 4AJOA 3RC2A 3B1JA 2W2LD 4HNHA 4UULA 2XPCA 4CLDA 1I2ZA 1U1IA 4WNCA 3O38A 3WX0A 4E31A 1D3AA 3WIEA 1Z6ZA 2ZTVA 4J2OA 4DLAA 1D1TA 5TQVA 1A7AA 4A2CA 4CMIA 1X1TA 4BNNA 1Q7CA 4BMNA 3VKVA 4XYLA 1P74A 3G79A 2GZ2A 1MXHA 1T2CA 3TZKA 4ND2A 2DKNA 1J0XO 4FQ8A 5CHEA 1DJNA 1LI4A 2VZ8A 1SOWA 2AA3A 4FJ0A 1KC1A 3AM5A 4BNKA 3B1FA 4NU6A 2R00A 3NYWA 2Q1SA 3UHAA 3GFBA 4YJFA 2FN7A 5L3ZA 3OF2A 3LF2A 4YTEA 1PJBA 2CSUA 4FFOA 4Y6SA 4BIIA 5G2OA 5I7VA 3AY3A 2AMFA 3ZW8A 1B14A 2X22A 1DBVO 2OXIA 4BMSA 3E18A 2D0IA 1U3VA 4GI2A 3FSRA 1K89A 4TVOA 1VJ0A 1GYRA 3D4OA 4CMAA 2VUUA 2NVUB 3H9EO 4NPCA 3G17A 2DFVA 1GPDG 3ONDA 4A7PA 4N7RA 4E5YA 3C8MA 1YL7A 4EITA 1O95A 1BXGA 1XWFA 5BR7A 3JYOA 4IQGA 2O4UX 2NU9A 2W98A 1QR6A 4J7UA 4CLOA 4CMEA 1B7GO 2DC1A 5I9LA 2NU7A 1JAXA 2HRBA 1WMAA 4ALKA 3E6AA 5AQ1A 3JYPA 3ZHYA 3OH8A 1B8UA 3IJPA 4L4RA 1EQ2A 1C0LA 2G0TA 4BNJA 4UUNA 5FI5A 3ZWCA 2I65A 1CF2O 1JWBB 1UR5A 2C7GA 2EIHA 4CLOB 2AXQA 3CUKA 3STHA 3ITKA 2VZ9A 3ZW9A 4BNZA 3WSVA 5JCXA 1E5QA 3GY0A 4QQRA 4WEQA 1ENOA 3R3SA 5F5NA 2H1SA 1RM5A 1V35A 5T64A 3AY6A 1KVSA 4L75A 2YDYA 4CUJA 1P1JA 1GPJA 4UUOA 5JYDA 3PLNA 4XYEA 1T4DA 2OP0A 1DRWA 1U4OA 2HAEA 2WJPA 5T8KA 1CRWG 3IP1A 3WJ7A 4IQ8A 4BNUA 4L9RA 4K9DA 1K6IA 4UAGA 5AXBA 4MKXA 4QXMA 4LW8A 1VKNA 1HT0A 1NM5A 4BB5A 1E7RA 4YQYA 3ZV5A 2D5CA 1GV1A 3K96A 4BNVA 1LRKA 4TQGA 3PGJA 4Z9YA 3BMOB 3TOZA 4RVHA 2DLDA 2E48A 1DIRA 4BKOA 3DTTA 4XGKA 5CFZA 1E3LA 3ZN2A 3HZZA 4FFMA 4HY3A 4A5OA 3RQSA 2Q4EA 1IHYA 4GWGA 3PIIA 1R66A 4E33A 5TSDA 1Y1PA 2X23A 3U4DA 4II2A 4WCFB 3BMNA 4BNXA 3GAZA 4BKPA 4BO5A 2UAGA 3GN2A 1B16A 1HE4A 3K31A 5IN4A 2VHVA 4PVCA 4CL3A 2NWQA 4XX0A 3BMQB 5H83A 3ZWBA 4NK5A 2DBZA 1R37A 2LDXA 1Q7BA 2OOSA 1NVTA 2I99A 4R1TA 1ZCJA 1HL3A 1HE5A 4UVDA 4LRSB 4XDZA 4DMMA 4P4GA 1PJLA 1UP6A 2WDZA 3JQ9C 3AOEA 3WGIA 1XCBA 2CF6A 3L6DA 3G3EA 5FI3A 1ZSYA 2OFPA 4FCCA 3HADA 4MINA 4AVYA 1BVRA 4BNHA 3RUHA 1ENYA 2O3JA 4RPJA 4YT5A 4Y6RA 4M87A 4E2XA 2P91A 4WLUA 4NR0A 1QRRA 4GVXA 2AE2A 1IB6A 1LX6A 1NPTO 5B1YA 4CLXA 1EVJA 2JFHA 3Q1LA 2GN6A 3H6KA 1DC4A 2EJWA 2VRBA 3TOXA 3FNEA 4JBIA 1C14A 1WAMA 2B0JA 2BI7A 1HTBA 1H2HA 1U9JA 5JCJD 3MJEA 3U62A 4PFJA 5COQA 4KWHA 2VNAA 5JDCA 3UUWA 1PR3A 3GFGA 1ZW1A 1FDWA 3DZHA 4GLLA 1A7KA 3H2SA 5KVCA 3E03A 4XYGA 5TNXA 1Z45A 2ZCUA 2EV9A 4PGFA 4UUMA 3RD5A 4B7XA 1ZSNA 1GFSA 2VWGA 4ILKA 3PYLA 3LC7O 4NH4A 2Z5LA 3BHIA 3AUAA 4NBRA 2VTDA 5F3RA 5JC8A 5J9GA 2AQKA 1WNTA 4XEHA 3W4IA 1NWHA 2X5OA 3GAFA 1JN0A 2X0RA 3GR6A 1SCUA 1C0KA 3JQCA 1XIVA 5AVOA 3RKRA 1GEEA 3GRPA 3KYBA 3OM9A 4OXNA 1U3WA 4CV2A 3H5NA 4J43A 3UGKA 1I2BA 3PIDA 4WOKA 3WGOA 4AJNA 1TA4A 2VYND 3GZNA
chains in the Genus database with same CATH superfamily
3TO5A 3K0FB 4WT7A 5EOVA 1F2TA 2OGZA 3NWEA 3CZQA 3R09A 3WWPA 3V8VA 3S2YA 1DLIA 3V00A 4D4MA 1MCZA 3U26A 1KNXA 3GFQA 4PYIA 2ZYGA 4UZSA 4PNEA 2ZB8A 2JGRA 2VEOA 1M9NA 2W0MA 1AV6A 1BWQA 2YJ5A 3WL5A 3THWA 4N76A 4YP0A 4QREA 1ZGAA 2RH5A 3WMWA 1OZ0A 4U9HS 1GTVA 4DCVA 1QG2A 1DXOA 5J2TA 3TL2A 1C8LA 4WUTA 3TZLA 1F2TB 2NTNA 3K8ZA 2QUIA 1LVUA 1TJYA 2KLBA 3E9MA 1ZUD1 3WLTA 4R6XA 2BVNA 3IPLA 2JASA 4TWZA 2WQ7A 4MB2A 4C87A 3A1VA 2C84A 2UZ3A 1K7FB 4NYMQ 2ZPAA 4O4LA 3THWB 2BP7B 1G5IA 2D5IA 2JDIA 4MV9A 4L95C 2NZWA 3FUWA 2A3RA 4Q7MB 3UEOA 5BR4A 1Z4IA 1PZFA 2K2WA 3A31A 4RGVA 5A4DA 3L06A 4NV0A 1KO7A 3OQPA 5M6DA 1K97A 2Q0QA 5B3JA 2JGDA 4BEBA 1U8UA 5I7EA 1NNI1 4Y98A 5IAEA 4AX4A 5T6MA 1JHYA 4CV3A 3H13A 1H2YA 5G3YA 1QR2A 3P9SA 4JLNA 2Z8XA 4R69A 1POWA 4YCAA 4K3VA 1VLJA 4MUFA 3PC8C 4L1KA 1B26A 5A9SA 5BV7A 2PUTA 3C43A 1QIEA 1SPBS 1RHUA 3BD6A 3KDAA 2J08A 5EP2A 2WF7A 5DBFA 1JKXA 5J59A 1RE0A 2C03A 3B2EA 3K5PA 1JECA 4I1OA 3FTCA 1CLEA 4Q93A 1CUZA 2QVLA 5IT5A 1EXVA 4RTKA 2D2VA 5C8DA 5HHTA 2A1TR 3LOQA 4OYRA 5T3YA 1B0PA 3DUFA 3DWFA 3AHCA 4Y9UA 3R7DA 3P7MA 3EUEA 3LQQA 5A9SB 3N59A 1G21E 4EW6A 1RAHA 1HFWA 2WEKA 3EG5A 4E2WA 1E7MA 1L7MA 2A0YA 4UQPA 1OX4B 3WBFA 5LMCA 4GPD1 3RC7A 1F6DA 3GCGA 3GLKA 2V74B 2XTMA 3AX6A 5D1NA 4DM3A 4ETIA 3DUFB 5EIAA 2YFYA 5FTLA 3QVGB 3RC8A 4DAEA 1QXSA 1Q1BA 1TD1A 3PT9A 1ILEA 3GG2A 4WFQA 4MYCA 2ZATA 2Q46A 4FSDA 4MQUA 4ISCA 1E3TA 4Y7DA 2BDUA 3QFCA 4OM7A 1CF4A 4MWZA 1BX0A 5DIFA 2XQIA 3FDJA 4G81A 4H3SA 3DBLB 4KTVE 4FE7A 3AHHA 2WWIA 1QONA 3KKLA 1W9HA 5JSKA 3U7QB 4EPRA 3C8DA 4QTYA 4DB4A 1FFSA 2FPOA 4NX2A 2GEBA 4ZAYA 2QTBA 1NLFA 4DPLA 5K3OA 3E2MA 3T7EA 2YWHA 1PW5A 3S8EA 421PA 1E9FA 1L5KA 3E5RA 3JQ6A 2PUAA 2R8PA 2ZUUA 3AI1A 1FSGA 1KVQA 2WRZA 3D5QA 5DCLA 3D3WB 5A04A 4F5WA 2VCYA 3WAJA 4H1TA 1H2BA 4M88A 5BPHA 4PO9A 5HMMA 3C39A 4DNOA 1RRGA 1U65A 2QD1A 3AP3A 4G2TA 1DQSA 4KH1A 5T4BA 3D7KA 5BYJA 5F5LA 3PA6A 3MFYA 3W4JA 4BZQA 3LTNC 3CH7A 1Y5RA 3A6FA 4R0NA 4TLCA 1ZMRA 4LRUA 5E7JA 5AW6A 4MLDA 3S2EA 3MM4A 4AS3A 4INJA 4MWBA 1B8OA 2IZ5A 2IOYA 4UCFA 4CLRA 2CXPA 2WIDA 3KZ1E 3OMWA 7ADHA 5KREA 5FJIA 5A4AA 3GLRA 4EG8A 4W5RA 3L7MA 2C1ZA 5FTNA 4Q9DA 2C58A 1PLLA 3PWSA 2GR9A 4EJ0A 2XUHA 2ZR9A 1XXHE 3WYNA 1GZ7A 3GP8A 3N39C 4A1OA 3UUFA 1XKXA 1BEUB 2G77B 3CLRC 3FCEA 3LY5A 4L0CA 4U3JA 4KGDA 4PZEA 3S28A 1JR3A 2H17A 3A9CA 4KUEA 4UMFA 5CXXA 3S0JA 2PUBA 3LZDA 3VH1A 5I5GA 1O8BA 1YJQA 3PR1A 3Q87B 1IZ0A 5E4FA 4I4CA 2VJLA 1PEKE 1U8AA 3O90A 4NVRA 1PGJA 5ITZB 5TPWA 4ZYTA 5AVUA 3K0SA 2ZYIA 2P9QA 1T2EA 3ANTA 2J30A 3UICA 4RW0A 3NLLA 1W4AA 3IVGA 2EKPA 4JUAA 1GRNA 1FDRA 2YQ5A 3S5UA 4B43A 2ZXUA 2V03A 1RRKA 1QQTA 2BZ1A 2F1OA 2JFQA 4N5LA 1R64A 4MICA 4PG5A 4TT3D 5ESRA 4HDRA 4F4DA 5HJEA 2DHDA 2PPLA 1GQQA 3DP9A 3BDIA 3EN0A 4P58A 3BFVA 4EOGA 2VCHA 2EKLA 5J63A 1ZR4A 3LKDA 4X97A 5TPWB 3S55A 2A1TS 4ZK6A 4Z99A 3IE2A 3RPEA 1ZBQA 2JANA 3BRWA 3QVTA 2R84A 3LPLA 3JZDA 5JZSA 2PRSA 3H75A 1UDBA 1EG7A 5CCEA 1YI1A 3AI2A 1N2HA 1H2FA 3QBVA 4HDRB 1E64A 4P5EA 4CTOA 1TEHA 4W1PA 2IXBA 3M4XA 3TSZA 4I9GA 3B7PA 3M81A 4DR4B 3EZFA 3U56A 1M10A 3QM1A 4KE6A 3P26A 2FWIA 1YMUA 3FZEA 4QUDA 3VVCA 1ZR2A 4MA0A 3ZJVA 1A72A 2NZVG 4M55A 4DUGA 4EJ2A 5JI2E 1RC1A 4X64B 1WXHA 2P35A 4YJGA 2BGNA 4HT3B 3NBQA 5MGNA 1KH3A 4AQYB 1JT2A 1E9DA 2C2WA 1KVUA 2EXXA 3WADA 1UMDA 5TF4A 2AFRA 3I1JA 4KRGA 2NV0A 1RPJA 2VJNA 3W04A 1DIHA 1CY8A 1UPTA 1U90A 2P6NA 1II0A 2J0UA 1UINA 4FMDF 1K5PA 1GEGA 1N2EA 4YJGB 4PBRA 1Z2CA 2SICE 2V7XA 1FFBA 3NTOA 3QV1A 2QUJA 3HCNA 4LEIA 1UMDB 4QXAA 2VPZA 1R1DA 5I9BA 1SHKA 4OX9Y 3IA7A 4H7HA 3E8XA 2YZNA 3G7NA 4C6HA 3H5AA 3GLGE 3QW2A 2GLTA 4FHCA 2J0UB 3BERA 1AUVA 4R1SA 2NSYA 4ZXPA 2A9FA 4CQLA 2G28A 3GT4A 2EF0A 2FZWA 1Q1EA 4HQOA 5FWAA 4BO4A 3CO0S 3EIQA 5JAUA 2EQAA 5AXDA 2BTEA 3T3GA 2EX4A 2I29A 3TLCA 1FUYB 3AVUA 3GNQA 1G8HA 2A4KA 4RC9A 2Q50A 2XYPA 4I55B 4W99A 4UU0A 3EEOA 4RVUA 2W2QA 4WDQA 1CT9A 1CZRA 1K63A 3COZA 2PS3A 1Z5WA 1D0VA 3FKJA 4UVIA 2YASA 4X92A 2O2GA 3FOFC 4NZYA 2ZTMA 3ZD8A 5ES3A 2Z09A 3DT6A 1KU0A 2CHFA 4ARZA 1QVWA 1EVIA 2DOKA 1EUCB 2HUPA 4QOEA 2ODNA 2DECA 3GVCA 3WYCA 1VSVA 3NEPX 2Z6AA 1Z0IA 1AKNA 1CJCA 2O54A 4Z6KA 3B9QA 2P5TB 5ALMA 2ZWIA 2O7VA 1XCPA 3HB7A 4N5HX 4YDSA 4EY4A 4EW3A 2E4WA 3K5IA 4OHFA 1WG8A 2WVGA 4N7JA 1HFKA 1T9GR 1WY7A 2O2SA 3KP1A 3PEEA 3II6X 1SG6A 2O1XA 2XYGA 1VIAA 1DELA 1EUDB 1QUEA 2VT2A 3LXMA 3R20A 4W82A 1FSPA 4GZMA 1QGYA 3IV7A 2P79A 4NCKA 2P75A 4ILEA 4F4CA 5D86A 3SSAA 2JLBA 3T4PA 4NDZA 3Q11A 1X7YA 1DINA 3C15C 3ZU3A 1GQRA 4Y6PA 2FX3A 1C7RA 4DLVA 1CP2A 1OWLA 2A5LA 4HYTA 1JKFA 2ZRJA 4G8CA 1DAGA 2AOUA 3S1AB 3VHXA 1YB6A 4HQ6A 1YFLA 2OD7A 3QELB 1C80A 4RE5A 1X7YB 3RS2A 4UD2A 4LA4A 4K6CA 1ZAKA 1SB8A 3AF0A 3JQAB 3MGKA 1Q3KA 4UATA 1PT5A 4WVFA 5C35A 2RIRA 1H4SA 2J9RA 2UUPA 2FPMA 2H7VA 3MOSA 2JLWA 2IXFA 3HYLA 4JHLA 3WS7A 1UBGA 3DONA 1AHIA 4IKOA 1UADA 3FGZA 1RPNA 3ROFA 1OT5A 1RYEA 2WVHA 4FE4A 1N2BA 4KI7A 3QLEA 3S68A 4BE9A 4F5EA 4HPWA 2CXQA 1U0OC 3V3TA 5FEUA 1GDTA 4XR4A 2YIDA 3LFHA 1RR6A 2MYNA 1EGHA 3UJAA 2Y1OA 2HV9A 3FCYA 1WJGA 1W6RA 3KJFA 5J2TF 5TJHA 16PKA 2GAJA 1Y4AE 5AK4A 3EPJA 1QX3A 1JU9A 2QL9A 3KTFA 1XC7A 2VNHA 3D02A 1MUUA 3DULA 4QUJA 1NXWA 1M8KA 1SMKA 2JZNA 2MSNA 3CPSA 2BBOA 2C04A 2JKZA 2UZ1B 3DE6X 3H4VA 4HC4A 4I1SA 2ZQYA 4KQIA 1G6KA 4M0PA 4C7MA 1BVUA 3ETDA 4KIUA 1KQOA 4J2HA 1O94C 2HMAA 3SHVA 3UB2A 3C4JA 4H6WA 1KZHA 3QV2A 3NHPA 1M0EA 4WLFA 3NDPA 1UZUA 2FEXA 4IHJA 1YZ3A 3DZ4B 3VKUA 4F9TA 3P71T 3LVRE 5T3UA 4DL9A 2IYTA 3IR6A 2YVLA 1MT0A 1IZYA 3OE5A 1E62A 3F3KA 2ZG6A 1BX3A 1ZVMA 6CHYA 3NHAA 1BFKA 1N75A 2ZI3A 4RDHA 3UVEA 5KIAA 3CYFA 1RMYA 1UBJS 1C9DB 1RABA 1TMGE 4WWHA 4K6GA 3VM6A 3RCBA 3D7LA 3HN7A 1P18A 4OQEA 4TMKA 4B34A 1P0PA 2ZE5A 2ORED 2Q8PA 3R5FA 1G5PA 1R27A 2DHCA 3H1EA 2H1LA 3AM3A 2EFHB 3BXHA 4MIOA 4MAAA 2Q2OA 2WHPB 3LSTA 2QRQA 2GLUA 3VR3D 2WE8A 1VE6A 5DLDA 2Q5OA 1JMVA 4RPKA 3PRJA 2Z9CA 3OCZA 5HVNA 1W34A 3O91A 3OCJA 4BNYA 3TLMA 1NXXA 1PFGA 1XCMA 5FPPA 1R5BA 1V2GA 4QOGA 2C00A 2YIMA 4LN1A 3H42B 1SIOA 2JLZA 3DDSA 3EGOA 1MOZA 4MDEA 1ZG3A 3RI3A 4FGWA 3NJRA 2PSSA 3IUJA 1V16A 3EP4B 2HA7A 1N5KA 4Q7LA 1WX1A 3WGGA 2E89A 5AJUA 4MVJF 3FUTA 5FBWB 2TRSB 4D4JA 2NOAA 3JALA 4RLHA 1RWNA 2VH1A 3DLAA 4K9KA 1MX9A 1DAPA 4C78A 5K20A 3MWDB 5EJMA 3EIWA 1I3OA 4FEGA 3C5HA 5LDGA 2GN9A 2R8EA 1NBAA 2YJ6A 1W8IA 2CL0X 2FPRA 3NXKA 1U3CA 1ZN8A 4F0JA 5AP9A 2VYCA 5IH3A 3T52A 1IVSA 1T5LA 1I5RA 3E9ZA 4FFSA 1VIDA 3VPCA 1M1XB 4LOAA 1Z0DA 3ZYCA 4KFTA 1ZIYA 1OBFO 1GN9A 5HIKA 3C6ZA 3S7TA 3QWBA 4YUYA 1KRXA 4J16A 1YRYE 4KC0A 5KU7A 1XSEA 4ON9A 1BRMA 4I3HA 4QPZA 1IMOA 3NGMA 3JQEA 1PJZA 4CN9A 1LC0A 1UC9A 4PS1A 5BO5A 2XB6A 2GHQA 1M7GA 2GD0A 3OURA 4QPPA 4CMIB 3ZHSA 4BX2A 3FY4A 5IHXA 4TN5A 5TVKA 2CT8A 1GUZA 2RCNA 1UWVA 1ZGBA 4IDAA 4Q01A 5ICMA 2V7UA 3THYA 1ESDA 4ZYVA 1UOQA 1W29A 2BMWA 2QL6A 1N8SA 3QWIA 1T2NA 4XARA 2H18A 2JS7A 4E1AA 4EA6A 4Z7OB 5FOQA 3CUTA 3FLEA 1OLSA 4RFVA 4R1OA 1DI0A 3KPVA 1MC1A 3QUBA 3VPGA 3K0HA 4B4KA 4BQOA 2HEGA 2Z1MA 2TMGA 3R6TA 1EEXB 1V11A 4JBGA 1XZGA 3S27A 3SK0A 4ES6A 3QI2A 2F43B 3THYB 1U1DA 4OJYA 1J39A 4YJFB 1QX4A 3HXOA 2X42A 2VZ0A 3TQOA 5DJ5A 3GPBA 3R24A 4XSHA 3SR3A 1WNFA 1DFHA 3WGNA 4H7JA 3GA0A 1D0SA 4CR7A 4C2AA 1E2KA 1RZRA 3RJZA 1T2DA 3T7AA 3VKGA 2FEKA 4KZPA 2YV1A 1NRWA 2PL5A 2M6SA 2W93A 5TT1A 1RWPA 1KO4A 3TR5A 2AEFA 4ZVKA 4C3ZA 3H8VA 1IXRC 2WTNA 4LXXA 1CX9B 1S1MA 2XBUA 4AM8A 5HA5A 1V3VA 3OTHA 4KRFA 1Z7BA 5DW3A 2CNBA 1WVMA 5FOUA 1KKLA 2PXCA 4EB0A 1JEAA 3OIFA 3LRTA 4XUDA 4BFZA 4DLBA 2GSWA 5JCOA 4YCSA 5EXPA 1Q77A 1S3IA 1N6OA 1PWHA 4HRYA 2VVTA 4ND7A 2OGSA 4RK1A 3A58B 1YCFA 4UMVA 4WGGA 2PSFA 4R8SA 4PRLA 4RSGA 5E38A 2Q4OA 1MF7A 5I9IA 4DILA 1NVVR 5HKBA 3GI1A 4W5QA 1MO2A 5FXMA 3CKKA 1KYZA 4X1OA 3R6LA 2BBSA 2VXBA 1CUEA 1S7CA 3DFIA 3OQ1A 2LCFA 4LY3A 1N7IA 2PKQP 4NMLA 3QF4A 4EO4A 4E22A 2ZRAA 2UZAA 1ML3A 1TT7A 3OOEA 3ACCA 1EFPA 4JB3A 1PQPA 3NX4A 3ODGA 1CUVA 4GRIA 3KEQA 2DZDA 1VSTA 4B09A 4WN9A 3STVA 3VR6A 1P6UA 2JW5A 3ETLA 3OEED 1BS2A 4KO2S 4MR8A 5CNMA 1CD5A 1Z08A 4CI9A 3L7BA 4DIUA 3SIPA 1YASA 1X92A 4KPGA 5JO0A 4BMZA 3RRFA 2OVBA 4UM8B 1EFPB 5EKTA 2EKZA 4BGDA 1TW2A 1YKGA 2BELA 3DQZA 2CJYA 1FIUA 5F9FA 4QXOA 1P4HA 1WABA 5FADA 2VWQA 1FMFA 2Q3JA 2H1CA 4MR8B 5GJCA 4E3WA 5A4MS 3WHKA 3R6WA 4XJVA 3R9KA 1B23P 5EFOA 4B82A 4LJ7A 4QGBA 3IFSA 3DNMA 4NOKA 1A1VA 5K99A 4C29A 2QK4A 2OESA 2JVJA 3F96A 3KEOA 4OQMA 1IQUA 3D4PA 3DVAB 4BP9A 4G0OA 3P9RA 4LYAA 1QE3A 2OQVA 4ZTZB 4FMDB 4AKSA 2I7TA 1TYBE 4WA8A 5FYQA 2OV3A 2X9NA 1GKKA 2YX1A 5IJAA 2WTUA 4FTWA 1X1CA 1L6RA 4G5OA 3GLUA 1GPWB 1M7HA 4K8RB 3W6OA 4IH9A 5DLYA 1V9CA 4ODIA 1N36B 3UGTA 2BZSA 3ZJ4A 4XVQA 4Y1EA 5C80A 3V7FA 4UBKA 4P0PB 3WO1A 4RMHA 3QTLA 4AUNA 3Q9UA 2PKRA 4WGFA 4ARIA 3TTUA 2AF3C 3Q5GA 4YP9A 5JWRA 1UL1X 3PJGA 1NFFA 4O2BA 3JPWA 1DC7A 4REMA 3NOOA 1KY4A 5ALTA 3CRNA 3DM9B 1CE8A 3BMNB 3IUQA 4NJMA 2DHQA 4U2GA 3WDKA 4AY5A 1DMRA 3H9CA 3EP8B 4Y2UA 1WHSA 4JB0A 2H7XA 3I64A 1XTBA 1BCRA 2MJLA 3KXDA 5EXXA 5EQTA 1VCNA 4KNWA 4LXYA 2P11A 4PC3A 3SM3A 3OIGA 3VMMA 1T9AA 4IIUA 5AKYA 1NR7A 1RJFA 5IEBA 1CE8B 4NJMB 5JFTA 3ORFA 1TZCA 4R1PA 4F1JA 4WBNA 5B53A 2RC6A 1PQ4A 4XAQA 3DG9A 5JAIA 4NMMA 1H9BA 2H2HA 4U6NA 1BCRB 1HETA 2RAFA 4FSHA 4EP1A 5JSQA 3UAYA 2RKBA 4JXJA 1Q0QA 4QQKA 3RSCA 1U02A 1V4BA 1ZRNA 1X7DA 2QDKA 2WSBA 4DDWA 2J0EA 4I1IA 1CJVC 1FSFA 4RV4A 1QKIA 4II7A 2JGKA 3LOUA 5HQTA 2F59A 1C1YA 3UXMA 2JI4A 4W8OA 2NPOA 2C1XA 5AI0A 2VQ3A 4XB1A 3PIRA 4EGJA 1QFXA 3UAGA 5AW4A 3CV3A 3UWPA 4PVDA 5ALVA 5E6RB 4X54A 5A0FA 4CMGA 2CYAA 2UUBB 3AIMA 3E5NA 1DKUA 3TI9A 3V7UA 4JEIA 1TQ6A 4L4UA 1GZVA 5JSUA 1VPVA 3ZVMA 1XRNA 3A25A 1CUWA 2I1QA 2P9HA 2W37A 5IUKC 2ZEJA 4JYPA 3TBFA 1UIMA 3WLFA 4OFBA 1YS7A 3IBYA 5LCXA 1E1YA 2VSYA 3V4PB 2W42A 1GNRA 5ABPA 4QO7A 3AB3A 3MCUA 4OF4A 3CEAA 4QJ5A 1XQWA 1XZHA 1G8SA 2HRRA 3SKXA 1U4SA 5L40A 1ZLYA 1OU0A 3B7WA 3MS4A 2WZCA 2QT0A 4LOJA 4PCLA 5HE8A 2QNIA 1R88A 4MQLA 3TUTA 2HQRA 3F9IA 4Q3OA 3HVJA 5EEGA 5TEWA 4UZFA 4GKKB 3SHTA 5FWYA 4DC1A 1ABFA 2R1TB 5AM0A 3KQQA 4DWWA 4B6SA 4AKGA 4X1YA 2G7ZA 5K6AC 1AU9A 4MUJA 2BL4A 2B6HA 1NSTA 1P5HA 5J2TB 1OBHA 1CY4A 2VZLA 3RV3A 3AZOA 4D9KA 5BSEA 4B0OA 1RHKA 2GEFA 1ZUNA 2IDKA 3F47A 3N2NA 3KAPA 3B2NA 4EJFA 3V1UA 5LNK1 4UAJA 1DG3A 1JKIA 3IUYA 4MJXA 4RZQA 4J9UE 5FWYB 1I24A 3O94A 2H3HA 5F51A 3G1TA 2YZ7A 3OQ6A 1RYBA 2YZKA 3EEFA 3Q9LA 3QVJA 4X1YB 3M83A 4CQJA 4EAAA 2HHHB 1YR9A 2CDCA 1DTEA 3DBHA 1PRYA 4HWGA 4DRXA 1ZUNB 5BPFA 4QBTA 1GWNA 2GJAA 4E46A 1XTSA 4M1MA 2HH9A 1L1FA 4B3GA 1NY5A 4W8GA 2HBZA 4EJSA 3H8JA 1MHTA 3M5CA 1D1PA 3A1SA 3I83A 5H68A 1U28A 4JP2A 2DR0A 3H11A 2ODAA 2Q9CA 5AI5A 1JAYA 2GZAA 2WPDA 5GVRA 2FEMA 1DEHA 5KKCA 5LQMA 4Q4CA 2JLVA 4KHPB 1H2RS 5ENVA 3B53X 5GGYA 2H1RA 4JEHA 1C7ZA 4HXYA 5DVZA 4F3TA 2P78A 2RHTA 2G88A 4XASA 5L8VA 3TW0A 3SQDA 1JXQA 3BE8A 4WOCA 3KQLA 1SIUA 1KI8A 3ANMA 3O4IA 3H11B 2AGVA 1Z88A 5AKJA 1AKWA 5GAJA 5FWDA 3RKUA 4D41A 5FTKA 1T26A 1SG0A 5JQGF 4OMDA 3SR0A 1QFSA 3C8ZA 2B1GA 3BWDD 4LMBA 2YFHA 4UD6A 1YHNA 3G23A 1FYFA 4WCFC 3RE1A 4CM6A 1DAOA 3TL6A 4BMCA 3CG4A 1W19A 1GNQA 1VL5A 2NUBA 5JCZA 1N5DA 1Y4SA 3X1JA 2EU8A 5H4GA 1R4MA 4WZAB 3TUZC 1ZN2A 4FYJA 3C3PA 1EPUA 1KFBB 5BN4A 3JWJA 4PPQA 1QHXA 3B82A 1HDEA 4WJZA 3GOHA 4HFRA 1NBEA 3JQGA 3ZLUA 2Y68A 4EHFA 1YT5A 1BKYA 4GPEA 5B6JA 2ZYSA 3BMXA 1R4MB 4IPTA 2CFOA 2JFWA 2XX3A 1ZCBA 5NLLA 4Z3OA 1M0WA 4RTRA 1X86B 4QX6A 2VYFA 4KLRA 5BN4B 2C0PA 2J0VA 3PE4A 4HEA6 2Q7OE 4CM8B 2DH6A 4C08A 4KXWA 4HLDA 3HNOA 1ZJYA 2I7CA 1DJQA 5GJVC 3ACBA 4AN4A 5HR5A 3ADCA 1KJIA 1Y8ZA 3K9CA 1CUBA 2I2WA 4HLCA 4ZT5A 1UT5A 2QLMA 4HF7A 2IZ0A 4NIMA 1BROA 1YQEA 2CXSA 4JIGA 1FTNA 3G2MA 4RVCA 4UOQA 3C87A 1KS2A 3UV7A 1DC8A 1G3QA 3ADPA 3AM4A 5D3ZA 5LR6A 3K6RA 5DYNA 4AJHA 3C74A 1G4AE 2OXRA 3AF6A 1E2JA 2D00A 1SN7A 3KTAA 5BORA 1M1YA 5JAZA 3IAEA 1KI3A 4OAOA 3EW7A 2R8YA 1L7DA 1I7BB 5CCXA 2OSVA 1VL8A 2XYRA 5K3FB 1OA1A 3V9AA 2FUEA 4DC9A 2OYSA 3F46A 3KUUA 1TUIA 1TYZA 1W4LA 2OE2A 2OZLA 3SKVA 3LQKA 3RTDA 3TUIC 3HVKA 1P45A 3WQQA 3RROA 5ALRA 3BT7A 4MEBA 4ZIRB 1KFJB 2X2EA 4M0EA 4U4AA 2BSQA 2XBLA 2RKOA 3H7IA 1U7TA 2YYZA 4LPSA 1AK1A 5CFOA 2AUMA 2BFFB 4O4JF 1LPNA 3V1NA 4B85A 5F3WB 2WJJA 2HA5A 1NJ6A 1YRLA 3W5UA 1IHPA 4C0AC 1ZK3A 2PUGA 1NPDA 1Q16A 2F9MA 2PEYA 4ROTA 1P1RA 1AN0A 1Q17A 4XZ3A 5IULC 1GNPA 3TIIA 1G1MA 2C2BA 3KBBA 5IFLA 1BN6A 2D5LA 2O8FA 3NCHA 4B17A 2GT1A 2Y93A 1Q7EA 4F45A 4DJAA 1GG9A 4KVAA 1LDNA 3RF7A 2ZIGA 4JZYA 1TLLA 4H59A 1QS0B 4MQBA 5DTJA 4DGQA 2VTEA 3RSLA 1OLOA 2BGUA 2Q3LA 1P0MA 3RTBA 5ES4B 1FMTA 2CMKA 2ZFUA 3DS8A 2P2NA 3BQMB 1TL7C 3JAWA 3RFUA 4DMGA 3GLFE 2N9UA 2O8FB 4TXMA 2ZSAA 4CJXA 4N3AA 1DBRA 5LXTA 4YHBA 3K15A 1JH9A 4YCBA 1FS5A 2HK6A 4TXNA 3TNFA 1KYIA 2P2GA 1OBOA 2VK8A 2HSDA 2ID4A 2RK3A 3DL4A 3K0AB 1CDEA 3PX3A 2R47A 2XUAA 3ENNA 1PJ8A 1WXIA 4IP0A 3W3ZB 3JAWB 2G0NA 4OATA 5BN3A 3QY9A 3TNLA 4JT4A 3OKCA 1SKYB 1SIBE 1O6ZA 3FB4A 3PWZA 4AJ4A 3V1KA 1J2TA 2D54A 1B15A 1DL5A 4XB6B 4IIVA 1T1IA 4J0GA 5J5VA 4HSEA 4B3IA 4NJEA 2Z0MA 2JFXA 3RIHA 3TLXA 1QIGA 2FWPA 4GRDA 4CN8A 1EVZA 4IY1A 4LVOA 3W9YA 5BN3B 5IHPA 4YJ3F 4RM3A 2NT4A 4UTXA 2YHBA 3GRUA 2EIXA 1UOEA 3IRUA 3P2KA 4OUDB 4WXMA 5TDHA 2B1RA 5FBVB 3GLIE 5JU6A 3GJYA 2XDAA 4MUBA 1ESNA 1GZSA 4MV6A 2MU1A 2YVKA 4PZUA 2DUUA 4ITUA 4RTMA 1N0IA 2R7AA 1OB2A 4KOEC 1BHO1 1JAHA 4YN3A 5KTSA 4LYEA 2FOXA 1WUYA 1Y81A 1NLUA 5JCJA 4CKBB 3KSUA 4JIMA 5KNCH 3K9FC 2A8YA 3AVPA 2FSHA 1RS0A 3PYMA 4UW9A 3QE9Y 3AG6A 4HLQB 4C4XA 4PM4A 4RTNA 1KJ9A 4C4PA 1NVEA 4GEGA 4PYRA 2YUTA 2WSSA 3OT4A 4D9FA 1M6VA 2I87A 4GX5A 3HB4X 4M76B 4RGYA 3QEBZ 4L5YA 3ADKA 3WL3A 4OJMX 2HXSA 3OP4A 1JIIA 3N8IA 5CFNA 2GFIA 5KMGA 2FMIA 2AG8A 3SFTA 4KQGA 2JHFA 2FN9A 5SZJA 3PQ7A 4F06A 5C2JB 1GG2A 1Z26A 2Q21A 3AUYA 3LRPA 3QK7A 2LTAA 2J9YB 5KBYA 2ZRFA 4G36A 1NW9B 4EA7A 2DETA 5HNKA 1ODKA 1Q1ZA 4NOLA 2POQX 3EIOA 2PXAA 3IE1A 4ND4A 3JQ7A 3LDAA 5CB8A 2ZJ0A 1OWNA 2EWWA 2FZEA 3MUFA 2FXIA 3URMA 1UPAA 4TRMA 5KYGA 5C4MA 1MAVA 1BO6A 2OV1A 3ZQKA 4ZCPA 1RVDA 1AZLA 1SC1A 3D1JA 4BFLA 2VYNA 3ZY4A 5J1SB 4B2LA 5EIFA 1ZRSA 2I8LA 2YHSA 3KZOA 4YWHA 4CTNA 2QLTA 4LNUB 3DMTC 3BRSA 4AW9A 2A6PA 3FJ1A 3N58A 4FGLA 4G8BA 4M1ZA 5F12A 5LUBA 1JQEA 1ZD9A 4GLOA 4JENA 4NG5A 4R2XA 5KYWB 5LYJF 1SVWA 3B6JA 4L0DA 2WBLC 5JMPA 3ZGVA 5EJ6A 1YR1A 5KVQA 1KJQA 2NU6A 2PLWA 4ZC8A 5KO2A 4UBOA 3T1HB 1Z37A 3COWA 1W59A 2XTZA 1UOOA 3F5FA 4GMDA 3F2IA 5EJFA 7MHTA 2ZANA 3NNDA 3SPXA 3TGLA 3GBVA 3EA5A 3HBLA 1BNCA 3EMDA 4RVOA 1RTTA 4YMVA 3NJ8A 4LZWA 1RQNA 1JIQA 3E5HA 1OAOC 4COKA 4CT4B 2G72A 5DKFA 4ZHQF 1DADA 3HKEA 3HCPA 4EFDA 2HK7A 2LP4Y 4P3XA 4FDLA 2YN4A 1JEEA 3AG5A 2INGX 1PR0A 1HFJA 2QMUA 1VJGA 1V1RA 2O3QA 1E7WA 1JG2A 2JFOA 4ZT3A 9ABPA 1F7UA 1JHZA 1WXGA 1HEUA 4RL4A 3UT6A 3HKEB 4CEIA 4E12A 1YNSA 2Z57A 3ERCA 2J67A 1KAGA 3SYMA 3ZVNA 3HM9A 3QITA 2GK4A 4IFBA 5IM5A 4S35A 2UZ0A 1NP6A 5EHGA 4U63A 2GEDA 1PJ3A 3ZJUA 1ZJ6A 5C32A 3M49A 4B7CA 4PZLA 3B85A 4Q02A 4DA7A 5AUOB 4RAOA 3DZ6B 2ZSHA 4GDMA 2QR5A 4Y2HA 1UZNA 3LNCA 3D2CA 4QAJA 3JRNA 4TYMA 1MQSA 4UNIA 1MC4A 2MSLA 5AVTA 1S0UA 3LD9A 3OJWA 1R9MA 2FW0A 2WD8A 3U0BA 1Q0UA 1CJMA 1GY8A 4C0XA 3SIRA 2FF5A 1ZISA 2JFGA 2IW3A 4XX1A 2IH2A 3T1YB 2IS6A 2RGNA 1QQ7A 1WB6A 3EIFA 4XFJA 3FD8A 1Y9ZA 3CUWA 3PE3A 4TL9A 3RYFA 4M36A 4A0GA 1K8ZB 3GGCA 3GELA 1OF1A 4AY4A 1CEYA 3KJQA 4ARUA 4R05A 2XHEA 3U44B 2AUTA 1SK8A 5IN5A 5T57A 4YEDA 1LPBB 1R4NB 4GGMX 1J70A 2BGGA 4M1WA 2V58A 2V7GA 4MI6A 5TMPA 5G1PA 1GTSA 2YJNA 4RHXA 4TWRA 5F73A 4H3HB 3G8BA 4P08A 3A9TA 2VG8A 1D7OA 3TX6A 3N86A 5KWSA 1M1NA 4Q12A 3FDXA 2JBAB 2YV5A 4XLLA 1WKCA 1LPMA 3H6GA 3BPSA 2QVZX 1MFPA 2JFUA 5BV0A 1NUTA 4UDNA 1QO0A 3TGWA 2OUIA 2DEUA 1ZJ4A 2PH5A 2FMXA 1F8UA 3P2OA 1JLKA 4L8GA 5JQGB 4WY8A 2PX8A 3OLWA 3CJTA 4IVQA 1QLJA 3ZLBA 4HZIA 2ZBVA 1HLDA 4JJAA 5C1DA 5H82A 4K1LA 1M1NB 1X7XB 4YJHB 3AR9A 1IZ9A 2A57A 4PINA 1ZKMA 2P4EA 3ND8A 3L49A 3N0VA 3SP1A 2K6GA 1DKPA 2OFOA 2PTGA 2OUKA 2O2YA 2PRIA 2ZUDA 3N2EA 3N2YA 4L73A 4TQ9A 2BZGA 1MO3A 2C8LA 1AMOA 4GT1A 3OTQA 4HDKA 3QOFA 3CKLA 5AH0A 4Y1FA 1E0DA 1YIAA 1ZC4A 1KZ1A 3I8SA 5EP4A 3AQ4A 2XXJA 4EVQA 4FINA 5JD5A 4MRAA 3K70B 1QGDA 1P72A 3MD0A 2XXBA 4YASA 4B8ZA 3V34A 1T9HA 1DIAA 5M29A 3H9BA 1OFUA 1Y63A 3ISJA 4FGSA 1MXFA 4MW9A 5FLEX 1HPLA 2SKDA 5KCMA 4LFCB 5KWEA 3Q3EA 4M4SA 1KEPA 3UK0A 1PDVA 2E0IA 2KM1A 3USCS 5DOVA 5KTTA 1F8GA 5TS3A 1W1UA 3W6PA 3IVCA 1EGAA 2PBRA 3D3QA 3JQ9A 5F2NA 3HZHA 2Z9DA 3U37A 2IDJA 1VMEA 4EW1A 1QCCA 2R48A 2R68A 3P0FA 3GJ8A 4XW2A 3ABRB 2VSOA 3SC2B 4BJHB 1RHRA 1AGPA 1UBEA 1G8JA 2ADFA 4BTLA 4GZLA 1NW6A 4KW7A 4NULA 1C2TA 1HDCA 4QICA 2I2FA 3UW3A 1FBTA 2I6FA 3RJ5A 3GUHA 2YXLA 5I8WA 3G5MA 1OBVA 4O4JA 3V55A 5EKUA 1BJRE 1ULAA 1GUFA 1QDLB 1Y3BE 2ADOA 3QPCA 4GOMD 4EHAA 2AHOA 4ZVQA 2VPXA 1DQRA 4KMRA 3ZU4A 2CJFA 2Q4RA 1A2KC 2OB1A 3WNCA 1UFQA 2DVMA 3GMDA 2GVDC 6NULA 2CLIB 2PX2A 4NAUA 1E4VA 4RVGA 4QARA 2EJUA 2QHXA 3DHYA 3GHYA 4RD1A 3BWEA 3IEKA 3TQSA 5ITWA 1Z83A 4IGFA 4MXDA 2WZDA 1JR2A 4O4JB 4WLEA 5DNDA 4Q7JB 5LB2A 1L8LA 2QTMA 2WK1A 3WB1A 4JI1B 1J9EA 4FEEA 4QT0A 2D7CA 2V9ZA 4IXMA 3ZPXA 2XMPA 2M1XA 2PXHA 2OA0A 5KYUA 1OXVA 2ZOSA 2HYIC 5K8IA 4C22A 2ZRCA 2WSIA 1VCIA 1W4CA 4KX5A 4US0R 3UJNA 3WFIA 1K86A 5BOVA 4HDNA 1F51E 4JUFA 1I3KA 4PZYA 5IRCD 1ISHA 5IU6A 1G6OA 3DH0A 4EYEA 2NUAB 4KFRA 4GQIA 3WGJA 4KSYA 4DJFC 2JB9A 3JATA 2FPWA 4P54A 3WRXC 5JS7A 1DAFA 3I5YA 4XXHA 3NH9A 3L8FA 5DTIA 1KAMA 2NMVA 2P2DA 4P2BA 4WH0A 3RUPA 1J2YA 2J59A 1FNCA 2FETA 3KQVA 2WIBA 2IIQA 5E8RA 4KWTA 4RGBA 2K7ZA 3P1JA 3C41J 4JP8A 1MENA 2O5RA 5F5XA 1SFRA 1XTVA 1X1AA 3PDCA 5UKDA 1E59A 1QE5A 4QIHA 3U49A 4UTVA 1XRSB 4PU0A 4YI3A 4NSNA 1U2TA 2Y1GA 3ZE7A 3MTIA 3VHRA 1E92A 2FWRA 4TKUB 5JXWA 2WVAA 2ZUTA 1ENZA 1Z06A 2R8RA 3REFA 1X8KA 3I5UA 3S2GA 4JYBA 4J4BA 3ZVRA 4WLOA 3EH2A 4ETMA 2C5SA 2Y9MB 4ZCQA 1BXKA 2JJ2A 3DMHA 3E23A 1S4QA 2IYWA 3I73A 3L5OA 3NOVA 4HUQB 2HIMA 4KACA 4YJ3A 4ZTBA 5U1PA 5K6TA 5EWLA 1BE6A 1KH1A 2OZEA 2XB4A 2DM6A 2P2CA 4YREA 3EDCA 1X0VA 2HJHA 3AKDA 1N9GB 2PNFA 2X2OA 2OORA 1L4EA 1JDVA 2RAVA 3AONB 4C30A 4YLYA 1ZW6A 1VXOA 4RETA 1IN8A 1QV7A 5DYWA 1ETHA 4QNMA 4YJ3B 1IU9A 4Y9TA 1PFVA 1T8SA 5EWLB 1SQ0A 3ZY3A 4ZJZA 5JNLA 1ECBA 2P4QA 4MGHA 2O2CA 3IAM1 3NKFA 3LC2O 5CK4A 1HDIA 3LLCA 4WE3A 4HQRA 1GADO 1XE3A 1IQ0A 2XWJI 3NHRA 4HB0A 4JBYA 5HMLA 3U2QA 4NABA 1I3MA 4XE5A 2BE9A 2FI1A 2VHCA 4CETA 3UKDA 2VHXA 2QAGA 3WLKX 1RBMA 3M1AA 5GJBA 1I4LD 2EP7A 4E6EA 5JECA 2VDOB 5JS6A 3ZDFA 2W6ZA 3ONEA 4DV0B 5B57C 5LNK6 1IONA 2Q5CA 1EVLA 3TCNA 4QM7A 3R5TA 3PC8A 4YP5A 3ANYB 4DLLA 1ZN7A 1W2HA 3FPAA 3LDGA 3NYRA 1QYCA 3NWPA 3JQFA 5A5FA 4JMPA 4M1OA 2PFKA 1GKYA 1LDMA 5EAIA 1JYEA 3SG0A 4BX9A 4ESEA 1QVVA 3H5TA 4AKIA 2FZLA 2WLTA 3C7CB 1JQJC 2QX6A 3QVVA 5JE8A 4I5FA 5CM2Z 4Q3EA 4XWWA 3OY2A 4JI2B 3U1TA 3IWDB 4B3BA 5AM4A 4GS5A 5EXDA 4A5SA 1KP3A 3AGPA 3PNOA 2VAXA 3D9QX 1EU1A 1E1LA 4MR7A 3EVFA 1ESEA 1P4GA 2OPBA 4G63A 4B6OA 1GYPA 4ND8A 5CYGA 3O8OB 3T5AA 1OFHA 5H16A 1JA9A 3GXOA 4KMOA 2QUAA 5EE0A 3DNPA 3MJ4A 5IKOA 4Z1OA 4GI7A 1NBWB 4QEZA 5KQPA 3SC6A 2UVQA 1DBSA 2QPTA 3RUDA 3UBMA 5CYOA 1KZ9A 3IKVA 1G38A 4MR7B 4H27A 4NFYA 1JYFA 4BFVA 3F98A 3AMVA 4ND8B 3H65A 3O6VA 3M5PA 3BE6A 3T7IA 1CC1S 3PXBA 1FVXA 2YWGA 1JR3E 3LTEA 2PE5A 2R62A 5LYJB 1CJKC 1ODLA 3OHMA 4A1FA 4C4TA 1D6JA 4XWAA 5TARA 4Q9NA 3DEJA 3NRBA 2Q3MA 3OX1A 4ZHQA 3OQOA 1G2QA 1FP6A 1U5CA 3I9JA 5FKJA 2HY7A 1GAWA 4RV9A 2AYXA 1QAOA 2H8KA 1QTQA 1U8CB 2G1JA 4WLVA 5IBQA 4TS1A 2G8NA 2X5NA 1L1RA 2VNKA 4TUYA 2A88A 3MGBA 5CPBA 3L8MA 5EA2A 5L3VA 3JSAA 1FFDA 3E15A 2VK2A 2PGAA