1H94A

Complex of active mutant (s215->c) of glucose 6-phosphate dehydrogenase from l.mesenteroides with coenzyme nad
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDSIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLCEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEAQEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
publication title Nadp+ and Nad+ Binding to the Dual Coenzyme Specific Enzyme Leuconostoc Mesenteroides Glucose 6-Phosphate Dehydrogenase: Different Interdomain Hinge Angles are Seen in Different Binary and Ternary Complexes
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase
total genus 168
structure length 485
sequence length 485
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h94A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h94A01
4LVUA 3IL2A 1PJQA 5TRTA 4DLLA 1OBFO 4BNYA 1OOEA 1X14A 1VL6A 3NTQA 2IRWA 1FDVA 4IZHA 3GR6A 5A5FA 3GFGA 2PNFA 3JQFA 3NYWA 3FBGA 1UP6A 1F06A 3MOIA 2PR2A 3CPSA 1ZW1A 1U3TA 2D1YA 1O89A 4KOAA 2FR8A 4OSPA 1N7GA 1PZFA 1DHRA 2VZ8A 3JYOA 4Y8VA 3Q6IA 4BMSA 3QVXA 4U7WA 4YDRA 1U4OA 4ZQBA 5EQFA 1PGNA 5T5QA 2B4QA 3G49A 4I8XA 1P1HA 1V9LA 3DBHA 3AOEC 3PHHA 5BR7A 3KLPX 3H5RA 4ONEA 4J9VA 3WMWA 3TFOA 1VM6A 5TNXA 1A5ZA 1X7DA 1KIFA 3V2GA 3VH4A 4RVSA 1U7TA 2AEMA 3DBRA 1I3MA 1MG0A 3KRTA 4XDYA 3GG2A 5JYAA 4PVCA 1GY8A 2I76A 1BXKA 4GSLA 3I3OA 5K6AC 1TVEA 4OMUA 5LCXA 1IY8A 1VSUA 3C8MA 1JN0A 5I8ZA 1T26A 2VWQA 1B3RA 4OHUA 4BO7A 2X9VA 5LDGA 2QHXA 1DXYA 3LSYA 1XDWA 3G0OA 2JCXA 3CKYA 3IAHA 3IUSA 2PK3A 3QRWA 4J7XA 4MVJF 2POQX 2WYVA 4U6SA 1E3JA 2QIOA 3U09A 5JCXA 1PJCA 4GKVA 1I8TA 4D43A 2EP5A 1JAYA 4UVEA 4EEXA 4P8RA 2OP1A 3FTNA 3VOSA 4G5HA 4RVGA 1T2DA 2Z1MA 1JAXA 1W4ZA 3KYCA 5I7EA 2EJWA 4B3HA 2X23A 2B37A 4PCVA 3FCOA 3E9MA 4D44A 2J6IA 1T4BA 1D4FA 3U4HA 4Q3CA 4B4UA 1E1LA 1N1EA 1VRWA 4QQRA 1H93A 3KO8A 1C1DA 4CM5A 2UV8A 3WG9A 3JQ9C 2ZTUA 3AU8A 4CM7A 3UKOA 5AXAA 4BNIA 4JJFA 2W2KA 3HE3A 4FC7A 4QFCA 4IIUA 3K96A 9LDTA 1PQPA 3UVEA 4MVJM 3RD5A 2HO5A 1M66A 4R41A 3H5AA 4GLOA 3NEPX 1Q1NA 1NNUA 3PI7A 2VHVA 4YJFB 3I6QA 3KYDB 4KTVE 4GGOA 3H65A 2C07A 4FFOA 5FEUA 1U2DA 3F4LA 1CEQA 4KDEA 2VTDA 4OXYA 1GV1A 3EW7A 4MP8A 1IUKA 2IXAA 3JD4A 3KVOA 3ZU3A 3H9GA 4O1MA 3H6KA 1NPTO 1J49A 1LLDA 1R4MA 1T2EA 1U28A 4QFDA 4XJTA 3WB9A 3NT5A 4BKUA 3AUUA 3N74A 3RWBA 4IY1A 2Y1DA 3GG9A 2NADA 3ZHBA 3D3WB 2VUUA 4R3NA 3EZLA 3TPCA 5HS4A 1M75A 1GFSA 4CUZA 1A7KA 4D3FA 2Q22A 2UYYA 3RJ5A 4YJHA 1OI7A 3RC2A 3ZN2A 4BMNA 2H1SA 4NJOA 1LLCA 1PJ3A 4BNNA 3OBBA 3ZGYA 1HDZA 3SVTA 3ZWMA 1X15A 1DEHA 4FJ1A 5A06A 3RASA 5C7LO 3K92A 3WNQA 1VC2A 5G4KA 5HRUA 3K6JA 4Y6SA 1N1GA 3U5TA 2QQ5A 1LDNA 1C1XB 1YBVA 3QLJA 4BB5A 2ZJ1A 2EG9A 3EVNA 2YDXA 3L07A 3DQPA 4NZ9A 4BNGA 4EEZA 2JCVA 2RHRA 4HP8A 4H7PA 1O5IA 2GZ2A 1ARZA 1EBFA 1U7HA 3JQFC 4WLOA 1GCUA 3IOYA 4MVJE 2CD9A 5A5EA 2HK8A 4FBGA 1YWGO 1EVYA 1NYTA 5L53A 4DLBA 4A27A 2R2GA 1ISGA 4PLVA 3SEFA 3AFNA 1FDUA 5DBFA 1UXIA 3I9KA 1ZSYA 3TQHA 5JS6A 1ISIA 3OEWA 3JQAA 4WKGA 2PKQP 1BMDA 3GDGA 4CMIB 1I32A 1WLYA 2X5OA 3BMQB 1YJ8A 5ITVA 3I9MA 2NTVA 3F1KA 2DUUA 4A03A 1NP3A 4PG6A 2HCTA 4BOYA 3PTZA 1YL6A 3SJ7A 2VRCA 3NTRA 1NPDA 3BYZA 4OGWA 4HNHA 3CSDA 4XIJA 4FFPA 2YHUA 3RFVA 5IXSA 4OJNA 4NK4A 4AICA 1BDMA 3PWKA 1B15A 2NVUA 5TIIA 3ZU4A 1TB4A 4GMFA 3WGZA 5U1PA 1LSOA 4K9DA 2H9IA 1XEAA 2YHIA 4AG3A 4CM4A 4IXTA 3K2EA 4Z3DA 5A04A 1YBMA 2W4QA 4J1TA 3X2FA 1W6UA 2DTEA 1RM5A 5I9NA 2CVOA 3HDJA 2QZZA 3PQFA 1V3TA 3QQPA 4GH5A 4JX8A 4P4NA 2FRDA 3GN2A 4WNCA 1UUFA 1E6UA 4A10A 3OQBA 1B0AA 3GVIA 1MP0A 1UZLA 3O38A 1I33A 4NJMA 3VH1A 3HFSA 2F1KA 1E5QA 1T4DA 2FR1A 4UUMA 1YL5A 3SLGA 1GQYA 4YAJA 5KJEA 4DMLA 2ZB3A 1FDWA 5CDGA 4RQUA 5JC8A 2Q1WA 3GOHA 4GMGA 3ABIA 4WNIA 2YUTA 1IL0A 3ZWPA 1J6UA 1H5QA 2CNBA 1IOLA 3LF1A 2PTGA 3RFXA 3FNHA 5TJHA 1QYDA 5KVQA 3R3SA 5BT9A 4NDNE 2AW5A 5L51A 2OXIA 3UGKA 1ENOA 1R16A 2CF5A 3PZBA 4ZQEA 1ID1A 2VYVA 4N5LA 3NGLA 4NBTA 1JVBA 3D1LA 4PLGA 2Q2VA 3ADPA 2SCUA 2I6TA 1MX3A 4WECA 2HLPA 3OA0A 2HMSA 3DOOA 1GEEA 3EVTA 1HKUA 2AA3A 2ZKLA 3CIFA 2Q50A 4EI2A 1DDOA 1U3VA 4FS3A 1ZJZA 5F1KA 4ZU3A 1GQ2A 3TOZA 4OXNA 3K31A 4EJ6A 1UXGA 1XU7A 3RI3A 2JD2A 3GAFA 4AJ4A 2EP7A 2BMAA 3BXXA 1K6IA 3KEOA 1UXKA 4FQ8A 1B8UA 2VNAA 3VAZA 1LNQA 1OMOA 4HFRA 3V2UA 3WYCA 1ONOA 3TZKA 1LSJA 2Y0DA 1P9LA 4U6QA 3PYXA 1E7RA 4BMVA 1UZNA 4AVYA 2NNLD 4LCEA 1QMGA 1KYQA 1PGQA 8LDHA 4YXFA 5DN9A 1FXSA 1ZZEA 2V6BA 4BO5A 4D42A 4BGUA 1JLLA 3H3JA 3PQDA 2OP0A 1E1KA 1E5LA 4BGVA 3E5MA 1R66A 5JO9A 2PV7A 2ZTLA 1DHTA 2NSDA 3OMLA 3KM0A 1TT5A 3GRPA 3GUCA 5BSFA 5T6BA 4NFHA 2D2IA 1CYDA 3QWHA 3ZHXA 1Y8RB 4J9UE 1HWYA 1KEPA 3F6YA 5DNAA 3HDYA 1PS8A 5C37A 4EDFA 1V8BA 3A06A 3PDJA 3W6ZA 5A9SA 4MIEA 1MXFA 2JL1A 3RAJA 1PR3A 4PLWA 5L40A 2B35A 1D8AA 4NFSA 3KYBA 1I5RA 5F3RA 1DRUA 1K2WA 1ENPA 3QWFA 1UDAA 1IHYA 4JGBA 1XIVA 2Y68A 5IDWA 4YT8A 1NM5A 2R00A 2DBVO 1ULUA 3OJLA 4L4XA 1SCUA 1UH5A 1W0CA 1KS9A 2FWMX 3A1NA 1PEDA 4RVDA 5EL0A 2NU7A 2D8AA 4PLZA 1ZK4A 4BO1A 5JYEA 5K9ZA 3DZHA 4MKRA 5I9LA 5CP8A 2GZ3A 3V8BA 3WYEA 2X0RA 3INGA 4WUVA 1HRDA 4PG5A 2QZ9A 3Q2KA 4BNJA 5EN4A 4NPCA 5F21A 1QV7A 3FSRA 3STHA 4D79A 3LC7O 2UVDA 4PLPA 2DLDA 3VKVA 3ETEA 3ICCA 3RUEA 4EZBA 1MFPA 3GPIA 3HWRA 3A9WA 1GUZA 1WXDA 3VTZA 2V6GA 3F5SA 3CZMA 1ISHA 4MVJG 4XYLA 1X7GA 1N2SA 2OL4A 1KY4A 2OUIA 4UREA 1U5CA 1Q7GA 1DFHA 3HN2A 1KETA 1E3SA 4I9NA 1XLTA 3LDHA 2NLOA 5TQVA 3SC4A 4Y67A 2PKQO 3MJTA 3JYLA 4EBFA 1Y8QA 3FN4A 4Q3BA 5KIAA 1R0LA 3LK7A 3INTA 4CM6A 2VTEA 4FSHA 1RKXA 4XQGA 2R6JA 2ET6A 2VHZA 4BNVA 4E5PA 1MGOA 4QTZA 3ZZNA 2QX7A 5JNLA 1HXHA 4HX5A 4IJUA 1Y5RA 2TMGA 1GAEO 4CQLB 4DC1A 5KTKA 4IQ8A 4TVBA 4D7AA 3C3XA 5H81A 3KZVA 4IPTA 4R1TA 3WICA 1R37A 4DA9A 2B5WA 2AQKA 5JAZA 4YWJA 4IDFA 4RO0A 4DRYA 5IAAA 4DIBA 1E92A 1PZGA 3FTPA 1D1TA 3DZBA 1QP8A 5L45A 3H5NA 4YBZA 4LVCA 4F6LA 1UXJA 2VOJA 2Y93A 5IG2A 3AM3A 1H6CA 3AI3A 1HZZA 2QRKA 4XRRA 5EMHA 3WQSB 1LUAA 4P22A 4MPDA 2UAGA 3T7EA 1DSSG 1CETA 3S2GA 3MTGA 3BTSA 3CXRA 3RUDA 2VNSA 1WPQA 4H16A 4DREA 1VKNA 5AXCA 3NDRA 4R51A 2H63A 3GNQA 2CF6A 4CMCA 4WCDA 3LVFO 3E1KA 4GX5A 5HM8A 1LDGA 3WGGA 4WCFB 4PN3A 3RC1A 4Z0HO 3M1LA 3WTCA 1H2HA 3DAPA 4A7PA 3I5MA 4DC0A 4BV8A 5G0VA 1H94A 1SB8A 3CMCO 1GV0A 1K6JA 1PGJA 4X54A 1P1JA 2WD8A 3WBFA 4IDGA 1T2AA 1KY5A 1PIWA 1A7AA 4FDAA 1VJTA 3O8QB 4E13A 4U8GA 5F1OA 3I23A 1S6YA 1SOVA 1PL7A 5GMOA 3JQ8B 4FJ0A 3IUPA 4MVJD 3G1UA 5I9MA 4IMRA 1WDMA 4AJ2A 1CIVA 4XYEA 4YVFA 3ZWNA 3ZWYA 2XPCA 3MJ4A 5COAA 5HS6A 2Q3EA 2WD7A 4Z9XA 1KEUA 3K5PA 2BHLA 4FOSA 1SMKA 2D59A 5JDCA 3RCBA 3H8VA 3GA0A 3KHUA 3OIGA 1IZ0A 4QEDA 3K2BA 1IYZA 2G5CA 3L6EA 3PIDA 2V65A 3OA2A 2QYTA 4IXWA 4E0BA 3FD8A 1A9ZA 4S3MA 4A2CA 1GPJA 2X0IA 5JY6A 2JKVA 3ULKA 5JYFA 1DPGA 4YAKA 4XR9A 2AG5A 4DQVA 2D4AA 3LLSA 2EW8A 1VSVA 4IZIA 1VI2A 1W8DA 1ISFA 2Y99A 3FRJA 3GK3A 5GZ3A 2Y1OA 3GMSA 2R00C 4NMHA 3GPDG 4WLEA 2IZZA 2NU8A 1ZXLA 1B8PA 1LSUA 3PYLA 2QRLA 4AJEA 1R4NB 2E37A 1GUFA 1PJ4A 3CZRA 4HUJA 3G17A 4J90A 4GLLA 3Q9UA 3S2EA 3OECA 1HE3A 5G0UA 1SC6A 4MDHA 3ROQA 4E2YA 4EUFA 5G2OA 3GVHA 2VUTA 1YVEI 4WJZA 4BGIA 4BQRA 5T57A 4MJLA 4AJHA 3FPCA 4E5YA 4OOFA 2QG4A 3ASVA 4GX1A 5TS3A 2H5LA 4QT0A 3B1JA 1MFZA 1GZ6A 4UVHA 1E7QA 4CM9D 5B4TA 3IP3A 1U4SA 3IC5A 1E1NA 2FSSA 4GWGA 4ZGWA 1FMCA 1T25A 1NAHA 1ONNA 2EKQA 2OMEA 4PG7A 5G0SA 4RVHA 3KV3O 4BHTA 3AY6A 2NVWA 2PZJA 4NH4A 4FIZA 4YJGB 3WSVA 1MB4A 1DIAA 3AFMA 4IM7A 1MV8A 4Z0PA 1HT0A 3PRJA 5CG1A 4CR7A 1BW9B 3MJSA 2VQ3A 2IXBA 2WMDA 4W7IA 3AI2A 5TF4A 4Y6PA 5KKAA 4YR9A 4YAGA 2XOXA 1PQUA 5CEJA 5U9CA 3R1IA 3S1LA 2J3KA 4RPGA 1IPEA 3GHHA 4HY3A 4IMPA 4AJNA 4P38A 4XRGA 5T64A 4MIYA 1A27A 4IUYA 3EUWA 4CUJA 3ZCXA 3ZNPA 2YYYA 2HSDA 5JDIC 1EDZA 1LI4A 4J7UA 4KTTE 5KVSA 1P0CA 2BH9A 5DOZA 1GQQA 1HL3A 4TRMA 5L7YA 3A4VA 1EVZA 2FMUA 1UP4A 2DT5A 4DBZA 2GSDA 4LMRA 2Q1SA 5HWSA 1LDBA 3MWDB 3WGYA 2HQ1A 3MJVA 2VWPA 4ZQHA 4NHEA 1K89A 3FNEA 4DIOA 1RYEA 1U3WA 4QX6A 3EDMA 4Y6RA 4ZD6A 3S8MA 4QSMA 1QSGA 4DUPA 2NTJA 4DVJA 2WYUA 4WEQA 1U9JA 5DBGA 3CEAA 1DC3A 2E6UX 4G2NA 1V3UA 1K6XA 5A3JA 1ZO8A 1HZJA 4UUOA 3ZH2A 1RYDA 2OZPA 1K5HA 4LW8A 3VZSA 1DC4A 4K6FA 3BMCA 4R1UA 1YS4A 3ITKA 4LSWA 1AUPA 3QWBA 3EYWA 3TN7A 3BMOA 1GEGA 4WEOA 1E6EA 3K73O 4CLDA 5H82A 1HDRA 4LRSB 4CL3A 3L0DA 2FHSA 3DOCA 3D5TA 3LU1A 5IF3A 2Y1EA 5B4VA 3QHAA 3V1TC 2OOSA 3GN1A 1VJ0A 4QO8A 1IB6A 2JCYA 3JYNA 2ZTVA 2EGHA 3GNTA 4CQMB 4ALMA 5JAQA 1CERA 1GADO 1XA0A 1U2GA 4QXMA 5L3ZA 1O9BA 2VRBA 4URFA 2XAAA 5HA5A 4JCOA 1IE3A 1E7YA 3ONFA 1PZEA 3ETGA 1QKIA 2FPPA 4N54A 3WLFA 3DWFA 1L7DA 4I9HA 5DF1A 3DHYA 4KQXA 2P9CA 5KJ6A 4XQCA 1EEHA 5BNFA 5JDCC 3PDUA 1EUDA 2C29D 1R15A 4LGVA 1CQIA 4P4LA 5DBIA 1LC3A 2AXQA 3H7AA 3NT4A 4IDAA 1ML3A 1Y7TA 4JJIA 5JO0A 2V6MA 1E7SA 4YQYA 4B3JA 1B26A 3MEQA 4J0EA 4YRDA 1SEPA 3TZCA 4TMFA 1DC6A 4YT2A 3LQFA 4DMMA 1UAYA 1BXGB 1EUCA 5G0WA 4QUKA 1NBOA 2PKRA 2EKLA 4RLSA 5TX7A 4GAEA 3M6IA 3DAFA 4L4RA 4PZEA 4Z0TA 4DYDA 1ADBA 1C0PA 3TRIA 4D0RA 2GF2A 3W6UA 1I3LA 5CG2A 1VJ1A 3GZNB 4Q3NA 3RVDA 3ZWWA 1JKJA 4A0SA 3GZ4A 2DKNA 4JJGA 4GL4A 2NUAA 3GQVA 3PXXA 1NPYA 4CPDA 2YV2A 4ALLA 2WTBA 3P5SA 3QVSA 1YQDA 4GKBA 4NFYA 3EY4A 3DMYA 1E6WA 4Y9DA 4JN6B 4ITUA 4P4GA 5L4LA 2BD0A 5CEFA 4L9RA 1JQBA 4CLOA 2EERA 4XEHA 5JMWA 1BHSA 2ILTA 4YA6A 4YCAA 2GLXA 4ND1A 5JAIA 2PH3A 3PFFA 2GN6A 4E32A 3Q0EA 1PU2A 3I9NA 1PS9A 4E5NA 3PGXA 1KEVA 4W99A 5L9AA 3WGTA 4IINA 1NAIA 2IODA 2GNAA 3JQGB 5ILOA 4BV9A 1NQ5A 1LRKA 1QLHA 1T1RA 1OC4A 1PJTA 5JAMA 4M49A 4NG5A 1BDBA 3E03A 2I3GA 2Y67A 1ZCJA 4XYGA 4BNXA 3KSDO 2DM6A 2C20A 5AOVA 2OORA 4XWYA 4B4WA 1WAMA 4L8VA 4O63O 2ZATA 3IQDB 3F5QA 3OH8A 1G0OA 2OGUA 3IIEA 3OEYA 1YDEA 4AJIA 1AHHA 1E3WB 3ENNA 4IDEA 2B4RO 3PJEA 4W7HA 2GYYA 2EHDA 2C54A 4J1SA 4O59O 2C2YA 5JXWA 3C24A 3RC9A 1I2BA 1UJMA 2WSBA 1R0SA 4BKPA 1X13A 1L7EA 3R6DA 4K1LA 4M86A 4OQYA 4CJXA 4EUEA 2HUNA 2I9PA 1EVIA 1YOVA 2WWRA 3ANMA 3QV1A 1O8CA 4WLFA 2PFGA 3C7CB 3RUIA 4HXYA 3ZWBA 2BFOA 4HFJA 4B7XA 1EFKA 4C7JA 1WZEA 1LC0A 1ZEJA 2FN7A 2FY8A 1JDJA 3ANLA 3AM4A 4ROSA 4PG4A 5KJCA 5KNLA 2HJSA 5A05A 1EMDA 4NBUA 5HTOA 2XF8A 3HNPA 1ZKMA 4EUHA 3ROMA 2PLAA 3BMNB 5JE8A 4CLRB 3RSHA 3NKLA 4CM8B 3TDKA 5AQ1A 3ETDA 4IJWA 2IEBA 5G0TA 3WJAA 2XXBA 1PWZA 3ZV5A 5A02A 2AHRA 3OFSA 1FDTA 2Q2QA 2GPTA 3TFQA 2A35A 3VTFA 5BQFA 1QG6A 2C7VA 1Y9AA 2Y66A 4R9SA 5DOVA 3F4BA 3FR7A 3UCXA 4N5NA 3BTVA 2LDBA 3SJUA 4LRTB 2J5QA 2DQ4A 3RKUA 1G0NA 1PJBA 1UR5A 2Y0CA 2J8ZA 2BFMA 1XR3A 5BNTA 3OP4A 4XB2A 1EQ2A 3PJDA 3I9LA 5BSGA 4BO9A 4WPGA 4UAGA 4ZRNA 4WLUA 4XR4A 3P7MA 3AK4A 4TRJA 4XGKA 1PL6A 4TQGA 4EGFA 3QJ5A 3OJ0A 3DBLB 3DTTA 3FWNA 2FOIA 4AJOA 4W4TA 2J5RA 4E6PA 1G6KA 2CMDA 2FP4A 2Q46A 5T67A 4BS9A 5ADHA 5U4QA 3VPHA 4W9NA 5MGBA 4IBOA 4NK5A 2HRZA 2PZMA 3AWDA 1I2ZA 4E33A 1X1EA 3C85A 1WWKA 3ZW8A 1Z6ZA 3IKTA 4FJ2A 1GZ3A 2ZB8A 2DPHA 1NTOA 4L73A 2G1UA 4AJ1A 3RU9A 2Z1NA 4JNKA 4R1SA 2P9GA 3ON5A 5TC4A 9LDBA 2JFFA 1KERA 3VKUA 1U5AA 3MOGA 5C7OO 2RBEA 1P33A 1EE9A 1EE2A 1NHWA 3D7LA 4DYVA 1QXSA 2UDPA 5L4NA 4RPJA 3TZHA 2WYWA 3GRKA 4HBGA 4S1VA 1F0YA 3UHAA 1VKOA 4BNKA 5FI3A 3VPSA 4XIYA 1LLUA 1GYQA 4WOKA 2I99A 3FNGA 1NFFA 1NASA 5B4UA 3T7CA 3LT2A 3I1JA 4U0KA 2Z95A 4IQ0A 3H2SA 3PGJA 3UCEA 3BHMA 2E82A 4FOOA 3HQ4O 1IZ9A 1ZK3A 2OO5A 5CEEA 3OIDA 4NI5A 2DVMA 2Q99A 3WTBA 4RPKA 2VT3A 1K0UA 5J23A 4D3SA 4Q3EA 2BLLA 1LX6A 2GN9A 4ILKA 1M76A 2J5KA 1JWBB 3HB5X 3H9EO 3Q9NA 2X86A 3ICPA 5THKA 3E6AA 3TNLA 1DIBA 4PZDA 3U9LA 4PLHA 4TKMA 2YJZA 3U4DA 3OETA 2VYND 1LQTA 1HE5A 1JTVA 1NVTA 3FI9A 1ZMOA 5I7SA 4HNGA 5AXBA 1NXQA 2CY0A 4PFJA 3PHGA 4XGNA 3ADOA 4WK6A 3DONA 1QV6A 4N5MA 3N58A 4BKOA 4LMPA 4YJFA 4LSMA 3UICA 3KYDA 1PGPA 2GRAA 4K26A 3JQAD 4XQ9A 3GLQA 1T2FA 3GEDA 3Q1LA 3GHYA 1MG5A 4XYBA 4CMKA 3JQ7B 5IN5A 4XYMA 3FPLA 4FFRA 2B36A 2HMTA 5IDXA 5EIOA 1ZH8A 3AUAA 5DP2A 4E2WA 4I5FA 3I83A 1GU7A 3MJCA 3AOGA 2VRCD 1NQOA 2Y05A 1E7MA 2DFDA 4J4HA 2EXXA 4J7CA 1EFLA 2DC1A 3D3WA 2AG8A 4JQCA 3PEFA 3O9ZA 5GZ6A 2FR0A 4UVDA 3GVPA 1GL3A 5EINA 4OAQA 4JBGA 1XG5A 3UFXA 2Q49A 1QYWA 3PVZA 4M55A 5JY1A 2O48X 3E8XA 4YACA 3ZV3A 1DOHA 3UW3A 1GUYA 4CMHA 1X7HA 3B1FA 4CODB 3M2PA 1P1IA 3RC7A 2VN8A 2GN8A 3JCZA 1NVGA 1CRWG 2HK9A 2PA3A 5JBIA 3NX4A 2G0TA 3JTMA 4G65A 2I3AA 2NQTA 1DIHA 3W1VA 1C1XA 4RCVA 4MVJH 3L4BC 2P4QA 5B12A 2J3HA 4GWKA 4D46A 5KCZA 3ENKA 4MVJA 3JQCA 3E9QA 3VH2A 3BAZA 3CUKA 1I2CA 2AQIA 3ORFA 1AXGA 1ZMTA 2YDYA 3LYLA 4ALJA 1I01A 2Z5LA 4CQMD 4TSKA 4MINA 1QORA 3FWZA 3ONEA 5CPFA 4YT5A 2BRUA 2YV3A 1SAYA 2IYOA 4DGSA 4EITA 5EESA 1WVGA 1YONA 3E9NA 2G82A 2YFQA 5ER9A 1SO8A 2IDZA 4RJTA 1MXHA 1GDHA 1RM0A 5IN4A 4RORA 3PJGA 5M6DA 1EK6A 2DTDA 3RUAA 4CMIA 3WGIA 2VYVD 2UUPA 5KJFA 4ZICA 1X0XA 3GGPA 4RDIA 3EGOA 4NIMA 1VE9A 5ITWA 5TJ9A 1DO8A 2BGMA 2J3IA 1J5PA 1Z7BA 4E5MA 1H9BA 4HWKA 4BB6A 1WMAA 3VZRA 4ZRMA 3DBHB 1H0KA 1DBVO 3TF5A 3ZI0A 1WZIA 3P2YA 4IDBA 1BG6A 4BO4A 5JDIA 3Q3CA 1Q2XA 3C7AA 1JWAB 3PP8A 1Y1PA 4W9NC 1HF3A 1GPDG 3AUSA 3P2OA 4R1NA 3DBRB 3DMTA 2DFVA 4GVLA 3RKRA 2HAEA 4DQUA 4AJLA 2PGDA 5AYVA 3MWEB 5G4LA 3WFJA 3WSWA 1M67A 1NX6A 3NUGA 4L74A 1XQ6A 5CHEA 4CM9A 4JK3A 2LDXA 4GPD1 1HYGA 1NR1A 2EV9A 5H83A 3NTOA 1U3UA 1XQ1A 1HETA 2JAHA 2OBYA 3QWIA 3ZWCA 4Z3KA 3TSCA 1LDEA 3V2HA 4ZQGA 1UXHA 1XKQA 4G81A 4U0JA 2ZCUA 4F6CA 2DPGA 5DDIP 2I67A 3R0IA 4Q39A 4IQGA 4J2HA 1PR9A 3I6IA 4YB8A 3HADA 5TT1A 3WXBA 2C0CA 4A26A 2CVQA 4FCCA 1Z7EA 5KVVA 3KYCB 3TOXA 3H2ZA 4B3IA 5CDUA 1P77A 2A92A 4IDCA 4B8ZA 5F5NA 3JD2A 1HDGO 5ICSA 4BVAA 1PWXA 4Z9YA 1O0SA 3E82A 4I5EA 4Z9FA 4J6FA 3IP1A 3GAZA 3GVCA 4YAEA 1PGOA 1UDCA 3RBXA 4BNLA 5FWNA 2D5CA 3MJEA 1UZMA 1C1DB 3JD1A 4E21A 4CLEA 3OQ1A 3T4EA 1BXZA 3RUFA 2G76A 1KEWA 5IDQA 2W2KB 1MC5A 1H6DA 4D0SA 1HLDA 5JLAA 3F47A 3HZZA 5KJ1A 1HE4A 3AY7A 3VPFA 3U4CA 4PRKA 3HN7A 4RZHA 3GF4A 3JV7A 4PRLA 1UAGA 3EC7A 1Q0HA 2DTXA 3KB6A 1VLLA 3PHLA 3TL2A 1O94A 4M8SA 1JKFA 3KUXA 1HLPA 1U8XX 2O3TA 5L7WA 4CMGA 5AXDA 4DBVO 2DBQA 1C14A 2JJYA 1R4MB 3GUYA 1N9GA 4UEJA 3QP9A 2VUSA 2BFAA 1PJSA 2O2YA 4XCVA 2Q4BA 3PHJA 2RH4A 1MLDA 1YB4A 3O4RA 1ORRA 4FGWA 5L7TA 4R68A 1P74A 4OM8A 3C7DB 3RROA 2CZCA 3CINA 2O3UA 4CMJA 5BNIA 3KXDA 1ZUD1 2P68A 3JQBA 2PD4A 4IJKA 4KUEA 4BO6A 2WDZA 4YJHB 3WBBA 3M2TA 3JD0A 1Z74A 4LN1A 3WYBA 3PLNA 2HJRA 4KUHA 2PY6A 1T24A 1YL7A 5JCJD 4K28A 4OQZA 1M6WA 1N7HA 1B7GO 5G4KB 1HE2A 1PL8A 2VOEA 3RU7A 1Y8RA 3WGQA 4MKXA 4C7KA 2RCYA 2ZYAA 2W2LD 1YB5A 3D0OA 1JKIA 2CVZA 3VDQA 1TLTA 2W98A 2A94A 3LF2A 4JXKA 3ZWXA 3R3JA 2W8ZA 1W73A 4WGGA 4O0LA 2QW8A 3QVWA 2CSUA 4O5OA 4L0QA 1QR6A 4E31A 4J91A 3ZV6A 4KWHA 1DRWA 3AW9A 4OKNA 3RJ9A 4II2A 2OFPA 4FFLA 3C1TA 4PZCA 3DC2A 5ENVA 3NRCA 1YQXA 4EJMA 4DPLA 2EEZA 4AFNA 2FPIA 1QRRA 1I24A 3ITDA 1H6AA 2BKAA 3O26A 5TGDA 3JQAB 4BNHA 2O2SA 3RBVA 2NACA 3RQSA 1D1SA 2X4GA 3WFIA 2Q1UA 1ZSNA 3CH6A 1B16A 4MOWA 1DFIA 3QVOA 1B2LA 5COQA 2BELA 1Z45A 1KVQA 3E5RA 3I9JA 4NBRA 1LSSA 4F3YA 1D7OA 4I08A 3EAGA 2VZ9A 3WQRA 3DMTC 3PZRA 2I5PO 2BGKA 3WMXA 3JYQA 3DZFA 4GVXA 1V3VA 1N5DA 3B70A 3HUDA 3L6DA 5ENDA 1PTJA 1P45A 2NVUB 1Q7CA 1R0KA 3NDJA 1BVUA 4BO0A 1E3EA 3M1AA 1E77A 5JPIA 2E48A 2YHIB 4B8WA 4CM4B 3QSGA 1F12A 5DT9A 1GYRA 3D4NA 1Y81A 3F1LA 3A28A 4KDFA 1AGNA 2PZLA 2ZK7A 3KBOA 3OSUA 5CAEA 1JA9A 5IDYA 1AHIA 2EWMA 1NR7A 1KBZA 2JD0A 2DUWA 4DPMA 4MO2A 3T4XA 2Y0EA 4IS3A 1YQGA 5IXYA 4KMSA 1GYPA 1EDOA 3U4IA 1YXMA 4R3WA 2O3JA 3BHJA 3W8FA 4WOJA 3DXFA 1QYVA 4E2XA 4CQLA 4NJMB 1TEHA 4DWVA 3DOJA 1G1AA 5ILGA 3OJOA 4DTIA 2BF7A 3DL2A 4AL4A 1WMBA 3K8ZA 4XDZA 1GTMA 2X5JO 2GUGA 4M87A 4OXKA 3UOGA 4ID9A 3VPXA 1P1FA 4RV9A 3GGGA 2DU8A 3NJ8A 4YT4A 2FZWA 4BNTA 3GDOA 2Q45A 1YH3A 4LK3A 3DZJA 3GC6A 1BRMA 3WS7A 3INRA 1ENZA 4RDHA 2QYSA 5BSHA 4AJJA 2NU9A 2AE2A 4MIOA 1H6BA 1JU9A 2AQ8A 4BNFA 4BNUA 1XHLA 1U8FO 4BKQA 2O23A 5DP1A 3OHSX 5C3MA 2NTNA 1ZEMA 1DC5A 1BWSA 1FDSA 4J4BA 2YFHA 5T8KA 2Q1TA 3EMKA 4A5OA 3UAGA 4W82A 1LEHA 1BGVA 3JD3A 2O50A 1HDCA 2X8LA 4WE3A 1LDYA 3GFBA 1TXGA 3OJFA 4WCFA 1FF9A 1DJNA 3ROKA 1TT7A 3ZWVA 4IGEA 1ZXBA 3D4OA 3QE3A 1A4IA 4CL8A 3PPIA 1YDWA 4UUPA 1EBUA 2HMVA 2C7GA 3ZU2A 3DHEA 1HYHA 3D4PA 1NQTA 4II3A 2VHYA 3O8QA 2C59A 5DCWA 3U62A 2P9EA 3JQ8A 2OBNA 2D3TA 4J49A 4GBJA 2C2XA 4GX2A 3JQBC 1DLJA 4BNZA 2AMFA 5IFLA 2C5EA 5AVOA 3IJPA 3KSUA 1LA2A 3KEQA 1E3LA 2O3QA 4M89A 3WLEA 3ZWAA 2GERA 4UVGA 3JQEA 5TSDA 5TT0A 2EW2A 3VH3A 1FJHA 3L9XA 1I0ZA 4J16A 1TA4A 4PLCA 1GR0A 3A14A 4D45A 3L77A 5L4SA 4RL6A 4E4YA 5KWEA 3ZV4A 2OHXA 1PZHA 5EJ2A 1BSVA 1J4AA 5EPOA 3NAQA 3LC2O 5A03A 1TT5B 3L4SO 3AM5A 3DZKA 7ADHA 1DRVA 4PIVA 1OAAA 1YGYA 3RUCA 5I8WA 3F3SA 1LRLA 1O95A 4BGEA 4J1NA 2O3RA 2PWZA 4OL9A 3OQ6A 5EQDA 4DL9A 3B20A 3EZYA 2B4TO 2BGLA 4GSKA 3OJEA 1DIRA 3PIIA 5F5LA 4AJKA 3S2FA 5DULA 5A9SB 1PX0A 3UH1A 4YPOA 1LBEA 3I4CA 1ISMA 4B4VA 2YQ4A 1CDOA 1R4NA 2VHXA 3DTYA 4HADA 3DFUA 3E48A 3VVBA 4E3ZA 1AN9A 3WIEA 1Z82A 3GNSA 2FSVA 4KP7A 5C5IA 1EVJA 1HDOA 3KETA 1P0FA 4Q3AA 3WGOA 2VZ0A 1UP7A 2G17A 4NBWA 2I66A 2PD3A 3UF0A 1RM4A 1P44A 1OC2A 1R12A 3HFGA 4XB1A 5FF9A 3TZQA 4TVOA 1C0LA 4YRBA 2X0NA 3ONDA 1CQJA 4CM3A 2AEFA 4J4TA 3GT0A 3ZDFA 1RJWA 3JSAA 1KOLA 1Y9EA 1T2CA 2NM0A 2ZB4A 4KUGA 1BVRA 5A9RA 4ZVVA 3KTDA 4ZJUA 3UXYA 1EUZA 1JVSA 3QWAA 2JHGA 4GX0A 1SEVA 1A4UA 1E0DA 1XGKA 2W90A 1K3TA 1DJQA 1LRJA 4YJGA 3SX2A 4I1IA 4AJPA 3W4KA 4TZKA 2VYNA 3F9IA 1HSZA 5EERA 1TI7A 1WP4A 4EYEA 3L4BA 1BW9A 1XSEA 4I9UA 1HDYA 4OOEA 4CMEA 3P19A 3C1OA 3O03A 4RVFA 1LU9A 3K30A 2RH8A 4NNJA 2O4CA 1KVSA 5IJZA 1I3NA 4H3VA 2YZ7A 5JSFA 3FR8A 2AE1A 1LQUA 2PGLA 4GGPA 1Q0QA 4JIGA 4YQZA 2DBZA 1Y8QB 4DXHA 2EIHA 1ZSVA 3LT4A 3PFWO 3NV9A 5IZCA 2GR9A 1ADFA 5LC1A 4CV3A 3QA9A 1EZ4A 3QVTA 3NT2A 2RAFA 1M6HA 2WE7A 5CPBA 2HMUA 2NU6A 4YAIA 1IPFA 1LDMA 1GZ4A 3DAGA 1B8VA 3IMFA 3RFTA 4XGIA 4MKZA 4Y98A 4BO2A 4BIIA 4NU5A 4RPLA 3BIOA 1YB1A 2HDHA 4R69A 3GDFA 3DR3A 1PJLA 4ESOA 1F8FA 4PLYA 3DO5A 3OIFA 4L76A 1H9AA 3HJAA 1VPDA 3GH3A 5A3VA 1YO6A 1S7CA 2O7SA 1D3AA 5GY7A 3QIVA 2GCGA 4ND3A 3V1YA 5B1YA 1YRLA 1N92A 1F14A 2UUOA 3H9UA 4ND5A 2GO1A 3DZGA 4YJDA 4J1QA 4HKTA 4J3FA 4RF5A 4QO7A 3PJFA 5T8KC 4B4OA 3CE6A 3OM9A 5KOIA 4L75A 4OIMA 4IS2A 2GGSA 3ROPA 8ADHA 4W6ZA 1E7WA 5MDHA 4NBVA 4XD2A 4DQXA 4ZN6A 1YKFA 4WCFC 5COBA 2ZB7A 2ZQZA 1SPXA 3FNFA 4CQMA 4B79A 1F17A 2D5AA 3RBZA 4INAA 4XQEA 3BA1A 4FN4A 2YY7A 3FF4A 4FPXA 2BFPA 2YW9A 3S2IA 4MP6A 4OSOA 4MVJP 3HB4X 2TMDA 2HMWA 2C5AA 4E2ZA 4TROA 4D3DA 1V35A 2X5KO 3I52A 1EQUA 3ZW9A 3V5NA 1ULSA 2VT2A 5FI5A 2ZTMA 2J3JA 2ZJ0A 2CUKA 1WW8A 3IDSA 4R01A 3H4VA 4OO3A 4JROA 3IKVA 1L1FA 3WR5A 1RPNA 3G1TA 1HDXA 4GI2A 2P91A 1YJQA 2WD7B 3GEGA 2H6EA 1XU9A 1XYGA 1E1MA 3WX0A 2EJVA 3HHPA 3I4FA 4JLWA 4CM1A 2O3SA 2WEKA 1Q0LA 3EHEA 1BXGA 3GVXA 3PK0A 4FFMA 3RIHA 3KSZO 2WM3A 1KVRA 4FGSA 1DB3A 5CDTA 4KQWA 1NFRA 3PYMA 1O6ZA 4CV2A 1VL8A 3GZNA 1N9GB 2X9NA 1Q7BA 3SC6A 3MCVA 1UDBA 2CDBA 3MTJA 1MA0A 3L9WA 2B0JA 1P3DA 3E18A 4WLVA 5T73A 3AJRA 4RPHA 4YEDA 3D64A 4FFNA 4ALKA 3PWSA 5C7IO 4HFNA 4IGFA 3H9JA 2VWHA 1MC4A 2ZCVA 2NV6A 4I5DA 3W4IA 2GN4A 2GD1O 1XWFA 4I5GA 3DEYX 4RF3A 4ND4A 5JC1A 1SZJG 4CV1A 1I3KA 1X0VA 4D41A 2DBRA 3UUWA 1KC1A 5THQA 4Z6KA 2JHFA 5LDHA 2CDCA 2V6FA 4H15A 4RZIA 2BI8A 3JQGA 2GDZA 3DFZA 4TZTA 2ZQYA 1E3IA 2ZYDA 1FK8A 1GCOA 3BHIA 2Q2WA 3HG7A 4ZHSA 1OFGA 1KVTA 4FR5A 1A71A 4WLNA 4LISA 3UN1A 4J43A 1RWBA 3VPGA 1IHXA 3BZUA 4UUNA 4BL5A 3I9OA 4BNMA 3L6OO 2P4HX 1SBYA 1Y5MA 3SXPA 4HV4A 3FHLA 2VWGA 4CMEC 5TLSA 1QYCA 1N8KA 4BO8A 4OKIA 1ZBQA 2PZKA 2F00A 3N7UA 1PS0A 2A4KA 1Y6JA 3H3FA 7MDHA 3KLMX 3Q2IA 1E3WA 1DLIA 4MVJI 1ZIDA 2HRBA 4LCJA 4CR8A 4R54A 1ZJYA 3WIDA 3FBTA 4TRNA 4ALNA 1WNTA 3COSA 4CUKA 3TJRA 4R9RA 4YRAA 4KZPA 3ZNOA 5IZCC 3VC7A 5A9TA 1C0KA 3S55A 3OICA 3VVCA 4CMBA 3IJRA 1P1KA 5J9GA 3JQ6A 3ST7A 4CR6A 3IS3A 1CJCA 1ZK2A 2B83A 2IZ0A 4C4OA 2PD6A 1I36A 2Y1CA 1ZFNA 4M54A 1T1SA 3BMQA 5A4DA 4RF4A 1ZVMA 4JBIA 3ZHYA 4R16A 4YTEA 2Q4EA 2O7QA 4DIFA 4PLFA 2X22A 4F46A 2ZYGA 1ZNQO 4R5HA 3PHIA 5DZSA 2VCYA 3EK2A 3AI1A 3W8EA 2WJPA 2P2SA 4XZ3A 5GZ1A 4DPKA 1LTHR 2IYPA 3BMNA 3CTMA 3DDNA 5ES3A 4CLRA 4CM8A 3LT0A 3C1AA 3ZNNA 1WDKA 3BTOA 3SLKA 2EKPA 4UVIA 1Z75A 2IEDA 4PG8A 3WGHA 3ZWOA 4ND2A 1LXCA 1DFGA 4FD3A 5ER6A 3ASUA 5FFFA 4R4JA 3WOHA 2JD1A 1I10A 5JCJA 1H2BA 2IZ1A 4XKJA 1CWUA 2EF1A 3BMCB 4CLHA 4NQZA 3PWZA 4IIVA 3D3EA 5DCYA 3WWZA 1NVMB 5HBRA 3WNVA 3NJ4A 1M2WA 4BUCA 1NFQA 3BMOB 2W2LA 3NDIA 1MUUA 2B69A 4F45A 1BTOA 3PQEA 2GZ1A 4M1QA 2PH5A 3QW2A 3Q11A 1SB9A 3ZU5A 4K6CA 2O4UX 5K0ZA 3CMMA 4DLAA 4Q9NA 3DBLA 3DB2A 4ALIA 3AOEA 2AQHA 4PGFA 2C82A 1GD1O 3B1KA 3VZPA 4CMAA 2X58A 1Z73A 3GEMA 4ZQFA 2VHWA 4XX0A 5CDYA 3AUTA 4L4SA 2B5VA 3F46A 2JAPA 2RHCA 1ADCA 1P31A 4GQAA 3G3EA 2D0IA 1QLJA 4FB5A 1PSDA 3MZ0A 3DZIA 5I7FA 3HDHA 4JP2A 1V0JA 3H9QA 3KOUA 4TWRA 2XXJA 3TWOA 3ZHZA 1B3BA 4E12A 1ADGA 1XCBA 1YE3A 1U1IA 3VHRA 5K6AA 1B14A 3V1UA 5IZ4A 4FC6A 2PGJA 1SOWA 4RF2A 3TL3A 1J0XO 2FPGA 3NGXA 2Y1FA 5JW6A 4RVUA 1SNYA 1V6AA 1PQWA 4IDDA 3UCFA 2CFCA 4JP3A 4TRRA 3LC1O 2QRJA 3AU9A 2X1HA 4E30A 1P1RA 1RM3A 2WE8A 4J0FA 2YQ5A 3DHNA 3ZNQA 2X6TA 1YBAA 2A9FA 2Y1GA 4JBHA 4QECA 3X2EA 4B7CA 4EW6A 4J2OA 1NQAO 1I30A 1NWCA 3JQDA 4OH1A 4UEOA 4TKLA 1F8GA 1ZK1A 2AEJA 2NVBA 1PJ2A 1A9YA 1IULA 4EJ0A 4XA8A 4BKRA 3SBOA 4RGBA 3K9QO 6LDHA 1WDLA 4BO3A 3BTUA 4UULA 3QY9A 4U5QA 1AE1A 2NQ8A 4A73A 1LLQA 2ZIZA 2JFGA 4MP3A 4CLOB 4N7RA 4KWIA 4E5KA 1VL0A 3JQ9A 4BQPA 1KVUA 2E49A 2P5UA 1DAPA 1DAOA 4R5MA 1ONPA 3WWYA 1HSOA 1ZK0A 1HTBA 1NHGA 5CDSA 4IJVA 4CV0A 5JYDA 1AXEA 4YYZA 4NR0A 1EK5A 4O6VA 2X0JA 5CFZA 5I7VA 3JYPA 1OZAA 1ISJA 3GMDA 2HKIA 3HDQA 1R6DA 3JQ7A 3TZ6A 3LLVA 2P5YA 4N18A 3WDSA 3OF2A 3PLRA 4B7UA 1KC3A 2CDAA 1DIGA 2E4AA 1X1TA 5JFOA 2V7PA 5L95A 1NWHA 1C3VA 2DAPA 5KVCA 2HU2A 2IE0A 2X9GA 4Q3DA 3VDRA 2RIRA 5A1TA 3AY3A 3U49A 2X7HA 3HSKA 2I65A 3LT1A 1LJ8A 2FZEA 5ICMA 1CF2O 3D5QA 6ADHA 3W8DA 5JMPA 4ZA2A 2BI7A 2NWQA 2GASA 3DBVO 2JFHA 5DCUA 3VZQA 1ENYA 2HK7A 3B6ZA 4RQTA 5B37A 1C0IA 4HFMA 4PVDA 4BNWA 1HYEA 3ANNA 5BSEA 4PLTA 3WJ7A 4RLHA 1YOVB 2YV1A 4OYRA 4UEKA 3LZ6A 3W4JA 1XELA 4NU6A 5F1PA 1JW9B 3RUHA 3U0BA 2EGGA 4CLXA 5FYDA 1HEUA 4XJSA 1A72A 3U3XA 3GY0A 1QYXA 3G79A 3GGOA 4WASA 3WQQA 5KKCA 4FW8A
chains in the Genus database with same CATH superfamily
1T0JB 1KF0A 4NYIQ 4EHFA 1R8XA 3IL2A 2ZJYA 1O2DA 5TRTA 4X1IB 3CPJB 1E99A 2H92A 1YQEA 4LNAA 1X14A 3S8EA 1VL6A 3PUJA 1A4RA 4H4EA 3A6JA 4WIAA 3GR6A 4K03A 2BPOA 4EGQA 5A5FA 1FIUA 4LYFA 3NYWA 5HP4A 4GT1A 1UP6A 2PR2A 4HN2A 1O89A 2R5WA 3NGMA 1Z37A 4KOAA 2FR8A 3MTQA 2B0CA 3O4FA 4K5QA 1PZFA 3QPDA 4OSPA 3ZJ5A 3H0VB 2D1TA 2FPOA 1M1YB 2VZ8A 5BSMA 1HFEL 3Q1KA 4B76A 4G37A 1M33A 3QVXA 3LLUA 1KFKB 3U2QA 2DT8A 4DCTA 1KAHA 3PPXA 1AHPA 2CHEA 1QIGA 3VYWA 1JEEA 1M2VB 1PGNA 2FFBA 2G9UA 5JSUA 3OZCA 3FROA 4A16A 2PQ0A 1SUBA 2K6GA 4WUTA 2PMKA 3H5RA 3IDAA 1XTJA 4FD2A 4OB7A 4AMGA 3L8DA 1W52X 4UHCA 4DGQA 1W76A 2C5BA 3G2MA 1H8EA 5EJFA 4QU8A 1VM6A 1A5ZA 1X7DA 2AMJA 3IDOA 3KOOA 4GPEA 3U3RA 4UC0A 3UAVA 3V2GA 3GO4A 4RVSA 1P39A 5FA6A 4F8YA 5LP6A 3KSBC 5JU6A 3DTVD 3A9UA 3DBRA 3ZVRA 1JVNA 2Y92A 3HYSA 3BHNA 2XTAA 4R1LA 5BW8A 4CKCB 4ZJYA 1IHPA 4NL4H 5REQB 4PO8A 4PVCA 4B6GA 2IOYA 2P62A 4YLYA 3MWEA 3D7SA 4JEMA 1Q0TA 1JB1A 3NM6B 3MOSA 2R8OA 1RXVA 1TVEA 2P9QA 4YH1A 1AZWA 1Z22A 5TVGA 1JN0A 1D4ZA 1GUDA 1JEYA 5I8ZA 2W2MA 3I37X 1UQRA 2J0SA 2AIRA 1B3RA 5IBCA 5LDGA 1NF3A 2BEKA 2XT6A 1YJ5A 1N1DA 3MRVA 1XDWA 1K68A 2OB2A 1W94A 5IJ9B 3SI7A 3NO4A 4MVJF 1S7GA 2FEPA 4MRVA 2PWAA 3T15A 5JCXA 1KZ6A 1I8TA 3VMFA 2EP5A 1QHXA 3RYCB 5D3KA 1NKVA 3C3JA 5SZHB 1S02A 4LYYA 4UBLA 3OFKA 1VJCA 2G88A 4RVGA 1T2DA 1ZM7A 5IT9A 3KYCA 3EFBA 3ESCA 3GLHE 3K8OE 3PGMA 5FNZA 3WL8A 3KUKA 1SC4A 4H0CA 4QVGA 2B37A 2IDKA 3H5IA 1X86B 1MO3A 3E9MA 3GB9A 3X1YA 4ZODA 4KN5A 4TTAA 2VDWB 4JODA 1MZPA 3OQHA 1OLUB 1S9HA 1XLVA 4E11A 4ETMA 1WV0A 3SHFA 4B4UA 4ZDJA 2G04A 5GVSA 1DUSA 3R9WA 1E1LA 1VRWA 5JJIA 3LT5A 4HEA1 4ZVQA 2RGUA 4MS4A 4H3KB 1AKNA 3SF8B 4HDRA 1IZYA 3JQ9C 2ZTUA 4FHEA 4WZAE 3WG9A 1GTG1 4D80A 2ZIGA 1P72A 4H3HB 1RC1A 2YVLA 4BNIA 4JJFA 1CUDA 1XJQA 2W2KA 3N6VA 4KNVA 4MQUA 5TMDA 1NBAA 4QFCA 3IPAA 3RD5A 1YCGA 3G2NA 4JJKA 1F2UB 3IERA 1M2GA 3IB6A 3NEPX 1D4AA 3I30X 3THXB 1JG1A 3OQVA 4Q7EA 5C8VA 3PI7A 1JIQA 1YIDA 3PQ2A 4UDYX 5LYJA 5M34A 4A15A 2PUGA 1NT2A 5FEUA 1U2DA 3TQRA 2ANCA 2HM7A 1WCYA 1W85A 2V7QD 3BCHA 2BEWB 3F4LA 3E4DA 3IBYA 3QYPA 4GYYA 1CEQA 4WVLA 2C5LA 3TD6A 3TTVA 4OL0A 3KUCA 3MT0A 1GV1A 3ELWA 1L5YA 4BVFA 1R6BX 1I7SB 10MHA 3AV0B 2IXAA 1UC9A 1WQ1R 1Z2OX 3PUVA 4O1MA 3H86A 5FTMA 5K51A 1NJSA 3JR3A 5HZGA 1T2EA 2V6IA 1MJFA 4CCYA 1U28A 1JIJA 5DH9A 4DA0A 4YREA 3QBTA 3WB9A 2OQ2A 3WKEA 3N74A 3FZNA 3O1JC 4IY1A 4JYBA 1QRAA 4WW0A 4GZLA 4GBED 1FYEA 4R3NA 1CJSA 5CA1B 3EZLA 2FF7A 1EX7A 1SHUX 2P6PA 2Z9DA 3D0QA 4FILA 3TPCA 3WRXC 3ZHRA 5HS4A 4A1FA 1GFSA 3QPWA 1YHZA 1ESMA 2QN6A 3GT4A 4D3FA 3FF1A 4YMHA 1FFSA 4LJ6A 5IC5A 1H2FA 3E8MA 1U9CA 3GJZA 2ZR0A 3HH8A 4RAOA 3RC2A 3FMGA 1EKXA 1LLCA 4I1UA 5CDFE 3X44A 4PHCA 4DG9A 3BGWA 1L4KA 2NO0A 3B2NA 1H66A 1KSJA 5C7LO 1YDMA 4MI1A 3EIXA 4EHLA 4LE1A 5JYBA 1YBFA 4FKBA 2X2EA 2NUBA 1ABFA 4PGHA 2DQYA 2DB3A 2UYGA 2ZZNA 1RKVA 1CKEA 1S1MA 3PC4A 2H1CA 1MNAA 3UAWA 3G85A 5FUYA 3TD2A 2EG9A 2YDXA 5B7QA 4NRDA 3L07A 4DJJA 3CRZA 3V8QA 4NZ9A 3Q6MA 1N3LA 3ROGA 3DZCA 4PYOA 4EPXA 5AW3A 4GW3A 2JCVA 3F49S 2RHRA 2XSZA 3LCVB 4CIWA 4HS4A 5KQRA 2GEBA 1PUJA 2DQKA 4H7PA 4OHMA 5BUCA 1O5IA 4L28A 3BWEA 3OFNA 2GZ2A 1ARZA 3JQFC 2PMDA 3VAAA 4CF7A 1J0CA 1F6WA 4WLOA 2QXYA 2PANA 2G70A 1CUCA 4FBGA 1AIPA 1TYZA 4DLBA 1QQTA 2R2GA 1ISGA 2AMYA 4PIMA 3SEFA 2AYZA 4XOIA 1FDUA 2HMYB 3I9KA 1ZSYA 3THRA 4ENTA 5WRFA 3CVXA 3URMA 3WXMA 1BD3A 3PBKA 3JQAA 1N1MA 1TM5E 3ETNA 1H8HA 3JS5A 4WKGA 2ZAMA 5CVVA 3U9TA 3V3TA 3W5UA 2AFRA 1ZIYA 4EY3A 1G1MA 5AUNB 5C1DA 3CZAA 1Q0ZA 2ZU0C 1RXYA 2CFIA 4PBSA 2D2FA 2CXTA 3GLIE 2D5IA 1CY2A 1TA0A 3I9MA 3E84A 4PHTA 2BGRA 1UINA 1YSCA 3UMBA 4P4SB 2DUUA 1S8NA 1UBNA 5IK2D 2JFWA 4LEIA 1KHTA 1NP3A 2PA0A 1E9FA 5G1PA 2YMQA 5DGTA 3SJ7A 2HUPA 2R7KA 1KDYA 3S7TA 2ECFA 2DBYA 1VXOA 1VGVA 2PJUA 3CSDA 3G2OA 4U3JB 5IVDA 3RFVA 2C2KA 3STWA 4OJNA 2OR3A 2FUKA 2O8BB 1NZJA 3L6RA 5TXGA 1YOBA 1SXPA 3PWKA 2ZI4A 3OM0A 4P7KA 4CETA 1UPFA 3MSCA 5EMMA 3CVYA 1KA9H 1G2PA 1LSOA 4MYTA 5DTIA 1T4GA 3VU9B 3K2EA 3ZHCA 1YBMA 3L4JA 1QZTA 3LVBA 2QGFA 2W4QA 4I3FA 3QFTA 1W6UA 1JQ5A 3C3DA 1S3IA 3DKPA 4U9IS 1Y5LA 1RQRA 2QZZA 3G8YA 3GFVA 3DF7A 3DMRA 3QNWA 4GLFA 4KZKA 1DAMA 2DYKA 1DO0A 3QMPA 4MX8A 5EI5A 1HYBA 2R6AA 2YWDA 1D2GA 4LOKA 1FX0B 4HPXB 2V1UA 3R4CA 3NXKA 4N0PA 3QQPA 4XW2A 4EGAA 1VA5A 2VXYA 1CT9A 1EA5A 3CLUD 3H6HA 1C7FA 1TEXA 2OENG 3M3PA 4I4NA 5ALVA 1MVLA 3C3MA 2EFGA 1W6RA 1UZLA 4YJ3A 3EWNA 2CUTA 2BEUB 3PGKA 1E32A 2PRIA 5AK4A 1U1GA 1W2HA 1YL5A 3L0YA 4P83A 4YUXA 1E1YA 1CHNA 3BWMA 2HHHB 3U80A 4YAJA 4IIEA 3LLMA 3F0TA 5MN4A 1FRZA 3PUIA 1TQ6A 2IUUA 2ZB3A 4WX2B 1BFKA 4KE8A 5BV2P 1EI9A 2Q1WA 3GOHA 3R75A 4MRSA 1ESDA 4FBMA 2FQ1A 3HL0A 3I04M 3KV1A 4HQ6A 1OFVA 2Q9BA 1H5QA 2CNBA 3JZIA 1IOLA 4GPTA 3RFFA 1ZH6A 2PTGA 5DLPA 5J47A 5BT9A 2XIJA 1EBBA 5BV1A 3S1AA 2D7DA 2G9QA 2R6HA 1M0SA 2KM1A 3V3KA 3UGKA 5AVQA 1R16A 2PAFA 3OD5A 4HQNA 4OCZA 4X0EA 4YP0A 1ID1A 4OJTA 1K0FA 1K1EA 4N5LA 3M4XA 2HSWA 4D97A 1SKYB 4A8PA 3P9YA 3K70D 3D1LA 2SCUA 1MJNA 1X38A 1L1RA 2K7ZA 4TLMB 1GZ7A 1Q21A 4ND6A 4BBJA 3K0SA 2HLPA 4YV7A 1SN7A 3WQBA 1I7CB 2GNPA 4UTNA 3OA0A 1EAMA 1F20A 2X41A 4D2IA 2AA3A 2WUVA 2ZAGA 1CJKC 4EI2A 3R9KA 4FS3A 2A5YB 1X8KA 3UENA 4KGVA 4ZU3A 3V7WA 2NOAA 4O2RA 2ZSDA 1JV2B 2WYHA 3EXFB 4LYDA 3E0XA 2KLBA 4YRKA 3IJ5A 1XU7A 1AHNA 1GT91 2JD2A 2JJ1D 2EP7A 1NVVR 3KAQA 1DTSA 1TA9A 2X1VA 2XGMA 3KEOA 1L4NA 1N0IA 2Q28A 3HM9A 3A2LA 4XGQA 4KIGA 4DXAA 2WBLC 3F5MA 3JQRA 4MUGA 2IYUA 1B8UA 4Y2SA 3VNSA 3E3NA 4AWBA 5FUQA 1B23P 1RRGA 1RAEA 3VAZA 1OMOA 4HFRA 4ZOLA 2REBA 4TN5A 1ZGJA 4OUDA 2FPUA 5EIWA 1S2OA 2WWIA 1UZNA 1VLHA 2IYEA 4DQLA 3NHZA 1OLSA 3CRMA 1KYQA 4PM4A 4JC0A 1V71A 1V8PA 4YXFA 3IQWA 3MPUA 2G5PA 4D42A 3QKUA 2YWFA 2A7XA 3DE7X 1QU3A 3O84A 2AMLA 1RC0A 1JLLA 3PQDA 3FYUA 1E1KA 1EFAA 2CFTA 4BGVA 4GDFA 2HF7A 5JO9A 2PV7A 2EFDB 2NSDA 3KUUA 4DCGA 4EYOA 5A0TA 3IEVA 4YPVA 1E1QD 2JAUA 2VF7A 3KYIB 5A4KA 4O4HA 4U2CA 5T6BA 2IT1A 1PR0A 4JWTA 1M7BA 3S44A 1BO6A 1CYDA 2X0KA 3CEMA 3ZHXA 5AM3A 4IFEA 1Y8RB 4J9UE 5DGHA 1AKWA 1TZKA 3NG1A 4LWPA 3HDYA 4Z4HA 5T4BA 3VU8A 3W6ZA 4HPJB 3KOMA 1MXFA 4HAOA 3RAJA 3STVA 4QBFA 4EATA 1Z36A 2B35A 4ZIRA 4GECA 1KQNA 4L5JA 1E3MA 4NQRA 4HNRA 1IHYA 3SLRA 3DLTA 1IJEA 5LQKA 3K1TA 5LIRA 5C4IA 1KE1A 2C4VA 1NQUA 2FLVA 5KYNA 2DBVO 3MMZA 1KI1A 3CLKA 4L4XA 4EY5A 2F8LA 4Z53A 2JGAA 5JRJA 1CZHA 1DX9A 2IXTA 3AONB 1EFPB 2N1BA 2PS3A 3AGQA 3OTGA 4Y7DA 1G19A 2I22A 3SSAA 5ARDA 4PLZA 1ZK4A 4BO1A 5JYEA 1JDVA 2X4DA 3O90A 5BN4A 3LVRE 1M9NA 4MKRA 2GZ3A 4MS3A 3L0BA 3CF2A 4XSVA 5CP8A 2A9KA 2GKOA 4TVSA 1JQ3A 2IYXA 4H7KA 4DNOA 3V8BA 4CG3A 1NT4A 1J06A 1GKLA 4NCBA 5HTKA 1V7ZA 4TXLA 2MYTA 1O96A 1F38A 4RL4A 1NI3A 5EGNA 2J9FB 4ESHA 5JZVA 3CR3C 2QM8A 1U2EA 4NPCA 5F21A 1AK2A 3TB6A 2HRQA 4HRYA 5JV5A 5B64A 1QV7A 1LH0A 3H4MA 4JYPA 4WSOA 3MT8A 5L6MB 3MCUA 1G8PA 4PC2A 4KIWA 3OFJA 2UVDA 5CB6A 1BFUA 3ILHA 2DLDA 5LWHA 1MFPA 2PXCA 3K9GA 1E20A 1Z4MA 1WXDA 4IMJB 2VZEA 4WKCA 2IP2A 5DV9A 3VTZA 1R3UA 4B3DA 4FCTA 3GEIA 4C87A 5JVDF 1ISHA 4XYLA 3KSMA 2HV8A 2BT4A 4AZ3A 2AFHE 3PQ4A 4JDUA 4M37A 5ALIA 1NVVQ 2HSEA 2I7TA 3NNSA 3ROZA 5JNUA 5JRDS 1L6RA 4LJ7A 1XV5A 4I9NA 1L4UA 2VDKB 4KRYA 2NLOA 5KPDA 2I4MA 3RHZA 1JE1A 5IJ9A 3RRYA 1UBEA 2ZIWB 3C43A 1E2BA 1QVAA 1T8YA 1J24A 4M1YA 4OHPA 2GD0A 1RVV1 4IKOA 1DC7A 1X7YA 1Y1RA 3HTXA 2OV6A 3COJA 2FUG6 3LK7A 3WE7A 1E79D 2IW1A 4CM6A 4FSHA 2DECA 2XYQA 2IPAB 3KBBA 1E6MA 2C3OA 2RI0A 1DOAA 4Q93A 3L0IB 5C1OA 4R2WA 1CW2B 4LGYA 5JNLA 4BEBA 2JGNA 2J4CA 4IJUA 3OD1A 4BVEA 2QY9A 2D7CA 1GAEO 2TMGA 1NLFA 3V46A 4QJ3A 2ORIA 2PX0A 3AKEA 3GCXA 4D7AA 4HGYA 4JEUA 1OHHD 3KZVA 3NC4A 1KK0A 3O2JA 3UPTA 5JAZA 3SSOA 3EAQA 3DGFC 3ZS9A 2VPPA 5JNSA 4RO0A 1M2OB 1N4AA 5IAAA 3GEPA 4EPTA 3G8BA 1E92A 3GLFE 2BKXA 4Q9KA 4O2BB 4J0HA 2NZXA 3FTPA 2AOUA 3DO6A 3QEMA 3QOWA 4HI0E 3BL5A 1XZQA 5L45A 1OH5A 2H3EA 4LVCA 5EA2A 3KVNA 4HDSA 5DRYA 2Y93A 4C0XA 2ERCA 3BD7A 3CX3A 3O82A 2F64A 3JATB 1H6CA 2H0AA 2NU9B 2FSGA 4FWTA 4ZKEA 3TFWA 4N76A 5TPZA 1EINA 2LTAA 3A58B 4MPDA 4RIIA 1DSSG 1IDN1 3CXRA 5KX5A 2C97A 2GFQA 3PTLA 3RUDA 4DREA 1ORWA 5AXCA 3SQNA 2X3FA 3NDRA 2FW1A 4R51A 2Q7DA 1RMQA 1KMMA 1S89A 3CONA 4X1KA 3ZEAA 3IUYA 1I1NA 3GNQA 1DX4A 2CF6A 3A1DA 4WCDA 3PQ7A 4GR4A 3H75A 5HDBB 1DAHA 1J00A 2COKA 4PN3A 3RC1A 3HA2A 3M1LA 1T6YA 2O2IA 3DAPA 1EDDA 1Z2DA 4A7PA 3FJ1A 3I5MA 2N47A 2DETA 3EVGA 3R6GA 1EG2A 3K2IA 5G0VA 3TLCA 1Y9ZA 3JAMA 1ZRNA 1K6JA 3CKMA 3JPWA 3WBFA 3GMTA 1T2AA 5EHNA 5CLLA 1XZPA 1KY5A 4IVRA 4LBWA 3RSQA 1F9EA 5J2TF 3Q0TA 1JWLA 1N6LA 4I19A 2SNIE 2ZBEA 4FONA 2FK8A 2KWIA 2RHMA 4NCAA 1P7YA 4FJ0A 4S1WA 3UGQA 1Z39A 1N75A 4IMRA 3ZQKA 2YW2A 4QDOA 2CNWA 3INYA 2AV6A 4WMLA 4XYEA 1EZZA 3ZWNA 1ECCA 1P9OA 3ZWYA 2XPCA 5COAA 3DPUA 5TEWA 4CN9A 5C8YB 1STOA 3RCBA 4UATA 3CLRC 4ZXPA 3FPBA 1A8QA 3KHUA 4RTSA 4M1SA 4TKZA 3BB4A 4WK2B 1IZ0A 5TS2A 2OK7A 4EHHA 1IYZA 4I4TB 5C8ZA 5DWVA 2XNDA 1Z4JA 4GNRA 4JJ4A 4NESA 1NDQA 4JP8A 1T0IA 1D0IA 2V65A 4ADSG 4IKEA 2DCUA 1RAHA 1R64A 2OC4A 3AJDA 4IXWA 5HCNA 4D92A 3SZMA 2R8XA 3L0CA 5BWBA 5EHGA 4S3MA 1D1QA 1GPJA 2X0IA 3CGGA 4AZVA 1QU2A 4K6OA 5E2IA 4WTOA 3ULKA 2P0YA 3RREA 1WABA 5JYFA 3W7BA 4CR8A 2AG5A 5E4TA 4AW9A 4L72A 2D4AA 4RZXA 4EKGA 2EW8A 5NULA 1W4LA 1WVIA 3NHRA 4QBTA 4DSZA 3WZ2A 3A1FA 3AH8A 4FGKA 2R00C 3EMVA 3GPDG 4WLEA 3PYLA 1CY6A 3A04A 4O2LA 1RLOA 1OIXA 3D43A 4C6HA 2E37A 4KQJA 3R5HA 3LUJA 3EXAA 1DEAA 1E64A 1ZA1A 2C3MA 2QUBA 3IQGX 1N6RA 1JIUA 1A8UA 1FLAA 5AW9A 5HZKA 1JSRA 1QWSA 3HCOA 1SC6A 4MDHA 4MV5A 1USVA 2A5LA 4EUFA 5K03A 4RE5A 1JR3D 4EL0A 2BM0A 4WJZA 2W2PA 1WHTB 4BQRA 3FPGA 1M34A 1H4TA 2NXNA 3QKRB 1JHQA 1CE8A 3FPCA 1DXHA 3HY3A 5E1DA 5AUPB 1IN5A 1RI5A 2QG4A 3ASVA 4ILEA 1XQ9A 1CQJB 1KI6A 1GZ6A 1UEXC 2XZPA 3CRVA 3CBGA 2XY4A 4NDAA 1HRKA 2FSSA 3B12A 4GWGA 3NAMA 4U8HA 2QTLA 2EBWA 2JGJA 1FMCA 2GPJA 1V48A 5E4FA 3IV9A 1MORA 3GLRA 2ZBRA 4EY6A 1KK2A 4PG7A 3L06A 3PI6A 1GG5A 4I1SA 3BDIA 2VNKA 1XHEA 5G53C 4CF4A 4B6PA 3M3HA 3U3JA 1IRXA 3X1KA 4ZAXA 3BRQA 2E85A 5FV7A 2WFZA 1IJFA 2PAAA 5CT6A 5FT9A 4NCXA 1AK9A 1GQSA 3AY0A 1GXSA 3ABSB 2KBFA 3DV9A 4PSDA 4Y6PA 5KKAA 1SD1A 3VBCA 2CLCX 3OF5A 1ZN7A 2YZGA 5KSOA 2AKEA 3Q87B 2GBLA 3HUEA 4ROTA 5EE9A 1E2LA 4YRSA 2XLCA 1UPXA 4RPGA 2FX5A 5AK6A 3WL6A 3I9V6 4P31A 4YHBA 2Y1LA 1Y3BE 5HPYB 4B3BA 2J07A 3P94A 4C6RA 2A0KA 3ZWDA 3UMVA 4AMUA 1G7RA 1LI4A 1HL7A 3G0IA 4J7UA 4KTTE 2V3CC 1P0CA 1Z6QA 1HOXA 2CDNA 3H18A 5DOZA 4ZHQB 2C5FA 3ZCPA 2JCBA 4IH1A 5TPWB 1I14A 4MHTA 1SCAA 3A4VA 3RVJA 2ZUSA 2DWOA 3FSJX 1MPTA 3NKFA 4FEGA 2Q9AA 4Z99A 3AL3A 3GGSA 5BR4A 5HWSA 4V0ME 1ESCA 2PT5A 4GR9A 1NJ5A 2BHNA 4NNOA 3MJVA 3AEUA 5JAPA 5TMPA 1ZHFA 5FBWB 1RHUA 5IBQA 2KMLA 4F9TA 3QOFA 4NHEA 1AKTA 1FMFA 3FNEA 2DULA 4XLTA 4QX6A 3EDMA 3P32A 2FXVA 2YOFA 5AVSA 1XZIA 3TB4A 2B82A 4DUPA 1Z0DA 2I4RA 4BZPA 5J2UA 1U9JA 2GHIA 5DBGA 3I09A 1DC3A 2E6UX 4G2NA 3C74A 2Q6TA 4L6CA 1V3UA 2G09A 5ARBA 2AVDA 2ZIVB 1ZO8A 4DG8A 1HZJA 3M1IA 3LC0A 4V0OA 4Y2QA 2OPHA 4G07A 3VISA 5BN1A 1LS1A 5KYYA 3RRJA 4K6FA 1C7EA 1AKMA 2LZ0A 4G5OA 4QE3A 5ALJA 4K40A 1N6PA 1Y1TA 3EYWA 3TN7A 3PDHA 1KYXA 5HFAA 3K73O 1NMEA 1Q14A 4LZPA 2ZJFA 5FBQB 4RSGA 2UVPB 1PEKE 3THYA 2Y1EA 5B4VA 3CVVA 1WR8A 2I7DA 1LV8A 3QHAA 4RH1A 1II8A 2VJNA 4QO8A 4YRZA 1O4WA 2ZTVA 3MB5A 5DSTA 3GNTA 1XRMA 1OFHA 5AK3A 2VYQA 3H0EA 1M73E 1SUEA 1SG0A 4MW1A 5KAPA 2XYHA 3CN7A 3UJCA 1QC5B 2JBAA 4L85A 3D3NA 4Q19A 2H31A 3WWEA 1BE8A 3CX7A 4CKZA 1QX3A 3ASYA 1MOSA 2G36A 3ONFA 1CJUC 3U13A 3X43A 3U19A 1MAVA 3ETGA 1QKIA 4N54A 5FCDA 4WZAB 1NW4A 4E51A 4FOPA 3VR6D 3TW3A 1RYNA 2PSEA 4CKBB 1U0RA 2JLZA 3KKKA 3UQZA 5JDCC 3FG9A 4BV3A 3UHOA 3BM5A 1EUDA 1G8JA 2YHBA 2C29D 1R15A 4D3XA 4DAOA 5CB4B 3RWOA 4P4LA 3TOCA 1W59A 5DBIA 2HHJA 1MJGA 1EX6A 4DR6B 4DCMA 1S8FA 4D9JA 3KQMA 3UMSA 5GQSA 2PM8A 1QZZA 1ZNXA 1Y7TA 2V6MA 5DM0A 1E7SA 3LYHA 1E2KA 3MEQA 4C06A 1IG0A 3C6XA 1XCPA 3D6VA 4QQFA 3NONA 3TZCA 3NBFA 1DC6A 4N5HX 3TLEA 3LQFA 4MH0R 1PAUA 1Z35A 4DMMA 1EUCA 3LGSA 4KFTA 3SQLA 1NBOA 2PKRA 1NBME 4N7BA 1F0NA 2MINA 3H84A 1RW4A 4OQNA 4DSTA 1NN0A 4K88A 4DB4A 4N41A 2IS2A 3SXUB 4DYDA 4HXEB 5JZMA 4BFZA 2O9JA 2IDMA 2WAOA 1T0PA 4D0RA 4KITB 1TX4B 5DO9A 4QWWA 4RDCA 2V6JA 3GZNB 1TECE 4Q82A 2ZE6A 4XVHA 5AKZA 5FL7A 3EWIA 4KL8S 2PJZA 3GZ4A 3TLZA 3H2HA 1NBHA 1TZBA 2AOVA 4JJGA 1KS2A 4JJ6A 3NBUA 4MS1B 2CK3D 4CPDA 2WTBA 2WW8A 3P5SA 1YQDA 4GKBA 2BHTA 2RFLA 4FGLA 3EY4A 1EG7A 3DMYA 3F6PA 1KR2A 4Y9DA 2BKEA 2VJMB 3I1YA 3V80A 2PL9A 3TG2A 4QXOA 4GM0A 5CEFA 4DMGA 2Z8ZA 4CLOA 8MHTA 1TK9A 1KTIA 1BHSA 2WSYB 1NMQA 4UU8A 4YCAA 5IBRA 1Z47A 5FR2A 4QYIB 1PWYE 2FFHA 4OBEA 3Q0EA 2PO7A 1USKA 3TIFA 5LQUA 3I9NA 4CIBA 3O0TA 3DNMA 3DDSA 4W99A 5L9AA 3RYTC 2C3PA 3G7UA 3WGTA 3PTAA 1MAAA 1TD1A 1D2EA 2LE0A 3ICWA 4KX5A 4MPPA 4PZ9A 4YK7A 2EEPA 5DYIA 4JMLA 1T6XA 5ILOA 1JG3A 2ZS7A 1LRKA 4E5VA 4DR4B 1E1RA 5L3QA 4ZV9A 1T1RA 3HDVA 3H42B 4L0MA 2PFKA 3MM4A 3JQPA 1QG0A 2QF7A 3E03A 4I2NA 4CCSA 4ZCMA 5D84A 4ZVSA 1ZCJA 3WZMA 2C57A 3UO8B 5KDDA 5CNIA 2DM6A 5K8UA 4MROA 5AOVA 3B52X 4NAHA 2WA2A 3V00A 3CH5A 1PR6A 1TIBA 1AVTA 3FTQA 3O4GA 1TCBA 3WP0A 4C5CA 4GEKA 2OMKA 2WFLB 1S9DA 2BKLA 1D0SA 3OH8A 1AUXA 2Q6IA 1ZL0A 3L40A 3IIEA 3OEYA 1U9IA 1E3WB 5J4YA 4B2PA 1G18A 2XA9A 2B4RO 3PJEA 4W7HA 2QV7A 3FVVA 1L5RA 5JXWA 4KH0A 1NVFA 3C24A 3L43A 3R2JA 5AVWA 3TE7A 1UJMA 3F7MA 4XWTA 2J59A 3WV5A 2F55A 4I6GA 5LMCA 2BM1A 2VHEA 1TFUA 5KYXB 1EVIA 1WOYA 1YOVA 1J09A 2H7CA 2WKPA 4WLFA 1VA4A 1OX5A 3ZWBA 4HFJA 5J59A 3EARA 2FGKA 2R9VA 4YUAA 2FN7A 1CDEA 1VE5A 1P5RA 3IQFA 3ANLA 1RKUA 4MGIR 3AFIA 2HTEA 2FZCA 4R71A 1J97A 3L8HA 3WHIA 1PDOA 1ZJWA 1N2IA 2HJSA 1X1DA 3QXXA 3DR5A 1DKRA 4WK0B 3HNPA 4NC9A 5D7BA 2LCQA 1AKQA 1ZKMA 2G7ZA 4HJXA 4R2IA 2PLAA 4EUHA 1FTGA 5JE8A 4CLRB 2PMCA 3NKLA 1G9SA 1PFUA 3OWOA 1W48A 5AQ1A 4L02A 3RAPR 1RZVA 5G0TA 3L04A 1TNDA 1KFJB 3Q9LA 2D6FA 1PWZA 4OLAA 2WUDA 3VQTA 3FZGA 3ZYZA 5CTJA 5I4IA 1B6GA 1T13A 3ECSA 5HFJA 4A4DA 3VTFA 5BWOA 2RKWA 4YMVA 4FEEA 3CZ5A 1Y9AA 4JJEA 4R9SA 3FTDA 5JD3A 4ZEOA 3K15A 5FOVA 1U2RA 2L42A 3RS2A 1CY7A 1E1DA 5DLQC 1SUPA 1ZI6A 4HRXA 2QAGB 3SJCA 1L7RA 3SJUA 5KDLA 1QUEA 4MDYA 2MR6A 2DQ4A 3A9SA 3OKCA 1KI4A 3GEEA 1DT3A 4MRMB 2CNDA 3HP4A 4QU0A 4YWHA 1UR5A 2Y0CA 4PSKA 3AF6A 2RJNA 2BFMA 1XR3A 3OP4A 3VO1A 3P9SA 3SHVA 1EQ2A 3DHWC 3ORHA 3H6GA 3I9LA 3OC6A 4ZGGA 3KKOA 1T9BA 1U2GC 2Z2YA 3AK4A 3P7MA 4YFYA 3CNOA 4EGFA 2J4FA 1QGDA 2XUJA 2F2TA 3DBLB 3OJ0A 3Q6NA 1V11B 1UDWA 1IONA 1UZAA 1W4BA 1VZ2A 1OT3A 3NHSA 4E6PA 4WV3A 1G6KA 3JZFA 5ADHA 2XW6A 1UMDA 1IJKA 3PIRA 3EAFA 3HZOA 2C2HA 2I71A 4OA5A 4URWR 2AI3A 3MS7A 3NVMB 3U7QB 5KUTA 5MGBA 2O8FB 4M8KA 2HRZA 2PZMA 5EZ5A 3AWDA 1I2ZA 1MU0A 2AK3A 4K46A 4K87A 3VSAA 3C85A 4BLWA 3MUNA 4BRSA 1O95D 3GGDA 3IUNA 3PICA 4FNOA 5FI1B 2YXDA 3ZZMA 7AT1A 2EJBA 3HV2A 5FBRB 3HACA 4OHZA 1NTOA 2DR2A 1DTWA 2Z1NA 4NS1A 3K05A 4UOEA 1AGYA 3KJIA 2P9GA 1J2RA 1NX9A 3KHKA 4R1SA 1LPMA 1NXXA 4Y9RA 5ICCA 1KXZA 3VR4A 2GD2A 3ZZ1A 1XDZA 2IXEA 4EL5A 3AFGA 1PQ4A 2HHAA 1MNQA 5FWYA 5IVHA 1NNI1 2E9SA 5C7OO 5B55A 2BYTA 4NXMB 2Q1YA 3GYBA 2P1DA 3IE2A 5CK5A 3D7LA 4MCAA 2W93A 3FX2A 2UDPA 1HNXB 3ZLBA 3GRKA 1G8YA 4HBGA 3UHAA 3F71A 3GLGE 3PPWA 4X8MA 1BMTA 2FW0A 5F12A 1NF2A 2A5GA 1ZD2P 3J81A 3S68A 2AGVA 2REOA 2P79A 4HDMA 4B3GA 3LT2A 3PQVA 5J63A 3AB3A 4U0KA 4KGDA 2JJ2D 3BX1A 1NKTA 4MA4A 3TZEA 5CCXA 3BHMA 3A26A 1IEVA 5JQGA 1Y3AA 4QAQA 3RE1A 1M2EA 3KKLA 2I2WA 1T6NA 3HI4A 3VSBA 4XLZA 3OE7D 1OQAA 4LX8A 1ZMBA 3HXOA 2VT3A 2CUZA 4EK9A 3J7AC 1L7XA 3DDCA 4D3SA 4NCIA 4BEWA 1T8RA 1ZLYA 2J5KA 3IVXA 2W6NA 1TM7E 2F3UA 4MLZA 3AR8A 2NSHA 4I4IA 2AD5A 1Z4OA 2BCJQ 3TNLA 1A2KC 3TGWA 3NP7A 2C03A 3NXSA 2J46A 3U4DA 5FO0A 4X8OA 4ZV7A 2MMCA 1ZMOA 5FFMA 4WZBA 2QTMA 2CY0A 3U60B 2WIGA 5JAUA 1UXOA 3N58A 4N5MA 1D2RA 1E2FA 1NN3A 1ODCA 5GV7A 5LB4A 5KREA 3GLQA 5HK9A 1AKEA 3Q1LA 3ND6A 4R1QA 2X9QA 3CG4A 1KZ9A 2OILA 3I5UA 4XYMA 3UGTA 2RHTA 3ZD7A 2IDJA 3BFKA 4L22A 4X90A 1MOQA 3GH1A 3R5JA 3AUAA 3V8MA 3OMXA 3Q7EA 3VU0A 4C6TA 3TNYA 1Y1KE 3THWB 1D6NA 3B3FA 5TQ0A 3AEZA 1L5OA 3MJCA 4ZVRA 4JT9A 3W3AA 4UUBA 2DFDA 2XE6A 3OHMA 3QV2A 2V7VA 4EVRA 4J7CA 2A9JA 2DC1A 3KJZA 4FP9A 1GZVA 2ZYIA 4JQCA 4MHOA 3LPNA 3PEFA 1KFCB 1QH8A 4K7JA 4QRDA 3AIMA 4ZVOA 3RT1A 5GZ6A 3CEPB 4JI6B 3ZDYB 3ZIUA 1VI6A 3GVPA 5JSYA 3BSFA 4M99A 5EINA 4KC0A 4EA7A 1XG5A 3UFXA 2Q49A 1QYWA 3PRYA 4M55A 3HU5A 3E8XA 5ALDA 1ZCZA 5C8XA 5JY1A 3IEPA 3UW3A 4CMHA 3B1WA 1IRIA 3I2YX 2IHTA 3IDZA 4C4YA 4CODB 1EXWA 3IOEA 5JH7B 2VN8A 3M0EA 2A0UA 2GN8A 3JCZA 4P33A 3LP8A 3N7AA 1P1CA 4HTFA 3WLRA 2V7UA 4RTPA 2QYOA 2H07A 1GPNA 4ARZB 3JWEA 1X19A 4W5JA 1BHQ1 2O1WA 3JTMA 4JC8A 4RHYA 3Q3VA 3TVTA 4QDTA 3T5TA 4G26A 1V8FA 4MVJH 5LZ5A 3L4BC 2P4QA 2YYSA 4W7SA 4MVJA 1Q1BA 3F5DA 5D5HA 3BAZA 1CS4C 1TTPB 1RWVA 2R2AA 5JZ9A 1JHDA 1R9GA 4HQKA 4M1ZA 2FYTA 2AFHB 3ORFA 1XWWA 2IUEA 2JBHA 3NUZA 4HLQB 5AW7A 2YDYA 8ATCA 5AVUA 1GGFA 2GZHA 4LOHA 3E2PA 4ALJA 5J5AA 1GO2A 4WXHA 1OKKA 2QLTA 3FWZA 3N9IA 4YT5A 3NPMA 3VR0A 2GKSA 2AFIA 4PC3A 2Q0HA 2C00A 2IYOA 5KMGA 4UM7A 2HRCA 2JB9A 4JEIA 3ZDCA 2R1TB 2UXBB 4DNXA 1UCFA 1WVGA 3IHTA 3PL1A 3EE6A 1VG1A 3ZGNA 1GDHA 2YY5A 4U1RA 1HC7A 3UT6A 3F78A 4W5QA 1LBQA 3RUAA 1JDBB 3OFVA 4J0IA 3WYDA 3QUSA 1ZM2A 4NBKA 1IBCA 3JSXA 4ZICA 2VP9A 3F74A 3GGPA 3P52A 4L8FA 4RDIA 5EJ5A 2I34A 4P7JA 3L7CA 4OP2A 1VE9A 3P4XA 4JIMA 4KJZA 2BGMA 2FPXA 1H9BA 1S8AA 2HBYA 3EZ7A 1PG5A 3QU4A 3GP8A 3VZRA 2IEGA 4MUEA 4W8GA 3DBHB 1IDOA 4AAYA 1MB3A 1NBWB 2W0MA 3BCSA 1DBVO 1Y33E 3UKDA 1FRQA 1EB8A 1QE3A 1ZD4A 3BK2A 4IDBA 5BYKA 5JDIA 1A8PA 3Q3CA 3F7NA 1YQTA 3PP8A 4YN3A 1R0YA 4B33A 4E2FA 1NKSA 2JKZA 3FLBA 3RC8A 5JT1A 4IV5A 3E61A 2WKRA 3P2OA 3DMTA 4A0FA 4BB9A 2DFVA 1L8QA 3HYCA 3RKRA 2ORYA 4DQUA 1X7XB 4ARIA 1OXTA 3TRJA 2Z6AA 1B1AA 2A0YA 4KYVA 5G4LA 3TPFA 4I55B 2ZSIA 2LRHA 5GM1A 1Q11A 1OASA 1XQ6A 5BYJA 4ZAYA 4CM9A 1K7SN 2X15A 4ICIA 1PDVA 1JBEA 3HXPA 2OV4A 4HUTA 2I33A 4W8HA 4FMDB 2JAHA 5ALOA 1HETA 2B7BA 3R0XA 3OZSA 4HC4A 4RY0A 3QE4A 3WGJA 3V2HA 1Y98A 4B81A 5HRCA 1UXHA 3D0RA 3ONVA 4O0MA 4N9WA 2CMFA 1UJ4A 5DDIP 2XUGA 4X7BA 3LKVA 2IHUA 3STUA 2VP6A 2H4HA 3MINA 4RIEA 5J40A 3AVXA 2CJWB 2GYWA 4K6HA 5TT1A 1WULS 3SAJA 1QQBA 1U0SY 1RWQA 3Q7RA 5DYGA 4ZVKA 5BORA 2R6ZA 4AKHA 3NIBA 1FYWA 1P77A 4B3IA 2A92A 4IDCA 4L9SA 5F5NA 2H5JA 2IXFA 2J3LA 4LDQA 2H16A 3Q0IA 2ZTHA 3T9CA 3U81A 3F4KA 1EM6A 4OQ4A 3B3JA 1D2HA 3NASA 2F3PA 5CW2A 2XBMA 3OP1A 2P2LA 2ERYA 3DE5X 5ITZB 1FUKA 2XT0A 4YAEA 1PGOA 2J32A 2ZI3A 2Z6VA 4RZ2A 5ALPA 4ZDWA 1VL2A 1P91A 3EXHA 4Q3KA 3LNCA 2B4AA 1ZHOA 2VUHB 3E05A 3NBKA 1E59A 5FB3A 2HWKA 3OQ1A 3T4EA 2O8CB 1KH3A 4TS9A 4JLNA 3EPAB 1Q22A 1J2EA 4JOSA 5IDQA 1MC5A 4DNFA 1HLDA 5G02A 1I3CA 1D2CA 2AZMA 3DEKA 5JLAA 1OPXA 3M5PA 1Y4AE 3QMWA 3QYAA 3FMOB 5KJ1A 1C30B 1S2MA 1I5EA 4FFBA 3U4CA 4DBLC 2ERXA 3HN7A 2JRLA 5FTKA 2R85A 2IYNA 1MOPA 1JR6A 1L5QA 2NG1A 3VDXA 4PYJA 1I7NA 4X44A 4JVMA 4CEJA 2DTXA 1Q0HA 3PDIB 3PHLA 1IK6A 1O94A 1Z8NA 4G8CA 4GZ3A 1HLPA 1U8XX 2O3TA 4FE7A 4MQLA 4PF1A 2W58A 5KNCD 2WF7A 3R6LA 2G9VA 2ODQA 1I4EB 2F1RA 4QJIA 4U2BA 1QIEA 4B43A 2P1ZA 2O8VA 2RGCA 3TIGA 1FJGB 4EKDA 1N9GA 3QP9A 2VUSA 3NYRA 4RJIA 3TXYA 2ZSKA 1YB4A 3O4RA 3LKDA 1TUIA 5KYGA 5L7TA 1OX4A 3WRVA 1NLUA 4D8XA 1F6DA 3FVWA 4IVPA 1VIDA 3K09C 5EPEA 3NEAA 3RROA 2CZCA 1OWLA 3QFCA 2XQGA 2XWPA 3I12A 2FWJA 2AN5A 5FX2A 2F43B 3IT2A 3ME5A 2QN3A 4ZI3A 3JQBA 2HD4A 3BK1A 3AVUA 2YWRA 3IIKA 5CCBA 1ESZA 3HO1A 4KUEA 2VO1A 4YJHB 4F8JA 1JH8A 1GA4A 3JD0A 2WP0A 1N5RA 5JISA 5J4LA 4QD3A 3EQ9A 4LN1A 5IMBA 1RIFA 1CUUA 2LBPA 3QUBA 1PYOA 3PLNA 1SQSA 2BEVA