1H94A

Complex of active mutant (s215->c) of glucose 6-phosphate dehydrogenase from l.mesenteroides with coenzyme nad
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDSIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLCEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEAQEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nadp+ and Nad+ Binding to the Dual Coenzyme Specific Enzyme Leuconostoc Mesenteroides Glucose 6-Phosphate Dehydrogenase: Different Interdomain Hinge Angles are Seen in Different Binary and Ternary Complexes
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase
molecule keywords GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
total genus 168
structure length 485
sequence length 485
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h94A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h94A01
3KB6A 1TT5B 3OQ1A 2JHGA 3Q11A 3WICA 3OQ6A 3AI2A 2PKQP 1QYDA 2JCXA 4OKNA 1B3BA 2PY6A 1BXGB 1IY8A 1HSZA 1AHHA 2F00A 3VVBA 3TFOA 3P2YA 4TZTA 1M75A 4DREA 4E2XA 1H2HA 1XU7A 4J7XA 4R69A 4TMFA 2F1KA 2RIRA 4GVLA 1NR1A 4D41A 1YO6A 4MIEA 3VOSA 1BW9A 2BH9A 3I1JA 4CMHA 5G4LA 1R16A 3LF2A 3RC9A 2DC1A 1KVUA 4QO8A 5KOIA 5T73A 2P9GA 2D3TA 4BQRA 4E5KA 4OXNA 1ZEMA 2NTVA 4I1IA 1NM5A 4ZQFA 5ES3A 3B70A 4J1QA 4OSOA 4FFNA 2XXBA 4OO3A 3W4IA 4HFRA 4ALIA 2AE2A 2BGLA 2NQ8A 4QO7A 2GPTA 1KVRA 3EAGA 3G3EA 3VPGA 3PZRA 5COAA 3KM0A 4XEHA 4YXFA 5F21A 1MGOA 3D64A 1B16A 5B4UA 5T6BA 3K9QO 1RM3A 2P4HX 3U3XA 3TNLA 2NNLD 3ICPA 3MOGA 1YL5A 3ZCXA 3RIHA 4FJ0A 3ITKA 5JAMA 5KJ6A 1WVGA 2YDYA 5DBGA 4E5YA 3TZCA 1CRWG 2X58A 2O7SA 3ZWAA 1ISHA 2PKQO 3NTQA 4R5MA 3RBVA 2OP1A 3VDQA 2ZB4A 4AJ4A 3HDJA 5KJ1A 2DT5A 3PP8A 1J5PA 1DFHA 1BDMA 5T64A 4AJPA 1I0ZA 1WPQA 4XB2A 1U9JA 3JQFA 3U4CA 4GX0A 3GA0A 4Q3AA 6ADHA 4BNTA 3AUSA 3LU1A 1UP7A 1YBMA 4Z0HO 2HLPA 1P1FA 2J3KA 4E5PA 5HM8A 4FQ8A 1PZGA 3FPLA 1VL8A 1R12A 2VQ3A 2Z1NA 3G1TA 2RHRA 3JQGB 1KEWA 4I08A 1UXGA 1G0NA 4JP2A 5GZ6A 4QT0A 3LC1O 5DDIP 2OO5A 4CV3A 3KOUA 2EXXA 2QZ9A 1CETA 1V6AA 4W7HA 4AICA 3PFFA 3WLEA 1Y8RB 4M55A 4HFNA 1EVJA 4FGWA 5I8ZA 1YKFA 2JHFA 1XDWA 4KTTE 2I6TA 4BVAA 1I3MA 3UGKA 5G0SA 4A03A 4YJGB 7MDHA 4WLEA 1CYDA 1E5LA 2DU8A 2RH8A 1VE9A 5BSEA 2AE1A 4ALMA 3Q1LA 2NTNA 4RLHA 4J7CA 3JQFC 2RBEA 1U4SA 2WJPA 1JVBA 1Y7TA 3QWHA 1LSJA 3FNHA 5JS6A 4GPD1 2O3UA 1PU2A 4B4WA 4B7XA 5JY6A 4R1SA 2ZJ1A 3ZWWA 3PHLA 3PWKA 3L9WA 4XX0A 2ZQYA 5A04A 1DFGA 1GDHA 2VWHA 4RPGA 3TZQA 1QXSA 3E5MA 3WWZA 1YBVA 3AY3A 1ZMTA 3QRWA 1T4BA 3NGXA 4IXTA 3BMOA 2D8AA 4TROA 1EFKA 1HETA 4J1NA 4GVXA 3AU9A 3DO5A 4XIJA 4CQLB 1DHTA 3C85A 3ONEA 2QG4A 2VNSA 5TF4A 3RFTA 3IUPA 1ZJYA 5L53A 1MFPA 1YBAA 5L4NA 1IE3A 2DQ4A 3ADPA 3AU8A 3QLJA 2B83A 5JMWA 1T4DA 3HADA 3PXXA 2Q22A 1DHRA 2J3HA 3V1UA 5IFLA 2J5QA 3VHRA 4GL4A 1JKIA 3WBBA 4LCEA 4PIVA 1LSOA 3JQCA 4M86A 5DN9A 1E1NA 1YWGO 3TOZA 4UVDA 1ENPA 3RVDA 1NASA 2YW9A 5KCZA 3EHEA 3GVXA 4XJTA 3JD0A 2EGHA 2VUUA 4MVJA 4JNKA 5TGDA 3GUCA 4UVEA 3I3OA 1VJ1A 3WDSA 4CLOB 1GU7A 5JO9A 2VYNA 3WQSB 2PGLA 1LDEA 3KYCA 5CDTA 4MO2A 1PGOA 1TT7A 1UXJA 3GVIA 3HHPA 1KC1A 1SC6A 1FXSA 1ZXBA 4FFRA 5GMOA 1I2BA 4PLZA 2IDZA 4PLPA 2DBQA 3P2OA 3RFXA 2DM6A 3PYXA 3JQDA 1MB4A 2D5AA 4BO1A 4DIBA 3M6IA 3WTBA 1HDXA 4GQAA 3LT1A 4FOSA 4E5NA 3TSCA 4YT5A 1WMBA 2DPHA 3OJ0A 3MWEB 1HDOA 3K8ZA 4B8WA 2ZKLA 1R4MB 4BKPA 1U4OA 1GYQA 1V9LA 4E30A 3RFVA 1T1RA 4RVHA 4PLCA 2YQ5A 1HT0A 1T26A 2EIHA 4XR9A 3EW7A 4KTVE 3QV1A 3BXXA 4D0RA 4WCFC 1PS0A 4YJFA 1SOWA 3MJCA 1LXCA 1DFIA 3BMNA 4YRAA 5DZSA 2X23A 1HTBA 5I9LA 1QLJA 1UZLA 2C20A 5B1YA 3KBOA 5KTKA 1P3DA 1MX3A 2BELA 3ZN2A 1PJ3A 4CMGA 3LLVA 1T2CA 5ILGA 3AY7A 2WYWA 4R3WA 2DVMA 4HWKA 4E3ZA 1B3RA 3NDJA 4NFHA 5BNIA 3ZWPA 1XQ6A 2G5CA 1C0LA 2O3TA 1T2DA 3U5TA 4U7WA 4MINA 1QLHA 1LRLA 2PZJA 1PGPA 1V0JA 1KOLA 1CIVA 5BSHA 2J3IA 1LDMA 3AOGA 3NGLA 3ORFA 5DP1A 4EEZA 2FR1A 2POQX 3IL2A 4PFJA 1UJMA 3X2EA 1XGKA 1BMDA 2DBZA 4XB1A 1YOVA 1Y8QA 2V6GA 3GEGA 4GKBA 1HZJA 4UAGA 1U7HA 1VLLA 1E3EA 1W73A 1K6XA 2WWRA 4ZHSA 3Q9NA 3FNGA 3OJEA 4YRDA 1H5QA 3IJPA 1O89A 2QW8A 4CODB 4BO0A 3L6DA 4O6VA 1YQXA 4NDNE 2WSBA 2AW5A 4ZA2A 2P5YA 4MVJF 2X4GA 4JK3A 3MZ0A 3TRIA 3D3WA 1MG5A 2TMDA 4R1NA 1MFZA 4TWRA 2I76A 5CP8A 4BNZA 2Q99A 3DB2A 4L8VA 2E82A 1IHXA 3FCOA 3NT2A 4IMPA 3KZVA 4XGNA 2E49A 4OIMA 3JQ8B 5DNAA 1SNYA 5KJFA 2AEJA 2P9CA 1SEVA 4IDCA 2XF8A 5DCWA 3UXYA 4C4OA 1PSDA 1F8FA 3SLKA 4KWHA 5G0WA 2OOSA 3TL2A 2GR9A 3K96A 2IEDA 3ZDFA 4GX5A 1ZNQO 1JKJA 4I5EA 4IJUA 4J4HA 4ALJA 3ZWCA 3A9WA 3MCVA 4OSPA 3WIEA 1ONOA 1GUYA 2XOXA 1PS8A 2Y67A 1AHIA 3MTJA 2IE0A 4JBGA 3OP4A 3V2UA 3CTMA 2DTXA 1VKNA 1SOVA 5ICMA 4TVOA 1CQJA 2WEKA 3IP1A 3KO8A 3JQEA 1EUCA 5CPBA 2FOIA 5H83A 3GZNB 4KQWA 2HK8A 4OKIA 3H9EO 1R6DA 3FN4A 3D4PA 4ZQBA 2ZB3A 1PJ4A 1CERA 1HXHA 2IZ0A 5G4KA 4AFNA 4WNCA 2B69A 2Y1GA 5I7EA 3BHIA 3WFIA 1VC2A 2DUUA 1BXGA 4MVJD 3GZ4A 3P7MA 4AG3A 1WAMA 1U2GA 1V35A 1Y1PA 2OORA 4WLVA 4CL8A 5IZCA 4DC1A 4O63O 1L7EA 1NHWA 2OGUA 2H1SA 2NADA 5CDGA 1HDZA 4D7AA 4RGBA 3ZHYA 1UAGA 3DL2A 1NVMB 3OECA 1AE1A 3MJTA 3TFQA 1NPYA 5ITVA 1YL6A 4X54A 3NX4A 5G4KB 1ISJA 2B5VA 4IXWA 1SB8A 5AXDA 2WDZA 3FR7A 4J0FA 2O3JA 1ISIA 1UXKA 1K89A 1YQDA 2O2SA 3NTOA 4CUKA 4N5LA 1B0AA 4KUEA 4YVFA 5A4DA 5HS4A 2EP7A 3L07A 1WXDA 2VZ0A 4QUKA 1KEVA 4BL5A 1ENZA 1X15A 4W9NA 1X14A 4O5OA 3ZV4A 1YB4A 4A2CA 5FWNA 2W98A 4DPMA 1EBUA 3UICA 4D3DA 3D5TA 4OXYA 1E6WA 3SC4A 1DC3A 1H94A 1ZFNA 4FFLA 5IAAA 2QQ5A 4HKTA 4DQUA 1IPFA 4Y6PA 3DZHA 5DP2A 1OBFO 1TB4A 1ZSNA 1DOHA 4ND5A 1WZEA 5LDHA 3LK7A 3S1LA 4DPKA 3ENNA 2VWGA 1U3WA 3CZRA 1N9GA 4K26A 1U1IA 3B1KA 1GV0A 3V1TC 4CUZA 1JAXA 3F4LA 1ZIDA 1HDGO 1LI4A 4BB6A 1DO8A 2J8ZA 2W90A 1EDOA 1ORRA 1Q7BA 2OFPA 3JD1A 4J7UA 3RC1A 2VHZA 1M67A 4EBFA 4MP8A 4Y67A 1R4NA 2JFGA 4FW8A 2J3JA 3W8DA 1I33A 1I5RA 4Z9XA 1FDWA 3VPHA 2O48X 5KNLA 1E3WB 2C7VA 1NAIA 3L4BA 2I65A 3GN2A 1Z74A 1BDBA 4PLGA 2CVQA 2YJZA 4IM7A 5FI3A 3FF4A 3QVWA 2RH4A 4KQXA 4NJMA 4QECA 3V8BA 3F3SA 3L9XA 4WPGA 3E82A 1I2CA 1Y5MA 2HCTA 2CZCA 5A02A 4IGEA 1VPDA 3DAPA 1ZO8A 1B8UA 4FS3A 2ZIZA 3PLNA 3D5QA 2CY0A 2BKAA 5KWEA 1NVTA 4KDEA 5ENDA 2PH3A 3VAZA 4LSWA 4RF2A 4YQYA 3V5NA 2BI8A 2A92A 3D0OA 3ITDA 1ADBA 2BHLA 3RU7A 1O6ZA 1D1SA 4ZICA 1Z6ZA 4GBJA 3R0IA 2XPCA 3DFZA 4CL3A 4XZ3A 3WGTA 3D7LA 3M2PA 4CM9A 1XA0A 2ET6A 1ADFA 1GTMA 5T57A 4BNIA 1GY8A 5A1TA 3PJFA 3AY6A 1LU9A 1FDVA 2HK9A 2PD4A 3R6DA 2I67A 3RBXA 3G1UA 3WSWA 1WDLA 1LRKA 5CDUA 2VYVA 3HJAA 3LDHA 2OP0A 1E3SA 2CMDA 2JCVA 1J0XO 2X9NA 3IMFA 1P45A 4IJVA 1PGQA 3F1LA 2R6JA 1P9LA 2GGSA 3QSGA 2V6MA 4DPLA 2SCUA 4OGWA 2CUKA 1PGJA 1A4UA 4L9RA 2Z95A 3K31A 4BNVA 2UUOA 4I5DA 4K1LA 4YJGA 1XQ1A 2GDZA 4WKGA 5JPIA 1DSSG 1NP3A 1T25A 4MP3A 1XELA 1H9AA 5L7TA 2HMSA 5JYDA 4XYBA 2CSUA 5C3MA 1OC2A 2HRZA 5A9TA 2VZ9A 4ZQHA 3RC7A 1MP0A 3S2FA 1GD1O 4R5HA 2AA3A 4MP6A 3GNTA 5KVCA 1DEHA 2FN7A 4BGIA 4JBHA 4PLWA 1O9BA 3ZGYA 5IDXA 3ZWXA 3TQHA 2Q1WA 3E8XA 1T1SA 1FF9A 4KZPA 3DBLB 1RWBA 2X5OA 3JYPA 1LJ8A 3WGGA 5CEJA 3WR5A 4P4GA 4ND4A 4Q39A 2O23A 3H8VA 4BNJA 1Y9AA 2Y05A 2Y1EA 5F1KA 4DTIA 1LDGA 1D8AA 2QYSA 4AVYA 4QSMA 2DFVA 1F8GA 1PZHA 4F45A 4YJHA 3UVEA 4DBZA 5HBRA 4L74A 1LLDA 3OHSX 3C1TA 3DHYA 4B7UA 3GEMA 2W4QA 4FDAA 1U2DA 3ONFA 4CJXA 2VOEA 4Y6SA 2NWQA 2Q1TA 3PDUA 1X0VA 1Z7BA 1X1EA 1U7TA 2EJWA 2I3GA 4WJZA 1JU9A 2VUSA 3B1FA 3U0BA 4MVJG 2X9GA 1X7DA 4PLHA 5TT0A 4PRKA 1UR5A 1N8KA 3KTDA 3PQFA 4OOFA 3DZGA 3EGOA 3JQAD 2FHSA 4EDFA 3ZU5A 2PD3A 1NQAO 2I66A 4FCCA 1C1XB 5IDQA 5ITWA 3JD4A 4QTZA 5JAQA 2GCGA 1LC0A 4O0LA 3RJ5A 4CM6A 4B3IA 2QRLA 3B1JA 4XR4A 3F4BA 5CEEA 4D44A 1BVRA 4CM8A 2P2SA 3D1LA 4Z0PA 4DA9A 3F1KA 1B14A 4F3YA 3CE6A 3F46A 4N5NA 1LEHA 4UEKA 5A5FA 4YQZA 4WCFB 3H3JA 1ONNA 4NU6A 4NK4A 3O26A 1T2FA 3LYLA 4RPLA 4RF5A 5TC4A 3GC6A 2PZMA 4NFSA 2YHIA 2UDPA 2NLOA 5FI5A 3EMKA 3OIDA 4DUPA 1E92A 5EQFA 3ULKA 1ONPA 5KVQA 4CLDA 1PZFA 5JAZA 3H9UA 1YJQA 2FMUA 4D42A 3KLPX 4L0QA 3KYDA 1VSUA 2AHRA 2JKVA 1GPJA 2V7PA 4P22A 3I4CA 3TZHA 4E33A 1X1TA 1SPXA 1BVUA 4D3FA 4IBOA 2P9EA 3GFBA 1H9BA 2VN8A 1NWCA 4EJ6A 3WBFA 4IY1A 4A0SA 4BO9A 1B26A 1E6EA 4PVDA 3AI3A 1E1MA 4LVCA 1C0IA 2EF1A 1BRMA 2I5PO 4BB5A 4PN3A 3HWRA 3JQBA 2ZATA 3P19A 1JDJA 3ROMA 4G5HA 1DRWA 2EW8A 4QQRA 4M89A 1F17A 2E6UX 3PVZA 3CKYA 2NU8A 3ZU2A 4KDFA 2CDBA 4J43A 2HKIA 1J4AA 2Y1CA 2BFPA 1RPNA 2ZQZA 3HFGA 1LBEA 4GH5A 4G65A 2JFHA 2BF7A 2NU7A 1A71A 4ONEA 4BNYA 1YJ8A 4LW8A 3ZV5A 4BUCA 4BS9A 4EUFA 1TI7A 5IN5A 3KEQA 3WNQA 4FGSA 4HXYA 3PJEA 3EZYA 4IDGA 3HE3A 3WNVA 1AN9A 1KVSA 1L7DA 1GUFA 4B4UA 2TMGA 2NVBA 1LQUA 3GF4A 1P31A 1T2EA 5BSFA 5IG2A 3UH1A 3B6ZA 4EUEA 4OHUA 1ISFA 8ADHA 1X7HA 4Q9NA 1IB6A 6LDHA 2GN8A 1U8FO 5T8KC 4HV4A 4E13A 2X1HA 1P1IA 3GPDG 4NMHA 4ITUA 5TNXA 4YAKA 3ROKA 4YACA 2O4UX 1QRRA 1NX6A 1ZKMA 5BNFA 2G17A 1K2WA 1DDOA 2G76A 3PHHA 1W8DA 3E03A 2QX7A 1VKOA 1J6UA 2C0CA 3D3EA 1QYWA 2C7GA 2HK7A 2Y0DA 3E5RA 1I8TA 2E4AA 4DL9A 3FNEA 4WOKA 5G0TA 4JQCA 4FFOA 4O1MA 5DT9A 2BFMA 3FSRA 4K9DA 3KSUA 4HP8A 3RU9A 2IODA 1UDCA 1E7QA 3RUHA 3GT0A 5TX7A 2A9FA 2VZ8A 3NEPX 5COBA 1PX0A 5IZCC 4YT4A 1K3TA 1JWBB 1UZMA 4CR8A 5A03A 4J9VA 4YAGA 3KV3O 1GUZA 4NIMA 2QZZA 3DMYA 4S1VA 3QIVA 2O2YA 5CG2A 1E0DA 3MOIA 1YXMA 5T5QA 2P5UA 4FFMA 4J90A 1ID1A 4GSLA 4WLFA 5JAIA 2OBYA 4TKLA 1N1GA 5EN4A 5TT1A 2W2KA 1ZK0A 5JDCC 2VTDA 4R9SA 1O95A 2NVWA 2H5LA 2OXIA 4R1UA 2GASA 3BHMA 4JP3A 1JLLA 1YS4A 1AUPA 3E1KA 2OZPA 3ZNOA 1GZ6A 4KMSA 1EE2A 3WG9A 2GZ1A 3ANNA 1ARZA 4NJOA 3JQAA 5ER9A 5FEUA 4IIUA 3FWNA 1WP4A 1VRWA 1EUDA 5L4LA 3CPSA 2DFDA 3BMQA 3DOCA 1ZBQA 4CLEA 5B4TA 5U4QA 4KP7A 4B79A 1XYGA 1GV1A 5JFOA 4M1QA 1PJQA 1I3KA 1WDMA 4J4TA 1U3TA 4RO0A 5T67A 2GRAA 3TZ6A 4BNUA 4ND2A 4OQYA 4NBWA 3ZW9A 7ADHA 3S2IA 2IZZA 1YB1A 4FSHA 1PJTA 3ZU3A 3QHAA 5EL0A 4EEXA 1NR7A 1HE3A 3LC2O 4EUHA 3KYBA 1A4IA 2VT2A 5COQA 1JW9B 2ZYDA 5L7WA 1ULUA 4Q3CA 1PWZA 2O3RA 1ADGA 4BIIA 2Y93A 3M1AA 1ZCJA 2EEZA 3R3JA 3L77A 5DOVA 3T4EA 2DTEA 2Q46A 3AOEA 3I52A 5TLSA 1VL6A 4PLYA 4XYEA 3OIGA 1G0OA 2EJVA 3DZJA 4IQ8A 2OHXA 3KEOA 3RJ9A 4BQPA 2Q2QA 3ZZNA 1G6KA 4CLRA 3PHIA 1MG0A 3GHHA 2VNAA 4WNIA 3ASVA 4N5MA 1PQWA 5IF3A 2EW2A 2W2LA 4EITA 1EEHA 2J6IA 1WNTA 1PEDA 4JGBA 5TIIA 4XQGA 4LVUA 1E6UA 1KC3A 1DC5A 1HE5A 1NPDA 1GZ4A 2B36A 1ZVMA 4W9NC 2I3AA 2WD7B 3PWZA 1IHYA 3GVHA 3I5MA 4FR5A 2FR0A 2G0TA 3JQ9A 3BAZA 4R16A 2CVZA 2HMWA 1DRVA 4L4SA 1PR9A 3I83A 4BHTA 4J2HA 2XXJA 4HY3A 3RQSA 4HBGA 1HLPA 3KYDB 4CLRB 2X7HA 4YRBA 4OQZA 3OF2A 4NU5A 3GR6A 3GAZA 4P8RA 1TLTA 3OEWA 2NTJA 3U4IA 3F5SA 2VWQA 4NG5A 2Q50A 5B37A 4BO4A 2C29D 1KEPA 4GMFA 3ZV3A 2GUGA 3INTA 4H15A 4FC6A 3EZLA 5LC1A 2RAFA 3AFNA 4C7JA 2CNBA 2Y1OA 4MJLA 3Q2IA 1TEHA 2Q1SA 1B15A 1M2WA 4UREA 2GO1A 3NDIA 4EI2A 3S2EA 3WGQA 4Y98A 5HRUA 4FIZA 3TN7A 3BYZA 3LF1A 3FWZA 4I5GA 2X8LA 1C14A 1P1RA 5L3ZA 3JQ9C 4R3NA 3IJRA 3WGIA 4BNGA 1HYEA 2Z5LA 2EG9A 3LT2A 3SJ7A 5CDYA 3CMCO 1ZMOA 2GYYA 4UVGA 5L45A 1MA0A 3TL3A 3LSYA 3ZNNA 3A1NA 2G82A 3FNFA 3JQAB 5JDIC 3PJGA 5EESA 1CWUA 1XLTA 4QFDA 3W1VA 3BMQB 2RHCA 3DZKA 3GNSA 1XEAA 4BNKA 4ILKA 4IJWA 2IZ1A 3GMSA 3PTZA 4Q3EA 2JCYA 3DOJA 1BW9B 1JKFA 3JYLA 4Y9DA 3GNQA 1LRJA 3W8EA 4E31A 3ONDA 2YUTA 2PGDA 4ND3A 1HZZA 5IDWA 3KSDO 1RM0A 4MKZA 2WE8A 4W7IA 3R3SA 4Z3DA 2YHUA 2BLLA 3ZHBA 1LSUA 1QYVA 3BHJA 3WQRA 9LDBA 1RYDA 4URFA 1EE9A 3W6ZA 4D79A 3Q2KA 3W4JA 5F1OA 3SC6A 4Z6KA 5I7FA 4TQGA 4IGFA 1GZ3A 4DYVA 5AVOA 4RQUA 1YE3A 4RPJA 1KEUA 4YCAA 1J49A 4RVFA 2P91A 3FTPA 1EMDA 5ADHA 4PGFA 3VZQA 4K6FA 4HUJA 4FD3A 1GEGA 5JSFA 1HWYA 1D7OA 4NR0A 4O59O 1XR3A 9LDTA 3QY9A 4DQXA 3CIFA 3OICA 3HSKA 1ISGA 2X0JA 2OUIA 3S2GA 4YDRA 3DTYA 1LUAA 2GZ2A 1KVTA 3KUXA 1KYQA 1V3VA 3C1OA 3DOOA 1YONA 1F06A 1DJQA 1KETA 2VHVA 4XWYA 1P77A 3RUEA 1C0PA 3JD2A 4WK6A 4GI2A 4KWIA 3ETEA 4ZGWA 5M6DA 1KVQA 3WXBA 4PLFA 1H0KA 4DGSA 3QVXA 4ID9A 1FK8A 3BMOB 3UF0A 3A4VA 3PLRA 5LCXA 1EBFA 1U5AA 1IZ9A 1PL7A 3LZ6A 1UZNA 4YAEA 4IQGA 5A06A 3PPIA 2Y0CA 4J1TA 4WCFA 3E9MA 1QKIA 1QR6A 4II3A 3BTVA 3HDHA 3H9JA 3INGA 4BV8A 4BV9A 4BNWA 1WLYA 4W82A 2WM3A 3D4OA 4U0JA 2FPGA 5TRTA 4BNNA 4XRGA 5A9SB 5HWSA 1PIWA 4DIFA 4A5OA 2ZTMA 5JYAA 4II2A 4YEDA 3AK4A 1R4MA 1M6HA 4EZBA 4XJSA 1O0SA 1ZK2A 1AGNA 1E7SA 1FMCA 3HB4X 3QWBA 5IXYA 2DKNA 3ZHZA 2ILTA 1N1EA 1ZW1A 1BG6A 4I9UA 3PIDA 4WLOA 3TOXA 3UKOA 4D3SA 3RROA 4OMUA 4L4RA 1HDYA 3IQDB 3JQBC 1PL8A 4Z9YA 4PG7A 5IZ4A 3RWBA 1HF3A 1YQGA 2IYOA 3FHLA 2YZ7A 3JYNA 4J0EA 3G79A 2J5KA 2GZ3A 4BO2A 5HA5A 4E2YA 3HDQA 2G1UA 1MLDA 1NQTA 5LDGA 2A35A 3CEAA 4J16A 4ND1A 2YDXA 2Q49A 4IDEA 3WTCA 4LSMA 2DUWA 1R4NB 4L73A 2JAPA 2WE7A 3H9GA 1IYZA 3HDYA 1Q7GA 2HQ1A 4R9RA 4Z9FA 3RUCA 3GN1A 1CDOA 3AM5A 4PCVA 1C1DB 1DIAA 2UYYA 1PL6A 2IXBA 3WB9A 2BMAA 1P44A 1N9GB 1S6YA 1E1KA 3HUDA 3FI9A 3SVTA 5ER6A 5A9RA 3H5NA 1DAOA 3K5PA 3VPXA 1TVEA 3CMMA 1VI2A 4PZEA 5HTOA 1I2ZA 1LQTA 4RVGA 5T8KA 3T7EA 3EVNA 1RM4A 3NJ4A 5HS6A 4MVJM 3U4HA 3CSDA 1OZAA 4RF4A 3ADOA 2VYVD 2RCYA 3K92A 2PWZA 4YJDA 1PWXA 1KBZA 1SEPA 1PR3A 1ISMA 1Y81A 4U6SA 4B7CA 1CEQA 2PK3A 1EDZA 5JLAA 3H9QA 1NNUA 4IPTA 1UDBA 2PKRA 3H3FA 4E21A 4CV0A 2I99A 1OFGA 5C5IA 3WYEA 3QWFA 3Q6IA 1BSVA 1X7GA 2EERA 3AWDA 1ZJZA 3SXPA 1ULSA 3WWYA 3ZV6A 1PQUA 4JJFA 1Q0LA 3O8QA 4FBGA 1XSEA 4B3JA 3LC7O 1FJHA 2VRBA 1ZK1A 2HRBA 1B8VA 2PH5A 4IINA 4S3MA 3TZKA 2FZWA 3OETA 2YQ4A 1FDTA 1LDNA 4LMPA 3UOGA 4CR6A 2X86A 2V6BA 5JDCA 3B20A 4ZN6A 1I10A 4WECA 1K6IA 3V1YA 4G2NA 3OMLA 1Z45A 4B8ZA 3VDRA 3BZUA 5ICSA 3WX0A 3NT4A 1AXEA 3ROQA 4H16A 3N7UA 3O8QB 4L4XA 3JYOA 3SJUA 3I4FA 1E77A 3GRKA 2FP4A 1C3VA 5KKCA 5THKA 4R01A 2HO5A 3WSVA 2HU2A 1LLCA 2HMVA 3GUYA 3PQEA 4PRLA 3RKRA 4MPDA 2GN4A 3IAHA 5JNLA 2PZLA 3MEQA 4JJGA 3SBOA 2GN9A 4D43A 5J9GA 4EJMA 2PLAA 4MDHA 5DBIA 3VVCA 4E2WA 5GY7A 1PJBA 3DTTA 2ZB8A 3GRPA 1M6WA 1V3TA 4PG4A 4J4BA 2YV3A 2WYVA 2ZCUA 3NJ8A 3P5SA 4AJJA 3OA0A 1IUKA 4GX1A 1YB5A 4JN6B 2DLDA 3OJFA 1JVSA 3DBRA 3ZWBA 2NACA 3MJSA 2PA3A 1B2LA 4K28A 3DBRB 2HJSA 4I8XA 2NQTA 2P68A 1IZ0A 1E7YA 3QVTA 1HDRA 2NUAA 2PFGA 4KUGA 4PZCA 3ZU4A 1A72A 1GADO 4PG8A 3WIDA 1TA4A 3WS7A 1F0YA 3ZNQA 4OOEA 3L6OO 4J91A 2B4RO 4DMMA 2X22A 1IOLA 3OM9A 1NVGA 5JYFA 3NUGA 4N18A 3S8MA 3S55A 1NWHA 2JD0A 1EK5A 2O3SA 2ZJ0A 3H2ZA 1NHGA 3D3WB 3WJ7A 4F6LA 2B4QA 5K9ZA 2Q2VA 4YYZA 4YBZA 4CQMB 4RLSA 2VYND 1U3VA 1XWFA 3DBLA 4H7PA 4CQMA 4LN1A 1WDKA 4WASA 3K6JA 2NSDA 1XHLA 1DJNA 3IOYA 5I8WA 1N2SA 1KIFA 2WD7A 4TRJA 4XRRA 1I32A 3KRTA 1PJSA 2R2GA 3RAJA 3BMCA 4RDHA 2W2KB 1LTHR 5K6AC 3AW9A 4NHEA 2NM0A 2CF5A 2PTGA 4ROSA 4WGGA 3LVFO 5AQ1A 4PVCA 3DFUA 1GR0A 5EMHA 4CMBA 1E3IA 1LLUA 2BGMA 1P33A 4J1SA 2W2LD 1K5HA 1T24A 4N7RA 4OYRA 3D4NA 4W6ZA 1O94A 3L4BC 3AM4A 1GAEO 1YGYA 4AJLA 4R4JA 2EKPA 1NQOA 3JTMA 3K73O 4E4YA 4QX6A 4XDYA 1WW8A 2NU9A 2ZK7A 2YHIB 4JCOA 5AXCA 5KVVA 1H6AA 4WOJA 1KY4A 3C7AA 1EUZA 3GHYA 4LCJA 1HRDA 1WWKA 5JC8A 3AUAA 4OH1A 1YVEI 2FSSA 3K2EA 2YFHA 4CMEC 1VM6A 5G0VA 3TDKA 3M2TA 2WMDA 5BSGA 1XU9A 4EW6A 2GLXA 2FPIA 2JJYA 3PHGA 1DLJA 5TSDA 5FF9A 2NVUB 3GVPA 3IDSA 4IMRA 2VHXA 2O4CA 5JDIA 4E32A 3HQ4O 3M1LA 4CMEA 4OM8A 4GGOA 4BKOA 1D4FA 3C24A 4Y6RA 2W8ZA 4GMGA 2FPPA 4LRTB 2FY8A 4I5FA 4AJ1A 2YV1A 3DAFA 5KIAA 4F6CA 3TWOA 3LLSA 2Q45A 2D59A 3VZPA 4B4OA 3QW2A 4BMSA 1P1HA 1L1FA 5A5EA 5JXWA 1JAYA 5F3RA 4ALLA 4YA6A 4DMLA 3SLGA 2ZYGA 5L9AA 3KSZO 5DOZA 2O50A 4TVBA 2O3QA 1P0CA 3C1AA 2D1YA 3TPCA 4QEDA 3GG9A 3IKTA 1KS9A 4PG5A 3DONA 1ADCA 3DWFA 5BT9A 2VOJA 3VZSA 3PQDA 4Q3DA 1NXQA 2BRUA 4R1TA 2HMUA 3TF5A 4U6QA 1DBVO 3A28A 3AUUA 4XIYA 5CFZA 4DIOA 1MUUA 3WYCA 1MXFA 4TRMA 3HG7A 1ZEJA 2Y66A 4QXMA 1DIRA 1W6UA 3DHNA 3G17A 3O03A 4YAIA 3H4VA 5AYVA 3RUAA 5TJHA 3VKVA 4CMIA 2OL4A 4BMNA 1MXHA 4M8SA 5DBFA 2IEBA 3NKLA 3PGJA 4AJHA 3WLFA 3E18A 4BKUA 1R0SA 3PYLA 3GY0A 3WGYA 3PRJA 2GN6A 2Y68A 1SBYA 2VCYA 2VRCD 5C7OO 1DIGA 4R68A 4NBTA 3UCEA 3LQFA 4BKRA 3U49A 1DC6A 3MJ4A 4DWVA 1EZ4A 1BGVA 4ZVVA 1NAHA 4AJIA 1HE2A 1D3AA 2WYUA 1OC4A 5K6AA 3L4SO 4DQVA 2PR2A 3IP3A 4F46A 1YH3A 3PHJA 3DQPA 4CMJA 3PEFA 1NPTO 1SAYA 1OAAA 2UAGA 3DEYX 5I7VA 1Q0QA 1NBOA 1R0KA 4MVJP 1MC4A 3I9KA 5EIOA 1V8BA 3C3XA 1JA9A 5CHEA 1M76A 1GL3A 3I23A 2QIOA 4YT8A 4OL9A 2OMEA 4CQMD 3Q0EA 2AEMA 3HN2A 4MKRA 1EVYA 2NV6A 1EFLA 3PK0A 4ZD6A 3SEFA 3GOHA 4XGIA 2VTEA 4U0KA 2CDAA 4H3VA 4WE3A 2A94A 3A14A 3GLQA 1E5QA 5A3VA 5TJ9A 5U1PA 3GFGA 2EWMA 3STHA 3CXRA 4A26A 4WUVA 4CM1A 4PZDA 4RQTA 2BFAA 3F9IA 4RORA 1P1JA 4XQCA 3UHAA 3GGPA 3KLMX 5BNTA 3GPIA 3QJ5A 2R00A 1AXGA 5KJCA 4Z0TA 4WCDA 5C37A 1D1TA 5IXSA 1ZZEA 4NFYA 1QSGA 4DLAA 5I7SA 5J23A 4CLHA 1WMAA 4ESOA 5JCJA 1LDYA 3IIEA 1H93A 2FRDA 1LX6A 4J3FA 2AG5A 2C5EA 1E3LA 1QYCA 3BMNB 4E0BA 1SMKA 3QA9A 4R54A 1B8PA 4UEJA 4FPXA 1GEEA 5JY1A 1DIHA 1IL0A 8LDHA 3ZWMA 3OH8A 3IUSA 1UP6A 3VH1A 1A9YA 1ZK3A 2Y1FA 4RDIA 3E9NA 4WLUA 3DDNA 2VHYA 1HEUA 1DB3A 4RL6A 4MVJH 3L6EA 3HB5X 5CPFA 4ZQGA 3H5RA 2J5RA 4NPCA 3QP9A 1YRLA 5I9NA 3BTUA 1Y9EA 4RVDA 1C1XA 2AQKA 2CFCA 2Q4EA 2DTDA 5KKAA 3OIFA 4GLOA 3WGZA 4BGVA 3OQBA 2C5AA 4IDFA 1G1AA 2CVOA 3RI3A 3GMDA 1M66A 4RJTA 5L7YA 5CG1A 4I9NA 1E1LA 2OBNA 5BQFA 4MVJI 1O8CA 1Q7CA 3FRJA 3RUIA 3HN7A 1A7AA 1QV7A 2B4TO 3AM3A 4XKJA 5GZ1A 2DAPA 1I24A 3DBHA 2X5KO 4P4NA 2D0IA 3PDJA 4GX2A 4LISA 3GDOA 2LDBA 3C7DB 3AJRA 2AG8A 3H7AA 4JBIA 3PZBA 5KJEA 1U3UA 3QQPA 2EKLA 3H2SA 4CLOA 3ICCA 2JFFA 3C7CB 3Q9UA 3JYQA 1U8XX 4AJNA 4BNFA 3GDGA 5MGBA 1NQ5A 5DF1A 4ZU3A 4E2ZA 2EKQA 1BHSA 1IULA 4DYDA 2BD0A 1PQPA 3QVSA 2FSVA 3OFSA 4IZIA 4RF3A 3NYWA 5THQA 3WMWA 4CMIB 1ZSYA 3UAGA 3DR3A 3ST7A 3UN1A 3T4XA 3VTZA 3U9LA 1QMGA 4Q3BA 3OA2A 3WOHA 4BO5A 3LT4A 1DAPA 3G0OA 1NYTA 2E37A 1P1KA 3AI1A 1Z75A 1PJ2A 3OJLA 1H6BA 5B12A 1VSVA 4CLXA 4XD2A 1MV8A 4FFPA 1E3WA 1NFRA 2B0JA 2JAHA 4TRNA 4LRSB 1GYRA 3UCXA 2JL1A 3Q3CA 5ILOA 2LDXA 1BWSA 1BXKA 2YY7A 2H9IA 3BTOA 1Y5RA 3WFJA 1BXZA 4BNXA 1WZIA 3NAQA 3CZMA 4IDDA 1EQUA 5TS3A 4KUHA 2C82A 4JJIA 3R1IA 1GYPA 2ZYAA 4MIOA 2X0IA 3KETA 1T2AA 4CM9D 2YYYA 1Z82A 1QORA 1I01A 3GH3A 4UUOA 2VUTA 4BGUA 1UH5A 1OMOA 3ROPA 4AJOA 4P38A 5EPOA 3RUFA 1UXIA 4AJ2A 3O38A 4GWKA 5A3JA 1HE4A 3OEYA 4DXHA 4CM8B 5CEFA 1XG5A 4MIYA 5EERA 1FDUA 2P4QA 2Y1DA 3QWAA 4HNHA 1N92A 4M54A 3VKUA 3RKUA 1A27A 4DRYA 1HYGA 1DLIA 3AOEC 4DVJA 1H2BA 3EYWA 5AXAA 3H65A 3VH4A 5CDSA 3ZWYA 5CAEA 4KOAA 4MVJE 3JCZA 3V2GA 4CQLA 3O4RA 4AL4A 1RYEA 1OOEA 3PIIA 2B37A 3DHEA 4HFMA 1Q1NA 1U28A 3GEDA 3KXDA 4K6CA 3U09A 3RCBA 1LLQA 3W6UA 1GQYA 4NJMB 5MDHA 4J6FA 4E6PA 3PWSA 3V2HA 4FB5A 3DMTA 3IC5A 4RVSA 4RVUA 3CUKA 1PJCA 4CV1A 2GD1O 4U8GA 3ZH2A 4N54A 1NFQA 3ETGA 2VT3A 3DC2A 1H6CA 4PLVA 4CM7A 4C7KA 1CF2O 3DMTC 1LDBA 2GERA 3OBBA 4JIGA 5AOVA 4J9UE 3WGHA 3FTNA 4UULA 4GLLA 4MOWA 2EP5A 3I9LA 1RM5A 4NZ9A 4EGFA 4RZIA 3INRA 2UVDA 2VHWA 4UEOA 1N7HA 1E7RA 4ALNA 2QRKA 1Y6JA 4DC0A 3JV7A 4YPOA 4TRRA 2C59A 1QG6A 3PJDA 4J49A 4OAQA 5H82A 5FFFA 4YJFB 1S7CA 2DBVO 1GCUA 2FZEA 3IKVA 2PGJA 4EJ0A 3CINA 2D4AA 1Y8RA 3E9QA 4M49A 2ZTUA 2AEFA 4BNMA 1UUFA 3WJAA 3ZWOA 5L40A 5G0UA 3KVOA 3GK3A 5FYDA 1VL0A 4XQ9A 2CDCA 4I9HA 4A73A 3JQ6A 1YL7A 4XDZA 2DPGA 4TKMA 1EQ2A 2ZTVA 3UUWA 3VZRA 2HSDA 1P74A 3I9MA 4G81A 5IJZA 2C2XA 3RBZA 2HDHA 1ENOA 4GKVA 4MKXA 3IS3A 4ZJUA 5JCXA 2V6FA 5EJ2A 1QP8A 2PV7A 5KVSA 1DC4A 3PFWO 1SCUA 1A7KA 3C8MA 1FDSA 4YJHB 1JN0A 3ZNPA 4B3HA 1W0CA 4RCVA 4NH4A 4ZRMA 4CV2A 2HUNA 3JD3A 3A06A 1QV6A 4IJKA 4UVIA 4YT2A 1PZEA 5JMPA 3BMCB 3VPFA 3I6IA 1E7WA 1KERA 4FC7A 4BO7A 3GG2A 3FPCA 3ENKA 1V3UA 3JQ7B 4HNGA 1R37A 1GQ2A 4DLBA 1X0XA 4CM4B 4L75A 5A05A 1E7MA 1ZK4A 4A10A 5EINA 1HLDA 3FD8A 1HYHA 4YB8A 1KY5A 3GZNA 4XCVA 3EDMA 2I9PA 4BO8A 3AUTA 3EUWA 2NVUA 4XA8A 3GVCA 1PGNA 1R15A 4LK3A 3VH2A 1F12A 2EV9A 4M87A 4B4VA 4FOOA 4NBRA 2AXQA 4FJ1A 3ASUA 4EYEA 4RV9A 1HL3A 2C54A 5JW6A 4IIVA 4DBVO 3T7CA 2Y0EA 5IDYA 1JTVA 4IS3A 4L76A 4Q3NA 4GAEA 4IDBA 2EHDA 3W8FA 1ZH8A 3NRCA 1HSOA 1B7GO 2AQHA 5L95A 3N74A 3N58A 4U5QA 5JCJD 4ZRNA 5F1PA 3COSA 1A5ZA 2AQIA 2X0NA 1Z73A 3W4KA 1UXHA 4W99A 2WD8A 3VH3A 4NBVA 4TZKA 1RJWA 3WGOA 5JYEA 3MJVA 1GPDG 3PYMA 2QHXA 5U9CA 2GNAA 5K0ZA 4OJNA 4WLNA 3H6KA 3GGOA 3WMXA 3L0DA 3NV9A 1UP4A 3UW3A 1O5IA 4CMAA 3DXFA 4OXKA 3PI7A 3I9OA 3ZHXA 4GGPA 4A27A 2GSDA 4GSKA 4DLLA 1XIVA 4CM4A 4CMKA 4R51A 4IZHA 3FBTA 3VC7A 4FN4A 4R41A 3ANMA 4BGEA 2GF2A 1ZSVA 5F5NA 4JX8A 4NBUA 2UUPA 4YAJA 1K6JA 3UCFA 3WYBA 2D2IA 2C07A 1MC5A 3AFMA 3VTFA 2IXAA 5L4SA 3CH6A 2ZCVA 3GDFA 3HNPA 5JBIA 3FR8A 2X5JO 2IYPA 3HZZA 5C7LO 1A9ZA 3FBGA 3K30A 3ON5A 2HAEA 2O7QA 4CM5A 2Y99A 4BO6A 2X0RA 4HADA 3E48A 1R0LA 1F14A 3DBHB 5F5LA 3QWIA 4JROA 3HFSA 3K2BA 3DBVO 4D45A 1ZUD1 4JXKA 1JQBA 3BA1A 5L51A 3F6YA 2AMFA 3BIOA 3X2FA 4NNJA 2FWMX 1LC3A 1U5CA 1Z7EA 4J2OA 1N5DA 4D46A 4NK5A 3I9JA 1CQIA 4LMRA 4JLWA 3BTSA 1DIBA 1X13A 4CUJA 4BNHA 1BTOA 1GQQA 1K0UA 3ANLA 3I6QA 1YDWA 3RUDA 1LA2A 3GGGA 4BNLA 2X6TA 2Q3EA 5I9MA 4RPHA 5A9SA 4ALKA 3MJEA 5JO0A 1ENYA 3E6AA 2BI7A 3TJRA 4W4TA 3UFXA 1I3LA 4FJ2A 4XGKA 1I36A 2QYTA 1NFFA 4IQ0A 4LGVA 4XYLA 2CF6A 4QFCA 4PLTA 3QVOA 4P4LA 2PZKA 1EVIA 3NT5A 1C1DA 3KYCB 3ZWNA 4Y8VA 2ZB7A 2Z1MA 3F5QA 4YWJA 1PJLA 3JQ8A 5DCYA 4WEOA 5G2OA 1ML3A 3EK2A 5DULA 3MWDB 4IDAA 3KHUA 2JD2A 3EC7A 4UUPA 2H6EA 4UVHA 3NTRA 2Q4BA 2BGKA 1TT5A 3NDRA 3RSHA 1DPGA 1E3JA 1HKUA 2A4KA 2NU6A 2YFQA 3QE3A 2Q2WA 1Q2XA 1H6DA 3DZIA 3U62A 2BFOA 4CM3A 1EK6A 4CR7A 2HJRA 1Q0HA 2WTBA 2DBRA 2UV8A 5C7IO 2PD6A 1JWAB 2B5WA 2FR8A 2PNFA 3OJOA 4NI5A 4XYMA 4CMCA 1LSSA 4CPDA 5IN4A 4E12A 1I3NA 1SB9A 1XKQA 1GFSA 5JE8A 5ENVA 4TSKA 1XCBA 2CD9A 4WEQA 1QYXA 3ZWVA 3RD5A 4UUMA 3ABIA 1HDCA 1DXYA 1R66A 1GCOA 1YDEA 1PS9A 3ETDA 2ZTLA 3DAGA 1OI7A 3JSAA 3LT0A 1RKXA 4E5MA 1W4ZA 4NQZA 1P0FA 1I30A 3F47A 2D5CA 2VWPA 3DZBA 5JC1A 3WQQA 1PTJA 2AQ8A 2B35A 4XYGA 3I9NA 4GWGA 3RASA 1CJCA 3MTGA 1C0KA 1UAYA 1N7GA 3ZI0A 1LNQA 2EGGA 4XQEA 3H5AA 2VRCA 3G49A 4Z3KA 4HX5A 3ZW8A 3GQVA 2HMTA 4IUYA 2XAAA 5AXBA 1TXGA 4ZQEA 3EY4A 4IS2A 2R00C 2V65A 4BMVA 4AJKA 5B4VA 3U4DA 3PGXA 1EVZA 2JD1A 4YR9A 4UUNA 4INAA 3GAFA 2C2YA 4YTEA 3JQGA 2IRWA 1VJTA 5GZ3A 4HFJA 1UDAA 3JQ7A 4BKQA 1DRUA 2Q1UA 5DCUA 1VJ0A 5H81A 5BR7A 5EQDA 3OSUA 4A7PA 2QRJA 1IPEA 1NTOA 4AJEA 4RPKA 1SO8A 3RC2A 2X9VA 1SZJG 4PG6A 4BOYA 3EVTA 1ZXLA 4RZHA 3DZFA 3VPSA 1Y8QB 1YOVB 5TQVA 3SX2A 2YV2A 4D0SA 3O9ZA 2E48A 4BO3A 2H63A
chains in the Genus database with same CATH superfamily
1XX6A 3KB6A 4EO9A 2WFZA 1XEXB 2BHTA 2O0MA 4A0FA 4HDNB 4JFAA 3D2AA 4H0NA 4DMHA 3BCUA 2B2CA 4M8LA 4HSEA 3UOWA 2BONA 2F3RA 3WICA 3L0BA 3G5MA 4U6NA 3STVA 4LJLA 3AI2A 3O8BA 1SUPA 1VBNA 2E5WA 5AVJA 1B3BA 2PY6A 4F3NA 1IY8A 3EYAA 1HSZA 3B1ZA 4KV7A 4ZVUA 3HDGA 1XU7A 3LXMA 2I87A 1BE0A 2J07A 4R69A 2G71A 2RIRA 3EAFA 1WZUA 4GVLA 2CVPA 4I2NA 1YO6A 4PWZA 4Q1EA 4URWR 4D41A 1JENB 4ZJZA 3U6KA 4AIIA 1A9TA 2PGOA 3T3OA 1S2LA 4W63A 3UMYA 5JSKA 1R16A 4QQFA 3EGVA 2DC1A 1DMSA 4HH1A 2QUJA 5T73A 2Q29A 3OX2A 3VSBA 3DE3X 4OMDA 1N2XA 5DNCA 4DUYB 5K3FB 4ARSA 1SRQA 4I1IA 1QHXA 3NDBB 3B70A 2RMKA 1XA3A 4XFKA 3ZXYA 4F6RA 4RH1A 3C15C 2JKYA 2AYXA 2WWFA 4UTNA 2NQ8A 5GM2A 2I2XB 4GE3A 1WSBA 4UZSA 3BGIA 1X86B 2QW0X 2QE6A 3EAGA 2C7PA 3PZRA 3BB1A 3FFTA 1OYOA 3E9DA 2DWQA 2VH1A 4LWZA 4BWGA 4QKQA 3V7YA 1TF2A 2EZUA 3IJEB 3D64A 5T6BA 1IEWA 3CX3A 2JGNA 3NIGB 3PGKA 3K9QO 3AIMA 3SJCA 1LK7A 3N0RA 4M0KA 1AGPA 2E9SA 4NNOA 2NNLD 3ICPA 2E7ZA 2ZXUA 4WERA 3A1FA 1N7IA 2NU9B 4CGYA 4B82A 2LCQA 4X60A 3IIJA 3SIXA 5H1YA 2ERYA 5K3AA 1EZ1A 2N47A 3D8HA 2CLFB 2WUGA 3H5OA 4RVNA 4XB6B 4X91A 3WP0A 2PKQO 4R5MA 1J8DA 1G20A 2OP1A 3F90A 3I0ZA 4XAQA 4IDHA 3VDQA 4DLSA 1J24A 3HDJA 2WC1A 3PP8A 1LTQA 4TSFA 5FWYA 2FX5A 4IGAA 1XDBA 2C7BA 3AJDA 1YSCA 1GP2A 2D2VA 4XB2A 4M7PA 3TIVA 2HF9A 2ODPA 3AKYA 3N0XA 4YHBA 1VLVA 5IBQA 5BW5A 1KFEB 4U7JA 2W2OA 3AUSA 3LU1A 4KXVA 4P84A 4YO8A 4E7OA 3LUGA 3OQNA 1RQLA 4F7WA 1NRJB 2VPPA 2F4VB 1P1FA 2A5LA 1OXUA 2GLTA 5CYFA 3VKWA 4EI9A 4OQ4A 4C4SA 3UPTA 4LFAB 3FPLA 4HGYA 3Q8KA 3F8WA 1VL8A 3BD8A 3FLAA 3V8QA 4MUAA 2VQ3A 3C14C 1JNYA 3IT2A 2M9MA 2NXCA 1B42A 2EQAA 2RHRA 5BO5A 4DSTA 5BPHA 1IK4A 2QBYA 4I08A 4O89A 2JLXA 1IUNA 1G0NA 4LBZA 1HOXA 1G20E 2OFFA 1AF4A 3LC1O 1XNRB 2OO5A 2V1UA 2I4NA 2QZ9A 4W7HA 3PFFA 4H9GA 4PYQA 3I5YA 2FA9A 3DS8A 2HHHB 2HDNB 4J2TA 3DMGA 1PW5A 5I8ZA 1QHHB 1XDWA 4HRYA 5HZMA 4BVAA 1I3MA 2CXUA 2ZS7A 4NFLA 3RTBA 4ETWA 1RAGA 2WF9A 4CEJA 3FOFC 4G0OA 7MDHA 1NW5A 2B8EA 1TLLA 2E18A 4XDGA 2IH4A 2JS7A 4YJKA 5FXMA 2DERA 1E5LA 2N1MA 3R75A 1VE9A 5BSEA 1XI2A 1YR7A 2EIXA 2VDWA 3O91A 3T3PB 3AI7A 3EVDA 1U4SA 3K8YA 4BWFB 2WJPA 1JVBA 1Y7TA 3W6PA 5ALVA 2X9LA 5FX2A 1L4UA 3HXTA 4WSOA 3QUSA 4WBNB 3FWPA 1AQIA 2Z4TA 1PU2A 2ZSFA 3BBLA 2PLWA 4XLZA 5JY6A 2WDPA 3ZWWA 3KPWA 1GZHB 1T9AA 2ACEA 4F84A 4XX0A 5C5DA 4AROA 4HEA6 3HN6A 1L3CA 4O02B 1RZVA 4PF1A 2FAXA 3K20A 2OKGA 2ZRMA 3R0VA 4JLUA 5FHQA 1QXSA 3PDCA 4K86A 4PPGA 3MK31 1YBVA 3IYLW 4U02A 4B2IA 2FPNA 4HAWA 1GL9B 1EFUA 1W52X 3TEMA 3UQZA 1G8JA 3D3NA 1RBZA 1HETA 2CD7A 3H1PA 3JZIA 4J1NA 1N8NA 4GVXA 4MCAA 1J9EA 2WA1A 5FBZA 2DQZA 1VB3A 3F98A 5JXJA 2Q07A 5KC9A 1SBCA 4YJ2F 4C9BA 1M6YA 4ZMRA 2CLIB 2P67A 1ZJYA 3FTCA 3RUPA 1YBAA 3P9NA 3M0EA 3WYFA 1A5BB 4LE2A 3RTCA 1XCGB 2OGWA 1SXPA 4FHDA 2OORC 4JP5A 2HQOA 3CRW1 3OOYA 1E2QA 2PDAA 4FYKA 4LMAA 3CZ5A 2ODAA 3TCXB 2QY6A 2HWYA 1JHMA 2I4LA 2FWIA 4K2HA 1H05A 3WBBA 2NSLA 4PIVA 1LSOA 1NW8A 3RO7A 2CW5A 5JD4A 2B25A 1ZMXA 3RHFA 1NASA 2VF4X 3FZNA 3RTAA 3GFTA 4YMGA 3ZJTA 3OZRA 1XKTA 3EHEA 4DDVA 1TJ4A 3RIYA 2EGHA 4I50B 3ZZ0A 3PS9A 4D6PA 5K0NA 4CLOB 2VHEA 2VYNA 3GQBA 3WQSB 5JBNA 4JJAA 1TZBA 4JD5A 5KTNA 5TGTA 1E8NA 1PGOA 1DBWA 1TMGE 3QX3A 1CU1A 2D0PB 1EX6A 2H4WA 3IEPA 1KC1A 4OUDB 3ZHQA 4LHXA 1CEEA 3RYCB 1IC6A 2BN4A 4AZSA 2K7FA 4JXJA 4PLZA 3K9FC 5REQB 3FYDA 4PLPA 3SX4A 1FU4A 3NYQA 1AKWA 1M74A 2DM6A 2XUOA 3P2OA 1QIKA 2QMOA 3CSUA 2HSGA 4BO1A 4KGXA 4KFTA 3M6IA 1Z3IX 4QEKA 3AQIA 4OPMA 5LYYA 3T9BA 4HL6A 2GPNA 3SKVA 3P20A 2CK3D 5JEEA 3TSCA 4YT5A 3IE2A 1WMBA 2DPHA 5LQKA 3KP1A 4DWJA 3M49A 1HDOA 3A4IA 3G2PA 3E1SA 2XWJI 5KQSA 3W5SA 1QO7A 121PA 2VHTA 1V5EA 2D06A 1U4OA 3AJ8A 1GYQA 1V9LA 4E30A 1FVFA 3JZMA 1T1RA 2C8KA 2OHHA 1UQTA 4TYQA 2VT7A 2VJLA 4ZO6A 1JLSA 1SC1A 3G9UA 3QFRA 3T1QA 2VBFA 3EW7A 2X4LA 4HXFB 2Q0XA 1V2HE 1RMYA 3QV1A 1SXHA 3BXXA 4GI7A 4QSHA 3NETA 3VC1A 2YR0A 3MJCA 1KSFX 1J39A 1RP1A 2E87A 2YY5A 5HVNA 5DZSA 2YYAA 2PRIA 1HTBA 5FBHA 4KBGA 4Q1VA 4AT1A 2C20A 1XMQB 2BP7A 4FYYA 3HY6A 3IQIX 3LLVA 3RREA 2HTEA 1Z5GA 3OCWA 4R3WA 1L5NA 4MUEA 2FNAA 1KYVA 3AG5A 5BNIA 4NFHA 3ZWPA 4IH9A 3OEED 1XQ6A 4DG5A 4ZJYA 2G5CA 1KI6B 2H0AA 5AVSA 3AKZA 1T2DA 1O0BA 2Z04A 1R00A 3A10A 3C7TA 3VNRA 1KI8A 3Q3HA 2COUA 1JPNA 4N0QA 4A0GA 1ZAYA 1N25A 1PGPA 1UT8A 1SC9A 4P34A 2BBSA 1QK4A 5BSHA 2EFJA 1LDMA 2J3IA 3AOGA 3NGLA 4C0LA 2JIQA 2FR1A 5LR6A 4LHZA 1GRRA 2YIMA 3AR9A 2XIJA 3MLBA 4J0HA 4U9HS 1N4AA 4IJ6A 1XGKA 2V6GA 1RRFA 1YZHA 2Y92A 3ZBPA 4E3WA 1U7WA 1E3EA 4P0QB 1YULA 3A6PC 3WWOA 1FYFA 1X74A 2VPIA 2WMNB 3FNGA 3MUEA 5HE8A 3SMQA 4G41A 4YRDA 2AL7A 3L7NA 1JIJA 2EF0A 3SC2B 3TIFA 1LGYA 4J0IA 5LDDC 3IBCA 4DMFA 2DE0X 3BJRA 4BO0A 3L6DA 4UBJA 4HNSA 3EISA 1X7XA 2OWDA 4O6VA 5MFZA 2WSBA 2QLLA 1M8FA 5LU9A 5DX0A 3WKDA 4BBAA 3KSBC 1RJ9A 1NP7A 2BSXA 5FO1A 5BR1A 2VDKB 1KMIY 2V0CA 2WG0A 4YRSA 4IOLA 3QVMA 3HACA 1BZYA 1HYBA 4TWRA 3MTEA 4WY8A 2JRCA 3VO1A 4DJTA 4L8VA 3GMIA 1GRCA 1F6WA 2WSSD 3R5KA 3DVQX 3K0FA 3RADC 2K2WA 2R97A 2P9CA 1SEVA 2PS0A 3PFHA 4QVKA 5DVZA 3EH1A 3B13B 3K35A 3MERA 3CCCA 4YRRA 5FAXA 4MPTA 5G0WA 2C4TA 4PC2A 2FEOA 4XIFA 3HUTA 4GQBA 5FNVB 2OOSA 3SMVA 5FV4A 3K96A 5DNYB 5AR1A 4YHHB 4Z7OB 2ZSKA 2WIBA 2EFCB 1ZNQO 1NW7A 3QLVC 4FYXA 3ZK8A 3WRVA 1SVKA 3A9WA 4KLAA 5FR1A 3OZSA 3TPFA 5BP7A 1W5EA 2AVDA 4AN4A 4UOZA 3CT4A 3R6GA 3HVKA 4EF5A 3HVIA 1E79D 1AHIA 1XQ9A 2PMEA 1X42A 5CVDA 1NJ2A 2D1RA 4ZEWA 2I1LA 1FDRA 1K9VF 3KX2A 1CQJA 4G0WA 3PQVA 4YWHA 2CJFA 2P5SA 5L3SB 1WR8A 1YS7A 1EUCA 2CUNA 2FOIA 1IQUA 5ISMA 4RGQA 3SDSA 1XWWA 1GTSA 4K6GA 3BIXA 2JI6A 2A8YA 1Y1LA 4Q9JA 1B93A 4JWTA 3OAAA 3VR0A 5ADUS 4ZOQI 1QOPB 3LFHA 1G7CA 1YJXA 4U8HA 2OM2A 2BHSA 3GEBA 4MEJA 5EKUA 3AEQB 2JZCA 1VSQA 1TO2E 1QF9A 5J9FA 2WJVA 4ZO7A 4AFNA 4CIVA 3ESCA 2HBZA 4Q24A 1YZLA 3T3NA 4QBIA 3OMWA 1KQOA 1N0IA 3BHIA 4NYMQ 3G23A 3UV7A 3BERA 1KJIA 5BV7A 1VC2A 2NO4A 3EDYA 3HC7A 4TWIA 2P7HA 4MVJD 1UM8A 4E1AA 1P5JA 1PYGA 3HB7A 3TQCA 1V35A 4BQSA 4DR3B 1QE0A 4P5PA 4YREA 4BE4A 4DLTA 4P3NA 3STYA 3UHPA 2QTWB 1VPTA 2H1SA 1Y5LA 5CDGA 1T3LA 2B8TA 2RHMA 2E4UA 2LTAA 3VU1A 2XUHA 2AZ4A 3VO2A 2HGZA 1Y4UA 3NGMA 2C92A 3IOCA 1AUOA 1NPYA 1BD3A 1YL6A 5DSTA 5IKPA 4TV9A 3MFQA 1PO7A 4G8CA 1PFGA 1QH8B 4CG2A 4FYJA 1ISJA 4FMBB 2AN1A 2B5VA 2A6PA 1CJTC 1ZD1A 1XCMA 4J0FA 2O3JA 3O8RA 1UXKA 2ID8A 4OYLA 5IF9A 1YQDA 4B8YA 3U7HB 1CTQA 4CUKA 1WKCA 5A4FS 5AVQA 2WINI 2OV4A 4LJKA 1QGUA 1JG7A 3DZ6B 2I7CA 2JASA 4KUEA 4E51A 1WXDA 1FPQA 2Q0QA 4EECA 4O29A 4DT1B 3L3BA 4HEHA 5B7QA 1X15A 4DQDA 2QTGA 3VGJA 1OXKB 4O5OA 1GG8A 2GAOA 1FTQA 4ZPXA 2W98A 4D9MA 1FXWA 3R09A 4OHFA 2Q1YA 4EKDA 3C4VA 4TT8A 4UXJA 3UICA 5B1HA 1XTBA 2Z2IA 4OXYA 3SC4A 3VR6D 4FEAA 1DC3A 5JFTA 4H6VA 1RLMA 1ZFNA 1P81A 3FVQA 3M33A 1X8XA 4NXNB 4OHZA 1IPFA 2CHFA 4Y6PA 1PW7A 4RK6A 1MKYA 5DMHA 1OBFO 1TB4A 1E18A 1NJGA 2VJMB 5FOVA 5FWDA 3LK7A 2W6NA 4F2WA 1CQPA 2PT6A 1U3WA 2J0EA 1WMSA 3CZRA 1U1IA 3QLUA 2AWNA 2R0QC 3NU1A 4GE0A 1AGYA 1PP4A 2GBLC 2JGDB 5CX1B 2GT1A 4HWTA 4UBLA 5DN6D 1T0UA 3BCRA 4BB6A 3BS4A 2W90A 1UT5A 3PC8A 4L8GA 1EDOA 2ALJA 2OFPA 3JD1A 2WPDD 4J7UA 3B3AA 1D6MA 1NF8A 2H8GA 5HIIA 3SFVA 3VO9A 3WLKX 5D6NA 1HK7A 1R4NA 2J3JA 1H4QA 3UWOA 4KBFA 3STWA 4IYRA 4JOBA 1Y7PA 1TW2A 5H7XA 2C7VA 2M98A 3L4BA 2CLMB 1O97C 4JT4A 3GN2A 3UUFA 4BRWA 1Z74A 2X5NA 1FNCA 2DFPA 2YJZA 3R3YA 4DIEA 5JVDF 4KAXA 3QVWA 4KQXA 3I58A 2NTEA 2XCIA 3MWJA 3F3SA 1X8KA 3FVWA 3HSSA 3E82A 3HO8A 3LLMA 1QHGA 1VL5A 2CJYA 4P7FA 4TYMA 4D9KA 5F9FA 3GLGB 4DHEA 2CGEA 3DAPA 3GXOA 4OYYA 4FMCF 2QRQA 1H4TA 3PLNA 1QDEA 3DVRX 4PAMA 4BQOA 5BWNA 3KJHA 1K2VN 3A58B 2GBCA 1YZ3A 4KZKA 2FK8A 2DLCX 1L4YA 3U17A 3B6MA 2J9XB 2VHCA 3U5ZB 2IW1A 2A92A 3D0OA 3PA8A 2H5JA 3BF7A 3EDRA 1STOA 4XUDA 4ZMBA 3RU7A 3WHKA 1D1SA 3H83A 4PINA 4XCXA 3A0UA 3WV5A 2Q8NA 4B76A 3LM8A 1YZTA 3IA7A 3DFZA 3K16A 2DWUA 2OG2A 4TWZA 1YKSA 4D5EA 2O8CB 1X80A 2CKDA 1TEXA 1OHHD 2VT6A 3MXTA 5LJIA 3GBSA 5T57A 5JIBA 4G5GA 1Y7IA 4G0UA 2JLSA 9GPBA 1M2EA 2OLKA 4G4SO 5D00A 3PJFA 1Z68A 3MUNA 2EDAA 5H59A 5JZBA 4LXQA 3IT0A 3G1UA 3WSWA 1WDLA 4IMIB 5C5CA 4FIDA 4MV8A 4AM8A 3IBSA 4KK4A 3D8TA 4YP0A 3LX5A 1XEFA 2CMDA 2JCVA 2X9NA 3VO8A 1JV2B 4IJVA 4DIMA 1JJAA 1SKAA 3MPUA 2V6MA 4NY1A 2YFYA 3ER6A 2O59A 3AETA 2CUKA 4UBKA 1P60A 1I7NA 1U9CA 5CNKA 1A4UA 1NBWB 5DHRA 1NURA 3E7XA 2ONYA 4X95A 3HJBA 4L9RA 2IH2A 1DNPA 1SIUA 5DXAA 4OATA 4YJGA 4ARCA 3MBKA 3KKKA 4WKGA 1DSSG 4UTZA 3DGEC 2FN3A 2JLRA 4R05A 2HMSA 5ICFA 1SG6A 3V4RA 3K0CC 5D86A 5LSAA 1S4QA 4BLSA 3EPPA 3OQPA 1YUNA 3KAJA 4ZQHA 1MP0A 1L5SA 1AF7A 3IHLA 4RABA 2FKAA 3GNTA 1EVQA 4RLFA 4BGIA 4PLWA 2FCAA 1O9BA 1JYSA 5JTUA 2Q1WA 3E8XA 3EEBA 1FF9A 3BSFA 4GIBA 2X5OA 4KI7A 4LDZA 3MIZA 3U0VA 1MEOA 3GJQA 3WGGA 4WBXC 4AWXA 5CEJA 4G9EA 4Q39A 4HLNA 2O23A 1QH8A 1P2UA 1W85A 1Y9AA 2Q7DA 4B5KA 1BCRA 2WAAA 3I30X 3KTOA 3M4JA 1TCVA 2OV2A 4K1XA 1KIAA 1MNQA 3WZMA 4EO7A 4ZYWA 4UU8A 5AM3A 2GI4A 4KQ6A 4AVYA 2JPDA 4YCNA 3KTAA 2FX2A 4JJ6A 1XVIA 4B3BA 1JEYB 4MW7A 1HO3A 5HBRA 2XWPA 3IKJA 3OFKA 1LLDA 1NW3A 1NC3A 3K6SA 3GLSA 4D9JA 3CWZA 2A59A 1Z2CA 3BH6A 2IYLD 1RKVA 3NKVA 1VE6A 4HD8A 3ZLBA 3REFA 1CUAA 1T9HA 2TECE 4UBIA 2Z8YA 1K4YA 3PVCA 4Q9LA 4S04A 1Q83A 4R9VA 2PX4A 5H9VA 2Q1TA 2QIPA 1O6GA 4I8DA 5AVKA 2R5NA 1Z7BA 2A78A 2E4XA 3DEKA 3PUXA 4K46A 2I3GA 1MVLA 4WJZA 5DGCA 1JDPA 3C6YA 1VMEA 4P3YA 3U0BA 4LJRA 2O8FA 3DD5A 4AI6A 3V8BA 1LB1B 3MLEA 2C8JA 3OLXA 3AF2A 5FFNA 2IS4A 4R1QA 4DAEA 1ZN8A 4DC9A 4EPTA 1XQXA 2ZUCA 3QQ5A 1PL0A 2BWJA 4KWTA 4OG2A 5LYJA 3ZIAD 3EGOA 3H1AA 2W93A 4L15A 1KO7A 3LUKA 1QVWA 3M3HA 1DBRA 5KQLA 1EUYA 2B6HA 1O87A 2FFJA 5JAQA 1OFHA 4LRYA 4WZAB 1TCAA 4XR4A 3TO5A 4TL8A 3F4BA 3IURA 4AWBA 1UPFA 4JEHA 5CEEA 1A4RA 3AEKB 5EJGA 2H1CA 3A1TA 3U16A 4MUIA 2P2SA 4Z0PA 3ERCA 1WF3A 2ZR9A 5HUHA 2FN8A 1Z7YA 1DO2A 3T12A 4UOQA 3RS0A 1J70A 1D2EA 3EUEA 3H3JA 2P2GA 4NU6A 1T2FA 3KXLA 1IDN1 1ZLYA 3LD9A 2O5VA 5JSUA 1OB2A 4YRQA 3V1MA 3SGLA 2HT6A 2ZBQA 5SY6A 3AP2A 2GK4A 3OIDA 3QKSA 3O4FA 4C2AA 2W83A 1LNSA 3N8DA 3ULKA 3WGJA 1T0PA 2WZBA 2YQZA 4BLUA 3H9UA 1IHPA 3CLRD 4D42A 2EZTA 4Q3LA 3KLPX 4L0QA 1AD2A 1VSUA 2AHRA 2JKVA 4L6CA 1GPJA 2WAMA 2V7PA 4E33A 1UAAA 2EBUA 1X1TA 3AC0A 4H59A 1FYVA 2G6TA 2E1PA 1SPXA 1Z28A 2H0RA 2QX6A 4GEKA 1ZIPA 4US0R 4DRXB 5DTIA 3DZDA 3KYJB 1H9BA 3NRBA 1Z83A 4IDOA 4L9AA 3NHKA 2PLRA 1B26A 3JAKB 1T1IA 3Q7PA 4Z54A 3PSHA 4ICIA 2EF1A 3LP8A 1BRMA 3BGOS 2VRNA 3QXSA 2J85A 4HAZA 4O4LF 4YUWA 3JQBA 3JX9A 1MTZA 1LBIA 3CLUD 4Y6QA 1FFBA 1O96B 2BPOA 2KLHA 4G5HA 4MJ7A 3OM8A 4EA9A 3ENZA 2EW8A 3MYYA 4FKMA 3SBEA 4B3XA 4ZJPA 5C8XA 5K3SA 1G6OA 2ZBPA 1D6NA 1MEEA 3EBPA 3R9KA 4QVIA 3GRFA 4ZWNA 3Q41A 1A5TA 2I8AA 3ZU2A 3WISA 3QPVA 1NQXA 3HMQA 3VISA 1GTL1 4U5XA 4R1PA 1LW6E 3LBAA 2XYVA 1AO3A 2BFPA 1KI6A 1RPNA 4WA7A 3GELA 3Q9LA 1AA6A 4E94A 3K9LA 1G9TA 1VIMA 2JFHA 3NC1C 3QUCA 4E11A 4M1SA 5A6SB 1JMVA 4MYSA 4QT4A 2WV7A 2ATXA 4YY3B 1YJ8A 3ZW7A 3LQKA 1OXBB 4RKRA 3UH0A 4BS9A 3ILHA 3RSGA 3OKPA 1ONBA 2V9PA 3WNQA 3RGGA 3PENA 2FPLA 2Q4OA 4HXYA 1IBKB 2DY0A 3EZYA 2CNKA 4IDGA 2RGUA 5LOVB 1KVSA 1GUFA 5CJPA 4AECA 4HNRA 1LWNA 3PUZA 3N53A 4BVGA 3EXEA 3I73A 1T2EA 3ELBA 2GNPA 2PXAA 1VJRA 4FOTA 2V8BA 4PNPA 3QVJA 4CKXA 5TQ0A 1MO4A 1NN0A 1QBGA 4Q9NA 5EEGA 1O2DA 2OHOA 4B4DA 1V5FA 2ZS9A 2DF8A 1QRRA 3DZCA 5G41A 5BNFA 2VDQB 4BQNA 2OXRA 3RK1A 3UA3A 2CFIA 2G76A 3SR0A 4F9GA 1VKOA 1V48A 4B32A 2AH5A 2PYIA 4YC7A 1QYWA 4GXQA 4UATA 3ZGNA 2C7GA 1MOZA 2HK7A 4HDRA 1D07A 2C04A 3D5EA 2WMOB 2FJ0A 4L9SA 1A5SB 1SG9A 4QL3A 3SHTA 5DYNA 1ORDA 1GPWB 1RJDA 2WUDA 1MX5A 4FFOA 3WWCA 2C4KA 2G8NA 3FSRA 5EJIA 3X0DA 4EW2A 1HM5A 3I01A 1KS2A 5I7RA 5J4YA 1E7QA 5FBWB 4RM3A 4XX1A 3L7CA 4EQZA 1GQSA 1IXKA 2A9FA 2QTCA 2Z3ZA 3P9PA 4RJJA 5COBA 4DCVA 2P65A 1UZMA 3G82C 3CWCA 5A03A 1RZ3A 3T3EA 3UK0A 3KV3O 3DT9A 2V6IA 4JEUA 2OHGA 1MZVA 1BN6A 2AV6A 3QIVA 1E0DA 2XHEA 2V5UA 2RFLA 2NW6A 1UZAA 4H7KA 4KQHA 3BRWD 4YRKA 1ZK0A 2BR5A 1ZVVA 4NLLA 2I80A 3F6SA 4R9SA 1BWRA 1NMYA 2GUWA 3FZYA 1P29A 3AW8A 4WZBE 3ZHOA 4CQLB 4EG0A 3BHMA 2FK7A 4JQOA 1YS4A 4PFKA 1WEHA 2OZPA 1E9DA 2ZT7A 2ZBEA 3KE9A 3L02A 2GJ4A 5JNUA 4KMSA 3WG9A 4V3BA 1ODKA 2WTXA 2GZ1A 3ANNA 1ARZA 3QZUA 5ER9A 1N2JA 3MWLA 4IIUA 8MHTA 3PXDA 1E64A 1EUDA 1RJGA 4IOKA 1QTQA 4TL7A 2VA9A 4RIHA 4CLEA 3N8IA 5B4TA 4B79A 1FFCA 3P45A 1GV1A 4N76A 1ZGBA 5JFOA 1M6NA 1RJFA 1PJQA 1Q1QA 1WDMA 2PWPA 4J4TA 4LHYA 2VP5A 4M1QA 4LRXA 1KDZA 1VMIA 3EODA 3B48A 1ZQ9A 2ZR7A 5T67A 4M7WA 1B6SA 5K0BA 4S12A 3AVYA 4NBWA 1FL9A 7ADHA 2ZGVA 4LJ8A 1N6LA 4HATA 3ETLA 3LT5A 2HRCA 2Q6LA 5EL0A 4EEXA 3ZLVA 2I29A 1HE3A 1TCUA 5JT1A 2WZCA 1Z3CA 3RDPA 2NOAA 1DWOA 5COQA 1C7RA 5B3KA 4FBMA 3WHIA 4DIUA 1DAGA 5L7WA 1ULUA 4HRXA 1CUYA 1G42A 4Q3CA 1HG0A 2QVGA 2V7BA 2HJHA 1FUIA 1PWZA 5IVDA 2B1GA 2R66A 2Y93A 1SJ9A 3IVAA 4BIIA 3F97A 1ZCJA 4OI2A 1QX3A 4DM7A 1FUUA 2C31A 3WLRA 2IC5A 5DOVA 4NCAA 4B74A 5JCPA 1EWQA 5K0EA 3PKZA 4AF6A 3BJIC 4Q21A 5SYMA 3W77A 5TLSA 1VL6A 1P0MA 2VSXA 4UBMA 5JQGA 1XFDA 3OIGA 2QLJA 2VBIA 1NMZA 2GM3A 2OHXA 3UY4A 4BLOA 2Q2QA 3OCXA 3ZZNA 1S3IA 1G6KA 1TIBA 1PUIA 3K05A 1MG0A 2F64A 1N5OX 2DYKA 1W30A 3ZGXA 1BMQA 4N5MA 4YJ3F 2C57A 4EK9A 1E94E 5FADA 3TIXB 1R6TA 1U7XA 3KZ1E 1ZP6A 2J6IA 3I3SR 4P7BA 5D7BA 3ROZA 1XZQA 1WNTA 2VNJA 3DE0X 3GLRA 2II6A 3FSGD 1SQSA 3N6VA 1E6UA 1N6RA 1N9KA 2AB0A 3CO0S 3LPLA 1Q7RA 1PFQA 2WD7B 3FHOA 3PFGA 4BZQA 1IHYA 3CLTD 4ARZB 4M98A 3EFOB 1INLA 3QBVA 2CLEB 4NE9A 1X9HA 2ZRIA 3BAZA 3J7TA 5AW2A 4W1PA 2ZVPX 4KXWA 2GWRA 3K0EA 3NP7A 4WINA 1QIMA 1QB7A 2XXJA 1HTWA 1N77A 1GTJ1 1Y4AE 2HLNA 4RIIA 3AUKA 3S2UA 3RQSA 1Z0ZA 5K4HA 5FTJA 4HBGA 1HLPA 5LWHA 3I5AA 4DV5B 2X7HA 1T5DX 1CPYA 1FNNA 4E46A 4BFLA 4YRBA 5J4HA 3VX3A 3TLEA 4MPRA 3VJLA 4JLPA 4R2KA 4NU5A 1QO0D 3KT6A 4YP7A 1R0RE 3ZV7A 1JIVA 4P8RA 4F4JA 2C0PA 2NTJA 3NRJA 3OEWA 3F5SA 3MTAA 3U4IA 4B9EA 4BO4A 3I2FA 4YI5A 1KEPA 3OAAD 2FPGB 1NNEA 1EKXA 3HA3A 2V7GA 1JSXA 1VE5A 1TRHA 2DQYA 1S5PA 2GUGA 3INTA 3KQHA 1EX7A 3LUCA 1MPTA 1BH2A 1CZRA 1XZJA 3EPKA 4C4PA 2CNBA 2QLFA 3BICA 3Q2IA 2Q1SA 3KR9A 1M2WA 4UREA 3ML1A 2XRZA 2P9BA 1NVXQ 1GA4A 1E5DA 2BP7B 3V6MA 3MS7A 3QBTA 2LVBA 4HF7A 2KMLA 3P97A 1IAVA 4QBTA 1RCUA 1WX1A 2PNJA 3EP4B 3ZUGA 4R31A 4RADA 4QXOA 4LJYA 1YR6A 4F91B 5ALLA 4LSZA 3BXPA 1WXFA 2CWWA 2CL0X 3H2HA 1GQOA 5FOTA 4ZANA 2SBTA 1AT1A 1ZUWA 2F8LA 4JI4B 3TL3A 3RS9A 3IX7A 5A3QA 2BFCB 2YY6A 2DRIA 4MS4B 3F7NA 4MUMA 2ATCA 2PWAA 3R23A 1XLTA 7AT1A 4IEIA 3F4KA 1PR1A 3AUYA 4QG7A 3U3RA 4Q03A 3HU5A 1KDOA 3GNSA 4BNKA 3CVOA 3ZHSA 2IZ1A 3M3PA 3PTZA 2PMDA 4MA0A 4COKA 4O4IF 4FB4A 3EWNA 3W8EA 2WABA 2WWIA 1E6CA 2PBFA 1HEIA 4LOIA 1HZZA 5IDWA 1LS6A 4QYXA 5EG5A 3UEOA 1QP0A 1BVHA 3E8SA 4LC9A 2YHUA 1WU8A 4MUBA 1GZ5A 1BEZA 2XB9A 4TV9B 3WK8A 3ZHBA 1TVKB 1OLSB 1DTSA 5IW8A 3IR5A 3OEEA 4KXLA 3W5DA 2ORYA 2Q5JA 3DOFA 4ZHQF 2ST1A 5BW6B 2R7LA 4TQGA 3IVRA 3OUZA 1GZ3A 2ZWVA 1DIOB 1E3QA 3AHDA 3UJHA 4DADA 5E4YA 4RPJA 2WP8J 1J49A 2W9XA 1T4CB 1I4TD 3FTPA 3KJXA 3EZGA 3T41A 4HLUC 2QGZA 3VZQA 5ADHA 2H5IA 3S8EA 3SYLA 2GM4A 4F72A 1VBFA 4OHWA 1ISRA 1OAKA 3CNLA 4QXRA 4LECA 4QBGB 4RC9A 1F9AA 3ZIUA 4O59O 4R2IA 3T1VA 2J4CA 4DQXA 2QZPA 2GD2A 3B85A 2CXQA 2XYGA 2GX6A 4LRUA 2BY4A 4LWQA 2Y2VA 1VDMA 4CN8A 2H85A 2QTZA 4YDRA 1LUAA 3EWIA 1N1MA 4CCWA 1BYIA 2XI4A 3DOOA 4JODA 3RT1A 2H51A 4U2GA 3HCPA 3CZCA 1RW4A 1W9HA 2GLUA 2OB1A 1TF7A 3RUEA 2BUBA 1OUMA 5IKOA 1GT91 3OP1A 2IX3A 4DCOA 3LXUX 2WUVA 5E1DA 4DGSA 1Z4NA 1TZ2A 2ZM6B 1T2UA 1NVVQ 4ID9A 4N9QA 5LCXA 3MMSA 2ZBDA 4EA8A 1U11A 4WKCA 1IZ9A 1PL7A 3QX9A 5H5JA 1UZNA 3LY9A 1CY8A 3PGLA 4LYJA 2I54A 2XUKA 4FFBA 2PO5A 1QIHA 5A06A 2QA5A 2Y0CA 3OWHA 4IQGA 4MVYA 4QQNA 3E9MA 4WCFA 2A1UB 3W2GA 5MN6A 3H9JA 4BV9A 3QTBA 4KX5A 4BNWA 4H1WA 5EXPA 3RABA 5B6JA 1NRXA 3DCJA 1SCQA 1GGKA 1NUSA 3D4OA 3MRSA 4JA0A 4U0JA 5TRTA 4JI5B 1U2PA 2FETA 2ZQ5A 4POAA 1UK8A 5EI5A 4DIFA 2ZTMA 5KNBD 3CJQA 1T6YA 4II2A 3PEUA 4TQAA 4WUTA 5LMZA 3GBVA 4PPFA 2HXGA 5DI3A 5KC8A 1R4MA 1M6HA 1XL1A 4XJSA 1O0SA 5LZ8A 3COYA 2HR1A 1AGNA 1SXJA 3QWBA 1VBMA 1FTNA 2DKNA 2PYDA 1P62B 1Y6RA 4Q4AA 4D26A 4JI8B 1ZW1A 1P1CA 3EPAB 1KK1A 3PIDA 5TV2A 4A6EA 1ICEA 4FWBA 3UKOA 5CXUA 1BWPA 3N05A 4OMUA 2J48A 3CLKA 3F6CA 3JQBC 2ZWPA 1P2GA 3O8OA 2ADMA 4G1EB 1Z6AA 5JAHA 4PG7A 2ZKIA 3RWBA 1HF3A 3EDQA 2IYOA 2WY2D 3FPAA 3JYNA 4J0EA 1EA5A 1F51E 2J5KA 1XZKA 2PGNA 2GZ3A 4RK7A 5T4EA 3Q8LA 5HA5A 3UYKA 5LDGA 4TSFD 2I78A 1E6MA 2Q4RA 1LVUA 3IPYA 5EP2A 1P2DA 1IJBA 3T7DA 4FSXA 1YS2X 1QP7A 4IDEA 5GVRA 2HBRA 4LSMA 3WL6A 3HEMA 3IXLA 2GTPA 3O4IA 4L73A 3H9GA 4LXHA 5B5SA 4CHTA 1SULA 5I5EA 3DLIA 2ZI4A 1PUXA 1E2UA 4LS3A 1YR8A 4OA5A 4XOUA 2JW5A 4Z9FA 4HVLA 5KWJA 1QQBA 4NTZA 3HP4A 4HNAB 1I7BB 2O8BA 3ZPXA 3U7JA 1DIAA 1PL6A 1CZUA 4AMBA 4PC6A 3ZY2A 3E9YA 4OP2A 3HV2A 1AX9A 3HUDA 2OE2A 4EMBA 1Q19A 1ZU4A 2CL7X 1VP9A 1XYYA 3BK1A 3OCVA 4FFBB 4FOLA 4IHJF 5JS2A 1BOFA 1GCIA 4AZ0A 3MCUA 3DZ2B 4ME6A 4J8PA 3ZLJA 3P2MA 1DAOA 3HKBB 5FBQB 3K5PA 1JXAA 4OHBA 1E5XA 3PPYA 3X2SA 5IVIA 4OI4A 1HRKA 1T0IA 1XXHE 5HTOA 3W06A 4G0YA 3R76A 2MIIA 2XMZA 3DQZA 3E70C 2JA1A 4H7HA 3T1OA 1JQKA 5HS6A 1V1JA 3AFGA 4JVNA 3K0BA 4YP9A 3W0LB 5KX5A 4W5NA 1NW4A 4RF4A 4KDRA 3ADOA 2VYVD 2RCYA 1MIOB 3CLSD 3K92A 3HU3A 3HVHA 3ILYA 1N2OA 2X77A 1QQ5A 1PR3A 1ONSA 2A3RA 2VCHA 3JWHA 1Y81A 4N4AA 4MICA 4OK5A 2GNOA 3U9SA 1QHYA 2PK3A 4HVAA 1EDZA 5JLAA 1SY7A 3H9QA 2AMJA 3OFNA 1MH9A 1IWPB 4IPTA 5GP1A 3TR6A 3RC8A 2NZJA 1EDDA 3H3FA 3DNFA 3OE7A 5J4VA 5SZIA 5EMLA 3IT3A 4PO9A 4DDHA 1PX2A 2BEUA 3RVJA 3GP3A 1NF2A 1YKGA 3FZEA 3LCRA 4XD7D 5EJ5A 1R18A 5CGZA 4C4ZA 2DFTA 2CN1A 3ZV6A 1PQUA 4NWIA 2H1VA 4R2WA 5LQSA 5JVDA 4MHTA 4FBGA 1N5KA 1TVCA 1NIJA 3THWB 3OCJA 2RG1A 3RNLA 2XLCA 1ZK1A 4WK2B 3IQGX 3PUJA 5F1YA 2EG5A 2C61A 4DCJA 4IINA 4AN1A 2WF5A 2CNWD 1BA3A 3AERA 5SY9A 2PVCA 1L8QA 4FZ5A 5GGXA 4HQRA 4DCPA 3OTWA 3WGKA 2ILVA 3HU2A 3VTKA 5BN5A 4TYYA 1YRYE 3EJWA 3UOGA 1E0AA 3E8MA 2QG9A 3FLEA 4QFMA 4H7EA 4NZPA 1WDWB 3SHWA 4CR6A 2V6BA 1OA1A 3LHSA 4Z3OA 2GPBA 1E9CA 4ARIA 3NS7A 4B6JA 5DYTA 2F67A 1KQNA 3V1YA 2UYOA 3MJDA 1UJ5A 1PG2A 1EXDA 1GSIA 4A2QA 1OJ7A 3WI7A 3WX0A 1J0DA 2YWGA 1WDTA 1SD5A 3F49S 2Z2YA 4WFIA 5FPHA 3K1ZA 2HTFA 3ODGA 1VMKA 3T3GA 3DYIA 5J5VA 3T1HB 1PFYA 3I4FA 4RLQA 5FTLA 3IGFA 3SZ3A 2YINC 1SBNE 1MAUA 4KQKA 1VDZA 3BFPA 3GRKA 4QQKA 4RTKA 3FOEC 1E5VA 1CK4A 1PD1A 2R87A 4JELA 3KOZA 5THKA 1E6KA 3VZCA 1W75A 2HU2A 2JJ8A 2IQIA 3WSVA 3RKRA 1NV8A 3IAHA 3ZQ6A 5JNLA 3O84A 1TJNA 2QQEA 4RV5A 5KYWB 1Z22A 3MEQA 1FNDA 3SJZA 1VHLA 2AXPA 2FW9A 4I4TB 4ALJA 3DMNA 4FHFA 3UK7A 1MB0A 5C8YB 1ZN9A 1OH8A 4LDPA 5GY7A 1PJ8A 1FC0A 1PJBA 1PCXA 2PHZA 4CT5A 2J9YB 2O0LA 3KKPA 3G8AA 1JZTA 5AVRA 1PR0A 1KIMA 3O3OB 3NJ8A 3P5SA 3UKDA 4BP3A 2V98A 3B89A 3IJ5A 1IVYA 1VHWA 2Q5OA 1SKYB 2JB9A 4Y1FA 1NXOA 4YCDA 4L4YA 1P4HA 3ZKWA 2XSZD 1JVSA 4CKWB 3MJSA 1XZGA 3C70A 2X19A 3U40A 3IOMA 4I8XA 4TTRA 4CCAA 2NQTA 3USES 5IJXA 4M22A 5F9HA 2NUAA 4V0SA 3VOTA 1A72A 4PG8A 1G8AA 1GU1A 4UCXA 4Q7KA 1JL3A 1TA4A 2C2KA 2C8LA 2PA0A 4I4NA 4MQ6A 5BORA 3BPSA 3IMEA 4QATA 1SFRA 4BV3A 2B4RO 2J32A 3PPWA 2R47A 2NNWB 4J03A 3LCVB 2WHQA 5JYFA 4IVRA 2VHQA 3S55A 5B3LA 1AH2A 4JLAA 3OTHA 1AOXA 2JD0A 2O3SA 2FW1A 3H2ZA 5IT5A 3PC8C 1GNSA 5FI0B 3N2NA 4F6LA 2JFNA 3TVDA 4TOIA 3HKDB 4DLUA 5IT0A 4YYZA 1YVRA 1YB2A 1H42A 4YBZA 4EEKA 4AU1A 5D5HA 5CH8A 2P4EA 2Z9DA 1ABBA 4G67A 3EP9B 2IU4A 3E84A 3WSTA 2QQGA 3THRA 2O8EB 2FMIA 5I8WA 3AR2A 4ZFNA 4QU8A 4BFVA 1KIFA 2AMVA 2WD7A 3EWAA 4HRVA 3GPLA 4M0UA 4Q3OA 2R62A 2AFHB 1I14A 1AGRA 1TE2A 5A6VA 1FFYA 5LXTF 4AZTA 3RAJA 3ND8A 1H2FA 1WHSB 2OAQ1 1E1QA 4JHLA 5JQGB 3LVFO 5AQ1A 1USGA