1H9CA

Nmr structure of cysteinyl-phosphorylated enzyme iib of the n,n'-diacetylchitobiose specific phosphoenolpyruvate-dependent phosphotransferase system of escherichia coli.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
105
Chain Sequence
MEKKHIYLFSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of Cysteinyl-Phosphorylated Enzyme Iib of the N,N'-Diacetylchitobiose Specific Phosphoenolpyruvate-Dependentphosphotransferase System of Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords PTS SYSTEM, CHITOBIOSE-SPECIFIC IIB COMPONENT
total genus 34
structure length 105
sequence length 106
ec nomenclature ec 2.7.1.196: Protein-N(pi)-phosphohistidine--N,N'-diacetylchitobiose
pdb deposition date 2001-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1h9cA00
3VNBA 4DN6A 1JL3A 1VRVA 2PUBA 4Z4IA 4XAQA 4E7PA 1KRWA 1EAYA 1ISRA 3NNNA 4RXUA 2PE5A 5B3JA 1R8JA 4IRXA 1FFGA 3GL9A 4MYRA 3O1IC 5TQ2B 5BRAA 5KC8A 4D6XA 3QEMB 4G0OA 2JBAA 4ZYLA 3L49A 1ZN2A 3GYBA 2PKXA 3HK2A 5IC5A 4N76A 3C3MA 4KRFA 1P2FA 3IP7A 4YGXB 3OO0A 5TPWA 2BGGA 3H6GA 4KMRA 5TQ0A 2V0NA 3O2JA 2PAFA 4MS3A 1RXEA 5T7BA 3A0UA 3N53A 1NTRA 3GBPA 4PYRA 4Z4FA 3LKVA 3MIZA 4RK1A 1JH9A 4FB4A 3IDOA 4N0PA 3RVLA 1PNTA 7ABPA 2E4VA 4RY8A 3RVJA 1YMUA 2FEWB 1SXIA 4JB0A 5JNWA 1KGSA 3HS3A 3IPCA 3O21A 1UDRA 1ZVVA 1BDIA 4FE7A 3T6KA 2FLWA 4MS1B 4Z99A 2GI4A 3L6UA 1QPZA 3KHTA 1LJUA 4RKQA 2PUCA 1NXOA 2CHEA 3MA0A 4ETIA 1YS7A 3B2NA 4MGEA 1D1PA 2H0AA 3EGCA 2LP4Y 4F06A 1MB3A 1QQAA 3LUGA 4QPJC 4EUKA 5B3JC 1YK0A 4EVRA 1LBIA 2A9RA 4JASB 4W5NA 2MYPA 2PLNA 1BDJA 2CWDA 1GUBA 2VK2A 3DGFC 4XASA 3RVMA 5KQLA 4Z4GA 4ML3A 1KRXA 1USGA 2B4AA 3FFXA 2IPNA 3OO1A 4LX8A 3M9XA 4RWEA 4G0XA 2GKGA 1LJLA 1D2AA 3CU5A 4B09A 5CNKA 4D74A 5IX8A 1JWLA 5DKFA 3QLTA 2E4ZA 4O1IA 3UK0A 4G0ZA 3SG0A 4M88A 2CD7A 1E6LA 1L5YA 2A9OA 2FXIA 2QV0A 3JY6A 5DTEA 3QX9A 5TQJA 2PUEA 4KREA 3RH0A 5FWXB 2PUGA 1M2EA 4OLBA 3G1WA 1QP0A 2FKAA 4RV5A 5BRJA 3DBIA 1I3CA 2Q5CA 1B00A 1CHNA 1Z15A 4RS3A 1JYFA 2L2QA 3F7NA 5TPZA 3LMKA 1PEYA 3D8UA 3HEBA 3KYIB 2L17A 3CFYA 4KQ9A 3UUGA 4EYOA 2IPLA 1P6UA 4F12A 1HEYA 2RDMA 3A3KA 3N0RA 2KYRA 1RZRD 1Z2DA 3H5TA 2FQXA 3HO1A 5IEBA 4EYGA 3SAJA 1GLGA 2MYNA 2FMHA 3URMA 3QEMA 5GOTA 3KSMA 4RK4A 1K68A 1E2BA 1D5WA 3M9WA 5JNUA 3OQMA 4G0YA 5HKOA 2HJ9A 1JX6A 3F6PA 5DCLA 3C97A 5I4CA 1URPA 1CEYA 2E4XA 1U8TA 1JF8A 3ILHA 4Y9TA 4EY3A 1JYEA 3N0WA 5JNTA 3GV0A 4H3HB 3F73A 4MRMB 3OLZA 5BQ3A 4JAVC 2E4UA 1BAPA 2H3HA 2LIVA 4XARA 1ZH4A 1Z12A 3CRNA 3MF4A 4O5AA 5KI6A 2FN9A 2B1JA 3HUTA 3KYJB 3W9SA 1WETA 1USIA 3QLUC 2P9HA 5FWXA 2N9UA 1ABFA 5JS2A 4ZJPA 1U2PA 3Q7TA 2P4UA 1EFAA 1VLZA 1DC8A 2TMYA 3FMVA 4KNYA 3FDFA 2IOYA 1W25A 2FLKA 2QW1A 2ZAYA 3KLOA 4E7OA 4Z4CA 2MSKA 4PZ0A 2R47A 3D02A 3OMXA 3C6QA 4OBBA 2QR3A 3JVIA 4Z9BA 5TE9A 5IULC 3H5LA 3FFTA 3CS3A 1ZDMA 2NT4A 3CG4A 2O20A 3O2SB 1ZH2A 1BDHA 5JS1A 1GCGA 3KLNA 5FBKA 3NNSA 1E6MA 2E4YA 5FBHA 4W5OA 2IKSA 3UKJA 4W5TA 4N0QA 4MLDA 1QP7A 1OXBB 4YO7A 2GBPA 4RY9A 3OQNA 2NZVG 4S04A 4S05A 1SD5A 3QELA 1ZGGA 1T34A 5HM6A 5EWLB 3JPYA 2JVKA 3HV2A 3IP5A 1JLKA 4MQEA 3Q41A 2FMKA 3KKEA 2YHBA 4W5QA 5JNSA 3HVRA 3H75A 1EWTA 3I5AA 4LZLA 2NT3A 1DCFA 2JBAB 2X7XA 4F11A 4HNSA 3E3MA 3MM4A 4EVQA 5TQ2A 1JDNA 2WJWA 1M2FA 4MS4B 5CNMA 4WXMA 2QZJA 4HYEA 3CNBA 1TVMA 4QYWA 4EGSA 5FWYB 5IUJC 1PNRA 2NUBA 1Z13A 3C3KA 4L85A 4D6YA 1GUDA 2HSGA 2PUDA 1SXGA 1DZ3A 3MQ4A 1NXWA 2GWRA 3SQNA 3HJFA 4LE0A 3EULA 2L18A 3RQIA 3M6MD 4G0MA 4RDCA 5BR1A 3DZDA 3TD9A 3A0RB 3P9YA 5F64A 4IGAA 4JOQA 6ABPA 1NXVA 2PL1A 1VPWA 1BVHA 3EDCA 2FVYA 1ABEA 3K4HA 3BILA 1DRKA 3BRQA 4H60A 3A10A 1YVUA 4NCAA 1CYEA 4UHKA 1XHFA 4ZPJA 1C4WA 5C5EA 4XXHA 3SM9A 1Y1LA 4KK4A 5TPWB 1KMIY 2IDMA 1FFSA 2IYNA 4O1HA 3QEKA 3BREA 3QLUA 2WMYA 3EODA 3QLVA 1MAVA 2ID9A 3Q9SA 4CBVA 1A0OA 4WUTA 1QO0A 4RKRA 1LBHA 4UHJA 4RY0A 3CZ5A 4RZSA 1NXXA 5IEJA 4KK3A 4YWHA 1OXKB 3KJXA 4RSMA 1NXSA 2JRLA 2LBPA 1USKA 2MYUA 3T8YA 3GT7A 3KS9A 4H3KB 2E4WA 2JB9A 2W42A 2ZWMA 4MLCA 3OM1A 3NBMA 1DRJA 3G85A 5EWJB 4Q6BA 3JPWA 5IUKC 3IPAA 4RK5A 3MYYA 3LUDA 3CG0A 3E61A 4MQEB 2I6FA 4F8JA 2GX6A 5EWLA 1QNLA 4MAAA 1QKKA 3N0XA 2FEPA 3FGZA 3IP9A 1DCMA 1J56A 2MSWA 2PUAA 1GCAA 3CKMA 1DG9A 4KVFA 1ZITA 3T95A 1ZESA 1F4VA 2F8TA 1TMYA 5CNJA 4IF4A 4EVSA 3LTEA 1P6QA 4MR8A 5HQJA 3OLWA 3NHMA 4Z4EA 2AYZA 1VKRA 1FSPA 5CHYA 3OLXA 3N75A 2RJNA 3O1HB 2AYXA 3EJWA 4Q6WA 2DRIA 3NNDA 4MQFB 4OATA 2MYTA 3TB6A 1DBQA 2FEKA 1MB0A 2JCGA 3RVQA 4MS4A 5JNVA 2F8SA 2LUOA 4YV7A 2A9QA 5KWSA 4HNQA 4MQFA 1IIBA 2FTKE 2FN8A 1S8NA 3H1GA 1M5UA 4G0QA 4YLEA 3HDGA 3QX8A 3LUHA 1DBWA 3HXMA 3F6CA 1Z26A 3HSYA 4RK6A 3O2QB 3EQ2A 1W9HA 4NICA 3MMNA 3T38A 4YCSA 2MSLA 4ETMA 2IPMA 1RXIA 3RVOA 3Q7SA 4JA2A 3H6HA 1DP4A 2JVJA 4XLTA 4ZMRA 5T3YA 4IMIB 4MR7B 4KFCA 1JHZA 4FE4A 3H1EA 4PICA 1YIOA 3O1JC 3I09A 3GRCA 4JP1A 1NATA 4PE5B 3CTPA 3TO5A 5KQMA 2PUFA 1ZGZA 2HQBA 4DQDA 3JS5A 3HM9A 3OMWA 3DGEC 1PUXA 2A9PA 3H5OA 4WT7A 4MPTA 4RXTA 2RGYA 2WB4A 1TLFA 3HUUA 4MR9B 4Z0NA 3S99A 1QQBA 4NCBA 3KG2A 1D4ZA 4KZKA 3CZCA 1EHCA 1K66A 1FFWA 5C5CA 1A04A 4LE2A 1APBA 3SNKA 1E6KA 1AB5A 2HQRA 1JFSA 1YTUA 1LK0A 3H1FA 3OM0A 1Z25A 2HQOA 4MR9A 1RZRA 4Z9AA 1RNLA 6CHYA 4LRQA 4KQCA 4ETNA 3IP6A 4TLMB 1NY5A 1FQWA 3BBLA 4QYMA 1DBPA 5KQPA 4Q7EA 1TM2A 1DCKA 3RVRA 2J48A 1JFTA 1ZAYA 1MVOA 1L5ZA 4NQRA 3QK7A 2WRZA 1TJYA 2QU7A 4RK0A 5D2CA 4TMYA 4N03A 3DLBA 4G97A 1Z2EA 3KCNA 3RVKA 2FSPA 4WZZA 2JK1A 2LPMA 3LUKA 3NHZA 4NV3A 4HNRA 2QVGA 3VNAA 1BA2A 3I42A 3RVPA 4LDAA 3LFTA 3JVDA 2HPHA 2WY2D 3C3WA 3CLKA 4GNRA 3GWGA 1JDPA 2QVCA 4WWHA 4WXEA 5EWJA 8ABPA 1P8AA 3O74A 4RK7A 3LOPA 5DGCA 1PHRA 3TX6A 1DJMA 4KPYA 2R25B 4KV7A 3QELB 4PEVA 1U0SY 1M5TA 4MS3B 5JNRA 4TLLB 1JBEA 3BRSA 5CNIA 4YS6A 3SY8A 1ZHHA 3R0JA 4OG2A 5FWYA 1C0EA 4EYQA 3RVSA 4G86A 4YRZA 1YK1A 4ZMSA 4P1ZA 4Z4HA 1YMVA 2NZUG 1DC7A 3ROFA 5IUNC 2M1ZA 4MR8B 4MS1A 1YS6A 4JB2A 3RVNA 3LUJA 1SXHA 1U04A 2VYCA 3LKBA 3HZHA 4RXMA 4LE1A 3H5VA 1XHEA 5TPZD 1F51E 1Z18A 3N6VA 1ZY2A 3OQOA 4G0PA 2IPAB 3OLYA 3Q15C 5KC9A 2PMCA 3CHYA 2M98A 4OTZA 5IBQA 5TQ0B 3HDVA 4EYKA 5GQSA 4N41A 4MRMA 3FFWA 2VUHB 5ABPA 2PJUA 1A2OA 1NXPA 2QXYA 3DLHA 1H9CA 2WWVD 5E3JA 9ABPA 2OENG 5EWMB 3LUCA 1XWWA 1Z16A 2R4QA 2XDYA 1SRRA 5PNTA 1Z17A 3H5IA 4MR7A 3EQZA 4GPAA 4N47A 2OQRA 4F3TA 3K9CA 1JFVA 2R48A 5DLEA 5EWMA 2QSJA 1ISSA 1EWKA 3HCWA 3OLVA 3N8IA 4YP9A 4IILA 1EWVA 3QLVC 4L4UA 2L19A 4TN5A 4DADA 3GBVA 3GA5A 1QP4A 5ED4A 3LUFA 1PEAA 2YHAA 4LDZA 4P98A 1AB6A 3I45A 3ILYA 2PL9A 2FQWA 2FQYA 1NXTA 3H5WA 3EAFA 4XFKA 1QMPA 4QICA 2JVIA 2VUIB 2FMFA 2WJAA 2CHFA 1RPJA 3Q7RA 3ROTA 1U2QA 3O75A 3TMYA 1MIHA 4IMJB 4YR7A 4OLAA 4W5RA 1QO0D 2FW0A 5KQGA 5HSGA 3JTEA 3LUAA 1D1QA 2RJOA 2FMIA 2ID7A 3KTOA 4RU1A
chains in the Genus database with same CATH superfamily
2OGTA 4DHWA 2Q5FA 2AJCA 5ICSA 2AOTB 3DEHA 4CODB 3TIFA 4LV8B 1KRWA 4NU6A 3D6MA 4R2KA 1BWSA 4C4PA 2LR0A 4J2HA 4KGVA 1ODTC 3B7PA 4PN3A 1CJCA 5B3JA 4HN2A 2FPLA 2H85A 1XXHE 4FU0A 5BRAA 3U80A 3F6YA 5CLGA 4URUR 2BFNA 1NQXA 2HF7A 3C43A 4NE2A 5F76A 4ZYLA 2QYSA 1UANA 4QUIA 4TRNA 4JSTA 3WSWA 3H9CA 4WKGA 4EMBA 3JASB 4ZYUA 4BIIA 3GJ8A 3M1AA 3VBEA 5E6SB 2OV2A 3EY9A 4ZYYA 2I4RA 2NVBA 4GYWA 3TGWA 4IUCS 5JAIA 1PJTA 2IELA 1JIVA 1X7DA 4G5YA 4NKRA 1YB4A 4C21A 2O4UX 4JNKA 4DUPA 2LV8A 1X8KA 3KYDB 1LDNA 1IVSA 1OI3A 3FPJA 3R5HA 1KGSA 2OGUA 4XA8A 3IBTA 2Y0BA 3EGEA 4J90A 1VCMA 3G5LA 3I76A 1J2EA 3ZVMA 1FW6A 3U7FB 1DDIA 1QYIA 2J9XB 4RJLA 4KR7A 1HDRA 3ZK8A 3AHIA 3VJRA 1UUFA 1A2BA 3IV7A 3LBAA 1KAQA 3QBTA 3GI1A 4IGEA 3IP1A 4QQ8A 5FOSA 2LP4Y 4XJXA 2X1LA 1XCJA 2N1BA 3K53A 2H7CA 2R7KA 4JASB 4OOEA 4W7HA 4LYEA 5JMPA 1Z2OX 1JKJA 2P9QA 1K8XB 2WZCA 3NALA 4K6GA 4ZVRA 1JHRA 2Q1TA 1LRJA 5G53C 3WAKA 4Y9UA 4REQB 3AZQA 1FUIA 2FSVC 3CX8A 3MSXA 3KDPA 5HP4A 3M9XA 2C9OA 3OEED 1QBKC 4QQRA 5AI5A 2IQIA 4ITUA 1GZHB 3HJAA 3HO8A 2PL3A 4GQIA 5AJTA 3L0ZA 4Q1BA 1HEIA 4RL4A 4NHOA 1WLYA 4FZJA 2BDTA 1OB5A 4RE5A 1W8IA 4C4TA 2X8WA 4DDHA 2PUEA 1CUEA 2JDIA 4DJAA 1EFKA 4ZDIA 3GLIB 3EZYA 3FZEA 3GZ4A 3QF4A 2W6QA 1WB5A 1KVRA 3N05A 1UPTA 5CURA 2NO4A 1ACJA 3KDSE 3ANXA 3WFZA 1O58A 1WY7A 2YCLA 3DLTA 3MEQA 4UUQA 3NB0A 4CM4B 1FRVA 1Q5PA 5FA6A 4G4IA 2OO5A 3CLHA 5BW8A 5F23A 2NSLA 3RS3A 1V71A 4KQ2A 4PX3A 4Q3EA 5KIAA 2HV9A 2O7RA 3L46A 2EBFX 2VF5X 5CB0A 3S2SA 3MJHA 4I3FA 2IOQA 4DRYA 3KLMX 2AYYA 4IJVA 1W2WB 1R5NA 1IN4A 5A02A 2IWRA 4OIMA 5I7OA 1XEFA 4QEZA 2AA3A 1OBHA 2BEKA 4MUHA 4R9NA 3ACBA 5E1BA 2W8BA 3QVVA 4Y0NA 3OPYI 2PXCA 2SHKA 2CZGA 3KT8A 4EKYA 3L6OO 5CW1A 5ITSA 1XJ5A 5KTNA 4XPZA 2EWMA 4RM2A 3WQBA 4EPRA 2FQ1A 1AGYA 1U8UA 4X44A 4QBTA 2WU0A 1U9JA 5LJLA 1ZCJA 2CXTA 3EWNA 1WUYA 3BORA 4GZMA 5FTKA 4JI5B 4D26A 2BONA 3MWDA 1J5PA 5EMLA 2VKTA 4H7JA 4NULA 5FO1A 3UHOA 3IJRA 1AUPA 1WB4A 3K9BA 4POAA 5DB4A 3L4EA 2GCIA 4ALNA 4GGMX 1W4LA 5CBKA 2RHGB 1U1FA 2B1QA 2FN7A 2X42A 4FFOA 3MCTA 5FEMA 4GH5A 5IJ0A 4K3UA 4DV3B 2X2PA 1H2RS 1XQXA 3AVWA 3E27A 1KP2A 2O0MA 3IIKA 4QUBA 3W9SA 2E87A 1TVKA 1KQGA 4JB8A 5B58C 3DC7A 2ZRGA 3DDHA 5KYVA 3D6NB 3QEOA 3LWBA 1RCTE 4KE6A 2Z58A 3HCPA 2BW0A 2IHTA 3MCZA 4PAOA 4TZ0A 1KH3A 5FA5A 2G4CA 3JX9A 1M8GA 4E2XA 3OOSA 4LDPA 4O4HB 3V1UA 3YASA 1T4GA 3UV3A 2NYAA 4A91A 2V9CA 1TO6A 5I8WA 3HFGA 4OBBA 4WCVA 1I4OA 3KQSA 8ADHA 3RLIA 1EVIA 4LWZA 3VI3B 3N2IA 3SU8A 3VSAA 2VBFA 2J0EA 3HEAA 1KYXA 3EG5A 4KSYA 5DI3A 2AUMA 3KXIA 1RAEA 3OU2A 3SDZA 1AF4A 1W76A 2BTQB 2C92A 2CLDX 1WW8A 5LR6A 4YO7A 1XVAA 4K88A 4OJMX 2A59A 1DAMA 3ET4A 3RC3A 2HA0A 3DEJA 3DDUA 3REQA 4YDHB 3BCHA 5TNXA 1T36A 4BYGA 4DFDA 4FMCB 4L5YA 4LRWA 4D9HA 3QUCA 1SC3A 2D62A 3BIXA 1RAFA 1T1EA 2FWMX 3CNEA 4C0WA 1FU8A 4RV4A 5CFLA 6NULA 1B8PA 3TQSA 3K9LA 1U0TA 2XDAA 2D0OB 3IB6A 1TTQB 1TZ2A 3VO8A 3T15A 1AO3A 3A6GA 3EPKA 3L5KA 5E4YA 2OUIA 1MORA 2BKLA 4K9SA 1ZGAA 1E59A 5E7QA 5CNMA 5HIMA 3VYWA 1RC0A 3AB7A 1G18A 4UEKA 5E9AA 1TQDA 3ZW8A 1TI7A 1MABB 2WIJA 4MXDA 3GJQA 5HFJA 4YPOA 2Z6UA 1U2SA 2OGWA 3HB1A 2W2TA 2GHRA 3C3KA 3CKLA 1GTZA 3EEYA 3MGGA 4L85A 2X14A 1F5SA 1UKYA 1ZEJA 1Y9AA 1TEHA 4OFWA 2J1LA 3EULA 3M6MD 1XPJA 3INGA 1IG0A 2XQFA 1SBZA 1PJSA 1G98A 1UBOS 1MO2A 2UZAA 4PYOA 4BB5A 1DKNA 4ZVTA 5CA1A 3JD0A 3PQEA 3K4HA 3W9YA 2ZTMA 3GBSA 4U8GA 4V03A 2Q3MA 4RKWA 4LPSA 3T52A 1BU8A 2XUOA 3AR9A 3KXDA 4O4IA 4XIIA 3H7IA 1BTOA 5TX7A 3BN3A 4Z51A 2NO9A 4OHCA 2DBYA 1QFYA 2JF0A 4BY9E 2AX4A 5COBA 5LL6P 1C4WA 5FADA 2WUVA 4X65B 3ZXIA 4B3RB 1YL5A 4JBGA 4KK4A 4M7RA 5AHXA 4BX8A 2O3TA 3H16A 3VDQA 2BEUA 1RJFA 2UVPB 1QE3A 4IUDS 2HR1A 1SVLA 2WMYA 1LPNA 1FDVA 4KYUA 3X2EA 3L7MA 1GCOA 1MAVA 1WMDA 3IBYA 3PQ3A 4UU1A 3CSUA 3IKMB 1M0EA 3HU3A 1RP1A 2HU8A 1XTJA 3VSBA 4AN0A 1CRPA 5HMMA 1JDBB 3BQ9A 3BGDA 5FBQB 3ZV6A 3CZ5A 2CNWD 3DOEA 3HMQA 2CKDA 4HB3A 3V1TC 4GR9A 2BYTA 4MWTA 4EABA 1E1MA 3DVAA 5HQ3A 4M4SA 1QRTA 4EQZA 2W90A 2QTLA 2YWEA 3B38A 1L7BA 2YY5A 4GMXA 3MCWA 4OLHA 4IDGA 1J1ZA 3DL4A 3PRYA 4MMZB 4ARZB 3G68A 3JRXA 3BXFA 2MU1A 4PG5A 8OHMA 2NXNA 2ZBDA 5F3WB 4X0EA 1YDFA 4URZR 1SHKA 4AF7A 4E94A 2Y9MB 2VWHA 3LWZA 4MAMA 4GOJA 3WJ2A 5FAKA 3NP7A 2GF2A 1HQKA 1TD9A 4B47A 4KR6A 1E64A 2JIPA 3I3OA 3JAKA 4D8WA 2FUEA 4DR7B 3OQ6A 1D07A 3NHRA 3D8TA 2J3HA 2CVHA 5HQ3B 1SXJB 2VEDA 4KFTA 3TW6A 1J56A 1XZJA 1CY2A 4AS3A 4ARUA 4XQGA 2ORIA 3LXUX 4H77A 3BICA 1DAKA 4QECA 4ZODA 1PFVA 4JUAA 5AVZA 3OLWA 3QVJA 2VRNA 1JV2B 3P9PA 4LXIA 1G5PA 5T4FA 4YNBA 1W0KD 3FFBA 4H7IA 2W4MA 3PGVA 2I6TA 3SC4A 3AFGA 3EZ2A 4JKOA 4Z1MA 2FEKA 4S2UA 3AEYA 3MD0A 4HNQA 5A4JA 5FLEX 4TTPA 1N32B 2ZEJA 2XWQA 4INZA 3D4LA 1O6ZA 4YLEA 3PNOA 2IHVA 4NENB 2Q5EA 3RG2A 1M8JA 1Z4QA 2GPNA 1UFRA 3F3YA 5K6AC 1W9HA 3U5TA 2PT7A 2ZI3A 4BMNA 5A06A 4R84A 3GLRA 3OI7A 4HQ6A 1I01A 1KYZA 1P5FA 1UBHS 3GR6A 3PR2B 4DB2A 1P72A 2VEOA 4DBLC 1CQIA 1X6VA 4AX8A 1EE2A 5EHNA 3T7CA 4HQOA 2O8CB 1RTTA 4BZQA 2GJ4A 2FNAA 2OILA 4L9AA 3CX6A 1ODKA 4UM7A 1A4UA 1BCSA 2KM1A 3C5CA 3E3AA 3TO5A 3VC3A 1CQJB 1R0KA 1S89A 2GERA 1JWBB 2HTFA 2JIRA 1E3MA 4PC1A 2DUUA 3HCNA 4GYKA 2A30A 1E5QA 1Y8RA 4RYLA 1YB2A 1U0RA 5E4TA 2JLSA 5A5DA 3R3JA 3PJRA 1F2DA 2W2NA 3GLSA 5ALLA 4EEXA 3VZRA 2OO7A 2SKDA 2LW7A 4JEUA 4QQKA 5C18A 7YASA 3TG2A 4LF8B 4RHTA 2FX5A 5J5VA 1EHCA 3UMMA 2X9GA 1A5AB 2HQRA 3RKRA 2QUJA 5SZHB 3NRJA 4JXKA 3MT9A 3ZXYA 4HGYA 3ANYB 1RNLA 4Z9AA 3N1UA 2R2AA 2AD1A 3IP6A 3DMDA 3PF9A 1E5LA 1VMAA 1P39A 1GPJA 1WP9A 1A7UA 2OO3A 2WTBA 3DF7A 4MVJH 2DUWA 2VF8A 3I2KA 4PX9A 3NO4A 3NWBA 3I9JA 4PYKA 3I9OA 3LXMA 3I23A 1ZAYA 3GLIE 1KAGA 5ESDA 3OU6A 1PX2A 1X9HA 4HXGA 4RD6A 3DLBA 3E2IA 3IQGX 3H7AA 3RVKA 2ORWA 1TF7A 1C7FA 1KMNA 1HTTA 3MJFA 1CBUA 1XDWA 2WF8A 2K7ZA 3LQKA 1RM4A 4MUGA 1IMOA 4E21A 1AUVA 1NAIA 4BN4A 2QTVB 3C4JA 3MILA 1NF8A 3AHJA 2QT0A 3LFTA 1IOVA 3FJ1A 4GU5A 2HRQA 3QE4A 3UA3A 3UQYS 4AG5A 1YOBA 5F52A 2JCBA 2BT4A 2HLHA 2HWXA 2SICE 5A9SA 1K1EA 1JIXA 4BNVA 3FMIA 3LXRA 2INGX 2O2DA 3QF7A 4J75A 2P2GA 2JFOA 1WEKA 4X94A 5EWJA 5TMEA 4ARVA 5BNTA 2OHFA 4Q3KA 1ORDA 3DV0A 4V02A 1C7RA 1S4MA 3ISVA 4HFNA 2NSJA 4RK7A 3TX6A 3AJDA 2PS3A 2JGIA 4B0OA 1F5NA 5HTKA 4LJ4A 4LJ6A 3N8KA 3CNNA 4Q01A 1M5TA 5B3KA 2HXGA 5IAOA 2GYUA 2V1UA 2VC2B 1V37A 3O8RA 4LXHA 5THXA 4ZCLA 3JCZA 3HN2A 3HUDA 4Z4HA 1UXHA 2DLNA 3ROFA 5K20A 1J7KA 1XVUA 4ZVOA 4L72A 3RVNA 3FSGD 3RRMA 1U04A 3PDHA 5EP1A 5AR1A 4J16A 1RWQA 2GLUA 1V2GA 4L4ZA 2P6UA 1XHEA 1X0VA 3SP1A 4E7OA 3W9BA 1E0DA 1NVAA 2EKDA 2MOKA 1P2SA 3RTAA 1XTVA 3JWEA 2OB1A 4QPDA 2ZVDA 1PYDA 2FMXA 4JBWA 4UPEA 4GGOA 2VUTA 1SUEA 3TE6A 4ZO6A 2JI7A 4K9DA 3MLAA 3FPGA 3BEDA 3GFSA 2EL7A 2FG7C 1FSGA 3V7NA 4C7MA 3CW9A 1WXDA 5GQSA 4D9NA 1Z63A 1RQ7A 1QIJA 2VUHB 3HVHA 1TYEB 1NLYA 4AWAA 5ICGA 3NRCA 1UJ5A 3HY6A 2WFZA 2O8EB 4M1OA 4K03A 1ZZEA 3LFUA 1U0LA 2F3TA 2Z2ZA 3PENA 5G4LA 3UGTA 3SYNA 4UVGA 1UK6A 1KR2A 1HG1A 2BF4A 2P2CA 4F1KA 1EESA 3CZMA 1ZFNA 4JA0A 3I72A 3KJEA 5FYDA 1CVRA 3LC1O 1ZEMA 4PR0A 2IH4A 1ORTA 4JI8B 1KORA 1BO6A 5KTPA 2DUNA 3J81k 2R8BA 4JXXA 2QUBA 3W3ZB 1VTKA 1Z74A 4K81B 4KGXA 2QMHA 4TN5A 1N8KA 1OBOA 4OI4A 4MWZA 4CUJA 4D9GA 1HDXA 4DYDA 1NJ6A 1E89A 2Z2KA 4LV6A 3D7RA 1PD0A 2I2XB 3HB4X 4NATA 4Q1VA 5KWEA 1JKJB 1XZKA 1NL3A 5IYZF 4YJ3A 5JH7F 1QG2A 1EX9A 1LDMA 1O4VA 4N5HX 2BP7A 3NPAA 1PL0A 1SCUA 2ASEA 2DHCA 2FQWA 2G07A 2ZRHA 3QNUA 3TI9A 5IVKA 3HCDA 3AXTA 4XFKA 5AKXA 4C4YA 1ST3A 5LQJA 3M4YA 4H27A 4HAYA 4ZQHA 3SS8A 3OCXA 4W1QA 5AVRA 2REBA 5EXXA 4Y1RA 3GG2A 1QU3A 3UCFA 5AOBA 4FOSA 2WG1A 4IMJB 2Y71A 4TYPA 4IVRA 4MKZA 2P4EA 4IDCA 2N42A 3F3MA 4MW5A 1TJPB 3T8YA 4OA8A 3GLIA 4RU1A 3JR3A 3DD1A 4KU4A 2VFAA 2GZAA 3E3OA 4GW3A 4NZYA 2K5UA 3ZIAA 4KPFC 2XKKA 2ZBPA 2YVUA 3ESXA 4E2ZA 2PUHA 3BWYA 4RNDB 1RWPA 4BQEA 1R12A 2JGDB 3EFOB 4HMPA 4KR2A 3KUCA 4CMEC 3EY4A 4D5EA 3GUZA 4KGDA 3V55A 2W00A 4DV6B 2OV4A 1TYBE 1ZN2A 2CFRA 2QJRA 3RFUA 2FOLA 2P2ZA 2G17A 2VIIA 4KRFA 1G3RA 3D6FA 2YHUA 3IP7A 1Q83A 4NU5A 3AVTA 1I0ZA 3BFPA 2CHVA 4H35A 3USCS 4B40A 1MO3A 4E03A 1A9PA 2GZHA 5T7BA 3IMCA 4PYRA 4LDQA 2H57A 4YASA 4EI9A 1L4LA 2I67A 1UEJA 2PQMA 5BVGA 2C4VA 4B6FA 2OESA 5IAEA 2NPIA 4B4UA 5LBUA 3A6LA 5JYCA 2RH5A 4UD6A 3WIDA 1QK4A 1KIAA 3WADA 2IX9A 3L7YA 1TT7A 4LRSB 3ROEA 2HJHA 1VJ5A 1HTWA 1JVSA 2ZJ4A 3Q1LA 4HMOA 4MKIA 2QLFA 2NTNA 3GRRA 4XX0A 3GDGA 1XQ6A 1JTVA 2Y05A 4MGKR 2CFOA 3OCJA 4F6RB 4OI0A 5GONA 3PX7A 5A03A 4C6RA 1JJAA 1JA0A 4XWWA 3GGSA 4JY7A 1RTKA 2QUIA 3WLLA 1L3IA 1L8XA 4KQGA 5DLPA 5IC4A 2KSQA 2VHZA 1FQOA 1GG2A 2P8JA 1KSHA 2C5SA 4OHKA 1YKSA 4TRRA 3VPXA 2SCUB 3WJAA 1NVVR 5DYGA 3QYFA 1EXMA 5ERYA 2J8ZA 2HY7A 1W5AA 1EM6A 3DBHB 4QOJA 3SDSA 1VA4A 2QLTA 3AEKB 2QTHA 3D59A 3DC2A 5DBOA 3ROQA 4ZJYA 5DKFA 4MHOA 1VDMA 3U1VA 3UKOA 5C8ZA 2YRFA 4MGZR 1UQUA 1T24A 5EPOA 5KU7A 4UBNA 2E4ZA 2YZ2A 5AW9A 1K86A 3UK0A 1CRWG 1C7QA 1F2VA 4GMDA 2GILA 4B3HA 4KPGA 1J25A 2AMVA 2XUPA 2QMQA 1W19A 1DKPA 3UAXA 5A3SA 2PTGA 1VMIA 3OSZA 3PKJA 3RBXA 1A7AA 4OFBA 5T64A 4JYPA 1XT6A 4K9LA 4MARA 4OLBA 2WZBA 1R2QA 1E8NA 2H16A 4J8PA 1LTQA 1QHNA 2XGSA 2WSLA 4FZ5A 2P9FA 3DVRX 4AQYB 4P2BA 3KPVA 3HKEB 3T9DA 1GZ6A 3SQLA 2VAXA 4MV7A 3OJ0A 5JSQA 1F12A 3UXHA 1KJJA 2REOA 4BASA 1YTLA 3JQFC 3VZCA 4HDOB 1PSWA 1E99A 2ZWVA 3HG7A 1FFAA 1V7CA 3I9V1 3NT4A 1Y4SA 1H4VB 3JYPA 4H16A 4R8MA 4TWBA 3EIEA 4MJ3A 5IZCC 1YE3A 3EGWA 4PWYA 4US1R 4DLWA 2V7QD 5MGNA 2YUIA 3VR6H 1SQ0A 2BFPA 1YRYE 4F12A 1HEYA 4JLPA 5LQRA 4RMIA 4U9HS 4CG2A 4EB0A 3IUEA 2R6ZA 3B3QA 3WZ2A 1H1LA 4F1JA 2HREA 3I52A 3LCRA 4GSLA 2YJ4A 5DW0A 1J21A 1HYBA 3KSMA 4RK4A 4ZEOA 3WSTA 1GZ4A 4A26A 1KC3A 4JD5A 4BUZA 1P33A 4C1NA 2CLMB 3CR7A 5JG7A 3TSZA 4BLRA 2QN2A 3FOAA 2YZGA 1UJCA 1B0UA 1KVQA 1YZNA 3TDMA 3ZTYA 4B4VA 2F17A 3MYRA 4PHFA 1X86B 1OPRA 3BWEA 4Q82A 5F2NA 1B15A 3E03A 3L01A 3BIWA 3VTAA 5JDCC 1FDTA 2H4ZA 3RU7A 2OOSA 1KZ4A 1XXHB 1UXIA 1MQ8B 1W87A 1Z28A 3I2YX 3TUJC 1Z12A 4C7OB 1ULHA 4CWAA 1C3VA 4TSRA 1DDOA 3QE2A 4O5AA 1UPUA 4PO3X 3RS4A 3WHLA 1NBMA 3X2FA 4DWOA 1MF7A 4ZHQB 2B1JA 2AZXA 1USIA 2V9ZA 1QE5A 3GD5A 2P9HA 1F0KA 1NVKA 2N9UA 2ZYUX 5IZCA 2WAOA 4ZIRB 1DG3A 2ZWOA 2QTZA 4IW3B 5F9MA 4ZO8A 2X40A 2WOJA 3RBVA 3GPLA 4FI3C 3K0HA 4EGCB 2C4TA 1T1SA 2VS1A 3HGQA 4FUQA 5E6UB 3FTEA 3VNVA 3N86A 4U2BA 1YR3A 1EXNA 1WDTA 2MSKA 4E2FA 4LHWA 1NMZA 4C4ZA 1TA4A 1ESCA 4OP1A 4F38A 3GEBA 2FWBA 5FBKA 1GUYA 4TT3D 4IIJA 2IF0A 4KO2S 4PAMA 3V5NA 4FE3A 1QGAA 3U19A 1GZUA 2PX0A 2ZJ5A 3AF1A 5J47A 3IJPA 1GPAA 1SELA 1ZD3A 4FLMA 3SIXA 4Q4LA 1WCIA 5A4AA 2X8AA 5AYVA 3ZD9A 4HAUA 1S3FA 2QRVA 4Y6GB 2GZ1A 1N0VC 2GZSA 2XZTA 3M5PA 5ESXA 5K0CA 2HU5A 5C1PA 2BUBA 5JNSA 2WWTA 3KPYA 3S44A 4DR5B 4Y9RA 2YDYA 3CF2A 4QO7A 1UBLS 2OORC 4KXNA 1WZNA 2HMTA 4ZOCA 3ZG6A 1JEYB 1A27A 1VI6A 2ZKIA 1Y63A 4QDTA 2WJWA 2C83A 3MS7A 5EHGA 1YRWA 4AULA 2JIZA 2EFYA 3SHQA 5C7IO 2JH3A 5I5GA 2B4KA 1N2SA 4EGSA 4G5XA 4XPIB 1V7QA 1XMSA 2OG2A 1OW3B 3SC3A 4W9MC 2PO5A 1SXGA 3UB4A 4HP8A 1WMSA 1DZ3A 4TT8A 1DHTA 3PQ6A 1TX4B 1E3WA 2RGWA 4EI8A 5B2EA 3GEEA 1LRLA 4IUBS 1T15A 1GUAA 2IX3A 3TD9A 5HCIA 2X22A 4RTKA 3L1HA 1HWYA 2D5CA 6ABPA 1W36C 1P5RA 1KYWA 4HWSA 2XVYA 3RGWS 2XY4A 2XMPA 1J0AA 3UH0A 3HA2A 3I6YA 3JQBA 1FLAA 1XWFA 3Q8XB 1XL1A 1W4RA 1XHFA 1IPHA 5CLFA 3JU3A 1GU7A 3Q3GE 5KOJB 1RRVA 2OV6A 4ZVKA 1KMIY 3SJ7A 1SCJA 3TR5A 3FG9A 2Y1KA 4A9AA 2OY0A 2PKQO 1Y82A 3G2JA 4Z4QA 4KAAA 2XT6A 2GZDA 1UK9A 5JCJA 2DB3A 1J2RA 3S81A 1VHJA 4V0OA 3QIAA 4PCUA 3IEVA 5CH8A 5P21A 4JLAA 1N2ZA 3NS7A 4TMZA 2J09A 1OVGA 3EMKA 4XB2A 3EUFA 1PTJA 3VC7A 4X54A 5FCDA 1KETA 2RMKA 3GJ4A 2B5OA 4JUIA 3E8XA 3NI2A 2CLLB 2XRZA 1JQDA 3CUEF 3BIFA 4I3HA 4HS4A 4BYMA 2ZWMA 1JNXX 1TM4E 2RAUA 4X7PA 4YT2A 4D41A 1JDZA 1F9EA 3IEXA 4YO8A 1JIKA 3ZKAA 3E23A 4WFKA 3KEGA 2FZCA 1XX6A 4GX1A 2AHOA 2MR5A 4HS9A 4J0EA 4Y2RA 4ZCQA 3PTAA 2C7BA 2P9CA 3EEIA 4OKNA 1GGJA 4PRKA 4B3MB 1ESDA 1X80A 2RI1A 4DC1A 1EBUA 2LZ0A 3H1BA 4I4CA 1JZQA 2IEYA 3K0FA 2WTUA 1T9AA 3DL0A 4CF3A 1CEQA 2K2QB 3D5TA 1CV2A 1JGTA 3ZXXA 4ZYZA 1WKBA 2CXXA 2Z0MA 2BKXA 4MV5A 5LC1A 4BMYA 2R6R1 3NFYA 1EK1A 4RVDA 1GR1A 1KKLA 3HHEA 4XR4A 3ZQJA 1MRSA 4WD3A 5HQJA 3WQSB 4YAIA 4XWKA 3I61A 4J2TA 4HT3B 1R00A 4DIBA 2B4RO 2VDMB 3PYLA 4W9NC 1RXYA 1WAMA 4PLTA 2WIGA 4LN1A 2ZUBA 3M1LA 4JOCA 1XFAA 3M6AA 4HH1A 4K0RA 4R9VA 1E2HA 1L5KA 3VZDA 1L7OA 3KJZA 1RRGA 1GV0A 1T5SA 1NUSA 2RGCA 3FYUC 3KUKA 3OPYA 5TQVA 3RRJA 3O3OB 3VGPA 2F8SA 2OCYC 5JCOA 3ZHRA 4D4JA 4MQFA 1KKMA 5HNKA 2NZJA 1A8UA 4F9FA 3H1GA 4WI1A 3FMPB 4WVLA 4YA6A 1R6XA 1HSZA 3LA6A 4NG4A 3V8EA 4PG7A 2RHBA 5AVKA 1DBWA 1DFIA 3OTWA 3N2EA 4GMKA 4RH1A 3SE7A 4D81A 2QGNA 3N2LA 1J70A 4B6GA 3T38A 4UHDA 2MSLA 1MV5A 4FGUA 1OYVA 4HEA1 1RXIA 1FQKA 3HH8A 3OEEA 1FDSA 3Q7SA 1VYVA 3I4LA 5I7WA 4HNUA 4BZXA 5A0VA 2IYPA 4XLTA 3ZH2A 4HJXA 3WISA 3ZY3A 1E2DA 3OEWA 1YFLA 3NM4A 3VH4A 4QULA 1JSXA 4W9RA 5DM1A 4YWJA 5KX5F 2D13A 1V8BA 2ZTLA 3EWIA 5IP5A 2BI7A 1MEEA 5KQMA 1HSOA 4YPVA 4L5BA 5FT9A 3D2AA 1Q11A 1VL0A 4LY0A 4P5PA 2BGNA 3JQ8A 4ZXPA 2HCFA 3PHGA 2WC1A 3ND7A 3IT0A 5H16A 821PA 3QJYA 3BL6A 3HUUA 1IXRC 1YT5A 3D0OA 3HL0A 1NE2A 1U7PA 3NDJA 3BVPA 3KG2A 4MVJF 2BMDA 2BC9A 2X7HA 5FJJA 1G6OA 2GCNA 2RGXA 3QG1A 4Q39A 1NLUA 3QBVA 4TV9B 1TF5A 4J3FA 1APBA 2O3SA 4CMIA 4YRDA 2FFJA 2IIQA 3WGNA 3HLTA 4C3VA 4HNVA 2NVUA 1B1CA 1G5FA 1SHLA 1NVWQ 1ODIA 1YVEI 3AP3A 1M6VB 3EWSA 4I4TB 2WD8A 3O47A 4NBUA 4PCLA 1XRLA 2HMYB 1UZAA 4HDRA 1NUUA 3ES9A 3FJOA 1N2HA 1GZSA 2D1RA 4BJHB 1KZ9A 2P7IA 4G26A 1P7ZA 4JODA 2WDZA 1EP3B 1I1OA 4FK8A 4BQQA 4F84A 2JZCA 2DY1A 2VHWA 1O95C 4IRMA 1W30A 2JJ2D 5DGTA 4RKYA 1WQ4A 4CVNA 4BGUA 4DSUA 3HC7A 3BTUA 4L51A 4M1KA 3UYLA 5KDLA 2FCRA 1NW4A 4KLNA 3TAUA 2PLRA 3GH1A 4XUCA 4D9MA 4ZV4A 4ABTA 3KSUA 3DBLA 4OIFA 2XOKA 3ZY5A 5BSGA 5JCXA 3LCJA 1TMGE 2CUTA 3GP3A 1AQYA 2C9CA 1GR0A 1V41E 2DBRA 4Q7JB 1AQNA 5DULA 1Q0QA 4O4LF 4RKFA 1J1IA 1VBKA 2BI8A 3L8HA 1OJ7A 2ZUTA 3DKPA 4K6MA 5DGCA 3R3XA 4FW8A 4ZN6A 4A15A 3K0FB 3SR4A 2X8BA 4X8HA 3DJFA 2EEZA 2Q1UA 5LLTA 4NFHA 3DEIA 3VKWA 3TDNA 2HMUA 4A6PA 3U44B 3CINA 4X71A 1U2GA 2AOTA 5DGHA 1NUPA 5CCDA 1AIPA 2J0QA 4GX0A 1BEZA 4ES6A 3KQOA 1LF5A 2C20A 3L0OA 4KRXA 2PPLA 1PV2A 1QCCA 4M55A 4R5HA 4Z86A 1BG6A 5CVUA 5IBPA 2VYCA 5HIJA 2QTFA 4ALMA 3F8WA 4LE1A 3H5VA 4J4TA 1G5QA 2XUAA 3NCHA 3RABA 3GGDA 1ZKMA 4E07A 3OH8A 4QUAA 4R8LA 2VSYA 4RAQA 4OK5A 2HIAA 3FI0A 2JIQA 2GRJA 1IJKA 3K09C 2ATEA 4IIGA 3PICA 1MX1A 2D5IA 3QOWA 5BUSA 2WBLC 1SG6A 1DIBA 1U28C 3GELA 4GPBA 3EQ9A 5JSHA 3RS5A 3ZLVA 4PO9A 5AJZA 5HIAA 1UADA 1YOVB 5SZIA 1X3LA 1NXPA 2QXYA 4B4KA 5LWHA 1ZH6A 4DIUA 2WINI 1SA0B 1V7PC 4Y6PA 1Z35A 1P31A 2YNMC 3A4LA 3MSCA 4JVNA 1CTQA 2AI1A 3KXKA 1ADGA 3M3HA 1FLDA 3R5SA 4GMGA 3HBFA 4N01A 5JI3E 4DUZB 1KKUA 1PDVA 4O4LA 5JXIA 4ZGWA 1PT9A 4G36A 4DZZA 1RYMA 2XMQA 4JJGA 4NZNA 2HSWA 1G2PA 3HWRA 3SJAA 4DMRA 2FFAA 2FW9A 5LN1A 3T4XA 1FRNA 1QYXA 1XQYA 1OWLA 1W6UA 3G2MA 1IATA 3KUUA 2QRKA 4FEEA 4OJTA 1V5WA 3O8OB 5JTTA 1YQUA 2ID8A 3BMNB 1GNLA 3T61A 1EUYA 1OUMA 2F3SA 4E70A 3EC1A 3GIDA 3ZGVA 2FRVA 1E0SA 1RXSA 5AI8A 4IS3A 3X2SA 3I73A 1PJRA 4HQRA 4WIAA 2DZDA 2R5NA 2G04A 3I5MA 5IKOA 2VDJA 3PPIA 5JJKA 2HSEA 1QMPA 4YONB 1DTEA 3THXB 4YMTA 3OBBA 4Z8YA 3OIDA 3IHTA 4FQ8A 2WF7A 3DE6X 5DI3B 1XI2A 3RW9A 2XMZA 4RZ2A 3TMYA 2C2GA 4O29A 2FPOA 4OLAA 4XM1A 2EERA 1NPYA 2H9AA 3GDFA 5ALJA 3RV4A 4EDFA 1Y1RA 3QI2A 1QHHA 3REQB 3W5HA 2FMIA 4J0IA 4PTLA 3N7TA 3V3TA 4H2DA 3FW1A 3VNBA 4FGJA 5DWVA 4EJSC 2EJUA 4Z4IA 2O8VA 2BBSA 4BO3A 4RHCA 1OGIA 2Q4OA 1BW9A 3LCVB 3LUPA 4I5EA 5CD9A 1RXUA 2COKA 3EXHC 1KI3A 2GPJA 3R4CA 4WMLA 3GGGA 2QX4A 5D8DA 1HNNA 4XIGS 4GC9A 5BWMA 5HVNA 4CKWA 1ABBA 1HFEL 3QFHA 3GRUA 4CTJA 1H1TA 1Y80A 2KJQA 4R1QA 5BSFA 4QYSA 1I3NA 1LTKA 5FQOA 5JS6A 3FOWA 2ZYWX 4JBLA 5CXXA 1W4AA 4L8WB 3RWMB 1U0JA 1LUAA 2H9YA 1T5TA 3VR0A 5FFMA 1X1AA 1H3EA 1MHTA 3OHSX 4A2CA 2FJUA 4GVLA 4DMGA 1BW9B 2VT2A 3L8GA 4FN4A 4N0PA 1PNTA 2JAWA 3W4KA 1UP6A 1A96A 1CJTC 1LLCA 1L4YA 2G77B 4DLAA 1SUBA 3RC2A 3TJMA 5JADA 1F1BA 1KK1A 1T8SA 1I1HA 2AMYA 3MIIA 1VJDA 3B3FA 2W6IA 2OHIA 1O0CA 2REXB 2ZXFA 1XCPA 2IIVA 1ISPA 4ENSA 1NXOA 4UM9D 5FBLB 1S5PA 2JFUA 4AKGA 1NVXQ 5C81A 3WBBA 2BUAA 1RC8A 3K05A 1TM7E 2Q1WA 4CM9D 1MB3A 1E2FA 4GX5A 4CDMA 4ENUA 5B3JC 4KPUA 1YK0A 3I9NA 4HNHA 4MJLA 2HNAA 1YUMA 4Y2YA 2Q3CA 1BZYA 3DDSA 2RBGA 2C2KA 2ADFA 4BU1A 4LMBA 1Y8CA 2CYAA 4E3ZA 1N2XA 5CFRA 4WY2A 4OAOA 3GLKA 2JFYA 3PUKA 3S5JA 4ZKEA 1CT9A 4J7UA 1U9IC 5IDXA 1AHPA 4UJ3A 4CLXA 5CNKA 1XF9A 4IO1A 2ONCA 4ND1A 1XLVA 3H1PA 3KWFA 3EW9A 4O0MA 4CG3A 2XCQA 4ZYTA 4CUKA 3DHEA 3ADOA 1IK4A 1YZUA 1YZHA 4MNTA 3AG6A 4Q9LA 5FTMA 1HYGA 2L42A 5CM8B 4C6TA 2X77A 2ZM6B 3ISTA 4R71A 4P34A 3LFHA 1FL9A 5F2EA 5I7FA 1E60A 1M2EA 2A9FA 5CCBA 2XZPA 2H51A 1X39A 3JAKB 4W5NA 4E08A 4EPXA 2PGOA 1M1XB 5CRIA 4Z3KA 5AO9A 5UKDA 4HAWA 1RRKA 3AVUA 5L53A 2ENWA 2PZ8A 2WM3A 3VOSA 3P0RA 3ETLA 5H68A 1KJ8A 3K1TA 4PZPA 1UKVY 3LC2O 1QORA 2QRVB 4QD3A 5JSUA 2H17A 5F1KA 3M6VA 1MW8X 2BH2A 4GG1A 4PN7A 3O8BA 2XHZA 1TU3A 2B8TA 1NVMB 4GDMA 1FBNA 1HQYE 2D5LA 4C20A 2I99A 1TC2A 2Z4SA 1Y1PA 3WGIA 5FKJA 5FR2A 3NV9A 1VRCA 3FSEA 3MBIA 1C9EA 3I9FA 4L74A 4N18A 4MV8A 1FVFA 4DLVA 2A6PA 4EMSA 4RL6A 5G41A 4LJSA 1D5WA 4IFBA 5JNUA 3WLHA 4V2UA 1PR2A 3B1VA 2C5EA 1XVLA 2J31A 4I4IA 4LIPD 4PSCA 4XDGA 1XMVA 2ORYA 1KDPA 2WT8A 1HZJA 1HH4A 1LQUA 1LPPA 3C6BA 3F5FA 3HBLA 3OECA 4NYJR 1OHHA 1OLUA 1Y3FE 1PG5A 1B4DA 1TW3A 2WIBA 2RGAA 3HCAA 3O83A 1JDSA 1PKEA 1T2NA 1UL1X 3N0WA 4ZYWA 1VBMA 2KX7A 3RFFA 4ZTZB 2Y4NA 2AN5A 2G0TA 2OFWA 4ZZ3A 5JANA 4XSHA 3NOVA 3MMSA 2NG1A 4DWJA 5BUZA 2XYVA 1IN7A 2QQ0A 3BMXA 5TB5A 2JANA 1XJWA 1Y3BE 4GYJA 4WKNA 1G5TA 3N7AA 4Z7OB 5ES3A 2A58A 4ZJPA 1LBSA 4RZ3A 1G5IA 5A7FA 4GOND 2LDBA 3T0GA 3MFYA 2FUG1 4UAVA 2IL1A 4URXR 3DEKA 2HXYA 1P7CA 3KLOA 4X41A 2JAXA 1XCLA 2BE9A 1D7AA 2MSNA 1FYEA 1O5OA 3A1SA 1ZMXA 1TF2A 3AHEA 3CG4A 3I12A 3I2IA 2Z98A 2HA6A 4IIUA 5F12A 4PSUA 3QIVA 5IVPA 5JS1A 5BR8B 3AIIA 3FBWA 2IKSA 1U7XA 2FPPB 3KL2A 3AQ4A 2HA5A 3BXEA 1V5IA 3DBRA 1WCWA 4MIOA 2IVZA 3AWDA 1JNYA 1JHUA 2J0VA 3OOHA 4OXKA 4AJEA 4WEOA 2MIIA 3NWPA 2I87A 4JCCA 3OT1B 1VKJA 1YV9A 2G71A 1LI5A 2GWHA 5ALDA 2XZDA 3E1KA 2WU4A 1T9GS 3H75A 3QUSA 3RI3A 3IDAA 2NT3A 2JCVA 4DR2B 4QATA 3TNFA 2AUTA 2Z9BA 3KAKA 3ETEA 4IDNA 4NPHA 4F45A 5LVAA 1U7OA 3KALA 2CL5A 2JLYA 2FFRA 1A3CA 1Z5OA 3ZZMA 1P7PA 3M81A 3WLRA 4KG7A 4OMCA 3PD1A 5DPMA 3QKWA 2GETA 1IRXA 3NIWA 1IM5A 4JI7B 4FIZA 1IXZA 1WL8A 3HRHA 3U7EB 1QRSA 1XRQA 3NUZA 1Y3IA 4TM7A 3URKA 3LY9A 5J5CA 3TVYA 4G5RA 3W77A 4EX7A 1AXRA 1NXWA 2GWRA 2OLJA 4U6QA 1JHAA 3WLQA 5C5IA 1YZKA 5CA0F 3B6KA 3DZDA 3IIJA 1FFHA 4FZRA 4IGAA 4BFVA 4F72A 4E5MA 3ZBTA 3BKWA 1FZQA 1XBTA 1QGZA 3PC8C 3PBKA 2XUKA 5GIOE 1KHTA 1XQ9A 3LWDA 4ZRNA 2D3WA 1GPH1 4L6CA 1DJQA 4MV1A 5A9RA 2CWWA 1XUOA 2FGJA 2VJNA 4DG9A 2PA3A 3IQEA 1AKTA 1RWNA 4G4GA 1JMYA 1THMA 2EX4A 2VSFA 2NU7B 2BFEB 3FIJA 3H6KA 4KE9A 2PK3A 2HMWA 3PFGA 3BZWA 1CQPA 3MT7A 3QEKA 4CQNA 1TE2A 5GVSA 3IUPA 4DY4A 4PYLA 2DPGA 3BSYA 4RA9A 3STHA 3UK6A 3WNZA 3PGLA 3HDJA 4MJ7A 3N58A 4YUXA 4XYEA 4TKVB 2VJBA 1GN8A 3N3BC 4FQ7A 4NBKA 4PZDA 5KMGB 1C9KA 1LVUA 4G5HA 4AZ3B 1OQAA 3O4JA 2XOEA 3VU0A 1Y1SA 4N3AA 3ZU3A 1N2OA 3BOSA 2BM9A 3GT7A 3KS9A 2Q7XA 2WD7A 4EG4A 3OSUA 4L7QA 4JT9A 2XNDA 4RMNA 1T8YA 3ZZTA 3MLEA 1JVBA 2A33A 4Y6QA 1J2JA 2PG3A 5LP6A 3I8SA 2ILVA 3NAZA 3JVUA 5C1OA 4LXQA 5BV0A 1RYFA 5KUTA 4RBNA 3K3PA 2NVUB 2XVZA 4CCAA 2XGJA 1BXGB 1XVTA 3HKCB 3R3WA 1DWUA 1AKUA 1VDZA 3LV8A 2BFCB 4UASA 1F6WA 1LW7A 4RD3A 2O8DB 4V0SA 4AZ3A 1TYCA 4Q48A 4P0TA 4RF3A 5E9WA 3ML1A 1H4QA 1VP3A 1HDOA 2PH1A 1T0UA 2AFHE 1AQIA 1Q0LA 3DOCA 4FONA 2VL7A 3SZMA 3V8VA 2YOFA 4HGNA 3MUOA 4HPXB 3TTTA 3RUHA 3NJRA 1NR1A 2BE7A 3UUFA 1JHOA 1A8IA 1MJGM 1M34E 1K3FA 2FPMA 3IMFA 5CHYA 3NW9A 4DDWA 5M34A 4ZT6A 1TLLA 1DU4A 3BD6A 4FFWA 2CCGA 4HXYA 3LW8A 1S2DA 2GAIA 2VG8A 1B43A 1RLUA 5H9WA 3QYJA 3TFOA 2CYCA 1AN9A 1EFCA 1G38A 5KVSA 1CEEA 3IO5A 4GGPA 4HX9A 4UUPA 3A1DA 3QXGA 2YIJA 3WHIA 2R6AA 1TGYA 2HGZA 1DAFA 1WQ3A 2B82A 4PZUA 3JWPA 3RAGA 3T3EA 3CE6A 3TZLA 3S1SA 4XYBA 4KODA 2AN1A 3HXOA 1NKSA 3I01M 3K7EA 1SBHA 5DF1A 3HEMA 1II8B 2NGRA 4GI3A 3N07A 3NATA 2Q1SA 1BSVA 1XDZA 2Q8QA 2GD2A 3IEPA 5D6OA 4PX5A 1EUQA 3DZJA 2VJMB 4CIWA 2P62A 2WUWE 3E5RA 2C3MA 3PXAA 4R6WA 3UFBA 4TRMA 5L95A 1E3IA 3CF4G 1XMIA 4TYWA 1GNVA 3EZ9A 1TCVA 4ZANA 4KFCA 5KYWB 4EEKA 4CIDA 1C8KA 2RH4A 5EXTA 3C5HA 2I7CA 2Y92A 4HF7A 3E7WA 2C5AA 1LVHA 1MOZA 2DQKA 2WNHA 4JP1A 4LRXA 3OKFA 1EDEA 1K7XB 2VBCA 4G5QA 4F5EA 2Z4RA 1Q92A 4CEJB 3H9EO 4FOOA 2AE1A 3KJNA 3U13A 4DJEC 4DT1A 2ZKLA 1OWNA 1NBIA 4GI1A 3E8SA 2IYAA 3EPLA 2OVFA 2WUDA 5INTA 4C7BA 3Q1KA 4WASA 3B36A 2JFQA 4OF4A 2UU9B 3ERCA 3ZVLA 1QQ5A 4U4AA 4MVYA 1Y1QA 1CRZA 2YC4C 3TZCA 3CZCA 1FFWA 2RCYA 3V33A 2FZ5A 2DTEA 2QZ4A 4BRZA 3U3XA 1LPMA 3B5IA 4QEKA 3MMZA 3CVWA 2Q3DA 2HBZA 3H1FA 4X61A 3T7IA 5BV7A 1BWRA 1GGHA 2Y1DA 3B51X 4Q1DA 4WBSA 1PW7A 4YHBA 3ZCVA 1IY2A 1SUIA 4R40A 4TLMB 1BCRB 4ZHSA 1OLSB 1B26A 2VWQA 2Q5HA 3M6LA 4B2LA 4OHYA 1U65A 4FGZA 2C54A 4KR9A 3RVRA 4DCOA 2J48A 1JFTA 4QC2A 1OMOA 3B1YA 1M1YB 1Z6GA 3VOTA 2IUFA 4NQRA 1GFZA 2B94A 2VNHA 2QU7A 2PSJA 2WRZA 3FLAA 5D2CA 5K2MA 3SIPA 4BKUA 3AUFA 4HATA 2IF2A 2AD5A 4IIJB 2OZLB 3IPRA 4KRYA 3NORA 4G5GA 3VNAA 5HHTA 2XZLA 1QMGA 3PZBA 3TD2A 1OHHD 4BMVA 3O7MA 4LYFA 1OH7A 1CW2B 2G1PA 2F67A 3TRKA 5AVWA 1OKKD 1ZOSA 3T7DA 4WXEA 3K0AA 1J0XO 2OZPA 2A67A 1P1JA 1RWWA 3PEEA 3Q6IA 3QE3A 3T9AA 4QM6A 3SIWA 3HE3A 2E21A 3F96A 1NRWA 2ZBQA 1NVTA 5BXQC 3PGXA 1CP3A 5CITA 1PWXA 1JQ3A 3GN1A 1YZLA 2XTMA 5AESA 1KBOA 2Q45A 3DLIA 2YN2A 1S9HA 4QUJA 2PZLA 4HDAA 1N34B 4ZEWA 3R0JA 5H3HA 1PK7A 3G8DA 1NX6A 3VC2A 1C9DB 5B1DA 5SY4A 4DUGD 3UGJA 2G6BA 3QZUA 1PZXA 1B7GO 1GFWA 1PHPA 4ZOLF 2YASA 1AQ6A 4RCZA 4UOZA 3GRYA 5IN4A 3TFQA 3OPXA 1BJKA 1IY9A 2XNCA 1JI0A 1UF9A 1UJMA 2QUKA 2X4GA 3F1KA 2I55A 3DR5A 4Y30A 2QAGC 3NKFA 3GA0A 2UKDA 1OWOA 1VCIA 1JSZA 3UPTA 2R97A 2RCNA 2H2FA 1KI1A 1G60A 1J0DA 2P0YA 4E2WA 4WKPA 1RRCA 5K3FA 1IUOA 4PZEA 1Q95A 1RI4A 3T7TA 5FLXA 1P0IA 3NPMA 3RUAA 3G2KA 2JD1A 4P9NA 3EGXA 3OKCA 4HXFB 3B6EA 1WW2A 4LPKA 4TM8A 4J76A 4MRMA 4S24A 4NJMA 5E2BA 1UIRA 3H5AA 2BHTA 4TS9A 4DXDA 4LVNA 2AR7A 3DNFA 3DOFA 3ASZA 4LCJA 1BJTA 3OQBA 1WRBA 2CUKA 5IDWA 2QZZA 4AIRA 2I6SA 2PV0A 4XQEA 1RHKA 5DYNA 3KR0A 5AKGA 3IUBA 2OP1A 1BXRA 3CJQA 5EQFA 1C3XA 4BS9A 4BNKA 5KVVA 3FPLA 2PS9A 1YFZA 1HE3A 2G4VA 1LF0A 3SICE 1JKIA 4LTDA 2EZ4A 4I3GA 3VV3A 1BVUA 3IA2A 3ZWCA 3ECSA 1ZD4A 5KEIA 1QK5A 1R50A 2QX8A 4I1SA 4YP9A 1ZOIA 5KSPA 2X2EA 3KK0A 5FQNA 3PE3A 5IN5A 3SBXA 3VO1A 1T4BA 2L19A 4EHDA 2W2LA 2LVBA 5K3OA 4ZGGA 5AKLA 2OBMA 4WKCA 3PIIA 1P60A 4LDZA 5LQMA 4KQXA 2V7GA 3I45A 3BWCA 1FZTA 1DX4A 4R16A 1DQZA 3ILYA 1C8LA 2YRXA 2YXLA 3OFND 4EK9A 4IOJA 2JFFA 3UAVA 4M8SA 2WF5A 1N2CA 1U0EA 1X7WB 2AVDA 2JJQA 3CLVA 3CUWA 3E15A 3LPNA 4K3VA 3DL7A 3FWYA 3IEMA 2QG6A 2HT1A 3AK4A 4I0WB 3ILXA 5IBCA 3EMVA 4EFNA 1GL9B 2XKJE 1UMBA 1P4GA 1A4XA 2D0DA 3GPCA 3I2HA 4I6JA 1QO0D 5JAHA 2ZXEA 4Z0PA 2I3DA 3QOFA 4L8GA 4RESA 1KOJA 3CVYA 5EIOA 4ASUA 5K0JA 4RJTA 1TK9A 3C98A 5TMBA 4AY5A 3GLTA 2H2GA 4E7PA 3C39A 5KNCH 2EZ8A 3LHSA 3EVZA 5FP0A 5P8WA 1G63A 1ZI6A 5GP1A 1OXVA 1Q20A 3H9JA 2HDNB 1RQPA 2B30A 1PEKE 4JT4A 3MW8A 4DZRA 3O1IC 2QPAA 1YCHA 2HT6A 4J49A 2FR1A 1ECGA 4X91A 4CQMD 2GCOA 3IELA 2PPVA 3HJRA 5JS7A 4QBIA 4C78A 4F04A 4DLKA 3LECA 2BGGA 4TTRA 4FEGA 2ECQA 2FEMA 4S12A 1N77A 4A92A 3SBDA 2PDAA 3KXLA 4IDPA 1E0KA 5BW4A 3BRCA 5E3IA 1RU3A 4FFBB 2EQ5A 2HJRA 3MVEA 4N1AA 2O8CA 3B6MA 3BX1A 3I6ZA 4GI2A 5F3RA 4B6PA 3AINA 3GA7A 2FEWB 2FY8A 4X1IB 3PNVA 3WVNA 2PGXA 3ZZ0A 4CMHA 1KWGA 4Q3BA 2J6CA 13PKA 1MAWA 3N74A 4FOPA 1E9FA 5AI4A 1UMDB 3RFVA 2ZE6A 4P7FA 3IT3A 4UVEA 5I9BA 2XUGA 5FLYA 1J1UA 1DIGA 2WE7A 2HJWA 4P58A 2PKEA 3WWPA 2VP6A 4NPCA 1BHJA 2DT5A 5AVVA 2OCBA 1QQAA 5MN6A 2J3LA 4FBLA 3ZIUA 1Z5PA 3DE7X 1DKLA 2QMYA 4EJFA 3NAGA 4EVRA 5KKCA 4D2IA 4B73A 4IPTA 1JEQA 2ZJ1A 1LC0A 3PP8A 1SBIA 2PLNA 2WHPA 4Q34A 3JAMA 1GUBA 1R8QA 3HGMA 1CUZA 4NJMB 1BEEA 3I6MA 1V39A 5EOVA 2V8BA 2O2CA 3E7DA 3FFXA 3MCAA 4M1ZA 4BE9A 3LQ4A 3N6RA 4U9IS 4L9RA 4TZKA 2V3CC 3W5IA 1XJQA 2QJFA 2EYQA 3T3GA 3PGA1 4WGGA 4K6HA 1X42A 5JRDS 3VR3D 2QNRA 1KSGA 1X7YA 3FUWA 1ZW6A 1O1YA 1RAGA 4LRTB 3WL6A 4Q66C 5DRTA 1RQRA 4QGFA 4AK9A 5LMNB 2HHHB 4YJGA 4YAFA 5HKBA 2WSBA 1ZJZA 1CIJA 1HLFA 3V9AA 3QMWA 2RHJA 2HSJA 2I6QA 2QV0A 4ARSA 3UJCA 2W2QA 2JIOA 2NUPA 3FNIA 3L41A 4XVHA 5G3ZA 3ZGLA 3ZWVA 4OO3A 1WF3A 4P32A 2PMEA 3TLJA 4C0JA 5JD4A 1FS5A 1Z15A 3MJTA 4KMSA 1NP3A 1IXKA 2PUTA 4JZKA 1ETUA 3VGJA 5A3QA 2VBGA 1MN6A 1NULA 2CUZA 3HCCA 3OTGA 2VNAA 3I01A 3P9CA 1B0ZA 5G02A 3GLFE 3HI6A 3L8CA 1U63A 4ZQCB 3FCYA 1OYOA 4M7OA 3EPJA 3VUFA 2B21A 1NG9A 1YB7A 2FKNA 2PKWA 1ZISA 4UHCA 3GNSA 1XNQB 3KPUA 3S1AB 1YASA 3BFKA 4LSWA 5DE3A 4D0LB 3QXJA 1XK6A 4ZAFA 5GJCA 3A3KA 3W8FA 5AIAA 2ZP1A 2FAXA 1WMBA 4TVBA 1ISHA 1E2MA 4QYXA 2D7DA 4IFTA 2VPZA 5ECGC 3OESA 1H0SA 2XBMA 1SBCA 1V7ZA 2TMDA 2RB4A 4KLCA 2ZG6A 3U9LA 4EA6A 1VBNA 3KOXA 5FPSA 1E9EA 1Y89A 4BB0A 4L3VA 2AC2A 1UWCA 4G0YA 1G4AE 4W5JA 5DM0A 4NV1A 4ODIA 4B35A 1P5HA 1NGSA 2MWMA 3R5TA 3UF0A 1I33A 4P80A 2Z2XA 4LHYA 2Z6QA 1ENYA 3HADA 3LH5A 4U0KA 2BEWB 1EVYA 1UBNA 3OE4A 1JYEA 2J32A 2IK8A 1RVDA 3K0CA 2P1RA 3I0MA 3NYWA 3OLZA 4D8XA 1M83A 2G1AA 2LIVA 3L1VA 5F1PA 2G36A 4DEYA 4YP6A 5BQFA 1P2DA 1UCFA 4ONEA 5AK5A 5KYYB 1W52X 1HV8A 4DCCA 2K6GA 3GFQA 2OHHA 3HPQA 3KYJB 1NF3A 1SQ5A 2RKWA 3AKEA 4UXHA 4DYHA 2BFCA 2N3ZA 2JFZA 1R6AA 2Q3BA 3K8YA 1JYSA 5K2OA 2HTEA 4RA6B 1GD1O 3MTDA 2PRJA 5GONB 5KOHA 1B6GA 4KB5A 3BJEA 3TSOA 1BGWA 2EJCA 3ICCA 4BGIA 2PJZA 2FLVA 1T3GA 3EK2A 2QRLA 1O2DA 1A8SA 2QR3A 3I53A 5FPPA 6GPBA 1AV6A 3KD3A 4RTMA 4MRPA 4XVCA 2ZRJA 1FLVA 4EB6B 1HFJA 1GCGA 2P6PA 3O73A 1S3SA 2XRMA 3R8FA 1A1VA 3M5WA 3OU7A 3K70C 3PHHA 3L8MA 4EA8A 2FETA 1SCUB 3FWKA 4EY7A 3OQNA 1NKVA 3WMEA 5AKIA 1NP6A 1C3LA 1JJVA 3AZOA 3HV2A 3OJFA 2JEZA 4HQNA 5K0GA 1ONOA 3IR5A 2YKGA 1Y33E 4BVGA 3IRUA 4JOSA 3EZ7A 4C08A 4LNAA 4IIJF 5K1ZA 1IL0A 1XCMA 3WK8A 2I1LA 3JV7A 2VTBB 2JBAB 5MHTA 3IUJA 5KNBD 1EPUA 5KYXA 4EH1A 5FOVA 3GDWA 4NFLA 3FPFA 4Y18A 2ZR0A 1NMEA 3UOAB 4EHFA 1O57A 1XTBA 2JJ1D 3GNTA 4HYEA 3MLBA 4B7AA 1YJAA 4QRHA 4F21A 1W5SA 3NC0C 4XM2A 1G19A 1WKVA 3K5WA 4ZCSA 4E5UA 4RMHA 3UPDA 5BYKA 3SHWA 3ZE9A 3RYIB 1M2JA 3SQNA 5IAKA 3FN4A 3H4IA 3SFZA 2XXAB 3HJFA 3RQIA 2L18A 3U4QB 1RADA 4OGGA 4H7DA 3P9YA 3KOYA 1D0VA 1ZI8A 4V0KA 1P91A 4W8GA 1H1LB 3BHMA 2G83A 2OMEA 1HQDA 3G5AA 5GZ6A 3RS8A 5CFPA 1EFUA 1F6BA 2I4MA 2NVWA 4OXIA 2AW5A 1ID1A 4IMRA 4X6XA 2P7HA 4E12A 4WLFA 2QIPA 4PFSA 3EH1A 4K9OA 2A0FA 2BFOA 1CB0A 2NYVA 1GILA 1K08A 1SVWA 3QXCA 4PZZA 5CU7A 5HE8A 4YRIA 1R0YA 3G49A 3A58B 1PFWA 4I7EA 3IJ5A 5A0FA 2G8LA 1XKTA 4WUTA 3FPEA 1QLJA 5F77A 4W7SA 2DKOA 3OM9A 4AKTA 5MFPA 4JFRA 5MFZA 4OHFA 4QOHA 1JG2A 3SKXA 3EC2A 1E7MA 1HETA 2R5FA 5EIXA 2DR2A 1YJ8A 2LBPA 1ULTA 1XB2A 3Q0EA 4GC5A 4COOA 1M9NA 3OZEA 2QSUA 5FBRB 2R8OA 4E5NA 2O2EA 4JR0A 3HLKA 3N5CA 2PUVA 3RRXA 2JGKA 3UG7A 1PFUA 5CLHA 1PL7A 3USZA 5J1SB 4IH4A 5FTLA 4IGKA 4HLCA 2OYRA 5I45A 4Q6BA 3TMKA 4M60A 1IVNA 4O4JA 3MBKA 2C88A 2IXAA 4QG3A 1Z06A 4MQEB 1W59A 3FHJA 1WVGA 4J1QA 4ZPXA 2K7FA 2GEKA 4QXQA 4U0JA 3A1TA 4H4DA 2O2GA 1O54A 1YC5A 3ZHBA 1ZL2A 1P0FA 4RZUA 1Y5NA 1YQGA 2V7UA 1EVJA 4KVFA 1GT91 1DG9A 5F5LA 4RTNA 2ORVA 1JW9B 1INLA 3TRHA 2JFNA 1ADYA 2LIPA 2ZTVA 1MBZA 4PXSA 1ZK3A 3KKQA 2QUAA 3TBFA 3W7BA 3DVSX 4V24A 3AYZB 5H9VA 1FYWA 1IHOA 3UT5B 2JKZA 3OLXA 4NOLA 4IAOA 3A4TA 3D4NA 1YRBA 2IYOA 1MXFA 3PT9A 2WLSA 3DTTA 5CFOA 5IVIA 2IU6A 1N2CB 2JLCA 1FF9A 3KAJA 1UPCA 2Z09A 2VXBA 3FZGA 5IDYA 3NKLA 2H0QA 1ZOOA 1F9AA 3MGAA 3ZDXB 4ZAVA 2WJVA 4XSGA 2Z9DA 3N87A 1QBGA 3N2GA 3NGLA 3QX8A 4OQDA 2XTZA 2ES4A 1K4MA 4YRCA 2WE8A 4PLWA 3ZJ5A 5ITZB 1S8AA 4Q21A 5CCXA 1WB9A 3QVMA 1PW5A 3KT6A 4I66A 3RKSA 2I4LA 3VZBA 4HO1X 1HNXB 3QPAA 4NESA 3E0XA 4N5DA 4JA2A 1ZSNA 3KEQA 4M7PA 3WBKA 2M1XA 5FD8A 3V1KA 4O4IB 1UK8A 4RV9A 1BXRB 3UK2A 3LRXA 4XGNA 5D00A 1OI4A 2Q5JA 4J9UE 2X76A 1HGXA 3H1EA 4PICA 1A9SA 1D3AA 2I1WA 5JRJA 3JQBC 3TOZA 1Y37A 3PDJA 2G8NA 4FIDA 2ADOA 2Q27A 2ZVJA 5COAA 1T9CA 1KPGA 2EG9A 2O23A 1KP3A 1SZJG 4MPTA 1EQUA 3AETA 2IUYA 4M1QA 4DPMA 1ENZA 2FW7A 4GBJA 1XLTA 2ZB8A 4MR9B 2XCOA 2YHSA 2BTOA 2HN9A 2IU0A 1QQBA 1E2JA 1L8LA 3IAEA 3SZLA 2BAGA 1RFGE 2ZROA 2QYTA 3BXGA 4QXAA 2NU9B 3M1YA 2PT6A 3OE5A 3GFVA 3PA6A 5D3KA 4JB3A 2QXTA 1IMJA 3HDQA 1O0BA 3ZDDA 1EWRA 3R41A 2FDXA 2R7MA 2OPBA 4M7WA 4MYHA 3OM0A 4TKUB 3VJKA 3HTXA 2JI4A 2HHJA 1TPYA 3OD5A 2XUHA 2O0KA 4PC3A 1M67A 4UBLA 5CYFA 4WHMA 4LOIA 1Y3DE 3WYDA 4QYMA 1T4MA 4Q7EA 4KI0A 4M0KA 4NCXA 3VTZA 1TEXA 1WULS 4AJHA 1HDIA 1TGVA 4LX0A 2ZB3A 1PUIA 3QF4B 3RS2A 2WTAA 2Z30A 4TWIA 4Q9JA 4M9RA 3C3DA 4EKIA 5GJWC 2EDAA 1HBJA 3ZHUA 4FMDF 4GXTA 1VXOA 4QU0A 3AESA 2CE2X 2Y1EA 5JZSA 1JLHA 2F2TA 5K0FA 2GRUA 4HSGA 4A3SA 5IAAA 2C4MA 5B57C 5BSMA 5HKKD 2B1IA 1PWHA 5HRCA 2VO1A 5IW8A 2OL4A 1X14A 1C4OA 5ENVA 2VHQA 2OLKA 8ABPA 5FWNA 1G55A 3N9IA 4LZAA 1Z4LA 1QFXA 2A86A 4GKKB 1ILEA 1EXWA 4ZWNA 4OD0A 3ZWAA 2AWNA 1WXIA 4Y6LA 1CB7A 4AVYA 2HK9A 2ERCA 5JTUA 2IDZA 1JBEA 1QZUA 1ZHHA 4KKXB 1SO8A 2Q4DA 1VKZA 2Y66A 2H1WA 3HJHA 2NYRA 5DGXA 5F5NA 1UFQA 3RVSA 4BFCA 4Q12A 2MSEB 5K51A 4F0JA 5KNBH 4KQMA 4ZMSA 2XODA 1UZMA 2C1XA 2NZUG 3X0DA 3ADDA 5D3MA 3QEAZ 1EUCB 1TFUA 1UMDA 5LFAA 4NE9A 3RRNA 4OMUA 3HXMA 1E77A 1VJGA 1NZFA 3HB9A 3MTAA 3PU6A 4LK2A 4RENA 3U4DA 4CFZA 1JHXA 4X3OA 5DOZA 2YDXA 4KN8A 3HYCA 2CXRA 4Q93A 2QEQA 1YQTA 4BKMA 1VRWA 1ZKDA 1ZMBA 3SXUB 3I64A 2FHSA 5ANRB 5KC9A 3F4KA 2PSDA 4QO8A 1F06A 3EVEA 3CVUA 4EENA 1GL3A 2FHPA 1OPXA 2I6XA 4TTQA 1JEEA 3WAJA 4YC7A 2OBNA 1C9JA 4N41A 3RODA 4CZ2A 3O0DA 2NU7A 3WP0A 4JU8A 3T9FA 4M76B 3N6XA 3JAWA 4Q7MB 1NR7A 1MMFB 4L9SA 4XD7D 5EWMB 1ML3A 1QF9A 4QNMA 1HOTA 1O9BA 2ZIWB 1OIXA 2H6EA 3DP7A 4D8UA 4EZBA 3TSAA 4E0BA 3UC9A 3KQKA 1M54A 3EQZA 1CDDA 2QYOA 3C24A 3NEPX 7AT1A 5G4KB 1XU9A 2JHGA 2WK1A 1W4ZA 2CNBA 3V7WA 1Z0JA 4BLTA 4B8WA 4BEBA 5C4IA 4U6NA 1T1RA 5KINB 1SD1A 3DBHA 1RXVA 3QU5A 4EG5A 4K9KA 1BYIA 1ND6A 4RVOA 4UHEA 1QYVA 4RHUA 1HT0A 1KEEB 3OZSA 3DO8A 2HA4A 1Y1KE 5FTWA 5AW7A 4LJRA 3UV7A 4V1CB 2AK3A 2UYOA 3P9KA 1YO6A 2AF3C 2F62A 5BOSA 3M1IA 4ZQGA 1AJEA 1ORIA 3ZNOA 4E32A 5DXFA 5DK4A 1EK0A 2WJ4A 3PX3A 3Q87B 3GJ0A 5E2AA 4QT4A 4QPZA 5KZMB 2F4VB 4L02A 1A9YA 2YY6A 3P20A 3MCVA 3B2QA 3Q7RA 5LQCA 2WYIA 3HWSA 5KVQA 2FEOA 3G89A 4L6AA 3IKJA 3COVA 4BKRA 3ZVNA 1FNMA 1I9CA 1VIAA 5BMVB 1QS0A 1U0BB 2IYTA 2FSSA 3ROPA 4RS4A 5DLDA 2CJFA 1NNSA 3L7BA 1M2WA 3AY0A 2W58A 4CG1A 3KRTA 4R05A 1SHZA 2QD5A 2QN3A 1KVUA 1R4MB 3QUTA 4QVKA 3SF8A 1XZQA 5HRUA 2GM5A 1R8JA 5AVQA 1FFGA 4NCHA 3VZSA 1M1UA 1V16A 4GP7A 5ALYA 2H1IA 1R9MA 1RM3A 3VR4A 1CIPA 1U5CA 2PKXA 3KTFA 3UMYA 5H8WA 1YCDA 4BEVA 2BZSA 4G4SO 1JSCA 3LM8A 4QXOA 5TJ9A 4KMRA 2CLHB 2PX2A 3AM3A 4EVIA 1YS9A 3I5UA 5CP8A 3SKYA 2PYIA 2X4IA 4MS3A 3MGKA 2DSNA 4IEEA 4ZI5A 4RTOA 4BO9A 3OY7A 4MVJP 1KOGA 1I7PA 3T9CA 2IOHA 1BVRA 2EGHA 2XNHA 3ICVA 4FMPA 4CM9A 5KKNB 1DIHA 1RHUA 1IIRA 1S1CA 1B0PA 2E4VA 4Q7KA 4IIFA 1AKRA 1Z4NA 1FIUA 3B9RA 1S6YA 2H1CA 3AW8A 3IPCA 3O21A 4GBMA 3WLSA 1NJ5A 4K8RB 2XQGA 4I5GA 2VWGA 3U40A 3GJ7A 4WJZA 3BBPA 3WXMA 4AKEA 3TLEA 4I8DA 5FUQA 1NFRA 2NUAB 3U39A 3OE1A 1LI7A 1T8WA 2PBZA 4E4RA 4FNGA 3D31A 3D3EA 4G1MB 1UXOA 1U28A 4Q4HB 1SOWA 3OZAA 1FQJA 3IIMA 1ZK0A 2IP1A 4ZV9A 1OR8A 5JD5A 1J97A 4ED9A 1XV5A 4KIWA 3A7DA 4NYMQ 4UATA 5TGZA 4ZIRA 4I1IA 1ZIDA 1G3QA 1LS6A 1MGPA 1CEXA 2B99A 3JSAA 3OFVA 4XIJA 1YQ9A 4RA9B 2A9RA 4CFYA 4DVJA 1YFKA 3B1FA 3ND6A 3DGFC 4XASA 2FSFA 4GL4A 1YKFA 4GM1A 2C77A 4HDRB 2B4AA 1RWXA 2C0QA 5B6JA 1H2FA 2WUEA 3ZCQA 3PIDA 4GXRA 4BLPA 5JCJD 2O2JA 4B3BA 1CCWA 1E2GA 3GQVA 5LP1A 3L7OA 3LDUA 1DKOA 1AOXA 5CX1A 4RFSA 2WTNA 3TW0A 1YJ5A 5HF8A 4MVJD 5DHRA 5TQJA 2BD0A 3UANA 5J3JA 4BE7B 3RSCA 2YXBA 1JXQA 2I8AA 4M9ZA 3ZXUB 4BFXA 1USUA 1TM3E 1BJRE 4C3UA 1L5HB 5IXYA 4AD8A 4PS0A 4D5GA 1LX6A 2P9EA 4RS3A 2ZPUA 1SOUA 5DO9A 2B1GA 1TIPA 4G1BA 1P7WA 1DHRA 4KYVA 3WKCA 3CVVA 4EB3A 5HUHA 3COJA 3HP1A 3D8UA 4FNMA 4OJYA 3GDHA 3LS2A 2AFIA 3LOQA 2O14A 4D9KA 3A4NA 2XUJA 3B3AA 1Q0UA 2AC7A 3GD7A 3JQDA 4JGIA 4KEAA 2G9NA 1RQXA 4DG5A 2UXDB 1F8FA 1GA1A 4XYLA 2OGZA 3B52X 1BQ4A 4WVFA 4O2BB 3N0RA 1Z6ZA 2GTIA 2Z5VA 1I2AA 4NE7A 4YLYA 2HLNA 2ETVA 1CSEE 2QW8A 3CCBA 3HYLA 4M1YA 5JDCA 3LVRE 2M9MA 3IIIA 5GOTA 3FMFA 3G0BA 1V95A 3W34A 1T13A 3V8RA 5KX5A 1O7JA 1E2BA 3GZJA 2NOAA 1NG1A 3ENZA 3EOZA 2I2AA 3CZAA 4ISCA 1QIMA 1T3SA 4J1TC 4NCIA 1FYVA 2V6BA 3UWDA 8ATCA 2QLNA 1OI2A 3CF0A 1URPA 1BHQ1 2YH2A 3ZJTA 2ZUCA 1F0PA 1N7JA 1TZMA 2I71A 3GGOA 4HDKB 3HFSA 4O3FA 3ECCA 3ETDA 3L6CA 3ITEA 4RVGA 4BE4A 1P80A 4Y1EA 4QZVA 3NBUA 5EP2A 5C5DA 3ZQ6A 1BAPA 2NO0A 2XHEA 2BFEA 3EGXB 3GLHE 3H4TA 2Q41A 3IS3A 4IHJB 4XARA 2XKBA 3Q3CA 1CUHA 3LKZA 4RD2A 1QWSA 2OBXA 2PMBA 4N5IX 2ACKA 4CETA 2XE4A 4HEJA 3SEAA 3W6PA 2QPOA 2QMZA 4ZO9A 2GTPA 4GZ6A 1NPDA 1T2FA 4IIXA 2AJ8A 3S70A 3TE7A 1DC8A 4WW0A 5KMGA 1U8YA 3WZMA 3G8YA 3OG9A 4GKAA 3MRVA 3CNOA 1RLMA 3FPBA 4TSFA 3OOWA 4L4XA 3L7LA 3TAXA 2FK8A 3GHYA 3QU7A 4GOXA 2COEA 3P0IA 4MQUA 3WYEA 4BUCA 5IULC 2IYFA 3DV2A 6LDHA 1GPDG 1TPZA 1MIOB 1FVXA 1Z4MA 4HWGA 3ZC3A 5K03A 3IILA 2GH1A 3I1YA 3KBOA 3C6MA 3BCUA 4KFSA 5FBHA 2QD3A 4YGYA 3UKJA 1U90A 1VLJA 3H0KA 4BNGA 2ZZNA 1SBTA 4F97A 4RQUA 3VYVA 3VPBA 1Z33A 3GROA 3P27A 3WY9A 3BQMB 3TRIA 5DHQA 3TLBA 2R86A 1VE1A 4BJ6A 3WTCA 1H66A 4MQEA 4UMFA 4CE6A 2ISQA 4MQBA 2BGMA 2YHBA 3DTVA 2OBYA 4JXZA 2O2IA 1N5LA 4MV3A 5KDOA 1SRQA 2C03A 4JZYA 4Q4CA 7ADHA 1EWTA 2NWQA 1QIFA 3CE9A 3KU4A 3RUPA 1U5BA 3SF0A 3WOHA 3WLPA 4KR0A 1KBQA 1ZNWA 1JALA 1NBOA 2PHZA 3RIHA 3UXMA 3WYCA 1UC8A 2EATA 1U5AA 4BO1A 4CM7A 4LSGA 2BMAA 3HKDB 3W5UA 5EIBD 4UNNA 4CNQA 1J9EA 4RPLA 1TFRA 2X19A 3K96A 5F78A 4PLGA 3K6KA 5DNWA 5CA1B 3NDBB 1ZNYA 3A1EA 3NIGB 1NQWA 5DZSA 2QQEA 4PBRA 4MIEA 1A76A 2WUFA 2DHEA 3A0RB 1X7ZB 4DLLA 1MQ9A 2AIRA 2CXPA 3OZUA 4GPTA 4JOQA 4P7BA 4KAJA 2NZWA 3KOUA 4Q1EA 1TADA 3HUEA 4EKNB 4ZXFA 2H4YA 3GVPA 3PWZA 4A8JA 4DPKA 5ADHA 4NCAA 1G8SA 3VPHA 1CY7A 5C5EA 2CNOA 2W6PA 3ORSA 4EO9A 2H8KA 1Y8QB 1I6MA 2P9YA 2H5IA 2PGLA 3CSSA 3GCXA 3NBFA 5TPWB 1XMXA 1ZM7A 1CS0B 3FDZA 3FVQA 4PC7A 4HH3C 3WL7A 1U3GA 2JH8A 1QJCA 1HK7A 2P3LA 4M0CA 5KYGA 4D25A 3D0RA 4NTZA 1UKZA 3CN9A 4JVSB 1EBBA 4RGYA 1YC2A 4CBVA 4EMTA 1U98A 3NBAA 3P0HA 1FXWF 3A7EA 3Q6NA 4FT2A 4G6ZA 1IHDA 4ZYVA 1EK2A 3BJRA 4MQ5A 4F6CA 1OXKB 3PXCX 6AT1A 1TTTA 5FHQA 3UHPA 3PSAA 1ZM4A 4CMIB 2YMPA 4CLDA 1MJHA 4CV0A 3RC1A 1E69A 1GNQA 3SIRA 4AO6A 4PANA 2GJSA 2WA2A 2I62A 1JLLB 5H1YA 5DTJA 3JRWA 2YZ7A 3H8VA 2EJVA 1HF3A 1TO1E 4FX5A 4KWIA 2IYVA 5BVHA 1JXOA 1PUJA 2QRQA 3IPAA 4YP1A 2J7PA 3VUEA 4F5WA 4P4LA 3NHLA 1FP6A 4WECA 4TKUA 5DEIA 1YU6A 3ICEA 2PGNA 1LK5A 4XD7A 5TR9A 1K5DA 1ODLA 2E37A 4CMGA 3UMSA 1RYHA 1P17A 3DDNA 4GR4A 2QP4A 3QKUA 4PPQA 3G2OA 1DCMA 5K3AA 4A4DA 5CJJA 1G8PA 3MS4A 3C16C 2XE6A 2ZDHA 1SR8A 1W7AA 4K1LA 1VSBA 5A3JA 1MD9A 4LBZA 2V7VA