1H9SA

Molybdate bound complex of dimop domain of mode from e.coli
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
138
structure length
138
Chain Sequence
MQTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLQQGQNVTAYFNADSVIIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxyanion Binding Alters Conformational and Quaternary Structure of the C-Terminal Domain of the Transcriptional Regulator Mode; Implications for Molybdate-Dependant Regulation, Signalling, Storage and Transport
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords MOLYBDENUM TRANSPORT PROTEIN MODE
total genus 29
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9sA01
4DNRB 3T53B 3LNNA 1GUGA 4XIGS 2KA7A 3KLRA 1HTPA 2NN6H 1H9KA 4KKSA 2A69C 2YYZA 1GUTA 3IKJA 4BA1I 1DD2A 4DK0A 4KN4C 2DN8A 1GHKA 1DXMA 1OXUA 1YNNC 1V43A 2BE5D 3GQBA 2ZT9C 1GJXA 3QJYA 3NE5B 3A8IE 4TQUS 2JXMB 1OXXK 4PV1C 3H94A 4KHZA 2K7VA 4GZYC 2A6HC 3VA7A 3A7LA 5K36G 4DK1A 1Y8PB 1VF7A 1Y69U 1B9NA 2A6EC 2BE5C 2B8FA 3L7ZC 3LWUA 3M4YA 1CTMA 4JK1C 5A35A 3FMCA 4BA2I 2Q8IB 3P20A 1E2WA 5BN5A 1Z7TA 4H0LC 4TKOB 5KNBA 3PUWA 5JEAG 2BA0A 3VR3A 1GUNA 3A7AB 3MFYA 4L8JA 3ND8A 3OW7A 3D31A 3ND9A 4I7ZC 3RLFA 1ZYRC 1O7LA 3TZUA 5K36H 1DCZA 1IW7C 1ONLA 2IT1A 1EWHA 1H9SA 1H9JA 1H9MA 1Q12A 1Q1EA 4KI0A 3PUZA 1CI3M 3VR5A 1E2ZA 1IYVA 2L5TA 1IYUA 2QF7A 2F1MA 2A68C 5C0XH 4KKTA 3BDOA 2D5DA 2D62A 1Y8OB 4H44C 2EDGA 3PUYA 1LABA 3U9SA 3MXUA 1GHJA 3DXJC 2E75C 1B9MA 2JE6I 2KCCA 3AB9A 2A6HD 3PUVA 5JEAH 1GUSA 2AUJD 1LACA 1TU2B 3SDZA 1GUOA 3HGBA 4XTCS 3T56B 4DNTB 1CFMA 1FYCA 2EVBA 5BN3A 4G7OC 2BDOA 5KNCA 2JEAI 1I6VC 3FPPA 3EQLC 3SE0A 4LK1C 3QG1A 1HPCA 1Z6HA 1T5EA 2EJMA 3OOCA 4OO1H 1K8OA 1BDOA 2E76C 4KN7C 3T51B 3D4RA 4OGQC 2AWOA 3M7NA 1H9RA 1TKWB 4G7HC 3PV0A 2PNRC 2A6ED 2K33A 2NN6I 2PPBC 4H13C 3OPOA 2NN6G 1OXVA 1VF5C 5C0XG 2O5JC 5BN4A 2K32A 4OO1G 4IFDG 1SMYC 4IQZA 3M85A 2EJGC 3CRKC 1QJOA 2R6GA 4JBWA 2O5IC 3GD7A 1O78A 1PMRA 2CW0C 3A8KE 3I73A 4IFDH 1HCZA 4KMUC 1Q90A 1OXTA 1Y8NB 1H9SB 1HQMC 1VCIA 1ZKOA 1IW7D 3VR6A 1K8MA 2EJFC 2E74C 2PCFB 2V4DA 1VDZA 2D2CC 4G7ZC 4LJZC 1Q1BA 3PUXA 1E2VA 2A68D 3N6RA 3QIAA 3BG3A 1OXSC 3VR2A 2AUKA 2B8GA 2JEBI 4HR7B 3VR4A 5KNDA 2DNCA 1FR3A 2LMCB 3A8JE 1YNJC 3I4LA 2A69D 3WDNA 1A6XA 1G291 2DNEA 3W3AA 1V8QA 3I72A 4KKUA 3CRLC 3IFTA 4RCNA 2BA1A
chains in the Genus database with same CATH superfamily
2AQ2B 2B63B 4XIGS 3D3RA 2NZOA 1A15A 3URYA 1ILQA 2R7DA 4XYOA 4RA8A 2EYPA 3MVVA 5KIXA 3X3MA 3F2CA 3T1YL 4QMGA 1WCMB 1PFMA 4L5QA 1ESFA 4HJAA 2YU9H 1YVCA 2R61A 2HDLA 5K36G 1TWFH 3K58A 1TWAH 1GOZA 1XNRQ 2GVBA 4DUZQ 1ASZA 3N52A 2F0MA 4MHEA 1X55A 3F2BA 2VUMG 1WTPA 3RZOB 5D3IB 5IYDG 1QZHA 4M1UB 2CWAA 3OMGA 2UUCL 3T4AC 3TRZA 3F2UA 1VQGA 1G8ZD 4HMJA 5E4WC 4G4KA 3C1EA 1EIGA 1E2ZA 2JK8A 1IYUA 2WV6D 1K3RA 3MFGA 4K2LA 1EYAA 3HOYH 1LT4D 3CP0A 4OHJA 5C5MA 2R7ZH 1AH9A 3CC4A 5EBDA 4A3JB 4J8QA 3IRBA 4B9XA 3PUVA 2CQOA 1EY4A 5AJ3Q 3SDZA 1VQ8A 4DNTB 3K6OA 4A3GB 3OYYA 2UUCQ 1EOTA 1GUWA 3P75A 2ICEC 2F0HA 2GA4B 1HNXQ 4GNXB 3OOCA 2QGQA 4KY6A 1LT3D 1R4QB 4K5VA 4GOPC 4K0KQ 3MHBA 1IBMQ 1FL0A 4KHPQ 3EN2A 1TWHH 2NZ1D 4K5XA 4DAPA 5BN4A 1JE5A 4RWSC 4JOIA 2KENA 5JPMC 4A3BB 5FLXc 2VZAA 4POGA 2QDBA 1LT5D 4LAAA 5I6WA 4DK1A 3S1RH 1Y1VG 2ID0A 1N36L 5J39A 1WTQA 4DV3L 2A68D 2MO1A 4DR2L 5EQ0A 2DY7A 2HHHL 2SDFA 5EKLA 5LMUQ 5T1IA 1RJTA 2VUMH 2NVTB 3I4LA 2VB3X 4XXEA 5IP7G 4B08A 4YY3L 3IFTA 1X3FA 1LTGD 1PH1A 2QILA 4A3JH 2K5QA 1FGUA 3I3CA 2R7ZB 1PFNA 3S15B 1PVOA 1VQIA 4DF7A 1STBA 2JA5B 2PMZE 2WB1G 3PQIA 2RHQB 3H15A 3KFUA 4CKBA 1HTLD 1JOOA 1BQQT 3ULPA 1VQ6A 1D5MC 4IJLA 2Q8TA 1VF7A 1HZCA 5GQOA 2E2IB 3GTLH 3PIP3 2Q8IB 1YNJD 4A3MB 4BY7G 1CA6A 5KNBA 4KLKA 1PZID 4L6TB 4YHHL 4BY1G 2L15A 4BBSG 1Q86C 2E5LL 3T1HL 1W6JA 2BCOA 2EZVA 2Z0SA 5CV7A 1L1OB 1H9SA 4TVAB 2EE1A 4LF5L 4P73A 2B2VA 1AE2A 1O7ZA 4K14A 2KJXA 4JV5L 4PZ8A 1EIYB 1PH9A 3K57A 2K5VA 4OELB 3D4WA 4R8IA 1FNWA 3SGIA 2XRSD 1HR0Q 1EOVA 3ONAB 1B9MA 4A3FH 1GUSA 5T1GA 2Z1CA 2R7ZG 2R93H 1S5ED 1X32A 5BN3A 3AMUA 5KNCA 4WJ3M 2NVXH 1EZ6A 1WVLA 3EQLC 1STYA 1TS3A 1S4ZA 4LK1C 1HPCA 5DLQE 3H0GB 3S1RB 3M7GA 2D0OA 4P75A 2AWOA 2K5NA 1IYJB 4A3JG 2B29A 1NR4A 2Y0SB 1SLJA 1CKOA 2R3ZA 3UDXA 5HY6A 4A3GG 4ULLA 2KCNA 5IYCG 1VQ4A 1VQBA 2IHEA 1RIPA 3BDLA 4JBWA 2A73B 2HDMA 3RN5A 5I9PA 3JC66 1B53A 3UE0A 5IP9G 1PHJA 1H9SB 1L1OA 4JG2A 3NELA 4IUQA 2WFWA 4KK7A 2CFMA 1UE6A 5JJLA 5D65A 2MQHA 4B3MQ 5IODA 2AMCB 3VR4A 1VMPA 4J15A 3TMEA 1DJRD 2ZJPA 3T53B 4HIMA 5M5WB 1XPRA 1A3VA 4MZ9A 4DR6L 3CCSA 5C3EG 1B3AA 4ME3A 1PH2A 3C3LA 1B2TA 2XIWA 3I4MG 3MAQA 1LTID 1Y1WG 1C48A 1IZ6A 4V190 1CKNB 4JV5Q 1RF2D 3X3NA 2JEAI 1NMGA 4JI7Q 4LMQD 4DV2L 1OO9B 2B2TC 5ELFA 1G6PA 4NDXA 3UDIA 3J7ZC 4DV1L 3K5NA 1IL2A 2R93B 4X3TA 1H9JA 2F0IA 4QL5A 4HCSA 3EROA 3PUZA 4E6IA 2YTVA 4EX5A 2RDGA 3L3OC 5A2QL 3H3VH 3FHWA 4FXDA 3MXUA 2CWPA 3GTGH 3J81E 1PH4A 2OQKA 4F7XA 1N34Q 4ZKCB 2E5LQ 4BBSB 1LTLA 3I7FA 1X3EA 1CSPA 2F0PA 2BDNA 2OTLA 2IY5B 1YEZA 2IHFA 3I4MB 1ICFB 2I0QA 1RODA 3QG1A 3TDQA 3F1ZA 1PRTD 2JA6B 4OGQC 1WTOA 2HHHQ 3MWYW 2PNRC 1V9PA 2NN6G 1SYCA 1VF5C 2R7FA 3R2TA 1TQOA 2XTIA 4JI3Q 2LSSA 5LL6S 4MNOA 4A3BH 1VQCA 3CQZH 4L5SA 2IWHA 2HQEA 4DR6Q 1EY6A 1KABA 3G7LA 1VCIA 3CCQA 3CCMA 2L55A 3VR6A 4LFAL 1CQFA 5IWAL 3GTGB 3MXPA 2R92H 3T16A 5JEAJ 3HOXG 1AE3A 4CHTB 1KHIA 2LS01 2DNEA 1VMCA 3I72A 2ZM6Q 3U58A 1QZGA 1J8IA 4U68A 2PZTA 1KDAA 2EXZA 4ILWA 2KCMA 3S2HH 1HZAA 5DEHA 1SBBB 4IOAA 3KK7A 4C3JB 4IPGA 2UXBQ 4IJHA 4A76A 4LF5Q 3OIPA 2I5HA 4GLXA 3NHHA 1P16A 3ICEA 1PYSB 1HRJA 2J4XA 4HMIA 1C7YA 3H3VC 3GDEA 1IBKL 3HOUG 3A7LA 1II3A 2KOLA 1D2BA 1EY8A 1T9HA 4FO2A 5NUCA 2IJ0A 4DR1L 1U9RA 1EUJA 5JEAG 1Y1VB 3KF6B 3P1HA 3OW7A 4B9WA 4I7ZC 4X66Q 1EWIA 2FJ2A 2JA8G 4A3CG 1H9MA 4WORA 2NBFA 3HOVB 1C9OA 2Q2UA 3HKZB 2F4VQ 3IL8A 2RSOA 3J7A5 4X64Q 5EGTA 3PUYA 1LABA 5FLXL 3ER0A 1I6HH 1J9OA 4DV1Q 5JEAH 4B3TQ 4RCOA 2KEEA 2M2LA 3AEVA 4GN3B 4RG1A 3FPUB 4R8NA 3KBGA 2VW9A 1HFNA 2HUGA 3A0JA 3QB3A 4BY1H 2EJMA 2HIXA 1T5EA 3PIPA 4A3KB 5C5LA 4JBMA 4LFAQ 4A3EG 1HXYD 3SEBA 2F0WA 4DR3L 5CV9A 5IOCA 3GTPH 2MHVA 1NAPA 3OPOA 2YU9B 1FJGL 4J1MA 4O1NA 2PQEA 1STNA 2OF1A 5C44H 1C4QA 1XPOA 4LF8Q 1SMYC 4IQZA 4DAVA 2WAQE 4JBKA 5C44G 1RCVD 2VS1A 3OIQA 4O2DA 3K5LA 2Z8LA 2E74C 1PH8A 3EA6A 1J6QA 3NUCA 3A55A 4DR3Q 1PRTF 1CHQD 1EFWA 2DNCA 4IFDJ 3W1BA 3UE1A 4DN4M 2A69D 1KNEA 1STGA 5J1ZA 1LYLA 1V8QA 1YZ6A 1PDQA 4RCNA 1SJHD 1W3SA 4JW0A 1XYIA 4OX9Q 4EQPA 2K75A 3M4QA 2N3SA 1W2BA 2I07B 3RD4A 2NN6H 1XMOL 1AW7A 5EBCA 1JQYD 1XWEA 1DD2A 5C4ZA 5FOBB 3OHXC 5CR3A 4DAYA 3KF8B 5EAYA 1PZKD 4FF1A 3HOZH 5IGEA 1CZGA 3A8IE 4AYBB 4GKJL 2B2YC 1K28A 2ATWA 1E3PA 1Y69U 3KDFB 2HD3A 2B8FA 4IUTA 1K83B 4JC0A 3FMCA 3PO3H 1L2FA 4QJFA 3PIO3 2L11A 3QWNA 3SVMA 1SNQA 3PMFA 1Z7TA 4TKOB 5G3LF 3SK4A 5C3WA 3BVZA 2ZXOA 4JI1L 2J7ZA 2RA4A 5IGBA 2VQFQ 4CDCC 4L63B 1EYGA 4DXFA 5EPLA 3M4PA 1Q1EA 3CMEA 1LLRD 1PH5A 1UNSA 3KUPA 4APVA 4WJWA 2F0EA 1K3BC 2K04A 4A3BG 4IUVA 2JE6I 3I91A 4YIJA 4BBRB 3G4SA 3CPWA 3SK8A 4KD3A 3AFQA 1Y1VH 3NBHB 5FO7B 3R93A 1CK1A 1TWCH 4A3IB 4A3DG 1KDCA 1BBWA 1VQJA 1WCMG 1PRTB 3K59A 1D5ZC 3A5UA 1FNVA 1DM0B 2UXCL 4KN7C 3SK5A 3NQTA 4NXNL 1UE7A 1HHVA 3I55A 4WRDA 1BCPD 2RBMA 2A1AA 2IX1A 5JJIA 1N36Q 1MJCA 1QNUA 3S9WA 1CKMA 1PA6A 1B3QA 1SE2A 4OO1G 5C0XI 4IFDG 5GAHC 1EY0A 3WWVA 3HG9A 2KHSA 3GTLB 5IGCA 1WFQA 3TP8A 3I73A 1HCZA 2QEXA 4A3KG 1SNCA 3TP5A 3E6ZX 1Q1BA 4RGMA 3S16H 1U5KA 5E7NA 4QQBX 4HN7A 3CD6A 4GKJQ 5J22A 2FMMA 4Y7NH 2LMCB 2Q2IA 4PZ7A 3BYYB 5C4JB 2KHJA 3E5SA 2B2WC 3Q8DA 4NXMQ 4OIKA 4DR5L 5CBEE 1JICA 1STHA 2IPKD 2UUAQ 1EQRA 4FXKC 5IT9L 4JI0Q 1HNWL 3PO2H 3GP7A 3HOXH 4BA1I 2XWJB 1OXUA 2MUYA 2BE5D 1EEID 4IUPA 4MTKA 4DU9A 4HSPA 2MP1A 5BR8Q 4OWXB 5DM73 1OXXK 1CSQA 3H0GG 1ML0D 1EQQA 1EEFD 4EGVA 1L0XB 1ICWA 1NSNS 2NVQB 1JB7A 1L0YB 1KAAA 1RD9D 3OWEB 2EY5A 1E2WA 3B6YA 5I2YA 4BXXG 1D8LA 2BA0A 1KNAA 3BJUA 3S17B 1MIUA 1TY0A 2C5CA 2WB1E 2Z4IA 1IW7C 2M9VA 2YV5A 3ERQA 4NB3A 4IPCA 2DGYA 5BR8L 5LMNL 1Y1WB 4R4TA 1KLGD 2EY1A 2RF4A 1LTTD 2OXPA 1WTXA 2QKIC 3CMAA 4HSVA 1MSGA 4LF9L 2OWOA 2KCCA 1XPUA 2AUJD 1I50H 1SE8A 2NVYH 2WAQB 4R9WA 5FO9B 3CC2A 3K8AA 3CCLA 2B63G 2SOBA 4ODGA 2MO0A 3S1QB 2XGTA 4QY7A 2KUMA 1LTAD 5KGUA 4C3HB 2JA7G 2L4NA 2PPBC 4H13C 5JJZA 4YWKA 3RN2A 5IT9E 1X6OA 3LWEA 2EJGC 4DV6L 3S1QH 4Z9CB 3W5OA 3J7AV 3S24A 3HOVG 3CKIB 4KMUC 1TWFB 4PG3A 1HFGA 4IURA 3K0XA 4KTAA 5H1SE 1WCMH 2SNMA 2OEOA 1OXSC 1H95A 3NXWA 5C6AA 3ULLA 4ALPA 4JI4Q 1B7YB 5JPNC 5C3EH 5KNDA 5M3MB 2WACA 4BBSH 1SE3A 4OO1I 1G291 1BCPC 3V2TA 3G48A 4AIMA 4FNFA 1Q8IA 2Y0SG 1K0RA 1CQVA 2B2UA 4X3SA 3ULJA 3STBC 1Q8KA 5IYBG 1F9RA 2K52A 1RTNA 2CH4W 1GM5A 1R4PB 4YHHQ 5M5YB 2FHTA 2VQEQ 3NWTA 1BBXC 4CDEC 4A4IA 4RHSA 4KHZA 1CT1D 3S14B 1G91A 3BU2A 3HOYG 5FK9C 2G9DA 4H02A 4A93H 2A6EC 5A35A 3PO3B 1VQDA 2F0VA 2F3IA 3K7UC 4A3IG 4XQJA 5BN5A 4GKKQ 1SN8A 1SXTA 2B63H 3BS1A 3VR3A 1F9QA 1GUNA 5IGFA 3RUZA 2Q8RE 1AFPA 1RTOA 3NP8A 3RLFA 4ZLTF 4RGNA 1D5XC 1HA6A 4F8MA 4R4CA 2VY3A 4P72A 2TMPA 1LV9A 1A8VA 3S1MB 2L5TA 3BZCA 3NQIA 1BCPF 3BDOA 5IE8A 3NTIA 5I9OA 1U0LA 2F3VA 1SNOA 4DPGA 2NB0A 3DXJC 2JQOA 5M3FB 4A75A 3GTMB 4TSSA 3S16B 3HGBA 1BVSA 4LF6Q 4LUZA 1EYDA 1CFMA 2XVSA 2EY6A 2WKCA 2EIFA 2QA4A 4LUOA 1TS4A 1MGSA 3DHQA 2R92G 4UDUC 3ITPA 4RH6A 1Q3LA 5C4XH 1EYCA 4DUZL 4N9TA 1STAA 5EKIA 1VQFA 3OTOL 3JAML 4V0BA 2WINB 1S40A 3M85A 3H91A 1XX8A 4FYDA 4MN3A 4IUNA 4KJNA 1NUCA 1JCKB 5GAEC 3CF5A 1VDZA 1EU3A 2D2CC 3HKZE 4LJZC 4G7ZC 2XRQD 1X9NA 2RSNA 3N6RA 4DR2Q 4CKCA 1WYDA 1ZXTA 1SDFA 2F0QA 4RKBA 1PRTC 2LKVA 1I5FA 1A0IA 2JJQA 5KRUA 2RQXA 2TSSA 1EU4A 3HFZB 2LXKA 2ES2A 5JAVA 3E9HA 3HOZG 1TWHB 4RHRA 4DK0A 1TIID 3HKZG 4FF4A 1V43A 2M00A 1GJXA 1BNZA 4GNXC 3CCJA 2CKZB 4FF3A 1GO3E 1CA5A 4JI8L 3KF8A 3T1HQ 4HEDA 4PMCA 1JJ2A 2F0GA 1SYFA 2NVQH 2RVLA 4O0AA 4A3MH 3G6EA 1O80A 4X62L 2UUAL 4MTNA 5KEEA 1RL2A 4LF4L 4L8JA 3ND8A 3IFDA 1ZYRC 2UXDQ 3D0FA 3M3YH 5E3FA 3VYSA 3HOYB 2QF7A 4C3JG 3Q0AA 2VNUD 5CMDA 3S1NB 1N33L 3CCRA 1HA5A 1F2LA 1M8AA 4H44C 2J0TD 1RHPA 2CVRA 1NJIC 4A3FB 1LT6D 4ABNA 4JI1Q 2EY2A 1XXGA 3MC0B 1VQ9A 3PF5A 3P7JA 2CH4A 1JWSD 4HJ5A 4DFAA 3K0YA 1PTOC 2K28A 4C56C 1QUQA 1I3QH 1WJJA 3CU7A 1K8OA 2N88A 4JI5L 4DXGA 3TN2A 3PV0A 1XTCD 4KJOA 2JSOA 3E3XA 4HJ7A 1WTRA 3GTKB 3F2DA 2AQ1B 2PW5A 4GLVB 3MXNB 5ELDA 2UXDL 1SSOA 3I56A 2X6GA 1YHQA 1QVFA 1IXRA 2AHOB 1JJGA 1MKHA 4MIUA 1D1IA 4DAMA 4A3KH 2IX3A 1O78A 2JA6H 3K5MA 3FEWX 3A8KE 5M5XH 3PO2G 1Y8NB 1ZKOA 2V4DA 2CQAA 4EQOA 4HIDA 4LUVA 3KJOA 1E2VA 1JR0D 3PO3G 1FNUA 5M3MH 1DGSA 3BVGA 1X56A 2KHIA 3TBIB 2PI2A 3DMUA 1Y14B 4LF7L 2E2DC 1B44D 1K8GA 4A3LH 4ZRZA 1I4PA 2YYZA 4KN4C 3LGJA 4OWTB 3GV3A 2Z6KC 1QVCA 1DZ1A 1ET6A 1HH2P 2N8NA 4RFBA 4K8JA 2ASBA 3HRZC 4PV1C 5CV5A 5JVH3 1AP0A 2NZHA 1WOCA 5KYIA 2H5XA 4UP8A 3L7ZC 1ILPA 2F0NA 4EQ5A 3J80i 1Q82C 1F77A 1YIJA 3HOZB 1SAPA 2HCIA 3D31A 4X6AH 1ENAA 1I4QA 2XNAC 4DGZA 2CW0D 1ONLA 3NTHA 4EVOA 2UU9L 1EWHA 3I4MH 3K7AH 4R4QA 1TWCB 4KI0A 1GKHA 4A3IH 1A3UA 1F9PA 3TREA 1U4LA 1VQHA 1KIXA 1ASYA 1CUKA 5FKAC 3KOJA 4DV0Q 3NTKA 4C2MH 2ENBA 2EDGA 3F8TA 2K4KA 3U9SA 5ELOA 3CAMA 2UXBL 3HOXB 3TZDA 1WD0A 2WIIB 2K5DA 2AKWB 1GUOA 5E1FA 4HJ8A 3E0EA 4CDDC 3RLNA 2UU9Q 4JOIC 4OO1H 3AQQA 4BWGB 3QR8A 3T51B 3D4RA 4DV0L 1FVIA 1SMXA 4P74A 4GOPA 3PGZA 4LF4Q 3QOJA 1G2TA 4LFCL 3GTOB 1OXVA 2KBNA 1NY4A 1IHZA 4X3UA 1M1KC 4QUCA 1ENFA 4DK3C 1NBWA 3GTMH 3L2PA 4AQYL 3PUXA 3TQYA 4I65A 2Z4HA 4DV3Q 2JA7B 4R1JA 4BY7H 4LNQA 1KC8C 1E0BA 2YTXA 5M3FG 4K6DA 1IKMA 4KKUA 3CRLC 4XYQA 5IIFA 4K2KA 1HR0L 2ICIA 4LFBL 1UWVA 4PMWA 3JAME 4KKSA 2RCNA 4M8AA 4XT3B 1YI2A 4HAEA 1JMCA 2ZT9C 4AYBE 4N8X1 4JI4L 3MEHA 3L9AX 3CXCA 4A3FG 1HZ9A 2UXCQ 4GZYC 2PW7A 3TS2A 4EQNA 3GTJH 2QW7A 2X69A 1P8LA 1SNDA 4P71A 5FJ8H 2V1CC 1Q81C 1QOHA 1BOSA 4H0LC 1TVXA 5JVG3 1HJPA 4FP5D 2EYOA 5CYUA 3NENA 1MI2A 1SEBD 5K36H 2NWGA 4LWCA 3RLOA 2RHSB 2KEDA 4ZUIA 3VR5A 3HOWH 5GROA 3KLSX 4RAUC 4FDBA 4LFBQ 1Y8OB 5ELEA 1EY9A 3J81i 1WTHA 2A8VA 4A3DH 5FLXE 4KY5A 1IBLL 1TU2B 2QDLA 1KL9A 3T56B 2G5DA 4QB4A 1FYCA 2JA7H 1SYEA 1W6KA 2ZJRA 5D3DA 3SE0A 4H7BA 5IGDA 4LF8L 4DR7L 4DKAC 1M90C 2F52A 1HUMA 4ZUJA 3RZDB 1VQMA 1X3QA 1N33Q 2JA8B 3MZ5A 3M7NA 3PCOB 5COYA 3D4DA 1E7ZA 2Q2TA 1Z47A 3KDFA 3VDYA 1PYWD 5C0XG 4IFDI 5HGQA 1TWAB 4JI7L 1AZPA 2O4XA 2NTSA 1KAWA 2O5IC 4QUFA 3NSWA 3M4OH 5LHY1 3TP7A 1FGBD 3GO5A 3UI2A 1CHPD 4J6HA 3S15H 2R93G 4B3TL 1I4RA 3QIAA 4RGOS 5IYCH 5M5YH 5IT9c 1SYBA 3DUZA 4GNXA 4DNIA 1BF4A 2E2JB 2JYOA 1VQAA 4XT1B 1PTOB 3R8BA 2NVTH 2VUMB 4CJ2C 2JA9A 3RMHA 1Y1WH 2BA1A 4DNRB 4JI6L 4QCLA 1HQRD 3D6CA 3KLRA 2K01A 1HTPA 1WD1A 4DV2Q 2B2TA 3UDGA 4A3DB 3S17H 4DR4L 3HS0C 2E8GA 1DONA 3QJYA 4DV7L 1SRUA 2JXMB 3GTPB 2JP1A 3NBIA 2K7VA 2D0PA 3U4ZA 5KYLA 5CBAE 2A6HC 1QVGA 1PZJD 1F2ZA 1B9NA 2C9OA 4JK1C 1L1OC 3LWUA 3J7AF 1CTMA 1AN8A 4OWWB 2K5HA 3FDTA 1XNRL 5M3MG 4UPAA 3PUWA 1QG7A 1X65A 3PO2B 4I7AA 2DY8A 1E1OA 1GVPA 1TWGH 2GN5A 1O7IA 1Q12A 5FLMG 3GTJB 3STBD 4XQQA 1TY2A 2B39A 2N55A 1HZBA 3W2DA 2F1MA 5C0XH 1XMQL 2IW3A 5GAGC 2P5ZX 3RR5A 3J80E 1J5EQ 5CORA 1VQ7A 1V1QA 4DV4L 1U4MA 1KD1C 1LACA 4OONA 4WFN3 5I6YA 2L1BA 3HKSA 2EVBA 2I5MX 4G7OC 5I4DA 1FJGQ 4IPHA 1I94Q 1VQOA 1BXTA 1YHBA 1PYBA 2L0CA 5IGGA 4UAIA 2PNHA 1TT2A 3J81c 5I2XA 3EFXD 2KVMA 3DEPA 1VQ5A 4XDXA 3MXNA 3J80c 2F0LA 2XSCA 4HIKA 1NTGA 2L12A 1YJ9A 3J80L 1DOMA 1SFOB 3R3OA 2F03A 1EY7A 5C4XB 4OIJA 1I94L 2QEJC 5LMNW 2Z6BA 1HQMC 1KXLA 1BCPB 3HOUH 1IKLA 3QOLA 1WTVA 1R9TH 5AFWA 2A19A 5M3FH 2B8GA 4AYBG 4BY7B 3A8JE 2E2JH 1PH6A 2KQ3A 4DR4Q 4YCVA 2F0KA 4KD4A 4ZQ3A 3LNNA 4ME5A 3OW2A 5F2DA 3CCEA 4N8FA 1S72A 1H9KA 5LMUL 1E1TA 2FINB 1DXMA 3FVQA 4AQYQ 1EQVA 3NE5B 3NWSA 4K0KL 4CJ1B 1K0SA 3H94A 4CDFC 1Y8PB 3M4YA 4JI3L 1YNXA 1RDPD 3U4VA 4DR1Q 1KQSA 1PV4A 1I4GA 1BUVT 1SJED 3A7AB 2VL6A 3ND9A 5C44B 3KBXA 4DK6C 5IY0A 1YITA 1IYVA 4LF7Q 3I2ZA 2BH2A 2A68C 3S1MH 1HNWQ 3SR1A 2D5DA 2A5HA 1K73C 5M9OA 4QIWE 2E75C 4GLAC 1CKNA 4BXXH 2F0SA 3R2IA 1YBYA 1S3OA 3HOWG 1XMOQ 3E0JA 4QF4A 1GD7A 1R9TB 2ZTDA 2PZUA 1YJNA 4JI2Q 2BDOA 4OX9L 2HIVA 3FRPB 1Z6HA 2KECA 1AZQA 2PMZB 5IP7H 4HIOA 3VYTA 3NEMA 2NUCA 1VQLA 2EPBA 1YHAA 2NN6I 4K8IA 1B1ZA 1S5FD 5LL6X 1NMFA 3E9IA 5DM63 5LMNQ 5CV6A 4X66L 2I46A 1LO5D 3I4NB 1BBUA 4GOPB 1TXYA 5CC4A 1B50A 1JWUD 4JCVE 1EIHA 1F2MA 1QE6A 1SYGA 5ELNA 1IW7D 1M4VA 2JA6G 1U4RA 1PTOD 1CZWA 1JWMD 4P2CB 5GADC 5EPJA 1D7QA 4IO9A 4A3LG 5C4HA 4FF2A 3WOFA 1B8AA 3O13A 1G6ZA 3WDNA 1JB3A 4A93G 1I4HA 4YWMA 3HOWB 2O2LD 4IFDH 4C3HG 2AQ3B 4QIWB 3G6JB 5ELCA 3A74A 3BYTB 2K14A 3H6MA 1JC7A 5D14A 1GUTA 4IN3A 3OWFA 3Q22A 1I4XA 3GV6A 4A3EB 4NMZA 5CV4A 2EYMA 1FD7D 1GXDC 4TQUS 2R92B 1DYQA 1UAPA 3GTQH 3J7YW 4RGTA 4F88A 4NP5A 1B4OA 4CJ0B 2BE5C 2PO4A 1YJWA 4BA2I 3H0GH 4KV6A 1C0AA 1DOKA 1I3QB 3Q24A 4C3JH 3L0OA 3RNUA 1N32Q 3PIOA 1I50B 3MFYA 1ENCA 1UE5A 2F0FA 1C8CA 1BR9A 3C2PA 3FKIG 3V05A 4C3IB 4IOCA 1A63A 4OL7A 1CI3M 2FFKB 3ZYYX 4X3KA 2ZJQA 2MGSA 1XTDA 4KKTA 4RKLA 4ID6A 3S1NH 5JJKA 1LTRD 4BS9A 1CM9A 3K80C 4KHVA 2F0OA 2E2HH 3M3YB 1SE4A 4JI0L 4XTCS 2K05A 4CBVA 5C0XJ 5C3EB 4LF6L 4B3RQ 4ZYSA 2NTTA 1EIFA 3EVQA 1EY5A 3HZXA 3KLWA 3K7AB 3AU7A 3MTSA 2I5LX 1I6VC 4YY3Q 1XJVA 4IZ8A 1F9SA 2JN4A 4C2MB 4HTHA 1Z9FA 1XMQQ 2FXQA 2OTJA 4JPBW 4K6LA 3EJIA 1AEXA 3JAMi 2ZTEA 4R4IA 1HNZQ 2BOSA 4S3SA 1Q7YC 3G71A 3TP6A 3DWAA 3SHLA 1SFOH 2EQSA 2WP8J 1NNXA 4WJ4A 4RMFA 1WI5A 5A2QE 1PFSA 3DWQA 1PMRA 4F87A 4NPSA 2DJGC 3KYHC 3OSOA 5EPKA 4BY1B 2EJFC 4KHPL 1A2UA 4OXPA 3AYHB 4DV4Q 3PF4A 3MEFA 2RDHA 5FJ8G 2HT1A 1U4PA 3BZKA 1UEAB 2AUKA 3C1FA 5DNFA 2NVYB 1YNJC 4L5TA 1A6XA 3CC7A 1SNMA 2EYJA 1PH7A 4LF9Q 2FMCA 4BBRH 1GUGA 1QNKA 4GN4B 2MNAA 5IYDH 1TR5A 4LW1A 2B3GA 1OTCA 4UP9A 4LFCQ 1QUQB 2DJFC 1UUPA 5K5PA 3SXHA 1MSHA 4OEMB 4JBJA 4NXNQ 2AWNA 4HJ9A 3VA7A 2EXDA 4C1NK 3WOEA 1HNXL 1YNND 3CQZB 1LTBD 3KJPA 3S2DB 1QCBD 2HCCA 2RCFA 2F0UA 2LXJA 5AJ3L 2EYFA 4UP7A 4NKLA 3GTOH 1BKBA 3TZUA 5JOBA 1J5EL 3VYRA 1X54A 2OQ0A 2IT1A 2MFIA 3FKIH 4JI6Q 2PI2E 4X65L 4B3SQ 3D6WA 3CPFA 2JA5G 2SNSA 4DAYB 2Z6KA 1SYDA 1F2YA 5FO8B 4DR5Q 1GHJA 3I4NG 3TS0A 3AB9A 2F3WA 1MJEA 4JVZA 1QB5D 5J3BA 2KCTA 1NCVA 2WB1B 3OMCA 3FKIB 2H1EA 2PYKA 1XNQL 3HOUB 3KLSA 4X62Q 3VA5A 4A93B 5HGTA 1TKWB 4JYAQ 4B3ML 1EFID 3PSIA 2D9UA 2CHBD 4BBRG 2VB2X 1Q46A 3QO2A 4GKKL 1QILA 2O5JC 4G57A 1N9WA 2Y0SE 1JJCB 1MD2D 4B3RL 2MJ8A 1L0WA 3ERSX 2K03A 3KF6A 3BVMA 3D8GA 2R6GA 4DV6Q 2F4IA 4GS3A 1VS0A 1ZYRD 1OXTA 1HUNA 1VQEA 2B2WA 1EZ8A 4FXGC 1LTSD 4A3EH 4HCEA 3T1YQ 3JAMc 1JOKA 4JYAL 5HURA 1UEBA 1STEA 3HEJA 3CCUA 3J81L 2BH8A 2VXWA 4IPDA 1ET9A 5G3LD 3DWPA 4Y7NB 4ZAIA 1B70B 3M4OB 4R4OA 3DM1A 5C3XA 2WKDA 2CCZA 5IWAQ 1N32L 4Y52H 4DUYQ 4DV5Q 3H09A 3IKJA 1ZEQX 1D6EC 1GHKA 3C46A 3Q23A 1VQNA 1G2SA 4C3IH 2NYZD 4YCWA 2Z9HA 3VYUA 1JOQA 1TWGB 2F0TA 2RDFA 3UDFA 4YCUA 3HOVH 4DR7Q 1MHWC 2RKSA 1KRTA 2XWBB 4DUYL 4DV5L 2JA5H 5E4XA 1JE4A 3M9BA 5CGKA 1SMYD 1V1OA 3CHBD 3GTKH 5DAUA 1I6HB 2IX0A 3AFPA 1KDBA 1JORA 1X3GA 1XNQQ 4ZCKA 4UHVA 3IAYA 2Q2HA 5EJWA 5FLMH 1PTOF 4JI2L 3U50C 5M5WH 4IALA 2H4OA 3S2HB 5C4XG 2ALYB 1X3PA 1RKNA 1A62A 2A6HD 1PTOH 1IL8A 4IUUA 4A3GH 2ZXRA 2GVAA 1T5XD 4O42A 2PQAB 3NK9A 3FPPA 2ZM6L 4X65Q 5M5XB 4B3SL 5C4JH 1IBKQ 4JI8Q 2K6AA 4JI5Q 3RZOH 3DEOA 2LFNA 4G7HC 1O7YA 3K81C 1SNPA 2K33A 2ZTCA 1S5CD 1S5DD 3I4OA 1WTWA 1DOLA 1KLUD 2K32A 1EWCA 3GTQB 4GN5A 2K1BA 3CRKC 4C3IG 1QJOA 2E2IH 2CW0C 3RZDH 5IYBH 1Q90A 3T13A 4XQNA 3CCVA 1NE3A 1K8MA 2PCFB 2X6LA 3K5OA 4ZK9B 3OTOQ 1PH3A 3BG3A 1LUZA 4K5WA 2G9HD 2JEBI 1E22A 4NW2A 4CKEA 2PZWA 4FVMA 3J81j 3W3AA 4NXML 2F0JA 2MPMA 3A56A 1LM0A 4PMBA 2K5WA 2F0DA 4PQXA 1V1PA 3NBHA 5ELBA 4UY8C 3I8ZA 1TS5A 3CW2C 2DUDA 2KA7A 4X64L 2A69C 2HQLA 2N49A 4N9PA 1N34L 2DN8A 1HNZL 1EQTA 1YNNC 2XN9C 4ZKBB 3GQBA 4A3CH 1ESRA 2UUBL 1UE1A 4U673 3TSSA 3S14H 2QCPX 5EKKA 3S2DH 1MBYA 3A54A 3V96A 3P20A 2PQAA 3MXGA 1K8AC 2VQEL 2VQFL 1G51A 2OT2A 2JA8H 3FP9A 3BZDB 3MA2B 4AH6A 3A5ZB 1BO0A 5ISRA 1O7LA 2IL8A 1DCZA 3U9OA 2UUBQ 1A2TA 1VQPA 2K50A 1A3TA 1QWYA 2ZXPA 2D62A 5TSSA 3DLLA 2F4VL 3BDCA 2B2UC 1V1PB 1K9MC 2L9HA 5CV8A 2YTYA 1KRSA 1NR2A 2A74C 4A3MG 2EYHA 1E24A 4POFA 1VQKA 1PLFA 2C35B 4QGUA 3I4NH 3HP3A 1BDOA 2E76C 1K83H 4YWLA 1S5BD 3EIVA 4KY7A 4DV7Q 1H9RA 4C3HH 2OCEA 3H3VI 4Q5VA 3I90A 2A6ED 3I70A 3Q6SA 3ZJYC 1TS2A 4CGYB 3NPPA 2EYLA 1SR3A 3DM3A 4PNYA 4PZ6A 2EOTA 4Q0FA 3W1GA 1IBML 3GD7A 1HR0W 2NVXB 1PFBA 1JT8A 2B2YA 5IP9H 1IBLQ 1D1KA 2SEBD 1N8RC 3TEHB 4DA2A 3VR2A 3LX0A 1SROA 2E2HB 1EL0A 4HR7B 4C1NI 5L37A 4TRDA 2B2VC 1FR3A 3SK6A 2LY7A 3EBEA 1PXUA 1KTKA 4L5RC 2N78A 2WAQG
chains in the Genus database with same CATH topology
2AQ2B 2B63B 4XIGS 3D3RA 1A15A 3URYA 1ILQA 4XYOA 4RA8A 2EYPA 3MVVA 5KIXA 3X3MA 4QMGA 1WCMB 1PFMA 1ESFA 2R61A 2HDLA 5K36G 3K58A 1GOZA 3N52A 2F0MA 4MHEA 1WTPA 3RZOB 5D3IB 4M1UB 3OMGA 3T4AC 3F2UA 4HMJA 1G8ZD 5E4WC 4G4KA 3C1EA 1EIGA 1E2ZA 1IYUA 2WV6D 3MFGA 4K2LA 1EYAA 1LT4D 4OHJA 5C5MA 5EBDA 4A3JB 4J8QA 4B9XA 3PUVA 1EY4A 3SDZA 4DNTB 3K6OA 4A3GB 1EOTA 1GUWA 3P75A 2ICEC 2F0HA 2GA4B 3OOCA 4KY6A 1LT3D 1R4QB 4K5VA 3MHBA 2NZ1D 4K5XA 4DAPA 5BN4A 4RWSC 5JPMC 4A3BB 2QDBA 1LT5D 4LAAA 5I6WA 4DK1A 2ID0A 5J39A 1WTQA 2A68D 5EQ0A 2DY7A 2SDFA 5EKLA 5T1IA 1RJTA 2NVTB 3I4LA 2VB3X 4XXEA 4B08A 3IFTA 1LTGD 2QILA 2K5QA 3I3CA 2R7ZB 1PFNA 3S15B 4DF7A 1STBA 2JA5B 4CKBA 1HTLD 1JOOA 1BQQT 1D5MC 2Q8TA 1VF7A 2E2IB 3PIP3 2Q8IB 1YNJD 4A3MB 1CA6A 5KNBA 1PZID 4L6TB 1W6JA 2BCOA 2EZVA 5CV7A 1H9SA 2EE1A 2B2VA 1O7ZA 4K14A 2KJXA 3K57A 3D4WA 4R8IA 1FNWA 2XRSD 3ONAB 1B9MA 1GUSA 5T1GA 2Z1CA 1S5ED 1X32A 5BN3A 3AMUA 5KNCA 1EZ6A 1WVLA 3EQLC 1STYA 1TS3A 1S4ZA 4LK1C 1HPCA 3H0GB 3S1RB 3M7GA 2AWOA 1NR4A 2Y0SB 2R3ZA 4ULLA 2KCNA 3BDLA 4JBWA 2A73B 2HDMA 5I9PA 1B53A 1H9SB 4IUQA 4KK7A 5D65A 5IODA 3VR4A 1VMPA 3TMEA 1DJRD 3T53B 5M5WB 1A3VA 1B3AA 3C3LA 1B2TA 2XIWA 3MAQA 1LTID 1C48A 4V190 1RF2D 3X3NA 2JEAI 4LMQD 1OO9B 2B2TC 5ELFA 4NDXA 3K5NA 2R93B 4X3TA 1H9JA 2F0IA 4HCSA 3EROA 3PUZA 4E6IA 2RDGA 3L3OC 5A2QL 4FXDA 3MXUA 3J81E 4F7XA 4ZKCB 4BBSB 2F0PA 2BDNA 3I4MB 1RODA 3QG1A 3TDQA 1PRTD 2JA6B 4OGQC 1WTOA 3MWYW 2PNRC 2NN6G 1SYCA 1VF5C 3R2TA 1TQOA 5LL6S 2IWHA 2HQEA 1EY6A 1KABA 3G7LA 1VCIA 2L55A 3VR6A 1CQFA 3GTGB 3MXPA 3T16A 5JEAJ 4CHTB 2LS01 2DNEA 1VMCA 3I72A 1J8IA 4U68A 2PZTA 1KDAA 2EXZA 4ILWA 5DEHA 1SBBB 4C3JB 3KK7A 3OIPA 3NHHA 1HRJA 2J4XA 4HMIA 3H3VC 3A7LA 1II3A 2KOLA 1D2BA 1EY8A 4FO2A 5NUCA 2IJ0A 1U9RA 5JEAG 1Y1VB 3P1HA 4B9WA 3OW7A 4I7ZC 2FJ2A 1H9MA 4WORA 2NBFA 3HOVB 3HKZB 3IL8A 2RSOA 5EGTA 3PUYA 1LABA 5FLXL 1J9OA 5JEAH 4RCOA 2KEEA 2M2LA 3FPUB 4R8NA 3KBGA 1HFNA 2HUGA 3QB3A 2EJMA 1T5EA 4A3KB 5C5LA 1HXYD 3SEBA 2F0WA 5CV9A 5IOCA 2MHVA 1NAPA 3OPOA 2YU9B 4J1MA 4O1NA 2PQEA 1STNA 2OF1A 1C4QA 1SMYC 4IQZA 4DAVA 1RCVD 3OIQA 3K5LA 2Z8LA 2E74C 3EA6A 3NUCA 3A55A 1PRTF 1CHQD 4IFDJ 2DNCA 4DN4M 2A69D 1KNEA 1STGA 5J1ZA 1V8QA 1PDQA 4RCNA 1SJHD 1XYIA 4EQPA 2I07B 3RD4A 2NN6H 1AW7A 5EBCA 1JQYD 1XWEA 1DD2A 5C4ZA 5FOBB 3OHXC 5CR3A 4DAYA 1PZKD 4FF1A 5IGEA 1CZGA 3A8IE 4AYBB 2B2YC 1Y69U 2B8FA 4IUTA 1K83B 3FMCA 3PIO3 2L11A 3QWNA 3SVMA 1SNQA 3PMFA 1Z7TA 4TKOB 5G3LF 3SK4A 5C3WA 3BVZA 2ZXOA 2J7ZA 2RA4A 5IGBA 4L63B 4DXFA 5EPLA 1Q1EA 1LLRD 1UNSA 3KUPA 4WJWA 2F0EA 2K04A 4IUVA 2JE6I 3I91A 4YIJA 4BBRB 3SK8A 4KD3A 5FO7B 3R93A 1CK1A 4A3IB 1KDCA 1PRTB 3K59A 1D5ZC 1FNVA 1DM0B 4KN7C 3SK5A 3NQTA 1HHVA 4WRDA 1BCPD 2RBMA 2IX1A 1QNUA 3S9WA 1SE2A 4OO1G 5C0XI 4IFDG 1EY0A 3HG9A 2KHSA 3GTLB 5IGCA 3TP8A 3I73A 1HCZA 1SNCA 3TP5A 3E6ZX 1Q1BA 4RGMA 4HN7A 5J22A 2FMMA 2LMCB 3BYYB 5C4JB 3E5SA 2B2WC 4OIKA 5CBEE 1JICA 1STHA 2IPKD 4FXKC 5IT9L 3GP7A 4BA1I 2XWJB 1OXUA 2MUYA 2BE5D 1EEID 4IUPA 4DU9A 4HSPA 2MP1A 5DM73 1OXXK 1ML0D 1EEFD 4EGVA 1L0XB 1ICWA 1NSNS 2NVQB 1L0YB 1KAAA 1RD9D 3OWEB 2EY5A 1E2WA 5I2YA 2BA0A 1KNAA 3S17B 1TY0A 2C5CA 2Z4IA 1IW7C 2M9VA 3ERQA 1Y1WB 1KLGD 2EY1A 1LTTD 2OXPA 1WTXA 2QKIC 4HSVA 1MSGA 2KCCA 2AUJD 2WAQB 4R9WA 5FO9B 2SOBA 4ODGA 3S1QB 2KUMA 1LTAD 5KGUA 4C3HB 2L4NA 2PPBC 4H13C 5JJZA 5IT9E 3LWEA 2EJGC 4Z9CB 3J7AV 3CKIB 1TWFB 4KMUC 1HFGA 4IURA 4KTAA 2SNMA 2OEOA 1OXSC 3NXWA 5C6AA 5JPNC 5KNDA 5M3MB 2WACA 1SE3A 4OO1I 1G291 1BCPC 3V2TA 4FNFA 1Q8IA 2B2UA 1CQVA 4X3SA 1F9RA 1RTNA 1R4PB 5M5YB 2FHTA 3NWTA 1BBXC 4RHSA 4KHZA 1CT1D 3S14B 1G91A 5FK9C 2G9DA 2A6EC 5A35A 3PO3B 2F0VA 4XQJA 5BN5A 1SXTA 3BS1A 3VR3A 1F9QA 1GUNA 5IGFA 3RUZA 2Q8RE 1AFPA 1RTOA 3NP8A 3RLFA 4ZLTF 4RGNA 1D5XC 1HA6A 4F8MA 2TMPA 1LV9A 3S1MB 2L5TA 3NQIA 1BCPF 3BDOA 3NTIA 5I9OA 2F3VA 1SNOA 2NB0A 3DXJC 5M3FB 3GTMB 4TSSA 3S16B 3HGBA 1EYDA 1CFMA 2XVSA 2EY6A 2WKCA 1TS4A 1MGSA 3DHQA 4UDUC 3ITPA 4RH6A 1Q3LA 1EYCA 4N9TA 1STAA 5EKIA 3JAML 4V0BA 2WINB 3M85A 3H91A 1XX8A 4FYDA 4MN3A 4IUNA 4KJNA 1NUCA 1JCKB 1VDZA 1EU3A 2D2CC 4G7ZC 4LJZC 2XRQD 2RSNA 3N6RA 4CKCA 1ZXTA 1SDFA 2F0QA 4RKBA 1PRTC 2LKVA 5KRUA 2RQXA 2TSSA 1EU4A 5JAVA 1TWHB 4RHRA 4DK0A 1TIID 4FF4A 1V43A 2M00A 1GJXA 1BNZA 4FF3A 1CA5A 3KF8A 4HEDA 4PMCA 2F0GA 1SYFA 2RVLA 1O80A 5KEEA 4L8JA 3ND8A 3IFDA 1ZYRC 5E3FA 3VYSA 3HOYB 2QF7A 4C3JG 3Q0AA 2VNUD 5CMDA 3S1NB 1HA5A 1F2LA 1M8AA 4H44C 2J0TD 1RHPA 2CVRA 4A3FB 1LT6D 4ABNA 2EY2A 1XXGA 3MC0B 3P7JA 1JWSD 4DFAA 3K0YA 1PTOC 2K28A 4C56C 3CU7A 1K8OA 2N88A 4DXGA 3TN2A 3PV0A 1XTCD 2JSOA 4KJOA 1WTRA 3GTKB 2AQ1B 2PW5A 5ELDA 1SSOA 2X6GA 4MIUA 1D1IA 2IX3A 1O78A 3K5MA 3FEWX 3A8KE 1Y8NB 1ZKOA 2V4DA 2CQAA 4EQOA 1E2VA 1JR0D 1FNUA 3BVGA 3TBIB 3DMUA 2E2DC 1B44D 4ZRZA 1I4PA 2YYZA 4KN4C 3GV3A 1DZ1A 1ET6A 4RFBA 4K8JA 3HRZC 4PV1C 5CV5A 5JVH3 1AP0A 5KYIA 3L7ZC 1ILPA 2F0NA 1F77A 3HOZB 1SAPA 2HCIA 3D31A 1ENAA 1I4QA 2XNAC 4DGZA 2CW0D 1ONLA 3NTHA 4EVOA 1EWHA 1TWCB 4KI0A 1A3UA 1F9PA 1U4LA 5FKAC 3NTKA 2ENBA 2EDGA 3U9SA 3HOXB 3TZDA 1WD0A 2WIIB 2K5DA 1GUOA 5E1FA 4OO1H 4BWGB 3T51B 3D4RA 3QOJA 1G2TA 3GTOB 1OXVA 1IHZA 4X3UA 4QUCA 1ENFA 3PUXA 4I65A 2Z4HA 2JA7B 1E0BA 4K6DA 1IKMA 4KKUA 3CRLC 4XYQA 5IIFA 4K2KA 2ICIA 4PMWA 3JAME 4KKSA 4M8AA 4XT3B 4HAEA 2ZT9C 3MEHA 3L9AX 4GZYC 2PW7A 4EQNA 2X69A 1SNDA 1QOHA 1BOSA 4H0LC 1TVXA 5JVG3 4FP5D 2EYOA 5CYUA 1MI2A 1SEBD 5K36H 2NWGA 2KEDA 4ZUIA 3VR5A 3KLSX 4RAUC 1Y8OB 5ELEA 1EY9A 5FLXE 4KY5A 1TU2B 3T56B 4QB4A 1FYCA 1SYEA 1W6KA 5D3DA 3SE0A 4H7BA 5IGDA 1HUMA 4ZUJA 3RZDB 2JA8B 1X3QA 3M7NA 3MZ5A 5COYA 3D4DA 1Z47A 1PYWD 5C0XG 4IFDI 1TWAB 1AZPA 2O4XA 2NTSA 2O5IC 4QUFA 3NSWA 5LHY1 3TP7A 1FGBD 3GO5A 3UI2A 1CHPD 4J6HA 1I4RA 3QIAA 4RGOS 1SYBA 3DUZA 1BF4A 2E2JB 2JYOA 3R8BA 4XT1B 1PTOB 2VUMB 4CJ2C 3RMHA 2BA1A 4DNRB 4QCLA 1HQRD 3D6CA 3KLRA 2K01A 1HTPA 1WD1A 2B2TA 4A3DB 3HS0C 1DONA 3QJYA 2JXMB 3GTPB 2JP1A 3NBIA 2K7VA 5KYLA 5CBAE 2A6HC 1PZJD 1F2ZA 1B9NA 2C9OA 4JK1C 3LWUA 3J7AF 1CTMA 1AN8A 3FDTA 3PUWA 1QG7A 3PO2B 2DY8A 1Q12A 3GTJB 4XQQA 1TY2A 2B39A 2N55A 3W2DA 2F1MA 5C0XH 2IW3A 3J80E 5CORA 1U4MA 1LACA 4WFN3 5I6YA 2L1BA 2EVBA 4G7OC 5I4DA 1BXTA 2L0CA 5IGGA 4UAIA 1TT2A 5I2XA 3EFXD 2KVMA 3DEPA 4XDXA 3MXNA 2F0LA 2XSCA 2L12A 3J80L 1DOMA 1SFOB 3R3OA 2F03A 1EY7A 5C4XB 4OIJA 2QEJC 1HQMC 1BCPB 1IKLA 3QOLA 1WTVA 5AFWA 2B8GA 4BY7B 3A8JE 2KQ3A 2F0KA 4ZQ3A 4KD4A 4ME5A 3LNNA 5F2DA 1H9KA 2FINB 1DXMA 3FVQA 1EQVA 3NE5B 3NWSA 4CJ1B 3H94A 1Y8PB 3M4YA 1RDPD 1I4GA 1BUVT 1SJED 3A7AB 3ND9A 5C44B 3KBXA 1IYVA 2A68C 3SR1A 2D5DA 2A5HA 5M9OA 2E75C 2F0SA 3R2IA 3E0JA 4QF4A 1R9TB 2PZUA 2BDOA 3FRPB 1Z6HA 2KECA 1AZQA 2PMZB 3VYTA 2NUCA 2EPBA 2NN6I 4K8IA 1B1ZA 1S5FD 5LL6X 5DM63 5CV6A 2I46A 1LO5D 3I4NB 5CC4A 1B50A 1JWUD 1EIHA 1F2MA 1QE6A 1SYGA 1IW7D 1M4VA 1U4RA 1PTOD 1CZWA 1JWMD 4P2CB 5EPJA 5C4HA 4FF2A 3WOFA 3O13A 1G6ZA 3WDNA 1JB3A 1I4HA 3HOWB 2O2LD 4IFDH 4C3HG 2AQ3B 4QIWB 3G6JB 5ELCA 3BYTB 3H6MA 1JC7A 5D14A 1GUTA 4IN3A 3OWFA 3Q22A 1I4XA 3GV6A 4A3EB 4NMZA 5CV4A 2EYMA 1FD7D 1GXDC 4TQUS 2R92B 1DYQA 1UAPA 3J7YW 4RGTA 4F88A 4NP5A 1B4OA 4CJ0B 2BE5C 2PO4A 4BA2I 4KV6A 1DOKA 1I3QB 3Q24A 1I50B 3MFYA 1ENCA 2F0FA 1C8CA 1BR9A 3C2PA 3V05A 4C3IB 4OL7A 1CI3M 2FFKB 3ZYYX 4X3KA 2MGSA 4KKTA 4RKLA 4ID6A 1LTRD 4BS9A 1CM9A 4KHVA 2F0OA 3M3YB 1SE4A 4XTCS 2K05A 4CBVA 5C3EB 5C0XJ 4ZYSA 2NTTA 3EVQA 1EY5A 3HZXA 3K7AB 3AU7A 3MTSA 1I6VC 4IZ8A 1F9SA 4C2MB 4HTHA 4K6LA 3EJIA 1AEXA 2BOSA 4S3SA 3TP6A 3DWAA 3SHLA 2WP8J 5A2QE 3DWQA 1PMRA 4F87A 4BY1B 3OSOA 5EPKA 2EJFC 1A2UA 2RDHA 1U4PA 1UEAB 2AUKA 3C1FA 5DNFA 2NVYB 1YNJC 1A6XA 1SNMA 2EYJA 2FMCA 1GUGA 1QNKA 1TR5A 1UUPA 5K5PA 3SXHA 1MSHA 2AWNA 3VA7A 4C1NK 3WOEA 1YNND 3CQZB 1LTBD 3S2DB 1QCBD 2HCCA 2F0UA 2EYFA 4NKLA 3TZUA 5JOBA 3VYRA 2IT1A 3D6WA 2SNSA 1SYDA 1F2YA 5FO8B 1GHJA 3AB9A 2F3WA 1QB5D 3OMCA 1NCVA 2WB1B 3FKIB 2H1EA 2PYKA 3HOUB 3KLSA 3VA5A 4A93B 5HGTA 1TKWB 1EFID 2D9UA 2CHBD 2VB2X 3QO2A 1QILA 2O5JC 4G57A 1MD2D 2MJ8A 2K03A 3BVMA 3D8GA 2R6GA 2F4IA 1ZYRD 1OXTA 1HUNA 2B2WA 1EZ8A 4FXGC 1LTSD 4HCEA 1JOKA 5HURA 1STEA 3HEJA 3J81L 2VXWA 1ET9A 5G3LD 3DWPA 4Y7NB 4ZAIA 3M4OB 3DM1A 5C3XA 2WKDA 3H09A 3IKJA 1ZEQX 1D6EC 1GHKA 3C46A 3Q23A 1G2SA 2NYZD 3VYUA 1JOQA 1TWGB 2F0TA 2RDFA 2RKSA 2XWBB 5E4XA 1JE4A 5CGKA 1SMYD 1V1OA 3CHBD 5DAUA 1I6HB 2IX0A 1KDBA 1JORA 3IAYA 5EJWA 1PTOF 4IALA 2H4OA 3S2HB 1X3PA 1RKNA 2A6HD 1PTOH 1IL8A 4IUUA 2ZXRA 1T5XD 4O42A 3NK9A 3FPPA 5M5XB 2K6AA 3DEOA 2LFNA 4G7HC 1O7YA 1SNPA 2K33A 1S5CD 1S5DD 1WTWA 1DOLA 1KLUD 2K32A 1EWCA 3GTQB 2K1BA 3CRKC 4C3IG 1QJOA 2CW0C 1Q90A 3T13A 4XQNA 1K8MA 2PCFB 2X6LA 3K5OA 4ZK9B 3BG3A 4K5WA 2G9HD 2JEBI 4NW2A 4CKEA 2PZWA 4FVMA 3W3AA 2F0JA 2MPMA 3A56A 4PMBA 2K5WA 2F0DA 4PQXA 1V1PA 3NBHA 5ELBA 3I8ZA 1TS5A 2KA7A 2A69C 4N9PA 2DN8A 1EQTA 1YNNC 2XN9C 4ZKBB 3GQBA 1ESRA 4U673 3TSSA 2QCPX 5EKKA 1MBYA 3A54A 3V96A 3P20A 3MXGA 2OT2A 3BZDB 3MA2B 1BO0A 5ISRA 1O7LA 2IL8A 1DCZA 3U9OA 1A2TA 1A3TA 1QWYA 2ZXPA 2D62A 5TSSA 3BDCA 2B2UC 1V1PB 2L9HA 5CV8A 1NR2A 2A74C 2EYHA 1PLFA 3HP3A 1BDOA 2E76C 1S5BD 4KY7A 1H9RA 4Q5VA 3I90A 2A6ED 3I70A 3Q6SA 4CGYB 1TS2A 3NPPA 2EYLA 4PNYA 2EOTA 4Q0FA 3GD7A 2NVXB 1PFBA 2B2YA 1D1KA 2SEBD 4DA2A 3VR2A 3LX0A 2E2HB 1EL0A 4HR7B 4C1NI 4TRDA 2B2VC 1FR3A 3SK6A 2LY7A 1PXUA 1KTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNR B;  3T53 B;  3LNN A;  1GUG A;  4XIG S;  2KA7 A;  3KLR A;  1HTP A;  2NN6 H;  1H9K A;  4KKS A;  2A69 C;  2YYZ A;  1GUT A;  3IKJ A;  4BA1 I;  1DD2 A;  4DK0 A;  4KN4 C;  2DN8 A;  1GHK A;  1DXM A;  1OXU A;  1YNN C;  1V43 A;  2BE5 D;  3GQB A;  2ZT9 C;  1GJX A;  3QJY A;  3NE5 B;  3A8I E;  4TQU S;  2JXM B;  1OXX K;  4PV1 C;  3H94 A;  4KHZ A;  2K7V A;  4GZY C;  2A6H C;  3VA7 A;  3A7L A;  5K36 G;  4DK1 A;  1Y8P B;  1VF7 A;  1Y69 U;  1B9N A;  2A6E C;  2BE5 C;  2B8F A;  3L7Z C;  3LWU A;  3M4Y A;  1CTM A;  4JK1 C;  5A35 A;  3FMC A;  4BA2 I;  2Q8I B;  3P20 A;  1E2W A;  5BN5 A;  1Z7T A;  4H0L C;  4TKO B;  5KNB A;  3PUW A;  5JEA G;  2BA0 A;  3VR3 A;  1GUN A;  3A7A B;  3MFY A;  4L8J A;  3ND8 A;  3OW7 A;  3D31 A;  3ND9 A;  4I7Z C;  3RLF A;  1ZYR C;  1O7L A;  3TZU A;  5K36 H;  1DCZ A;  1IW7 C;  1ONL A;  2IT1 A;  1EWH A;  1H9S A;  1H9J A;  1H9M A;  1Q12 A;  1Q1E A;  4KI0 A;  3PUZ A;  1CI3 M;  3VR5 A;  1E2Z A;  1IYV A;  2L5T A;  1IYU A;  2QF7 A;  2F1M A;  2A68 C;  5C0X H;  4KKT A;  3BDO A;  2D5D A;  2D62 A;  1Y8O B;  4H44 C;  2EDG A;  3PUY A;  1LAB A;  3U9S A;  3MXU A;  1GHJ A;  3DXJ C;  2E75 C;  1B9M A;  2JE6 I;  2KCC A;  3AB9 A;  2A6H D;  3PUV A;  5JEA H;  1GUS A;  2AUJ D;  1LAC A;  1TU2 B;  3SDZ A;  1GUO A;  3HGB A;  4XTC S;  3T56 B;  4DNT B;  1CFM A;  1FYC A;  2EVB A;  5BN3 A;  4G7O C;  2BDO A;  5KNC A;  2JEA I;  1I6V C;  3FPP A;  3EQL C;  3SE0 A;  4LK1 C;  3QG1 A;  1HPC A;  1Z6H A;  1T5E A;  2EJM A;  3OOC A;  4OO1 H;  1K8O A;  1BDO A;  2E76 C;  4KN7 C;  3T51 B;  3D4R A;  4OGQ C;  2AWO A;  3M7N A;  1H9R A;  1TKW B;  4G7H C;  3PV0 A;  2PNR C;  2A6E D;  2K33 A;  2NN6 I;  2PPB C;  4H13 C;  3OPO A;  2NN6 G;  1OXV A;  1VF5 C;  5C0X G;  2O5J C;  5BN4 A;  2K32 A;  4OO1 G;  4IFD G;  1SMY C;  4IQZ A;  3M85 A;  2EJG C;  3CRK C;  1QJO A;  2R6G A;  4JBW A;  2O5I C;  3GD7 A;  1O78 A;  1PMR A;  2CW0 C;  3A8K E;  3I73 A;  4IFD H;  1HCZ A;  4KMU C;  1Q90 A;  1OXT A;  1Y8N B;  1H9S B;  1HQM C;  1VCI A;  1ZKO A;  1IW7 D;  3VR6 A;  1K8M A;  2EJF C;  2E74 C;  2PCF B;  2V4D A;  1VDZ A;  2D2C C;  4G7Z C;  4LJZ C;  1Q1B A;  3PUX A;  1E2V A;  2A68 D;  3N6R A;  3QIA A;  3BG3 A;  1OXS C;  3VR2 A;  2AUK A;  2B8G A;  2JEB I;  4HR7 B;  3VR4 A;  5KND A;  2DNC A;  1FR3 A;  2LMC B;  3A8J E;  1YNJ C;  3I4L A;  2A69 D;  3WDN A;  1A6X A;  1G29 1;  2DNE A;  3W3A A;  1V8Q A;  3I72 A;  4KKU A;  3CRL C;  3IFT A;  4RCN A;  2BA1 A; 
#chains in the Genus database with same CATH topology
 2AQ2 B;  2B63 B;  4XIG S;  3D3R A;  2NZO A;  1A15 A;  3URY A;  1ILQ A;  2R7D A;  4XYO A;  4RA8 A;  2EYP A;  3MVV A;  5KIX A;  3X3M A;  3F2C A;  3T1Y L;  4QMG A;  1WCM B;  1PFM A;  4L5Q A;  1ESF A;  4HJA A;  2YU9 H;  1YVC A;  2R61 A;  2HDL A;  5K36 G;  1TWF H;  3K58 A;  1TWA H;  1GOZ A;  1XNR Q;  2GVB A;  4DUZ Q;  1ASZ A;  3N52 A;  2F0M A;  4MHE A;  1X55 A;  3F2B A;  2VUM G;  1WTP A;  3RZO B;  5D3I B;  5IYD G;  1QZH A;  4M1U B;  2CWA A;  3OMG A;  2UUC L;  3T4A C;  3TRZ A;  3F2U A;  1VQG A;  1G8Z D;  4HMJ A;  5E4W C;  4G4K A;  3C1E A;  1EIG A;  1E2Z A;  2JK8 A;  1IYU A;  2WV6 D;  1K3R A;  3MFG A;  4K2L A;  1EYA A;  3HOY H;  1LT4 D;  3CP0 A;  4OHJ A;  5C5M A;  2R7Z H;  1AH9 A;  3CC4 A;  5EBD A;  4A3J B;  4J8Q A;  3IRB A;  4B9X A;  3PUV A;  2CQO A;  1EY4 A;  5AJ3 Q;  3SDZ A;  1VQ8 A;  4DNT B;  3K6O A;  4A3G B;  3OYY A;  2UUC Q;  1EOT A;  1GUW A;  3P75 A;  2ICE C;  2F0H A;  2GA4 B;  1HNX Q;  4GNX B;  3OOC A;  2QGQ A;  4KY6 A;  1LT3 D;  1R4Q B;  4K5V A;  4GOP C;  4K0K Q;  3MHB A;  1IBM Q;  1FL0 A;  4KHP Q;  3EN2 A;  1TWH H;  2NZ1 D;  4K5X A;  4DAP A;  5BN4 A;  1JE5 A;  4RWS C;  4JOI A;  2KEN A;  5JPM C;  4A3B B;  5FLX c;  2VZA A;  4POG A;  2QDB A;  1LT5 D;  4LAA A;  5I6W A;  4DK1 A;  3S1R H;  1Y1V G;  2ID0 A;  1N36 L;  5J39 A;  1WTQ A;  4DV3 L;  2A68 D;  2MO1 A;  4DR2 L;  5EQ0 A;  2DY7 A;  2HHH L;  2SDF A;  5EKL A;  5LMU Q;  5T1I A;  1RJT A;  2VUM H;  2NVT B;  3I4L A;  2VB3 X;  4XXE A;  5IP7 G;  4B08 A;  4YY3 L;  3IFT A;  1X3F A;  1LTG D;  1PH1 A;  2QIL A;  4A3J H;  2K5Q A;  1FGU A;  3I3C A;  2R7Z B;  1PFN A;  3S15 B;  1PVO A;  1VQI A;  4DF7 A;  1STB A;  2JA5 B;  2PMZ E;  2WB1 G;  3PQI A;  2RHQ B;  3H15 A;  3KFU A;  4CKB A;  1HTL D;  1JOO A;  1BQQ T;  3ULP A;  1VQ6 A;  1D5M C;  4IJL A;  2Q8T A;  1VF7 A;  1HZC A;  5GQO A;  2E2I B;  3GTL H;  3PIP 3;  2Q8I B;  1YNJ D;  4A3M B;  4BY7 G;  1CA6 A;  5KNB A;  4KLK A;  1PZI D;  4L6T B;  4YHH L;  4BY1 G;  2L15 A;  4BBS G;  1Q86 C;  2E5L L;  3T1H L;  1W6J A;  2BCO A;  2EZV A;  2Z0S A;  5CV7 A;  1L1O B;  1H9S A;  4TVA B;  2EE1 A;  4LF5 L;  4P73 A;  2B2V A;  1AE2 A;  1O7Z A;  4K14 A;  2KJX A;  4JV5 L;  4PZ8 A;  1EIY B;  1PH9 A;  3K57 A;  2K5V A;  4OEL B;  3D4W A;  4R8I A;  1FNW A;  3SGI A;  2XRS D;  1HR0 Q;  1EOV A;  3ONA B;  1B9M A;  4A3F H;  1GUS A;  5T1G A;  2Z1C A;  2R7Z G;  2R93 H;  1S5E D;  1X32 A;  5BN3 A;  3AMU A;  5KNC A;  4WJ3 M;  2NVX H;  1EZ6 A;  1WVL A;  3EQL C;  1STY A;  1TS3 A;  1S4Z A;  4LK1 C;  1HPC A;  5DLQ E;  3H0G B;  3S1R B;  3M7G A;  2D0O A;  4P75 A;  2AWO A;  2K5N A;  1IYJ B;  4A3J G;  2B29 A;  1NR4 A;  2Y0S B;  1SLJ A;  1CKO A;  2R3Z A;  3UDX A;  5HY6 A;  4A3G G;  4ULL A;  2KCN A;  5IYC G;  1VQ4 A;  1VQB A;  2IHE A;  1RIP A;  3BDL A;  4JBW A;  2A73 B;  2HDM A;  3RN5 A;  5I9P A;  3JC6 6;  1B53 A;  3UE0 A;  5IP9 G;  1PHJ A;  1H9S B;  1L1O A;  4JG2 A;  3NEL A;  4IUQ A;  2WFW A;  4KK7 A;  2CFM A;  1UE6 A;  5JJL A;  5D65 A;  2MQH A;  4B3M Q;  5IOD A;  2AMC B;  3VR4 A;  1VMP A;  4J15 A;  3TME A;  1DJR D;  2ZJP A;  3T53 B;  4HIM A;  5M5W B;  1XPR A;  1A3V A;  4MZ9 A;  4DR6 L;  3CCS A;  5C3E G;  1B3A A;  4ME3 A;  1PH2 A;  3C3L A;  1B2T A;  2XIW A;  3I4M G;  3MAQ A;  1LTI D;  1Y1W G;  1C48 A;  1IZ6 A;  4V19 0;  1CKN B;  4JV5 Q;  1RF2 D;  3X3N A;  2JEA I;  1NMG A;  4JI7 Q;  4LMQ D;  4DV2 L;  1OO9 B;  2B2T C;  5ELF A;  1G6P A;  4NDX A;  3UDI A;  3J7Z C;  4DV1 L;  3K5N A;  1IL2 A;  2R93 B;  4X3T A;  1H9J A;  2F0I A;  4QL5 A;  4HCS A;  3ERO A;  3PUZ A;  4E6I A;  2YTV A;  4EX5 A;  2RDG A;  3L3O C;  5A2Q L;  3H3V H;  3FHW A;  4FXD A;  3MXU A;  2CWP A;  3GTG H;  3J81 E;  1PH4 A;  2OQK A;  4F7X A;  1N34 Q;  4ZKC B;  2E5L Q;  4BBS B;  1LTL A;  3I7F A;  1X3E A;  1CSP A;  2F0P A;  2BDN A;  2OTL A;  2IY5 B;  1YEZ A;  2IHF A;  3I4M B;  1ICF B;  2I0Q A;  1ROD A;  3QG1 A;  3TDQ A;  3F1Z A;  1PRT D;  2JA6 B;  4OGQ C;  1WTO A;  2HHH Q;  3MWY W;  2PNR C;  1V9P A;  2NN6 G;  1SYC A;  1VF5 C;  2R7F A;  3R2T A;  1TQO A;  2XTI A;  4JI3 Q;  2LSS A;  5LL6 S;  4MNO A;  4A3B H;  1VQC A;  3CQZ H;  4L5S A;  2IWH A;  2HQE A;  4DR6 Q;  1EY6 A;  1KAB A;  3G7L A;  1VCI A;  3CCQ A;  3CCM A;  2L55 A;  3VR6 A;  4LFA L;  1CQF A;  5IWA L;  3GTG B;  3MXP A;  2R92 H;  3T16 A;  5JEA J;  3HOX G;  1AE3 A;  4CHT B;  1KHI A;  2LS0 1;  2DNE A;  1VMC A;  3I72 A;  2ZM6 Q;  3U58 A;  1QZG A;  1J8I A;  4U68 A;  2PZT A;  1KDA A;  2EXZ A;  4ILW A;  2KCM A;  3S2H H;  1HZA A;  5DEH A;  1SBB B;  4IOA A;  3KK7 A;  4C3J B;  4IPG A;  2UXB Q;  4IJH A;  4A76 A;  4LF5 Q;  3OIP A;  2I5H A;  4GLX A;  3NHH A;  1P16 A;  3ICE A;  1PYS B;  1HRJ A;  2J4X A;  4HMI A;  1C7Y A;  3H3V C;  3GDE A;  1IBK L;  3HOU G;  3A7L A;  1II3 A;  2KOL A;  1D2B A;  1EY8 A;  1T9H A;  4FO2 A;  5NUC A;  2IJ0 A;  4DR1 L;  1U9R A;  1EUJ A;  5JEA G;  1Y1V B;  3KF6 B;  3P1H A;  3OW7 A;  4B9W A;  4I7Z C;  4X66 Q;  1EWI A;  2FJ2 A;  2JA8 G;  4A3C G;  1H9M A;  4WOR A;  2NBF A;  3HOV B;  1C9O A;  2Q2U A;  3HKZ B;  2F4V Q;  3IL8 A;  2RSO A;  3J7A 5;  4X64 Q;  5EGT A;  3PUY A;  1LAB A;  5FLX L;  3ER0 A;  1I6H H;  1J9O A;  4DV1 Q;  5JEA H;  4B3T Q;  4RCO A;  2KEE A;  2M2L A;  3AEV A;  4GN3 B;  4RG1 A;  3FPU B;  4R8N A;  3KBG A;  2VW9 A;  1HFN A;  2HUG A;  3A0J A;  3QB3 A;  4BY1 H;  2EJM A;  2HIX A;  1T5E A;  3PIP A;  4A3K B;  5C5L A;  4JBM A;  4LFA Q;  4A3E G;  1HXY D;  3SEB A;  2F0W A;  4DR3 L;  5CV9 A;  5IOC A;  3GTP H;  2MHV A;  1NAP A;  3OPO A;  2YU9 B;  1FJG L;  4J1M A;  4O1N A;  2PQE A;  1STN A;  2OF1 A;  5C44 H;  1C4Q A;  1XPO A;  4LF8 Q;  1SMY C;  4IQZ A;  4DAV A;  2WAQ E;  4JBK A;  5C44 G;  1RCV D;  2VS1 A;  3OIQ A;  4O2D A;  3K5L A;  2Z8L A;  2E74 C;  1PH8 A;  3EA6 A;  1J6Q A;  3NUC A;  3A55 A;  4DR3 Q;  1PRT F;  1CHQ D;  1EFW A;  2DNC A;  4IFD J;  3W1B A;  3UE1 A;  4DN4 M;  2A69 D;  1KNE A;  1STG A;  5J1Z A;  1LYL A;  1V8Q A;  1YZ6 A;  1PDQ A;  4RCN A;  1SJH D;  1W3S A;  4JW0 A;  1XYI A;  4OX9 Q;  4EQP A;  2K75 A;  3M4Q A;  2N3S A;  1W2B A;  2I07 B;  3RD4 A;  2NN6 H;  1XMO L;  1AW7 A;  5EBC A;  1JQY D;  1XWE A;  1DD2 A;  5C4Z A;  5FOB B;  3OHX C;  5CR3 A;  4DAY A;  3KF8 B;  5EAY A;  1PZK D;  4FF1 A;  3HOZ H;  5IGE A;  1CZG A;  3A8I E;  4AYB B;  4GKJ L;  2B2Y C;  1K28 A;  2ATW A;  1E3P A;  1Y69 U;  3KDF B;  2HD3 A;  2B8F A;  4IUT A;  1K83 B;  4JC0 A;  3FMC A;  3PO3 H;  1L2F A;  4QJF A;  3PIO 3;  2L11 A;  3QWN A;  3SVM A;  1SNQ A;  3PMF A;  1Z7T A;  4TKO B;  5G3L F;  3SK4 A;  5C3W A;  3BVZ A;  2ZXO A;  4JI1 L;  2J7Z A;  2RA4 A;  5IGB A;  2VQF Q;  4CDC C;  4L63 B;  1EYG A;  4DXF A;  5EPL A;  3M4P A;  1Q1E A;  3CME A;  1LLR D;  1PH5 A;  1UNS A;  3KUP A;  4APV A;  4WJW A;  2F0E A;  1K3B C;  2K04 A;  4A3B G;  4IUV A;  2JE6 I;  3I91 A;  4YIJ A;  4BBR B;  3G4S A;  3CPW A;  3SK8 A;  4KD3 A;  3AFQ A;  1Y1V H;  3NBH B;  5FO7 B;  3R93 A;  1CK1 A;  1TWC H;  4A3I B;  4A3D G;  1KDC A;  1BBW A;  1VQJ A;  1WCM G;  1PRT B;  3K59 A;  1D5Z C;  3A5U A;  1FNV A;  1DM0 B;  2UXC L;  4KN7 C;  3SK5 A;  3NQT A;  4NXN L;  1UE7 A;  1HHV A;  3I55 A;  4WRD A;  1BCP D;  2RBM A;  2A1A A;  2IX1 A;  5JJI A;  1N36 Q;  1MJC A;  1QNU A;  3S9W A;  1CKM A;  1PA6 A;  1B3Q A;  1SE2 A;  4OO1 G;  5C0X I;  4IFD G;  5GAH C;  1EY0 A;  3WWV A;  3HG9 A;  2KHS A;  3GTL B;  5IGC A;  1WFQ A;  3TP8 A;  3I73 A;  1HCZ A;  2QEX A;  4A3K G;  1SNC A;  3TP5 A;  3E6Z X;  1Q1B A;  4RGM A;  3S16 H;  1U5K A;  5E7N A;  4QQB X;  4HN7 A;  3CD6 A;  4GKJ Q;  5J22 A;  2FMM A;  4Y7N H;  2LMC B;  2Q2I A;  4PZ7 A;  3BYY B;  5C4J B;  2KHJ A;  3E5S A;  2B2W C;  3Q8D A;  4NXM Q;  4OIK A;  4DR5 L;  5CBE E;  1JIC A;  1STH A;  2IPK D;  2UUA Q;  1EQR A;  4FXK C;  5IT9 L;  4JI0 Q;  1HNW L;  3PO2 H;  3GP7 A;  3HOX H;  4BA1 I;  2XWJ B;  1OXU A;  2MUY A;  2BE5 D;  1EEI D;  4IUP A;  4MTK A;  4DU9 A;  4HSP A;  2MP1 A;  5BR8 Q;  4OWX B;  5DM7 3;  1OXX K;  1CSQ A;  3H0G G;  1ML0 D;  1EQQ A;  1EEF D;  4EGV A;  1L0X B;  1ICW A;  1NSN S;  2NVQ B;  1JB7 A;  1L0Y B;  1KAA A;  1RD9 D;  3OWE B;  2EY5 A;  1E2W A;  3B6Y A;  5I2Y A;  4BXX G;  1D8L A;  2BA0 A;  1KNA A;  3BJU A;  3S17 B;  1MIU A;  1TY0 A;  2C5C A;  2WB1 E;  2Z4I A;  1IW7 C;  2M9V A;  2YV5 A;  3ERQ A;  4NB3 A;  4IPC A;  2DGY A;  5BR8 L;  5LMN L;  1Y1W B;  4R4T A;  1KLG D;  2EY1 A;  2RF4 A;  1LTT D;  2OXP A;  1WTX A;  2QKI C;  3CMA A;  4HSV A;  1MSG A;  4LF9 L;  2OWO A;  2KCC A;  1XPU A;  2AUJ D;  1I50 H;  1SE8 A;  2NVY H;  2WAQ B;  4R9W A;  5FO9 B;  3CC2 A;  3K8A A;  3CCL A;  2B63 G;  2SOB A;  4ODG A;  2MO0 A;  3S1Q B;  2XGT A;  4QY7 A;  2KUM A;  1LTA D;  5KGU A;  4C3H B;  2JA7 G;  2L4N A;  2PPB C;  4H13 C;  5JJZ A;  4YWK A;  3RN2 A;  5IT9 E;  1X6O A;  3LWE A;  2EJG C;  4DV6 L;  3S1Q H;  4Z9C B;  3W5O A;  3J7A V;  3S24 A;  3HOV G;  3CKI B;  4KMU C;  1TWF B;  4PG3 A;  1HFG A;  4IUR A;  3K0X A;  4KTA A;  5H1S E;  1WCM H;  2SNM A;  2OEO A;  1OXS C;  1H95 A;  3NXW A;  5C6A A;  3ULL A;  4ALP A;  4JI4 Q;  1B7Y B;  5JPN C;  5C3E H;  5KND A;  5M3M B;  2WAC A;  4BBS H;  1SE3 A;  4OO1 I;  1G29 1;  1BCP C;  3V2T A;  3G48 A;  4AIM A;  4FNF A;  1Q8I A;  2Y0S G;  1K0R A;  1CQV A;  2B2U A;  4X3S A;  3ULJ A;  3STB C;  1Q8K A;  5IYB G;  1F9R A;  2K52 A;  1RTN A;  2CH4 W;  1GM5 A;  1R4P B;  4YHH Q;  5M5Y B;  2FHT A;  2VQE Q;  3NWT A;  1BBX C;  4CDE C;  4A4I A;  4RHS A;  4KHZ A;  1CT1 D;  3S14 B;  1G91 A;  3BU2 A;  3HOY G;  5FK9 C;  2G9D A;  4H02 A;  4A93 H;  2A6E C;  5A35 A;  3PO3 B;  1VQD A;  2F0V A;  2F3I A;  3K7U C;  4A3I G;  4XQJ A;  5BN5 A;  4GKK Q;  1SN8 A;  1SXT A;  2B63 H;  3BS1 A;  3VR3 A;  1F9Q A;  1GUN A;  5IGF A;  3RUZ A;  2Q8R E;  1AFP A;  1RTO A;  3NP8 A;  3RLF A;  4ZLT F;  4RGN A;  1D5X C;  1HA6 A;  4F8M A;  4R4C A;  2VY3 A;  4P72 A;  2TMP A;  1LV9 A;  1A8V A;  3S1M B;  2L5T A;  3BZC A;  3NQI A;  1BCP F;  3BDO A;  5IE8 A;  3NTI A;  5I9O A;  1U0L A;  2F3V A;  1SNO A;  4DPG A;  2NB0 A;  3DXJ C;  2JQO A;  5M3F B;  4A75 A;  3GTM B;  4TSS A;  3S16 B;  3HGB A;  1BVS A;  4LF6 Q;  4LUZ A;  1EYD A;  1CFM A;  2XVS A;  2EY6 A;  2WKC A;  2EIF A;  2QA4 A;  4LUO A;  1TS4 A;  1MGS A;  3DHQ A;  2R92 G;  4UDU C;  3ITP A;  4RH6 A;  1Q3L A;  5C4X H;  1EYC A;  4DUZ L;  4N9T A;  1STA A;  5EKI A;  1VQF A;  3OTO L;  3JAM L;  4V0B A;  2WIN B;  1S40 A;  3M85 A;  3H91 A;  1XX8 A;  4FYD A;  4MN3 A;  4IUN A;  4KJN A;  1NUC A;  1JCK B;  5GAE C;  3CF5 A;  1VDZ A;  1EU3 A;  2D2C C;  3HKZ E;  4LJZ C;  4G7Z C;  2XRQ D;  1X9N A;  2RSN A;  3N6R A;  4DR2 Q;  4CKC A;  1WYD A;  1ZXT A;  1SDF A;  2F0Q A;  4RKB A;  1PRT C;  2LKV A;  1I5F A;  1A0I A;  2JJQ A;  5KRU A;  2RQX A;  2TSS A;  1EU4 A;  3HFZ B;  2LXK A;  2ES2 A;  5JAV A;  3E9H A;  3HOZ G;  1TWH B;  4RHR A;  4DK0 A;  1TII D;  3HKZ G;  4FF4 A;  1V43 A;  2M00 A;  1GJX A;  1BNZ A;  4GNX C;  3CCJ A;  2CKZ B;  4FF3 A;  1GO3 E;  1CA5 A;  4JI8 L;  3KF8 A;  3T1H Q;  4HED A;  4PMC A;  1JJ2 A;  2F0G A;  1SYF A;  2NVQ H;  2RVL A;  4O0A A;  4A3M H;  3G6E A;  1O80 A;  4X62 L;  2UUA L;  4MTN A;  5KEE A;  1RL2 A;  4LF4 L;  4L8J A;  3ND8 A;  3IFD A;  1ZYR C;  2UXD Q;  3D0F A;  3M3Y H;  5E3F A;  3VYS A;  3HOY B;  2QF7 A;  4C3J G;  3Q0A A;  2VNU D;  5CMD A;  3S1N B;  1N33 L;  3CCR A;  1HA5 A;  1F2L A;  1M8A A;  4H44 C;  2J0T D;  1RHP A;  2CVR A;  1NJI C;  4A3F B;  1LT6 D;  4ABN A;  4JI1 Q;  2EY2 A;  1XXG A;  3MC0 B;  1VQ9 A;  3PF5 A;  3P7J A;  2CH4 A;  1JWS D;  4HJ5 A;  4DFA A;  3K0Y A;  1PTO C;  2K28 A;  4C56 C;  1QUQ A;  1I3Q H;  1WJJ A;  3CU7 A;  1K8O A;  2N88 A;  4JI5 L;  4DXG A;  3TN2 A;  3PV0 A;  1XTC D;  4KJO A;  2JSO A;  3E3X A;  4HJ7 A;  1WTR A;  3GTK B;  3F2D A;  2AQ1 B;  2PW5 A;  4GLV B;  3MXN B;  5ELD A;  2UXD L;  1SSO A;  3I56 A;  2X6G A;  1YHQ A;  1QVF A;  1IXR A;  2AHO B;  1JJG A;  1MKH A;  4MIU A;  1D1I A;  4DAM A;  4A3K H;  2IX3 A;  1O78 A;  2JA6 H;  3K5M A;  3FEW X;  3A8K E;  5M5X H;  3PO2 G;  1Y8N B;  1ZKO A;  2V4D A;  2CQA A;  4EQO A;  4HID A;  4LUV A;  3KJO A;  1E2V A;  1JR0 D;  3PO3 G;  1FNU A;  5M3M H;  1DGS A;  3BVG A;  1X56 A;  2KHI A;  3TBI B;  2PI2 A;  3DMU A;  1Y14 B;  4LF7 L;  2E2D C;  1B44 D;  1K8G A;  4A3L H;  4ZRZ A;  1I4P A;  2YYZ A;  4KN4 C;  3LGJ A;  4OWT B;  3GV3 A;  2Z6K C;  1QVC A;  1DZ1 A;  1ET6 A;  1HH2 P;  2N8N A;  4RFB A;  4K8J A;  2ASB A;  3HRZ C;  4PV1 C;  5CV5 A;  5JVH 3;  1AP0 A;  2NZH A;  1WOC A;  5KYI A;  2H5X A;  4UP8 A;  3L7Z C;  1ILP A;  2F0N A;  4EQ5 A;  3J80 i;  1Q82 C;  1F77 A;  1YIJ A;  3HOZ B;  1SAP A;  2HCI A;  3D31 A;  4X6A H;  1ENA A;  1I4Q A;  2XNA C;  4DGZ A;  2CW0 D;  1ONL A;  3NTH A;  4EVO A;  2UU9 L;  1EWH A;  3I4M H;  3K7A H;  4R4Q A;  1TWC B;  4KI0 A;  1GKH A;  4A3I H;  1A3U A;  1F9P A;  3TRE A;  1U4L A;  1VQH A;  1KIX A;  1ASY A;  1CUK A;  5FKA C;  3KOJ A;  4DV0 Q;  3NTK A;  4C2M H;  2ENB A;  2EDG A;  3F8T A;  2K4K A;  3U9S A;  5ELO A;  3CAM A;  2UXB L;  3HOX B;  3TZD A;  1WD0 A;  2WII B;  2K5D A;  2AKW B;  1GUO A;  5E1F A;  4HJ8 A;  3E0E A;  4CDD C;  3RLN A;  2UU9 Q;  4JOI C;  4OO1 H;  3AQQ A;  4BWG B;  3QR8 A;  3T51 B;  3D4R A;  4DV0 L;  1FVI A;  1SMX A;  4P74 A;  4GOP A;  3PGZ A;  4LF4 Q;  3QOJ A;  1G2T A;  4LFC L;  3GTO B;  1OXV A;  2KBN A;  1NY4 A;  1IHZ A;  4X3U A;  1M1K C;  4QUC A;  1ENF A;  4DK3 C;  1NBW A;  3GTM H;  3L2P A;  4AQY L;  3PUX A;  3TQY A;  4I65 A;  2Z4H A;  4DV3 Q;  2JA7 B;  4R1J A;  4BY7 H;  4LNQ A;  1KC8 C;  1E0B A;  2YTX A;  5M3F G;  4K6D A;  1IKM A;  4KKU A;  3CRL C;  4XYQ A;  5IIF A;  4K2K A;  1HR0 L;  2ICI A;  4LFB L;  1UWV A;  4PMW A;  3JAM E;  4KKS A;  2RCN A;  4M8A A;  4XT3 B;  1YI2 A;  4HAE A;  1JMC A;  2ZT9 C;  4AYB E;  4N8X 1;  4JI4 L;  3MEH A;  3L9A X;  3CXC A;  4A3F G;  1HZ9 A;  2UXC Q;  4GZY C;  2PW7 A;  3TS2 A;  4EQN A;  3GTJ H;  2QW7 A;  2X69 A;  1P8L A;  1SND A;  4P71 A;  5FJ8 H;  2V1C C;  1Q81 C;  1QOH A;  1BOS A;  4H0L C;  1TVX A;  5JVG 3;  1HJP A;  4FP5 D;  2EYO A;  5CYU A;  3NEN A;  1MI2 A;  1SEB D;  5K36 H;  2NWG A;  4LWC A;  3RLO A;  2RHS B;  2KED A;  4ZUI A;  3VR5 A;  3HOW H;  5GRO A;  3KLS X;  4RAU C;  4FDB A;  4LFB Q;  1Y8O B;  5ELE A;  1EY9 A;  3J81 i;  1WTH A;  2A8V A;  4A3D H;  5FLX E;  4KY5 A;  1IBL L;  1TU2 B;  2QDL A;  1KL9 A;  3T56 B;  2G5D A;  4QB4 A;  1FYC A;  2JA7 H;  1SYE A;  1W6K A;  2ZJR A;  5D3D A;  3SE0 A;  4H7B A;  5IGD A;  4LF8 L;  4DR7 L;  4DKA C;  1M90 C;  2F52 A;  1HUM A;  4ZUJ A;  3RZD B;  1VQM A;  1X3Q A;  1N33 Q;  2JA8 B;  3MZ5 A;  3M7N A;  3PCO B;  5COY A;  3D4D A;  1E7Z A;  2Q2T A;  1Z47 A;  3KDF A;  3VDY A;  1PYW D;  5C0X G;  4IFD I;  5HGQ A;  1TWA B;  4JI7 L;  1AZP A;  2O4X A;  2NTS A;  1KAW A;  2O5I C;  4QUF A;  3NSW A;  3M4O H;  5LHY 1;  3TP7 A;  1FGB D;  3GO5 A;  3UI2 A;  1CHP D;  4J6H A;  3S15 H;  2R93 G;  4B3T L;  1I4R A;  3QIA A;  4RGO S;  5IYC H;  5M5Y H;  5IT9 c;  1SYB A;  3DUZ A;  4GNX A;  4DNI A;  1BF4 A;  2E2J B;  2JYO A;  1VQA A;  4XT1 B;  1PTO B;  3R8B A;  2NVT H;  2VUM B;  4CJ2 C;  2JA9 A;  3RMH A;  1Y1W H;  2BA1 A;  4DNR B;  4JI6 L;  4QCL A;  1HQR D;  3D6C A;  3KLR A;  2K01 A;  1HTP A;  1WD1 A;  4DV2 Q;  2B2T A;  3UDG A;  4A3D B;  3S17 H;  4DR4 L;  3HS0 C;  2E8G A;  1DON A;  3QJY A;  4DV7 L;  1SRU A;  2JXM B;  3GTP B;  2JP1 A;  3NBI A;  2K7V A;  2D0P A;  3U4Z A;  5KYL A;  5CBA E;  2A6H C;  1QVG A;  1PZJ D;  1F2Z A;  1B9N A;  2C9O A;  4JK1 C;  1L1O C;  3LWU A;  3J7A F;  1CTM A;  1AN8 A;  4OWW B;  2K5H A;  3FDT A;  1XNR L;  5M3M G;  4UPA A;  3PUW A;  1QG7 A;  1X65 A;  3PO2 B;  4I7A A;  2DY8 A;  1E1O A;  1GVP A;  1TWG H;  2GN5 A;  1O7I A;  1Q12 A;  5FLM G;  3GTJ B;  3STB D;  4XQQ A;  1TY2 A;  2B39 A;  2N55 A;  1HZB A;  3W2D A;  2F1M A;  5C0X H;  1XMQ L;  2IW3 A;  5GAG C;  2P5Z X;  3RR5 A;  3J80 E;  1J5E Q;  5COR A;  1VQ7 A;  1V1Q A;  4DV4 L;  1U4M A;  1KD1 C;  1LAC A;  4OON A;  4WFN 3;  5I6Y A;  2L1B A;  3HKS A;  2EVB A;  2I5M X;  4G7O C;  5I4D A;  1FJG Q;  4IPH A;  1I94 Q;  1VQO A;  1BXT A;  1YHB A;  1PYB A;  2L0C A;  5IGG A;  4UAI A;  2PNH A;  1TT2 A;  3J81 c;  5I2X A;  3EFX D;  2KVM A;  3DEP A;  1VQ5 A;  4XDX A;  3MXN A;  3J80 c;  2F0L A;  2XSC A;  4HIK A;  1NTG A;  2L12 A;  1YJ9 A;  3J80 L;  1DOM A;  1SFO B;  3R3O A;  2F03 A;  1EY7 A;  5C4X B;  4OIJ A;  1I94 L;  2QEJ C;  5LMN W;  2Z6B A;  1HQM C;  1KXL A;  1BCP B;  3HOU H;  1IKL A;  3QOL A;  1WTV A;  1R9T H;  5AFW A;  2A19 A;  5M3F H;  2B8G A;  4AYB G;  4BY7 B;  3A8J E;  2E2J H;  1PH6 A;  2KQ3 A;  4DR4 Q;  4YCV A;  2F0K A;  4KD4 A;  4ZQ3 A;  3LNN A;  4ME5 A;  3OW2 A;  5F2D A;  3CCE A;  4N8F A;  1S72 A;  1H9K A;  5LMU L;  1E1T A;  2FIN B;  1DXM A;  3FVQ A;  4AQY Q;  1EQV A;  3NE5 B;  3NWS A;  4K0K L;  4CJ1 B;  1K0S A;  3H94 A;  4CDF C;  1Y8P B;  3M4Y A;  4JI3 L;  1YNX A;  1RDP D;  3U4V A;  4DR1 Q;  1KQS A;  1PV4 A;  1I4G A;  1BUV T;  1SJE D;  3A7A B;  2VL6 A;  3ND9 A;  5C44 B;  3KBX A;  4DK6 C;  5IY0 A;  1YIT A;  1IYV A;  4LF7 Q;  3I2Z A;  2BH2 A;  2A68 C;  3S1M H;  1HNW Q;  3SR1 A;  2D5D A;  2A5H A;  1K73 C;  5M9O A;  4QIW E;  2E75 C;  4GLA C;  1CKN A;  4BXX H;  2F0S A;  3R2I A;  1YBY A;  1S3O A;  3HOW G;  1XMO Q;  3E0J A;  4QF4 A;  1GD7 A;  1R9T B;  2ZTD A;  2PZU A;  1YJN A;  4JI2 Q;  2BDO A;  4OX9 L;  2HIV A;  3FRP B;  1Z6H A;  2KEC A;  1AZQ A;  2PMZ B;  5IP7 H;  4HIO A;  3VYT A;  3NEM A;  2NUC A;  1VQL A;  2EPB A;  1YHA A;  2NN6 I;  4K8I A;  1B1Z A;  1S5F D;  5LL6 X;  1NMF A;  3E9I A;  5DM6 3;  5LMN Q;  5CV6 A;  4X66 L;  2I46 A;  1LO5 D;  3I4N B;  1BBU A;  4GOP B;  1TXY A;  5CC4 A;  1B50 A;  1JWU D;  4JCV E;  1EIH A;  1F2M A;  1QE6 A;  1SYG A;  5ELN A;  1IW7 D;  1M4V A;  2JA6 G;  1U4R A;  1PTO D;  1CZW A;  1JWM D;  4P2C B;  5GAD C;  5EPJ A;  1D7Q A;  4IO9 A;  4A3L G;  5C4H A;  4FF2 A;  3WOF A;  1B8A A;  3O13 A;  1G6Z A;  3WDN A;  1JB3 A;  4A93 G;  1I4H A;  4YWM A;  3HOW B;  2O2L D;  4IFD H;  4C3H G;  2AQ3 B;  4QIW B;  3G6J B;  5ELC A;  3A74 A;  3BYT B;  2K14 A;  3H6M A;  1JC7 A;  5D14 A;  1GUT A;  4IN3 A;  3OWF A;  3Q22 A;  1I4X A;  3GV6 A;  4A3E B;  4NMZ A;  5CV4 A;  2EYM A;  1FD7 D;  1GXD C;  4TQU S;  2R92 B;  1DYQ A;  1UAP A;  3GTQ H;  3J7Y W;  4RGT A;  4F88 A;  4NP5 A;  1B4O A;  4CJ0 B;  2BE5 C;  2PO4 A;  1YJW A;  4BA2 I;  3H0G H;  4KV6 A;  1C0A A;  1DOK A;  1I3Q B;  3Q24 A;  4C3J H;  3L0O A;  3RNU A;  1N32 Q;  3PIO A;  1I50 B;  3MFY A;  1ENC A;  1UE5 A;  2F0F A;  1C8C A;  1BR9 A;  3C2P A;  3FKI G;  3V05 A;  4C3I B;  4IOC A;  1A63 A;  4OL7 A;  1CI3 M;  2FFK B;  3ZYY X;  4X3K A;  2ZJQ A;  2MGS A;  1XTD A;  4KKT A;  4RKL A;  4ID6 A;  3S1N H;  5JJK A;  1LTR D;  4BS9 A;  1CM9 A;  3K80 C;  4KHV A;  2F0O A;  2E2H H;  3M3Y B;  1SE4 A;  4JI0 L;  4XTC S;  2K05 A;  4CBV A;  5C0X J;  5C3E B;  4LF6 L;  4B3R Q;  4ZYS A;  2NTT A;  1EIF A;  3EVQ A;  1EY5 A;  3HZX A;  3KLW A;  3K7A B;  3AU7 A;  3MTS A;  2I5L X;  1I6V C;  4YY3 Q;  1XJV A;  4IZ8 A;  1F9S A;  2JN4 A;  4C2M B;  4HTH A;  1Z9F A;  1XMQ Q;  2FXQ A;  2OTJ A;  4JPB W;  4K6L A;  3EJI A;  1AEX A;  3JAM i;  2ZTE A;  4R4I A;  1HNZ Q;  2BOS A;  4S3S A;  1Q7Y C;  3G71 A;  3TP6 A;  3DWA A;  3SHL A;  1SFO H;  2EQS A;  2WP8 J;  1NNX A;  4WJ4 A;  4RMF A;  1WI5 A;  5A2Q E;  1PFS A;  3DWQ A;  1PMR A;  4F87 A;  4NPS A;  2DJG C;  3KYH C;  3OSO A;  5EPK A;  4BY1 B;  2EJF C;  4KHP L;  1A2U A;  4OXP A;  3AYH B;  4DV4 Q;  3PF4 A;  3MEF A;  2RDH A;  5FJ8 G;  2HT1 A;  1U4P A;  3BZK A;  1UEA B;  2AUK A;  3C1F A;  5DNF A;  2NVY B;  1YNJ C;  4L5T A;  1A6X A;  3CC7 A;  1SNM A;  2EYJ A;  1PH7 A;  4LF9 Q;  2FMC A;  4BBR H;  1GUG A;  1QNK A;  4GN4 B;  2MNA A;  5IYD H;  1TR5 A;  4LW1 A;  2B3G A;  1OTC A;  4UP9 A;  4LFC Q;  1QUQ B;  2DJF C;  1UUP A;  5K5P A;  3SXH A;  1MSH A;  4OEM B;  4JBJ A;  4NXN Q;  2AWN A;  4HJ9 A;  3VA7 A;  2EXD A;  4C1N K;  3WOE A;  1HNX L;  1YNN D;  3CQZ B;  1LTB D;  3KJP A;  3S2D B;  1QCB D;  2HCC A;  2RCF A;  2F0U A;  2LXJ A;  5AJ3 L;  2EYF A;  4UP7 A;  4NKL A;  3GTO H;  1BKB A;  3TZU A;  5JOB A;  1J5E L;  3VYR A;  1X54 A;  2OQ0 A;  2IT1 A;  2MFI A;  3FKI H;  4JI6 Q;  2PI2 E;  4X65 L;  4B3S Q;  3D6W A;  3CPF A;  2JA5 G;  2SNS A;  4DAY B;  2Z6K A;  1SYD A;  1F2Y A;  5FO8 B;  4DR5 Q;  1GHJ A;  3I4N G;  3TS0 A;  3AB9 A;  2F3W A;  1MJE A;  4JVZ A;  1QB5 D;  5J3B A;  2KCT A;  1NCV A;  2WB1 B;  3OMC A;  3FKI B;  2H1E A;  2PYK A;  1XNQ L;  3HOU B;  3KLS A;  4X62 Q;  3VA5 A;  4A93 B;  5HGT A;  1TKW B;  4JYA Q;  4B3M L;  1EFI D;  3PSI A;  2D9U A;  2CHB D;  4BBR G;  2VB2 X;  1Q46 A;  3QO2 A;  4GKK L;  1QIL A;  2O5J C;  4G57 A;  1N9W A;  2Y0S E;  1JJC B;  1MD2 D;  4B3R L;  2MJ8 A;  1L0W A;  3ERS X;  2K03 A;  3KF6 A;  3BVM A;  3D8G A;  2R6G A;  4DV6 Q;  2F4I A;  4GS3 A;  1VS0 A;  1ZYR D;  1OXT A;  1HUN A;  1VQE A;  2B2W A;  1EZ8 A;  4FXG C;  1LTS D;  4A3E H;  4HCE A;  3T1Y Q;  3JAM c;  1JOK A;  4JYA L;  5HUR A;  1UEB A;  1STE A;  3HEJ A;  3CCU A;  3J81 L;  2BH8 A;  2VXW A;  4IPD A;  1ET9 A;  5G3L D;  3DWP A;  4Y7N B;  4ZAI A;  1B70 B;  3M4O B;  4R4O A;  3DM1 A;  5C3X A;  2WKD A;  2CCZ A;  5IWA Q;  1N32 L;  4Y52 H;  4DUY Q;  4DV5 Q;  3H09 A;  3IKJ A;  1ZEQ X;  1D6E C;  1GHK A;  3C46 A;  3Q23 A;  1VQN A;  1G2S A;  4C3I H;  2NYZ D;  4YCW A;  2Z9H A;  3VYU A;  1JOQ A;  1TWG B;  2F0T A;  2RDF A;  3UDF A;  4YCU A;  3HOV H;  4DR7 Q;  1MHW C;  2RKS A;  1KRT A;  2XWB B;  4DUY L;  4DV5 L;  2JA5 H;  5E4X A;  1JE4 A;  3M9B A;  5CGK A;  1SMY D;  1V1O A;  3CHB D;  3GTK H;  5DAU A;  1I6H B;  2IX0 A;  3AFP A;  1KDB A;  1JOR A;  1X3G A;  1XNQ Q;  4ZCK A;  4UHV A;  3IAY A;  2Q2H A;  5EJW A;  5FLM H;  1PTO F;  4JI2 L;  3U50 C;  5M5W H;  4IAL A;  2H4O A;  3S2H B;  5C4X G;  2ALY B;  1X3P A;  1RKN A;  1A62 A;  2A6H D;  1PTO H;  1IL8 A;  4IUU A;  4A3G H;  2ZXR A;  2GVA A;  1T5X D;  4O42 A;  2PQA B;  3NK9 A;  3FPP A;  2ZM6 L;  4X65 Q;  5M5X B;  4B3S L;  5C4J H;  1IBK Q;  4JI8 Q;  2K6A A;  4JI5 Q;  3RZO H;  3DEO A;  2LFN A;  4G7H C;  1O7Y A;  3K81 C;  1SNP A;  2K33 A;  2ZTC A;  1S5C D;  1S5D D;  3I4O A;  1WTW A;  1DOL A;  1KLU D;  2K32 A;  1EWC A;  3GTQ B;  4GN5 A;  2K1B A;  3CRK C;  4C3I G;  1QJO A;  2E2I H;  2CW0 C;  3RZD H;  5IYB H;  1Q90 A;  3T13 A;  4XQN A;  3CCV A;  1NE3 A;  1K8M A;  2PCF B;  2X6L A;  3K5O A;  4ZK9 B;  3OTO Q;  1PH3 A;  3BG3 A;  1LUZ A;  4K5W A;  2G9H D;  2JEB I;  1E22 A;  4NW2 A;  4CKE A;  2PZW A;  4FVM A;  3J81 j;  3W3A A;  4NXM L;  2F0J A;  2MPM A;  3A56 A;  1LM0 A;  4PMB A;  2K5W A;  2F0D A;  4PQX A;  1V1P A;  3NBH A;  5ELB A;  4UY8 C;  3I8Z A;  1TS5 A;  3CW2 C;  2DUD A;  2KA7 A;  4X64 L;  2A69 C;  2HQL A;  2N49 A;  4N9P A;  1N34 L;  2DN8 A;  1HNZ L;  1EQT A;  1YNN C;  2XN9 C;  4ZKB B;  3GQB A;  4A3C H;  1ESR A;  2UUB L;  1UE1 A;  4U67 3;  3TSS A;  3S14 H;  2QCP X;  5EKK A;  3S2D H;  1MBY A;  3A54 A;  3V96 A;  3P20 A;  2PQA A;  3MXG A;  1K8A C;  2VQE L;  2VQF L;  1G51 A;  2OT2 A;  2JA8 H;  3FP9 A;  3BZD B;  3MA2 B;  4AH6 A;  3A5Z B;  1BO0 A;  5ISR A;  1O7L A;  2IL8 A;  1DCZ A;  3U9O A;  2UUB Q;  1A2T A;  1VQP A;  2K50 A;  1A3T A;  1QWY A;  2ZXP A;  2D62 A;  5TSS A;  3DLL A;  2F4V L;  3BDC A;  2B2U C;  1V1P B;  1K9M C;  2L9H A;  5CV8 A;  2YTY A;  1KRS A;  1NR2 A;  2A74 C;  4A3M G;  2EYH A;  1E24 A;  4POF A;  1VQK A;  1PLF A;  2C35 B;  4QGU A;  3I4N H;  3HP3 A;  1BDO A;  2E76 C;  1K83 H;  4YWL A;  1S5B D;  3EIV A;  4KY7 A;  4DV7 Q;  1H9R A;  4C3H H;  2OCE A;  3H3V I;  4Q5V A;  3I90 A;  2A6E D;  3I70 A;  3Q6S A;  3ZJY C;  1TS2 A;  4CGY B;  3NPP A;  2EYL A;  1SR3 A;  3DM3 A;  4PNY A;  4PZ6 A;  2EOT A;  4Q0F A;  3W1G A;  1IBM L;  3GD7 A;  1HR0 W;  2NVX B;  1PFB A;  1JT8 A;  2B2Y A;  5IP9 H;  1IBL Q;  1D1K A;  2SEB D;  1N8R C;  3TEH B;  4DA2 A;  3VR2 A;  3LX0 A;  1SRO A;  2E2H B;  1EL0 A;  4HR7 B;  4C1N I;  5L37 A;  4TRD A;  2B2V C;  1FR3 A;  3SK6 A;  2LY7 A;  3EBE A;  1PXU A;  1KTK A;  4L5R C;  2N78 A;  2WAQ G; 
#chains in the Genus database with same CATH homology
 2AQ2 B;  2B63 B;  4XIG S;  3D3R A;  1A15 A;  3URY A;  1ILQ A;  4XYO A;  4RA8 A;  2EYP A;  3MVV A;  5KIX A;  3X3M A;  4QMG A;  1WCM B;  1PFM A;  1ESF A;  2R61 A;  2HDL A;  5K36 G;  3K58 A;  1GOZ A;  3N52 A;  2F0M A;  4MHE A;  1WTP A;  3RZO B;  5D3I B;  4M1U B;  3OMG A;  3T4A C;  3F2U A;  4HMJ A;  1G8Z D;  5E4W C;  4G4K A;  3C1E A;  1EIG A;  1E2Z A;  1IYU A;  2WV6 D;  3MFG A;  4K2L A;  1EYA A;  1LT4 D;  4OHJ A;  5C5M A;  5EBD A;  4A3J B;  4J8Q A;  4B9X A;  3PUV A;  1EY4 A;  3SDZ A;  4DNT B;  3K6O A;  4A3G B;  1EOT A;  1GUW A;  3P75 A;  2ICE C;  2F0H A;  2GA4 B;  3OOC A;  4KY6 A;  1LT3 D;  1R4Q B;  4K5V A;  3MHB A;  2NZ1 D;  4K5X A;  4DAP A;  5BN4 A;  4RWS C;  5JPM C;  4A3B B;  2QDB A;  1LT5 D;  4LAA A;  5I6W A;  4DK1 A;  2ID0 A;  5J39 A;  1WTQ A;  2A68 D;  5EQ0 A;  2DY7 A;  2SDF A;  5EKL A;  5T1I A;  1RJT A;  2NVT B;  3I4L A;  2VB3 X;  4XXE A;  4B08 A;  3IFT A;  1LTG D;  2QIL A;  2K5Q A;  3I3C A;  2R7Z B;  1PFN A;  3S15 B;  4DF7 A;  1STB A;  2JA5 B;  4CKB A;  1HTL D;  1JOO A;  1BQQ T;  1D5M C;  2Q8T A;  1VF7 A;  2E2I B;  3PIP 3;  2Q8I B;  1YNJ D;  4A3M B;  1CA6 A;  5KNB A;  1PZI D;  4L6T B;  1W6J A;  2BCO A;  2EZV A;  5CV7 A;  1H9S A;  2EE1 A;  2B2V A;  1O7Z A;  4K14 A;  2KJX A;  3K57 A;  3D4W A;  4R8I A;  1FNW A;  2XRS D;  3ONA B;  1B9M A;  1GUS A;  5T1G A;  2Z1C A;  1S5E D;  1X32 A;  5BN3 A;  3AMU A;  5KNC A;  1EZ6 A;  1WVL A;  3EQL C;  1STY A;  1TS3 A;  1S4Z A;  4LK1 C;  1HPC A;  3H0G B;  3S1R B;  3M7G A;  2AWO A;  1NR4 A;  2Y0S B;  2R3Z A;  4ULL A;  2KCN A;  3BDL A;  4JBW A;  2A73 B;  2HDM A;  5I9P A;  1B53 A;  1H9S B;  4IUQ A;  4KK7 A;  5D65 A;  5IOD A;  3VR4 A;  1VMP A;  3TME A;  1DJR D;  3T53 B;  5M5W B;  1A3V A;  1B3A A;  3C3L A;  1B2T A;  2XIW A;  3MAQ A;  1LTI D;  1C48 A;  4V19 0;  1RF2 D;  3X3N A;  2JEA I;  4LMQ D;  1OO9 B;  2B2T C;  5ELF A;  4NDX A;  3K5N A;  2R93 B;  4X3T A;  1H9J A;  2F0I A;  4HCS A;  3ERO A;  3PUZ A;  4E6I A;  2RDG A;  3L3O C;  5A2Q L;  4FXD A;  3MXU A;  3J81 E;  4F7X A;  4ZKC B;  4BBS B;  2F0P A;  2BDN A;  3I4M B;  1ROD A;  3QG1 A;  3TDQ A;  1PRT D;  2JA6 B;  4OGQ C;  1WTO A;  3MWY W;  2PNR C;  2NN6 G;  1SYC A;  1VF5 C;  3R2T A;  1TQO A;  5LL6 S;  2IWH A;  2HQE A;  1EY6 A;  1KAB A;  3G7L A;  1VCI A;  2L55 A;  3VR6 A;  1CQF A;  3GTG B;  3MXP A;  3T16 A;  5JEA J;  4CHT B;  2LS0 1;  2DNE A;  1VMC A;  3I72 A;  1J8I A;  4U68 A;  2PZT A;  1KDA A;  2EXZ A;  4ILW A;  5DEH A;  1SBB B;  4C3J B;  3KK7 A;  3OIP A;  3NHH A;  1HRJ A;  2J4X A;  4HMI A;  3H3V C;  3A7L A;  1II3 A;  2KOL A;  1D2B A;  1EY8 A;  4FO2 A;  5NUC A;  2IJ0 A;  1U9R A;  5JEA G;  1Y1V B;  3P1H A;  4B9W A;  3OW7 A;  4I7Z C;  2FJ2 A;  1H9M A;  4WOR A;  2NBF A;  3HOV B;  3HKZ B;  3IL8 A;  2RSO A;  5EGT A;  3PUY A;  1LAB A;  5FLX L;  1J9O A;  5JEA H;  4RCO A;  2KEE A;  2M2L A;  3FPU B;  4R8N A;  3KBG A;  1HFN A;  2HUG A;  3QB3 A;  2EJM A;  1T5E A;  4A3K B;  5C5L A;  1HXY D;  3SEB A;  2F0W A;  5CV9 A;  5IOC A;  2MHV A;  1NAP A;  3OPO A;  2YU9 B;  4J1M A;  4O1N A;  2PQE A;  1STN A;  2OF1 A;  1C4Q A;  1SMY C;  4IQZ A;  4DAV A;  1RCV D;  3OIQ A;  3K5L A;  2Z8L A;  2E74 C;  3EA6 A;  3NUC A;  3A55 A;  1PRT F;  1CHQ D;  4IFD J;  2DNC A;  4DN4 M;  2A69 D;  1KNE A;  1STG A;  5J1Z A;  1V8Q A;  1PDQ A;  4RCN A;  1SJH D;  1XYI A;  4EQP A;  2I07 B;  3RD4 A;  2NN6 H;  1AW7 A;  5EBC A;  1JQY D;  1XWE A;  1DD2 A;  5C4Z A;  5FOB B;  3OHX C;  5CR3 A;  4DAY A;  1PZK D;  4FF1 A;  5IGE A;  1CZG A;  3A8I E;  4AYB B;  2B2Y C;  1Y69 U;  2B8F A;  4IUT A;  1K83 B;  3FMC A;  3PIO 3;  2L11 A;  3QWN A;  3SVM A;  1SNQ A;  3PMF A;  1Z7T A;  4TKO B;  5G3L F;  3SK4 A;  5C3W A;  3BVZ A;  2ZXO A;  2J7Z A;  2RA4 A;  5IGB A;  4L63 B;  4DXF A;  5EPL A;  1Q1E A;  1LLR D;  1UNS A;  3KUP A;  4WJW A;  2F0E A;  2K04 A;  4IUV A;  2JE6 I;  3I91 A;  4YIJ A;  4BBR B;  3SK8 A;  4KD3 A;  5FO7 B;  3R93 A;  1CK1 A;  4A3I B;  1KDC A;  1PRT B;  3K59 A;  1D5Z C;  1FNV A;  1DM0 B;  4KN7 C;  3SK5 A;  3NQT A;  1HHV A;  4WRD A;  1BCP D;  2RBM A;  2IX1 A;  1QNU A;  3S9W A;  1SE2 A;  4OO1 G;  5C0X I;  4IFD G;  1EY0 A;  3HG9 A;  2KHS A;  3GTL B;  5IGC A;  3TP8 A;  3I73 A;  1HCZ A;  1SNC A;  3TP5 A;  3E6Z X;  1Q1B A;  4RGM A;  4HN7 A;  5J22 A;  2FMM A;  2LMC B;  3BYY B;  5C4J B;  3E5S A;  2B2W C;  4OIK A;  5CBE E;  1JIC A;  1STH A;  2IPK D;  4FXK C;  5IT9 L;  3GP7 A;  4BA1 I;  2XWJ B;  1OXU A;  2MUY A;  2BE5 D;  1EEI D;  4IUP A;  4DU9 A;  4HSP A;  2MP1 A;  5DM7 3;  1OXX K;  1ML0 D;  1EEF D;  4EGV A;  1L0X B;  1ICW A;  1NSN S;  2NVQ B;  1L0Y B;  1KAA A;  1RD9 D;  3OWE B;  2EY5 A;  1E2W A;  5I2Y A;  2BA0 A;  1KNA A;  3S17 B;  1TY0 A;  2C5C A;  2Z4I A;  1IW7 C;  2M9V A;  3ERQ A;  1Y1W B;  1KLG D;  2EY1 A;  1LTT D;  2OXP A;  1WTX A;  2QKI C;  4HSV A;  1MSG A;  2KCC A;  2AUJ D;  2WAQ B;  4R9W A;  5FO9 B;  2SOB A;  4ODG A;  3S1Q B;  2KUM A;  1LTA D;  5KGU A;  4C3H B;  2L4N A;  2PPB C;  4H13 C;  5JJZ A;  5IT9 E;  3LWE A;  2EJG C;  4Z9C B;  3J7A V;  3CKI B;  1TWF B;  4KMU C;  1HFG A;  4IUR A;  4KTA A;  2SNM A;  2OEO A;  1OXS C;  3NXW A;  5C6A A;  5JPN C;  5KND A;  5M3M B;  2WAC A;  1SE3 A;  4OO1 I;  1G29 1;  1BCP C;  3V2T A;  4FNF A;  1Q8I A;  2B2U A;  1CQV A;  4X3S A;  1F9R A;  1RTN A;  1R4P B;  5M5Y B;  2FHT A;  3NWT A;  1BBX C;  4RHS A;  4KHZ A;  1CT1 D;  3S14 B;  1G91 A;  5FK9 C;  2G9D A;  2A6E C;  5A35 A;  3PO3 B;  2F0V A;  4XQJ A;  5BN5 A;  1SXT A;  3BS1 A;  3VR3 A;  1F9Q A;  1GUN A;  5IGF A;  3RUZ A;  2Q8R E;  1AFP A;  1RTO A;  3NP8 A;  3RLF A;  4ZLT F;  4RGN A;  1D5X C;  1HA6 A;  4F8M A;  2TMP A;  1LV9 A;  3S1M B;  2L5T A;  3NQI A;  1BCP F;  3BDO A;  3NTI A;  5I9O A;  2F3V A;  1SNO A;  2NB0 A;  3DXJ C;  5M3F B;  3GTM B;  4TSS A;  3S16 B;  3HGB A;  1EYD A;  1CFM A;  2XVS A;  2EY6 A;  2WKC A;  1TS4 A;  1MGS A;  3DHQ A;  4UDU C;  3ITP A;  4RH6 A;  1Q3L A;  1EYC A;  4N9T A;  1STA A;  5EKI A;  3JAM L;  4V0B A;  2WIN B;  3M85 A;  3H91 A;  1XX8 A;  4FYD A;  4MN3 A;  4IUN A;  4KJN A;  1NUC A;  1JCK B;  1VDZ A;  1EU3 A;  2D2C C;  4G7Z C;  4LJZ C;  2XRQ D;  2RSN A;  3N6R A;  4CKC A;  1ZXT A;  1SDF A;  2F0Q A;  4RKB A;  1PRT C;  2LKV A;  5KRU A;  2RQX A;  2TSS A;  1EU4 A;  5JAV A;  1TWH B;  4RHR A;  4DK0 A;  1TII D;  4FF4 A;  1V43 A;  2M00 A;  1GJX A;  1BNZ A;  4FF3 A;  1CA5 A;  3KF8 A;  4HED A;  4PMC A;  2F0G A;  1SYF A;  2RVL A;  1O80 A;  5KEE A;  4L8J A;  3ND8 A;  3IFD A;  1ZYR C;  5E3F A;  3VYS A;  3HOY B;  2QF7 A;  4C3J G;  3Q0A A;  2VNU D;  5CMD A;  3S1N B;  1HA5 A;  1F2L A;  1M8A A;  4H44 C;  2J0T D;  1RHP A;  2CVR A;  4A3F B;  1LT6 D;  4ABN A;  2EY2 A;  1XXG A;  3MC0 B;  3P7J A;  1JWS D;  4DFA A;  3K0Y A;  1PTO C;  2K28 A;  4C56 C;  3CU7 A;  1K8O A;  2N88 A;  4DXG A;  3TN2 A;  3PV0 A;  1XTC D;  2JSO A;  4KJO A;  1WTR A;  3GTK B;  2AQ1 B;  2PW5 A;  5ELD A;  1SSO A;  2X6G A;  4MIU A;  1D1I A;  2IX3 A;  1O78 A;  3K5M A;  3FEW X;  3A8K E;  1Y8N B;  1ZKO A;  2V4D A;  2CQA A;  4EQO A;  1E2V A;  1JR0 D;  1FNU A;  3BVG A;  3TBI B;  3DMU A;  2E2D C;  1B44 D;  4ZRZ A;  1I4P A;  2YYZ A;  4KN4 C;  3GV3 A;  1DZ1 A;  1ET6 A;  4RFB A;  4K8J A;  3HRZ C;  4PV1 C;  5CV5 A;  5JVH 3;  1AP0 A;  5KYI A;  3L7Z C;  1ILP A;  2F0N A;  1F77 A;  3HOZ B;  1SAP A;  2HCI A;  3D31 A;  1ENA A;  1I4Q A;  2XNA C;  4DGZ A;  2CW0 D;  1ONL A;  3NTH A;  4EVO A;  1EWH A;  1TWC B;  4KI0 A;  1A3U A;  1F9P A;  1U4L A;  5FKA C;  3NTK A;  2ENB A;  2EDG A;  3U9S A;  3HOX B;  3TZD A;  1WD0 A;  2WII B;  2K5D A;  1GUO A;  5E1F A;  4OO1 H;  4BWG B;  3T51 B;  3D4R A;  3QOJ A;  1G2T A;  3GTO B;  1OXV A;  1IHZ A;  4X3U A;  4QUC A;  1ENF A;  3PUX A;  4I65 A;  2Z4H A;  2JA7 B;  1E0B A;  4K6D A;  1IKM A;  4KKU A;  3CRL C;  4XYQ A;  5IIF A;  4K2K A;  2ICI A;  4PMW A;  3JAM E;  4KKS A;  4M8A A;  4XT3 B;  4HAE A;  2ZT9 C;  3MEH A;  3L9A X;  4GZY C;  2PW7 A;  4EQN A;  2X69 A;  1SND A;  1QOH A;  1BOS A;  4H0L C;  1TVX A;  5JVG 3;  4FP5 D;  2EYO A;  5CYU A;  1MI2 A;  1SEB D;  5K36 H;  2NWG A;  2KED A;  4ZUI A;  3VR5 A;  3KLS X;  4RAU C;  1Y8O B;  5ELE A;  1EY9 A;  5FLX E;  4KY5 A;  1TU2 B;  3T56 B;  4QB4 A;  1FYC A;  1SYE A;  1W6K A;  5D3D A;  3SE0 A;  4H7B A;  5IGD A;  1HUM A;  4ZUJ A;  3RZD B;  2JA8 B;  1X3Q A;  3M7N A;  3MZ5 A;  5COY A;  3D4D A;  1Z47 A;  1PYW D;  5C0X G;  4IFD I;  1TWA B;  1AZP A;  2O4X A;  2NTS A;  2O5I C;  4QUF A;  3NSW A;  5LHY 1;  3TP7 A;  1FGB D;  3GO5 A;  3UI2 A;  1CHP D;  4J6H A;  1I4R A;  3QIA A;  4RGO S;  1SYB A;  3DUZ A;  1BF4 A;  2E2J B;  2JYO A;  3R8B A;  4XT1 B;  1PTO B;  2VUM B;  4CJ2 C;  3RMH A;  2BA1 A;  4DNR B;  4QCL A;  1HQR D;  3D6C A;  3KLR A;  2K01 A;  1HTP A;  1WD1 A;  2B2T A;  4A3D B;  3HS0 C;  1DON A;  3QJY A;  2JXM B;  3GTP B;  2JP1 A;  3NBI A;  2K7V A;  5KYL A;  5CBA E;  2A6H C;  1PZJ D;  1F2Z A;  1B9N A;  2C9O A;  4JK1 C;  3LWU A;  3J7A F;  1CTM A;  1AN8 A;  3FDT A;  3PUW A;  1QG7 A;  3PO2 B;  2DY8 A;  1Q12 A;  3GTJ B;  4XQQ A;  1TY2 A;  2B39 A;  2N55 A;  3W2D A;  2F1M A;  5C0X H;  2IW3 A;  3J80 E;  5COR A;  1U4M A;  1LAC A;  4WFN 3;  5I6Y A;  2L1B A;  2EVB A;  4G7O C;  5I4D A;  1BXT A;  2L0C A;  5IGG A;  4UAI A;  1TT2 A;  5I2X A;  3EFX D;  2KVM A;  3DEP A;  4XDX A;  3MXN A;  2F0L A;  2XSC A;  2L12 A;  3J80 L;  1DOM A;  1SFO B;  3R3O A;  2F03 A;  1EY7 A;  5C4X B;  4OIJ A;  2QEJ C;  1HQM C;  1BCP B;  1IKL A;  3QOL A;  1WTV A;  5AFW A;  2B8G A;  4BY7 B;  3A8J E;  2KQ3 A;  2F0K A;  4ZQ3 A;  4KD4 A;  4ME5 A;  3LNN A;  5F2D A;  1H9K A;  2FIN B;  1DXM A;  3FVQ A;  1EQV A;  3NE5 B;  3NWS A;  4CJ1 B;  3H94 A;  1Y8P B;  3M4Y A;  1RDP D;  1I4G A;  1BUV T;  1SJE D;  3A7A B;  3ND9 A;  5C44 B;  3KBX A;  1IYV A;  2A68 C;  3SR1 A;  2D5D A;  2A5H A;  5M9O A;  2E75 C;  2F0S A;  3R2I A;  3E0J A;  4QF4 A;  1R9T B;  2PZU A;  2BDO A;  3FRP B;  1Z6H A;  2KEC A;  1AZQ A;  2PMZ B;  3VYT A;  2NUC A;  2EPB A;  2NN6 I;  4K8I A;  1B1Z A;  1S5F D;  5LL6 X;  5DM6 3;  5CV6 A;  2I46 A;  1LO5 D;  3I4N B;  5CC4 A;  1B50 A;  1JWU D;  1EIH A;  1F2M A;  1QE6 A;  1SYG A;  1IW7 D;  1M4V A;  1U4R A;  1PTO D;  1CZW A;  1JWM D;  4P2C B;  5EPJ A;  5C4H A;  4FF2 A;  3WOF A;  3O13 A;  1G6Z A;  3WDN A;  1JB3 A;  1I4H A;  3HOW B;  2O2L D;  4IFD H;  4C3H G;  2AQ3 B;  4QIW B;  3G6J B;  5ELC A;  3BYT B;  3H6M A;  1JC7 A;  5D14 A;  1GUT A;  4IN3 A;  3OWF A;  3Q22 A;  1I4X A;  3GV6 A;  4A3E B;  4NMZ A;  5CV4 A;  2EYM A;  1FD7 D;  1GXD C;  4TQU S;  2R92 B;  1DYQ A;  1UAP A;  3J7Y W;  4RGT A;  4F88 A;  4NP5 A;  1B4O A;  4CJ0 B;  2BE5 C;  2PO4 A;  4BA2 I;  4KV6 A;  1DOK A;  1I3Q B;  3Q24 A;  1I50 B;  3MFY A;  1ENC A;  2F0F A;  1C8C A;  1BR9 A;  3C2P A;  3V05 A;  4C3I B;  4OL7 A;  1CI3 M;  2FFK B;  3ZYY X;  4X3K A;  2MGS A;  4KKT A;  4RKL A;  4ID6 A;  1LTR D;  4BS9 A;  1CM9 A;  4KHV A;  2F0O A;  3M3Y B;  1SE4 A;  4XTC S;  2K05 A;  4CBV A;  5C3E B;  5C0X J;  4ZYS A;  2NTT A;  3EVQ A;  1EY5 A;  3HZX A;  3K7A B;  3AU7 A;  3MTS A;  1I6V C;  4IZ8 A;  1F9S A;  4C2M B;  4HTH A;  4K6L A;  3EJI A;  1AEX A;  2BOS A;  4S3S A;  3TP6 A;  3DWA A;  3SHL A;  2WP8 J;  5A2Q E;  3DWQ A;  1PMR A;  4F87 A;  4BY1 B;  3OSO A;  5EPK A;  2EJF C;  1A2U A;  2RDH A;  1U4P A;  1UEA B;  2AUK A;  3C1F A;  5DNF A;  2NVY B;  1YNJ C;  1A6X A;  1SNM A;  2EYJ A;  2FMC A;  1GUG A;  1QNK A;  1TR5 A;  1UUP A;  5K5P A;  3SXH A;  1MSH A;  2AWN A;  3VA7 A;  4C1N K;  3WOE A;  1YNN D;  3CQZ B;  1LTB D;  3S2D B;  1QCB D;  2HCC A;  2F0U A;  2EYF A;  4NKL A;  3TZU A;  5JOB A;  3VYR A;  2IT1 A;  3D6W A;  2SNS A;  1SYD A;  1F2Y A;  5FO8 B;  1GHJ A;  3AB9 A;  2F3W A;  1QB5 D;  3OMC A;  1NCV A;  2WB1 B;  3FKI B;  2H1E A;  2PYK A;  3HOU B;  3KLS A;  3VA5 A;  4A93 B;  5HGT A;  1TKW B;  1EFI D;  2D9U A;  2CHB D;  2VB2 X;  3QO2 A;  1QIL A;  2O5J C;  4G57 A;  1MD2 D;  2MJ8 A;  2K03 A;  3BVM A;  3D8G A;  2R6G A;  2F4I A;  1ZYR D;  1OXT A;  1HUN A;  2B2W A;  1EZ8 A;  4FXG C;  1LTS D;  4HCE A;  1JOK A;  5HUR A;  1STE A;  3HEJ A;  3J81 L;  2VXW A;  1ET9 A;  5G3L D;  3DWP A;  4Y7N B;  4ZAI A;  3M4O B;  3DM1 A;  5C3X A;  2WKD A;  3H09 A;  3IKJ A;  1ZEQ X;  1D6E C;  1GHK A;  3C46 A;  3Q23 A;  1G2S A;  2NYZ D;  3VYU A;  1JOQ A;  1TWG B;  2F0T A;  2RDF A;  2RKS A;  2XWB B;  5E4X A;  1JE4 A;  5CGK A;  1SMY D;  1V1O A;  3CHB D;  5DAU A;  1I6H B;  2IX0 A;  1KDB A;  1JOR A;  3IAY A;  5EJW A;  1PTO F;  4IAL A;  2H4O A;  3S2H B;  1X3P A;  1RKN A;  2A6H D;  1PTO H;  1IL8 A;  4IUU A;  2ZXR A;  1T5X D;  4O42 A;  3NK9 A;  3FPP A;  5M5X B;  2K6A A;  3DEO A;  2LFN A;  4G7H C;  1O7Y A;  1SNP A;  2K33 A;  1S5C D;  1S5D D;  1WTW A;  1DOL A;  1KLU D;  2K32 A;  1EWC A;  3GTQ B;  2K1B A;  3CRK C;  4C3I G;  1QJO A;  2CW0 C;  1Q90 A;  3T13 A;  4XQN A;  1K8M A;  2PCF B;  2X6L A;  3K5O A;  4ZK9 B;  3BG3 A;  4K5W A;  2G9H D;  2JEB I;  4NW2 A;  4CKE A;  2PZW A;  4FVM A;  3W3A A;  2F0J A;  2MPM A;  3A56 A;  4PMB A;  2K5W A;  2F0D A;  4PQX A;  1V1P A;  3NBH A;  5ELB A;  3I8Z A;  1TS5 A;  2KA7 A;  2A69 C;  4N9P A;  2DN8 A;  1EQT A;  1YNN C;  2XN9 C;  4ZKB B;  3GQB A;  1ESR A;  4U67 3;  3TSS A;  2QCP X;  5EKK A;  1MBY A;  3A54 A;  3V96 A;  3P20 A;  3MXG A;  2OT2 A;  3BZD B;  3MA2 B;  1BO0 A;  5ISR A;  1O7L A;  2IL8 A;  1DCZ A;  3U9O A;  1A2T A;  1A3T A;  1QWY A;  2ZXP A;  2D62 A;  5TSS A;  3BDC A;  2B2U C;  1V1P B;  2L9H A;  5CV8 A;  1NR2 A;  2A74 C;  2EYH A;  1PLF A;  3HP3 A;  1BDO A;  2E76 C;  1S5B D;  4KY7 A;  1H9R A;  4Q5V A;  3I90 A;  2A6E D;  3I70 A;  3Q6S A;  4CGY B;  1TS2 A;  3NPP A;  2EYL A;  4PNY A;  2EOT A;  4Q0F A;  3GD7 A;  2NVX B;  1PFB A;  2B2Y A;  1D1K A;  2SEB D;  4DA2 A;  3VR2 A;  3LX0 A;  2E2H B;  1EL0 A;  4HR7 B;  4C1N I;  4TRD A;  2B2V C;  1FR3 A;  3SK6 A;  2LY7 A;  1PXU A;  1KTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...