1HA6A

Nmr solution structure of murine ccl20/mip-3a chemokine
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
b'ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROPHAGE INFLAMMATORY PROTEIN 3 ALPHA
publication title NMR Solution Structure of Murine Ccl20/Mip3-A, a Chemiokine that Specifically Chemoattracs Immature Dendritic Cells and Lymphocytes Through its Highly Specific Interaction with the Beta-Chemokine Receptor Ccr6
pubmed doi rcsb
molecule tags Immune system
total genus 9
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ha6A00
5EPLA 1G2SA 2B2TC 1B2TA 1X3QA 4ZKBB 1PFMA 4RWSC 1AZPA 1NAPA 2X69A 1VMCA 2MGSA 2FFKB 4UAIA 1B3AA 2EPBA 2VXWA 1WTRA 1QE6A 1PFBA 2K04A 2L9HA 4QUCA 2KVMA 5CMDA 1EL0A 1IL8A 1F2LA 2N55A 1PFNA 2NYZD 4IURA 3HP3A 5EKIA 3FPUB 4CJ1B 2M2LA 1U4PA 1WD1A 1CA5A 2K03A 1EOTA 2KUMA 3SVMA 2RSOA 2B2WC 4CJ2C 2N88A 4IUTA 4X3UA 1S4ZA 3D6WA 3F2UA 1TVXA 4XT1B 1PLFA 2MJ8A 4MHEA 1M8AA 2NWGA 1Q3LA 4HEDA 2B2VC 2EOTA 1WTXA 1HHVA 4OIJA 1LV9A 4X3TA 1EQTA 3ONAB 4OIKA 2HDLA 5E4XA 2XIWA 1JE4A 1ZXTA 2SDFA 1BBXC 2KOLA 1DOMA 1SSOA 1NCVA 2RSNA 1ML0D 1WTPA 1WTWA 1RODA 2RVLA 2HCCA 3MTSA 2DY7A 5CORA 3LWEA 2EE1A 4RA8A 1G2TA 1HUNA 3I90A 1RTOA 2L4NA 3TZDA 4U68A 2K28A 4R8IA 2HCIA 2JYOA 3H91A 4IUQA 2B2UA 1HFNA 2HDMA 1MSHA 1RTNA 1U4LA 5EJWA 1WTQA 1J8IA 1DOKA 3I3CA 2R3ZA 1U4MA 2K05A 3FDTA 4X3KA 1CM9A 2MPMA 4IUUA 5D65A 5DNFA 1DOLA 1B4OA 2KEEA 1X32A 4CJ0B 1CA6A 5EPJA 1WTOA 1ILPA 2B2TA 2B2YC 3I8ZA 1SAPA 4RAUC 5T1GA 2JP1A 3DM1A 5COYA 2KECA 1DONA 1BNZA 1NR4A 1GUWA 1DZ1A 1J9OA 5AFWA 3Q6SA 1SDFA 4HSVA 4ZK9B 1MI2A 1U4RA 2MP1A 1MGSA 2L1BA 3IL8A 5CBEE 1WTVA 2B2WA 1NR2A 1XX8A 2K1BA 1IKMA 3TN2A 4HAEA 2FINB 3GV3A 5D14A 2FJ2A 1QNKA 2IL8A 2B2VA 5T1IA 1G6ZA 3UI2A 1RHPA 3N52A 3DEPA 4IUVA 1E0BA 2KEDA 2HUGA 2Q8RE 1RJTA 1O7ZA 4LMQD 1ICWA 1B50A 3GV6A 1PDQA 1HFGA 1O7YA 2L11A 1XYIA 1BF4A 2DY8A 4XDXA 1F9PA 1EIHA 1MSGA 4NW2A 1JICA 4XT3B 1ILQA 1AZQA 1EIGA 1IKLA 2FMMA 3KBXA 4ZKCB 3DEOA 3MWYW 5EPKA 4IUPA 2X6LA 1KNEA 4DN4M 1VMPA 2J7ZA 4HCSA 1A15A 1F9RA 1HA6A 1G91A 3G7LA 4O42A 4MN3A 1QG7A 4QUFA 3R93A 5JJZA 1BO0A 2Q8TA 1O80A 1WD0A 5E4WC 1F9QA 4R9WA 4X3SA 5CBAE 1WVLA 2B2UC 1C8CA 1AP0A 1KNAA 2CVRA 2K01A 3IFDA 3KUPA 1HUMA 3P7JA 5EQ0A 3I91A 2FHTA 2NZ1D 2B2YA 1X3PA 2D9UA 1F9SA 3QO2A 2L12A 1ESRA 2X6GA 1HRJA 2H1EA 2BDNA 4ZLTF 1B53A 4ZAIA 2RA4A
chains in the Genus database with same CATH superfamily
1LABA 2OTJA 3K58A 2F0VA 3H3VC 1B3AA 1IBMQ 3H09A 1T5XD 4DV3Q 5IWAL 1IL8A 1P16A 1VQCA 2E2IB 3M4PA 4C3HG 5EAYA 1JCKB 1PZKD 1BXTA 1HJPA 1I50B 1VQKA 5C44G 2F0JA 1RL2A 4LFBQ 2MNAA 3A0JA 2XTIA 4A3EB 1JOQA 1XMQL 4V190 1NE3A 2HQLA 3AFQA 4JCVE 1K0RA 2SDFA 2F0OA 4EQPA 2EXZA 3HGBA 4IALA 4DV5L 3TZDA 3PV0A 2E2JB 3OTOL 5BN5A 3MXNA 1WYDA 3L0OA 2WV6D 2D2CC 3C46A 4DR7L 1E1OA 4B3SQ 1AH9A 3TP7A 3PMFA 5G3LF 3K81C 2IX1A 1ZEQX 2Z4HA 2RHQB 1FD7D 4AH6A 1VQJA 4XTCS 4FYDA 1NTGA 1NJIC 3MXGA 4ULLA 2UXDL 3NK9A 2OWOA 2CW0C 4LF8L 5J1ZA 1UE5A 1VQEA 1HQRD 2KCCA 2R6GA 4ZK9B 1SEBD 1JB7A 4POFA 3CCRA 1TS5A 1WTVA 4GZYC 1KL9A 3NBHB 2EYFA 5LHY1 5JPMC 3TN2A 4E6IA 3CCJA 2E76C 1BVSA 2UUCQ 3EN2A 4EVOA 4DFAA 4GLXA 1Y1VB 2JE6I 1XPUA 4QQBX 1I6HH 3J81c 1I4XA 1GO3E 3KDFA 2Z6BA 1BKBA 1I4RA 2K5VA 2K5HA 2DUDA 4ZKCB 3MHBA 3S1RH 4CDFC 5EKLA 4KTAA 2LY7A 2GA4B 3VR3A 1G91A 5M3MG 4BY7G 1WVLA 2JJQA 2PW5A 1HH2P 5C4JH 2FHTA 3T1YL 3QO2A 1HRJA 1QVCA 1S5FD 1AFPA 1X56A 2E2DC 4NDXA 1QE6A 1PZJD 4FXDA 2ASBA 4A3BG 4KHPL 4OELB 4U673 3BYTB 4CDEC 1CA5A 4JI3L 5IWAQ 4AYBB 1AN8A 4C3HB 2NVTH 3GTKH 1PLFA 2KHSA 4Y7NH 3CW2C 3Q0AA 4LK1C 1VDZA 1I6HB 5JPNC 5D3DA 1XMQQ 1LTSD 4CKBA 4M1UB 1P8LA 5CV5A 1RODA 3SXHA 2NVQH 3I4LA 1BCPC 2NN6G 3S1RB 1EYGA 4BXXG 4X6AH 2A74C 1K8MA 3ZYYX 4DV5Q 3V96A 1Q1BA 2JK8A 3W5OA 5C4JB 3R2IA 4DR7Q 4HIOA 3VDYA 1VQNA 1ONLA 3T13A 1DONA 1NR4A 1DZ1A 3F1ZA 5BR8L 1KAWA 1EEID 4N9TA 4C1NI 3GD7A 2A6HC 4LF8Q 1XWEA 1ASZA 2R61A 4H13C 1Q81C 5M3FH 3PF4A 1SFOB 3UDXA 2PNHA 1S3OA 4DA2A 3GTKB 2NVTB 3A8IE 4QJFA 1NMGA 5FJ8G 2PQAB 3U50C 4DR2L 3H0GH 4DNIA 4KJNA 1VQDA 1B50A 1SJHD 1L0WA 3D4RA 1I4PA 2A68C 4ZYSA 1X65A 1ILQA 1W2BA 5IGEA 3GQBA 1LTTD 1WOCA 5IT9E 2NVQB 3R3OA 3TRZA 3NWTA 3P75A 3CCVA 4O1NA 4TVAB 1SROA 3FKIG 3R93A 3PIO3 3A5ZB 1A3VA 2F3VA 1Y1WH 1IBKL 2QDBA 1IW7C 4NP5A 4RCOA 4N9PA 2R93H 2OXPA 4S3SA 3HOZH 2O2LD 4DKAC 4HMIA 5EPLA 3ZJYC 2PZTA 4LF5L 5C3EG 4KY7A 4RWSC 5KRUA 4F87A 2FFKB 1LTBD 3M4QA 4B9WA 4JI8Q 3D8GA 3AMUA 2YU9B 4J1MA 4WFN3 3FPUB 4A3CG 1LTGD 3PO2G 2OEOA 4X3UA 4KHPQ 2L5TA 3F2UA 5K36H 2I0QA 4JI3Q 4LFAL 4ABNA 4LUOA 1I5FA 4GN3B 3SE0A 1ASYA 2I5LX 3H0GB 3ONAB 5DLQE 1D5XC 1BBXC 1VF5C 4I7ZC 4N8FA 2AUKA 2EY1A 2HIXA 2HCIA 1VQ6A 2L0CA 2UU9L 1MSHA 4EX5A 4R4OA 3STBC 4A3JH 3PUZA 5M5YH 1GHKA 2LS01 1YNXA 4DR1Q 2EYLA 1JWSD 1Q82C 1JJGA 3GTQH 1LLRD 3SK5A 1PRTF 5ELDA 5IP9H 1F77A 1LT6D 1RIPA 1I3QH 5GAGC 4JBMA 4FF2A 4JI0L 4IFDI 1I94L 1SR3A 2SOBA 3HOUG 5BR8Q 2JA5G 2N78A 1KAAA 1AEXA 2EDGA 3LWUA 3W1BA 5T1IA 1HZAA 3UI2A 2A19A 3ERSX 3AYHB 2Q8RE 1FGUA 2XRSD 3EJIA 2FMCA 3WWVA 1HFGA 3NXWA 4KK7A 3W2DA 3TDQA 4DR2Q 3T53B 2VW9A 1AE3A 1O7LA 1SN8A 5IT9c 1TXYA 5CV4A 1F9RA 1SE8A 1VQPA 4JW0A 1X54A 2QEXA 2QA4A 1FNUA 2VS1A 3I91A 5I4DA 3AB9A 3TS2A 1B8AA 3MC0B 3K0XA 5FO7B 3M85A 2EJMA 1KIXA 1RF2D 1N36Q 2MFIA 4LWCA 2HIVA 2K04A 4I65A 1T5EA 4LF5Q 1YBYA 2CW0D 1N32L 3SK6A 4YCVA 2LSSA 4P2CB 3HOUH 3SVMA 4CJ2C 2MHVA 2JA5H 3A74A 3PO2B 2I46A 1EYCA 1M8AA 2NWGA 4NXMQ 4EQNA 1BUVT 1X6OA 1TKWB 3PSIA 4RGTA 1PFSA 1STGA 5GADC 4X3TA 3E0EA 4A75A 1A3UA 4LFAQ 1DM0B 3U4ZA 1TWFH 2MO0A 1BOSA 1VQAA 4GLVB 4MTKA 3QWNA 5NUCA 4LUVA 1HZCA 1S72A 2K28A 1XTCD 4AYBE 1J8IA 1WCMG 2UU9Q 1ICFB 2R3ZA 3CRLC 1SBBB 3RR5A 1WTHA 3MXUA 2YYZA 1FJGL 5T1GA 3J7ZC 1PA6A 3KLRA 5I9PA 3ERQA 1K8OA 1STAA 1BNZA 3MZ5A 5L37A 3S2HH 2ICIA 3BDCA 1QVGA 2ZJQA 2F4VL 4DR6L 4H44C 1QNUA 2OT2A 1JOOA 1XX8A 4JI0Q 4DV0Q 3HOUB 3GV3A 1EIFA 1I94Q 3R8BA 1VCIA 1EIYB 2JA5B 3UE1A 1KDAA 1SMXA 1D8LA 4LNQA 1K73C 4RGOS 3WDNA 4K14A 1TWGB 1MKHA 1O7ZA 1G2TA 3I56A 1PDQA 3K5MA 4LF7Q 4P72A 3GTLH 2F0MA 4GNXA 2RDGA 4JI4Q 1TWFB 1KNEA 2IW3A 1KDCA 1JC7A 1O78A 3VYTA 2Q2UA 4DAMA 1K3BC 3PGZA 3JAML 1QG7A 1BCPD 3NBHA 4MIUA 1XTDA 2F0HA 1B3QA 3RN5A 2F0SA 5IYCG 2IJ0A 3EROA 4OONA 1WCMH 1X3PA 4F7XA 2K5DA 5FO9B 5C0XH 2M9VA 3NPPA 4XQQA 2KENA 2VQEL 2R7DA 2VNUD 1LTRD 4ZKBB 3NELA 2F0QA 1KC8C 1FR3A 2VB2X 2JA7G 4CHTB 3BVGA 3S2HB 2NUCA 4QMGA 2KBNA 5IY0A 1XNRL 4A93H 4DUZL 3HOVH 2FXQA 2QDLA 4UP8A 1CFMA 2A6HD 4R4TA 1N32Q 2HT1A 3AFPA 2VQFL 2ZM6L 1II3A 1Q3LA 4ME3A 5KNDA 1O7IA 2A5HA 4TSSA 4XIGS 3G4SA 3D0FA 1KHIA 5C3XA 1LTLA 4HJAA 1JE4A 1ZXTA 2RQXA 3GTLB 4FP5D 4DV3L 1KTKA 1NCVA 2G9DA 4ODGA 4GNXC 2F3WA 3GTOB 2QILA 5DM73 1PYWD 3H3VI 3LGJA 4MTNA 1I4HA 4DV7L 4H0LC 4DAYA 4LFBL 4IUQA 4DK0A 2K75A 1HFNA 5LMNL 4JOIA 3J80E 2RDHA 5IODA 2YTXA 1U4LA 3FVQA 1KDBA 4A3LH 1K0SA 1BDOA 4A3GH 3MEFA 3OMGA 3HOYG 1VQMA 2NB0A 1WCMB 3RNUA 3OSOA 1IW7D 1VQHA 1OXXK 4G7ZC 4A4IA 1GUTA 1TU2B 3K6OA 2RCNA 3I7FA 4UDUC 5IYDH 4DR4L 4C2MH 5J22A 1QZGA 2PMZB 2F4VQ 4DR6Q 4PQXA 4JV5L 3PQIA 2NBFA 2N49A 3GO5A 4B9XA 2M00A 3BVZA 1JMCA 3KF8A 1IHZA 1V9PA 1BF4A 3J81L 4JI6Q 2F0IA 3IKJA 2Z0SA 3L2PA 1UE6A 1YVCA 1NBWA 3TREA 3ICEA 1G291 1TIID 4FF1A 2BH2A 1OXVA 3M4YA 1B9MA 3DMUA 4B3MQ 1O80A 3GTMB 5CR3A 1EY4A 4JOIC 3IFDA 3D31A 1AW7A 5FOBB 1EZ8A 4GOPB 4A3GB 3STBD 1EZ6A 2L12A 4NB3A 2PQAA 1TR5A 2EQSA 3VR2A 4CDDC 4DXFA 3JAMi 1PH6A 2NTSA 2Q2TA 4PMCA 3P1HA 2VQEQ 5FLXE 2K6AA 5IGDA 4KD3A 3PO3H 4QY7A 5E7NA 3S17H 3JAMc 2G9HD 4C2MB 1A6XA 1X9NA 2RSOA 1SYEA 1PVOA 2VL6A 5FK9C 4IUTA 1XNRQ 4G57A 2IWHA 1VS0A 1V1PA 4DUZQ 1N34L 2CH4W 1PH7A 1EY8A 2NN6I 4OIJA 3F8TA 2VQFQ 2KQ3A 2ZM6Q 3NHHA 5C4HA 2EJGC 1EU3A 3SHLA 2ZJRA 3EVQA 4X62L 1EY5A 2H4OA 1ZYRC 4ZRZA 4H7BA 4AYBG 5A2QL 1D5ZC 4L5SA 3GDEA 3H91A 1EY6A 2WB1B 1RTNA 1CI3M 2BOSA 4DAVA 4DV7Q 2NZOA 1WTQA 3CD6A 3PIP3 3T16A 4IUUA 3VA5A 5LMNQ 3OWFA 1PTOF 1R4PB 1HPCA 1HA5A 1PYBA 3HOYB 3BG3A 2F0WA 3OIPA 4UHVA 2EY2A 4NMZA 3DM1A 4BBRH 1PH8A 1VQLA 1J9OA 2PNRC 3S1QH 1Y14B 3QB3A 1A2UA 1ET6A 2Z1CA 1HNZL 1K28A 1KRTA 3S17B 1X3EA 4YWLA 1VQ4A 1ESFA 1PRTC 4HAEA 3M3YH 3M7GA 2EZVA 4DR4Q 3HS0C 2NVYH 1HR0Q 1F2ZA 4RHRA 3OIQA 3DEPA 3FRPB 4LFCQ 4JV5Q 4WJ4A 4Q5VA 1J6QA 2J4XA 2F4IA 3KK7A 4GNXB 2D62A 4NXNQ 1Q12A 2JEAI 1EUJA 2X6LA 3RN2A 3S9WA 4DK3C 1A15A 4A3FH 3AU7A 1B7YB 3J81i 4IPHA 4XXEA 2K4KA 3ND8A 4R4IA 1E2WA 3K5NA 3E9IA 2OF1A 2ZJPA 3G6JB 3VR4A 5IYBH 2A6EC 5GAHC 4K2LA 1B2TA 3LNNA 1NAPA 1VMCA 5FLXc 4BBRB 3X3MA 1K8GA 1QJOA 1G6PA 1EFWA 2B8GA 1U5KA 2ENBA 4L5TA 1MD2D 1V1QA 5CV9A 3S1QB 3C1EA 5G3LD 3U9SA 1KLUD 1YJ9A 1A0IA 1VQ7A 1SMYC 5KYIA 1JB3A 4LJZC 4HIDA 4JBJA 4QL5A 3RZDH 1HCZA 2NVYB 3PUVA 4DR5L 4A3DG 3G48A 1RD9D 1LV9A 1N34Q 4JI8L 2KA7A 4QIWE 1WTPA 2RVLA 3H94A 3J81j 2DY7A 3UE0A 3C2PA 4KMUC 1RCVD 2NVXH 2YTYA 3CMAA 5HURA 2AQ3B 4WORA 2IPKD 3L9AX 4X62Q 4DAYB 4A3FB 5M3FG 2JEBI 3KYHC 4A3IH 3EIVA 4UPAA 3SEBA 3UDGA 2K33A 4F88A 1K8AC 4DV6L 2Z6KA 1HNWQ 4KHVA 3H0GG 1H95A 2UXCL 4QGUA 1BQQT 3EFXD 2CWPA 3BZDB 3EBEA 1XMOL 1GUWA 2I5MX 4N8X1 4JG2A 2UUBL 1SDFA 2XRQD 2YTVA 4KHZA 4EQOA 2I5HA 4JYAL 3X3NA 1UE7A 2Q8IB 2JN4A 4FO2A 1Y1WG 5C5LA 1Q8KA 1HNZQ 4DR1L 2K5QA 5GAEC 2R93G 2F0LA 3RZDB 4R4CA 1EWHA 1TQOA 3HOZG 4A3DH 3KLWA 3KF8B 4LMQD 3ULPA 5AJ3L 4G7HC 2F0KA 2F0DA 1SXTA 1EIGA 2OCEA 1NY4A 3TZUA 5BN3A 3O13A 2J7ZA 5IT9L 3VYRA 3A56A 3R2TA 4HCSA 2RF4A 2NVXB 1OXSC 2JA8H 3DHQA 1KQSA 5K36G 1EY7A 2PMZE 5CBAE 2MO1A 3QR8A 2K5NA 4IPCA 5KYLA 2Z6KC 4Y7NB 2X6GA 3NTIA 1S40A 2KCMA 2CH4A 1X3QA 1A3TA 3M4OH 3A5UA 4DNRB 2L9HA 2KVMA 1F2LA 4FNFA 5JJKA 2OQKA 4WJ3M 5EKIA 1PRTB 1WD1A 1TWAH 2P5ZX 4YIJA 2IHEA 2F0EA 4K5WA 4PG3A 5FLMH 1MIUA 1L0YB 3VR6A 1UEAB 2TMPA 3HOXG 4A3JG 3D6WA 3MVVA 2AHOB 1V1PB 2AKWB 3CCQA 2NTTA 1N36L 2OQ0A 5JVG3 3S1NH 3F2CA 4A3DB 4DR5Q 2PCFB 2KOLA 3BZCA 5IP9G 1SSOA 1QVFA 4DAPA 2A73B 2DJFC 1DD2A 5C0XI 2RDFA 4ILWA 3FHWA 4U68A 4UP9A 1E7ZA 2LXKA 4DF7A 5DEHA 3NTHA 2JA8B 4NPSA 4NXML 3D6CA 4C3IH 3S15H 2ALYB 1EYDA 3FDTA 4K6DA 4X3KA 4YY3L 5M3FB 2MPMA 2KEEA 3OW7A 2ZXOA 3BS1A 4DV6Q 3BYYB 4OEMB 2UXCQ 3F2DA 3M4OB 3I73A 4OL7A 1MI2A 1Y8PB 1XMOQ 4LW1A 3CPWA 3W3AA 2RKSA 4DV2Q 2UUBQ 2JA9A 1JJCB 2WB1E 4XYOA 1TWAB 3W1GA 4YHHL 4JYAQ 1SNQA 1YIJA 3HOXH 1Y1WB 2ATWA 1GUOA 1F2YA 3CC7A 3Q22A 1YHQA 4EGVA 2R93B 3HOZB 4NW2A 1HZBA 1LTID 2B63H 5AJ3Q 4P71A 5KEEA 3KF6B 4IUPA 3T4AC 2XVSA 1VMPA 4DV0L 1STYA 1WD0A 1WJJA 1ZYRD 1Y8NB 3QJYA 1UAPA 3S15B 4C3IB 4XQNA 4L63B 2CVRA 2B29A 2F52A 1AE2A 3NE5B 4HCEA 4RHSA 5EQ0A 1PH1A 4LF7L 1H9MA 1BBWA 4JI4L 3UDFA 1EQQA 1YEZA 3E0JA 4K8JA 2F3IA 1V8QA 1YZ6A 2VXWA 5I6WA 5CMDA 1LM0A 3HG9A 4PMWA 1SYFA 3HP3A 3Q8DA 5C6AA 1QZHA 2ES2A 1FL0A 2F0TA 4HJ8A 4P74A 4XT1B 4MHEA 1Z6HA 1PRTD 1M4VA 3K59A 1JR0D 4A3JB 3HOXB 2EOTA 4DV4L 4GOPA 5M5YB 4C3JG 4OIKA 2HDLA 5E4XA 2AWNA 2Y0SB 3K7AH 3GTQB 2VZAA 4X66L 1HTPA 2AQ2B 4R1JA 3S16H 2HQEA 1HUNA 1I3QB 5JEAJ 4PV1C 5C4XG 1DJRD 2ZTDA 1MJCA 2LFNA 5JVH3 3HFZB 2J0TD 2DJGC 3D3RA 2OTLA 1CA6A 3L7ZC 1JORA 1WTOA 1YJWA 2V1CC 4YY3Q 3D4WA 3K5OA 1N33L 3GTGH 3BU2A 1PTOC 2A6ED 4J8QA 3QIAA 3I4MH 1RDPD 3H6MA 5EKKA 1MGSA 2IX3A 1E2VA 1ENCA 5I2YA 5CBEE 3OYYA 2C9OA 1NR2A 4KY5A 4IFDJ 1QNKA 3ITPA 3HKZB 2O5IC 5M5XH 1FNVA 1SMYD 4IJHA 5C0XG 4YHHQ 1QILA 4GOPC 2DY8A 3OMCA 1MSGA 4C3JH 2AUJD 1CKNB 1IKLA 1CSPA 3URYA 1H9SA 1Y8OB 1Q86C 3K7AB 1XNQQ 3T1HL 3S16B 5IGFA 1IZ6A 3HRZC 1IL2A 4A93G 3G7LA 3HOVG 3DXJC 2Q8TA 1CQFA 2BDOA 5C4XH 1EWIA 4KD4A 1LACA 2D9UA 1LT4D 1BCPF 4IPGA 4JI6L 2XN9C 1TWHH 1XXGA 3RLOA 2EYJA 3HOWH 2MGSA 1SNMA 1L0XB 3NP8A 3UDIA 4B3RL 2CFMA 3DLLA 1EL0A 5HY6A 1JQYD 3I4MB 4B3ML 2ZXPA 4PMBA 4LF6L 1EOVA 2KUMA 1A62A 4A3LG 4FF3A 4A3GG 3E5SA 2K5WA 2PZWA 1STNA 5M5XB 1YNJC 1VF7A 5FO8B 4RMFA 1I4GA 2C35B 5C5MA 4IPDA 3ULLA 3CMEA 4DV4Q 2ICEC 4C3JB 4DPGA 1CTMA 4QIWB 1OXUA 1PV4A 4JI7L 4LF4Q 3FMCA 5I6YA 1YHBA 2EE1A 4RA8A 5IYDG 3CCUA 3CKIB 3I90A 2WAQB 4R8IA 4X66Q 2JYOA 1Z47A 2WKDA 3HZXA 3BDLA 1W3SA 3J80L 4HIKA 5KNBA 1EY9A 3I3CA 4F8MA 5C4XB 2CCZA 3VYUA 1X32A 4JI1L 2EYHA 5EPJA 3K5LA 3J7AF 3S14H 3S2DH 2JP1A 1SRUA 1PTOH 3FEWX 1TWHB 5KIXA 3NQIA 3HOWB 4DR3L 5ISRA 1A2TA 2EIFA 4HSVA 1N33Q 2MP1A 4M8AA 2WB1G 2L1BA 4A76A 2SEBD 2B2WA 3CAMA 1OXTA 2FINB 4YCWA 3TQYA 5JEAH 1EFID 5IGBA 1SYDA 1G6ZA 1RHPA 4HSPA 4IUVA 1VQGA 2HUGA 1W6JA 1EQVA 1IBLL 1O7YA 4OWWB 1STEA 4BBSH 2BA1A 3PO3G 2PO4A 1AZQA 4BWGB 4OO1H 1A8VA 3KLSA 1CZGA 5J39A 2ZT9C 4RFBA 3T1HQ 1HR0L 1VQBA 4A93B 4LFCL 1C8CA 3HOVB 2I07B 1CQVA 3VA7A 3S24A 1PH3A 2NZHA 1SNOA 3PUYA 3CXCA 2BA0A 4IFDH 3I4NH 1LUZA 4ZAIA 1WI5A 4O0AA 4NXNL 3S2DB 1PTOB 5KNCA 1AZPA 2WFWA 2X69A 3NQTA 3NBIA 5D3IB 1H9RA 2QKIC 3CCSA 5FLXL 4LF9Q 2YV5A 1PFNA 1SYCA 3KFUA 4OGQC 1U4PA 4B3RQ 4JI5Q 3MEHA 3C3LA 3IFTA 1A63A 5DM63 2B2WC 3U58A 4MNOA 4A3MH 1HXYD 4LF6Q 2B8FA 1YI2A 1UE1A 1U9RA 4P75A 3U4VA 2VY3A 1E2ZA 1LYLA 2JXMB 5JJIA 4ZUJA 3I72A 2XIWA 3V05A 3KLSX 4BBRG 3JC66 2UUAL 2JQOA 5BN4A 1C0AA 4G4KA 5CV6A 3MTSA 2HCCA 5CORA 3LWEA 1GKHA 2QEJC 2PI2E 1H9JA 1I50H 4MZ9A 4JI7Q 2F1MA 4LUZA 3OW2A 1WFQA 1UNSA 4Y52H 4FXKC 1Z9FA 1U4MA 2K05A 3I4OA 1EWCA 4CJ0B 4IUNA 3CRKC 1SAPA 2A1AA 4JI1Q 2Y0SE 2HD3A 4KKTA 1M1KC 3J80i 2XSCA 1W6KA 3J7AV 2PQEA 4B3TL 1G8ZD 2E2JH 1L2FA 5ELFA 4A3FG 3TEHB 1FYCA 4DR3Q 1CHQD 2BCOA 3T56B 5F2DA 4BY1H 1E22A 1HNWL 1NNXA 3J80c 1VQ5A 1UWVA 3CU7A 2B2VA 2R7ZH 5H1SE 4A3MB 2PPBC 3EA6A 2KEDA 3OPOA 1TS2A 3SK8A 1TY2A 4G7OC 1S5DD 5IYBG 1ICWA 1JE5A 5CV7A 4JI2Q 4BA2I 1SNDA 2DN8A 1IBLQ 1H9SB 2Z4IA 3V2TA 2RCFA 5IP7G 1HNXL 3PO3B 2KCTA 1DYQA 5TSSA 1I4QA 4DK6C 2WIIB 1EYAA 1VQFA 5E4WC 3TP5A 2JA6H 4I7AA 3S1MH 3P7JA 3HKZE 1Y1VH 2F0PA 3NTKA 1D2BA 4L8JA 1F9SA 1SNCA 3CCMA 1ESRA 5CC4A 1QCBD 2QW7A 1ET9A 1FNWA 5I9OA 1G2SA 2HHHL 2E75C 1Z7TA 2AWOA 3MFGA 2KHJA 4WJWA 1PFBA 4QUCA 1Q1EA 1C4QA 3KF6A 5A2QE 5I2XA 1PTOD 3OWEB 1KABA 1IXRA 4JC0A 4A3IG 3T51B 3QOJA 4BY1B 2N88A 4RGMA 1TVXA 1NMFA 2WACA 2BE5C 2R7ZB 1K9MC 4KLKA 2B2VC 3IRBA 2Q2HA 4PZ8A 2XGTA 1CSQA 1QWYA 1R9TH 4L6TB 4KI0A 1DOMA 3CC4A 4UP7A 4B08A 3MXPA 1D1KA 1ML0D 3RD4A 2JSOA 3MFYA 4OX9L 1JJ2A 2UUAQ 3M7NA 2AQ1B 4K0KL 5LL6X 2PI2A 4CDCC 5A35A 5IP7H 4C3HH 1VQ8A 5ELBA 3OOCA 1YHAA 4YCUA 1S5BD 5C44H 2JA6B 1LT3D 3M3YB 3SGIA 3S1MB 1CM9A 4CKCA 1SNPA 2K7VA 3A7LA 1FVIA 1X55A 1IYJB 3KOJA 3GTJH 1Q8IA 3BVMA 4K8IA 4APVA 3ULJA 2ID0A 2EXDA 3Q6SA 3PIOA 4GS3A 1XPRA 4Z9CB 1G51A 4K5VA 4TQUS 2JA8G 2WAQE 3IL8A 2XWBB 4QB4A 1GHJA 4B3TQ 1CKMA 3ER0A 2EYPA 2FJ2A 2ZTCA 2A69C 5M5WH 2DGYA 3N52A 3P20A 4L5QA 1E0BA 3CF5A 4PNYA 3H3VH 1RJTA 4KN7C 5GQOA 3I2ZA 1XYIA 1YNJD 2CKZB 1R9TB 3RUZA 1C9OA 5K5PA 2FMMA 4POGA 3MWYW 1CHPD 4DV2L 3E6ZX 1ENFA 2EYOA 3L3OC 4HR7B 4DN4M 3KBGA 1R4QB 5IGGA 1SFOH 5FLMG 4QUFA 3MA2B 1BBUA 1CK1A 1HNXQ 5IIFA 4R9WA 3TMEA 4FXGC 1Q7YC 1DXMA 5C44B 1YNND 4RKBA 2B2YA 1PH2A 4OWTB 3PF5A 1B53A 1GM5A 3TP8A 3GTJB 3VR5A 4P73A 1CKNA 4CGYB 3RMHA 2N8NA 2HHHQ 1IYUA 2N55A 1T9HA 1X3GA 5FKAC 2K03A 4C3IG 1QUQB 3FP9A 5M3MH 1S4ZA 4QF4A 3OTOQ 4BY7H 2L55A 2MJ8A 2PW7A 4A3IB 2O5JC 3SK4A 5M5WB 4HJ5A 5IGCA 1STHA 4RKLA 3TSSA 3DUZA 4GLAC 4HJ7A 3NENA 2YU9H 4GKJL 1S5ED 3KJPA 4O2DA 2UXDQ 1SE4A 1TS4A 4A3BH 3HEJA 4RG1A 4OX9Q 4K0KQ 5EJWA 3LX0A 2IY5B 2QCPX 4UY8C 5D65A 1EY0A 4IOAA 4NKLA 5GROA 4K5XA 1PZID 1SLJA 2Y0SG 2KHIA 1HZ9A 2B2YC 4OHJA 1D1IA 5IOCA 4FF4A 3BDOA 2B63G 2EVBA 1B9NA 3HKSA 5AFWA 2CHBD 1L1OA 2NN6H 3DM3A 4BXXH 2K1BA 1I6VC 5D14A 3D4DA 4ZQ3A 5M3MB 3CHBD 1Y69U 3U9OA 1KXLA 4KN4C 4BY7B 1SYBA 1SJED 2B3GA 4FVMA 1OTCA 2R92G 1D6EC 2AMCB 1S5CD 2L11A 3T1YQ 1GOZA 1JICA 4PZ6A 4Q0FA 1YJNA 4KKUA 1C48A 1STBA 3ND9A 2PYKA 1QOHA 2SNSA 2IHFA 4A3BB 5JJZA 3H15A 5KGUA 3HKZG 2E5LL 3PCOB 2IX0A 3CPFA 2H5XA 3WOFA 5FJ8H 1B44D 1XNQL 2QGQA 3S1NB 5HGTA 3E3XA 1GUSA 1PFMA 3C1FA 4UAIA 2EPBA 2DNEA 4CKEA 3PUWA 2D0PA 5EGTA 4KV6A 4L5RC 2CWAA 2XNAC 2B39A 4X65L 1L1OC 3MXNB 5C3WA 3FKIH 4OO1I 4R8NA 4IQZA 4RGNA 1MBYA 1TS3A 2K14A 1WTXA 2WINB 3DWAA 2E2HH 3G71A 2R92H 1EQTA 1XPOA 3GTPH 2Q2IA 3GP7A 1YITA 5LMUL 2A8VA 5DAUA 3J7A5 5C3EH 2RSNA 3I4MG 2Z8LA 1E24A 5EBDA 4ME5A 4WRDA 4GKJQ 4A3CH 3PO2H 5C0XJ 5DNFA 1FGBD 2VUMG 4DGZA 1PMRA 4OWXB 5LL6S 2IT1A 3KDFB 4KKSA 4RAUC 4LF4L 3K0YA 4DV1L 3CC2A 1BCPB 1PXUA 4JBWA 2WAQG 1U4RA 2B63B 5M9OA 3A54A 3BZKA 4BS9A 1DGSA 2Z9HA 4GN4B 2RHSB 1TY0A 4IZ8A 3FKIB 1D5MC 1LTAD 1UUPA 1KD1C 4GKKL 1IBKQ 4HMJA 2BE5D 2E2HB 2ZTEA 1V43A 4BA1I 3AEVA 2R92B 3HOWG 4AQYL 1F9PA 1CZWA 3GTPB 2LXJA 4HN7A 3N6RA 3KBXA 4RH6A 5C3EB 1SYGA 4R4QA 3K80C 5ELNA 4KY6A 1U0LA 1HA6A 4MN3A 2MQHA 3SDZA 1BO0A 2VB3X 1MJEA 4ZCKA 1KNAA 3KUPA 1F2MA 4ALPA 1LO5D 1GJXA 1TWGH 2NZ1D 1KLGD 2EY5A 2N3SA 5E1FA 2E5LQ 5IE8A 2PZUA 2UXBL 2H1EA 2KJXA 4ZLTF 5ELCA 2VUMH 1HQMC 2WKCA 1CKOA 1TT2A 4ZUIA 1V1OA 3F2BA 4C56C 1WTRA 3K57A 3CQZH 2F0UA 5CGKA 1NUCA 3MAQA 4CBVA 2EY6A 2NYZD 4CJ1B 2M2LA 4JPBW 1B1ZA 1C7YA 1N8RC 2O4XA 4DK1A 4HJ9A 4X65Q 3IAYA 3A8KE 4GN5A 2D0OA 1M90C 4TKOB 2A69D 2F03A 2RBMA 2DNCA 4LF9L 1EEFD 3GTGB 2LMCB 1B70B 4JI5L 5LMUQ 1RTOA 2L4NA 1GD7A 2GN5A 5JEAG 1PHJA 3DWPA 1Q90A 1EQRA 1E1TA 1QB5D 2EJFC 2K32A 1B4OA 3QOLA 3I70A 1ILPA 2KCNA 2B2TA 3I8ZA 4C1NK 1UEBA 3WOEA 4BBSG 2VUMB 1GXDC 1JWMD 1PYSB 2KECA 4IOCA 3GTOH 4OO1G 4YWKA 5LMNW 4X64L 1KRSA 1J5EL 3G6EA 3CQZB 5CYUA 4DV1Q 3TBIB 1PH9A 1L1OB 1K3RA 3RLNA 4A3KG 1SE3A 4XYQA 3CCEA 1GVPA 1YNNC 2V4DA 2IL8A 4IN3A 4OXPA 4IFDG 3I4NG 1ENAA 3A55A 3K8AA 2XWJB 1ZKOA 4GKKQ 1CUKA 4XDXA 2LKVA 3A8JE 2K52A 5J3BA 3NEMA 1HR0W 5EBCA 3A7AB 4JBKA 3DEOA 2K50A 1N9WA 1H9KA 1SE2A 4AQYQ 3JAME 2F0NA 4DUYL 1X3FA 2GVAA 1DCZA 5JJLA 2MUYA 4A3MG 3Q23A 1F9QA 4X3SA 1TWCH 1HUMA 1LT5D 3K7UC 1D7QA 1EU4A 5E3FA 3CCLA 4JI2L 3SR1A 3Q24A 4FDBA 2CQAA 1IBML 5HGQA 4PZ7A 2B2TC 1VQOA 3NWSA 4JVZA 2UXBQ 2A68D 4AIMA 2EYMA 1E3PA 2TSSA 4IURA 4V0BA 4J15A 3PIPA 5C4ZA 2E74C 3GTMH 2G5DA 4A3EG 1EOTA 3PUXA 2E8GA 4LAAA 4A3KH 3NSWA 5CV8A 1PH5A 3KJOA 4HEDA 3M9BA 1HTLD 5IYCH 1BR9A 1HHVA 5ELOA 3OHXC 5ELEA 1RKNA 3TP6A 3S14B 2R7FA 1FJGQ 4XQJA 3TS0A 1WTWA 1K83H 2JA7H 4EQ5A 4KJOA 4BY1G 4IO9A 4HIMA 1JT8A 4IJLA 2B2UA 2HDMA 4K6LA 1QUQA 4B3SL 2R7ZG 1CT1D 1DOKA 4QCLA 1TWCB 3DWQA 3VYSA 1DOLA 2D5DA 1JWUD 3NUCA 4ID6A 4K2KA 3RZOH 2ZXRA 2SNMA 2F0GA 3FPPA 3QG1A 5COYA 2WP8J 4DNTB 2QF7A 1GUGA 4BBSB 3RLFA 2C5CA 1XJVA 2E2IH 1GUNA 3AQQA 4YWMA 1JOKA 1PH4A 4X64Q 1J5EQ 2JA6G 2UUCL 1IKMA 4A3EH 4A3KB 1Y1VG 4HTHA 1NSNS 2GVBA 3HOYH 4RCNA 3J7YW 2F0FA 5JAVA 3GV6A 3J81E 1IYVA 3I4NB 1EIHA 2L15A 4XT3B 1OO9B 5EPKA 1K83B 1Q46A 5JOBA 2JA7B 4H02A 1MHWC 3B6YA 2CQOA 4O42A 4TRDA 3EQLC 3E9HA 3BJUA 2B2UC 3CP0A 4DU9A 1AP0A 2K01A 4DUYQ 3I55A 1VQIA 4J6HA 1VQ9A 4JK1C 2BH8A 2BDNA 4DXGA 3RZOB 2RA4A
chains in the Genus database with same CATH topology
1LABA 3K58A 2F0VA 3H3VC 1B3AA 3H09A 1T5XD 1IL8A 2E2IB 4C3HG 1JCKB 1PZKD 1BXTA 1I50B 2F0JA 4A3EB 1JOQA 4V190 2SDFA 2F0OA 4EQPA 2EXZA 3HGBA 4IALA 3TZDA 3PV0A 2E2JB 5BN5A 3MXNA 2WV6D 2D2CC 3C46A 3TP7A 3PMFA 5G3LF 2IX1A 1ZEQX 2Z4HA 1FD7D 4XTCS 4FYDA 3MXGA 4ULLA 3NK9A 2CW0C 5J1ZA 1HQRD 2KCCA 2R6GA 4ZK9B 1SEBD 1TS5A 1WTVA 4GZYC 2EYFA 5LHY1 5JPMC 3TN2A 4E6IA 2E76C 4EVOA 4DFAA 1Y1VB 2JE6I 1I4XA 1I4RA 4ZKCB 3MHBA 5EKLA 4KTAA 2LY7A 2GA4B 3VR3A 1G91A 1WVLA 2PW5A 2FHTA 3QO2A 1HRJA 1S5FD 1AFPA 2E2DC 4NDXA 1QE6A 1PZJD 4FXDA 4U673 3BYTB 1CA5A 4AYBB 1AN8A 4C3HB 1PLFA 2KHSA 3Q0AA 4LK1C 1VDZA 1I6HB 5JPNC 5D3DA 1LTSD 4CKBA 4M1UB 5CV5A 1RODA 3SXHA 3I4LA 1BCPC 2NN6G 3S1RB 2A74C 1K8MA 3ZYYX 3V96A 1Q1BA 5C4JB 3R2IA 1ONLA 3T13A 1DONA 1NR4A 1DZ1A 1EEID 4N9TA 4C1NI 3GD7A 2A6HC 1XWEA 2R61A 4H13C 1SFOB 4DA2A 3GTKB 2NVTB 3A8IE 4KJNA 1B50A 1SJHD 3D4RA 1I4PA 2A68C 4ZYSA 1ILQA 5IGEA 3GQBA 1LTTD 5IT9E 2NVQB 3R3OA 3NWTA 3P75A 4O1NA 3R93A 3PIO3 1A3VA 2F3VA 2QDBA 1IW7C 4NP5A 4RCOA 4N9PA 2OXPA 4S3SA 2O2LD 4HMIA 5EPLA 2PZTA 4KY7A 4RWSC 5KRUA 4F87A 2FFKB 1LTBD 4B9WA 3D8GA 3AMUA 2YU9B 4J1MA 4WFN3 3FPUB 1LTGD 2OEOA 4X3UA 2L5TA 3F2UA 5K36H 4ABNA 3SE0A 3H0GB 3ONAB 1D5XC 1BBXC 1VF5C 4I7ZC 2AUKA 2EY1A 2HCIA 2L0CA 1MSHA 3PUZA 1GHKA 2LS01 2EYLA 1JWSD 1LLRD 3SK5A 1PRTF 5ELDA 1F77A 1LT6D 4FF2A 4IFDI 2SOBA 1KAAA 1AEXA 2EDGA 3LWUA 5T1IA 3UI2A 2Q8RE 2XRSD 3EJIA 2FMCA 1HFGA 3NXWA 4KK7A 3W2DA 3TDQA 3T53B 1O7LA 5CV4A 1F9RA 1FNUA 3I91A 5I4DA 3AB9A 3MC0B 5FO7B 3M85A 2EJMA 1RF2D 2K04A 4I65A 1T5EA 2CW0D 3SK6A 4P2CB 3SVMA 4CJ2C 2MHVA 3PO2B 2I46A 1EYCA 1M8AA 2NWGA 4EQNA 1BUVT 1TKWB 4RGTA 1STGA 4X3TA 1A3UA 1DM0B 1BOSA 3QWNA 5NUCA 2K28A 1XTCD 1J8IA 2R3ZA 3CRLC 1SBBB 3MXUA 2YYZA 5T1GA 3KLRA 5I9PA 3ERQA 1K8OA 1STAA 1BNZA 3MZ5A 2ICIA 3BDCA 4H44C 1QNUA 2OT2A 1JOOA 1XX8A 3HOUB 3GV3A 3R8BA 1VCIA 2JA5B 1KDAA 4RGOS 3WDNA 4K14A 1TWGB 1O7ZA 1G2TA 1PDQA 3K5MA 2F0MA 2RDGA 1TWFB 1KNEA 2IW3A 1KDCA 1JC7A 1O78A 3VYTA 3JAML 1QG7A 1BCPD 3NBHA 4MIUA 2F0HA 2F0SA 2IJ0A 3EROA 1X3PA 4F7XA 2K5DA 5FO9B 5C0XH 2M9VA 4XQQA 3NPPA 2VNUD 1LTRD 4ZKBB 2F0QA 1FR3A 2VB2X 4CHTB 3BVGA 3S2HB 2NUCA 4QMGA 1CFMA 2A6HD 1II3A 1Q3LA 5KNDA 2A5HA 4TSSA 4XIGS 5C3XA 1JE4A 1ZXTA 2RQXA 3GTLB 4FP5D 1KTKA 1NCVA 2G9DA 4ODGA 3GTOB 2F3WA 2QILA 5DM73 1PYWD 1I4HA 4H0LC 4DAYA 4IUQA 4DK0A 1HFNA 3J80E 2RDHA 5IODA 1U4LA 3FVQA 1KDBA 1BDOA 3OMGA 2NB0A 1WCMB 3OSOA 1IW7D 1OXXK 4G7ZC 1GUTA 1TU2B 3K6OA 4UDUC 5J22A 2PMZB 4PQXA 2NBFA 3GO5A 4B9XA 2M00A 3BVZA 3KF8A 1IHZA 1BF4A 3J81L 2F0IA 3IKJA 1G291 1TIID 4FF1A 1OXVA 3M4YA 1B9MA 3DMUA 3GTMB 1O80A 5CR3A 1EY4A 3IFDA 3D31A 1AW7A 5FOBB 1EZ8A 4A3GB 1EZ6A 2L12A 1TR5A 3VR2A 4DXFA 2NTSA 4PMCA 3P1HA 5FLXE 2K6AA 5IGDA 4KD3A 2G9HD 4C2MB 1A6XA 2RSOA 1SYEA 5FK9C 4IUTA 2IWHA 4G57A 1V1PA 1EY8A 2NN6I 4OIJA 2KQ3A 3NHHA 5C4HA 2EJGC 1EU3A 3SHLA 3EVQA 1EY5A 2H4OA 1ZYRC 4ZRZA 4H7BA 5A2QL 1D5ZC 3H91A 1EY6A 2WB1B 1RTNA 1CI3M 2BOSA 4DAVA 1WTQA 3PIP3 3T16A 4IUUA 3VA5A 3OWFA 1PTOF 1R4PB 1HPCA 1HA5A 3HOYB 3BG3A 2F0WA 3OIPA 2EY2A 4NMZA 3DM1A 1J9OA 2PNRC 3QB3A 1A2UA 1ET6A 2Z1CA 3S17B 1ESFA 1PRTC 4HAEA 3M7GA 2EZVA 3HS0C 1F2ZA 4RHRA 3OIQA 3DEPA 3FRPB 4Q5VA 2J4XA 2F4IA 3KK7A 2D62A 1Q12A 2JEAI 2X6LA 3S9WA 1A15A 3AU7A 4XXEA 3ND8A 1E2WA 3K5NA 2OF1A 3G6JB 3VR4A 2A6EC 4K2LA 1B2TA 3LNNA 1NAPA 1VMCA 4BBRB 3X3MA 1QJOA 2B8GA 2ENBA 1MD2D 5CV9A 3S1QB 3C1EA 5G3LD 3U9SA 1KLUD 1SMYC 5KYIA 1JB3A 4LJZC 1HCZA 2NVYB 3PUVA 1RD9D 1LV9A 2KA7A 1WTPA 2RVLA 3H94A 3C2PA 2DY7A 4KMUC 1RCVD 5HURA 2AQ3B 4WORA 2IPKD 3L9AX 4A3FB 2JEBI 3SEBA 2K33A 4F88A 4KHVA 1BQQT 3EFXD 3BZDB 1GUWA 1SDFA 2XRQD 4KHZA 4EQOA 3X3NA 2Q8IB 4FO2A 5C5LA 2K5QA 2F0LA 3RZDB 1EWHA 1TQOA 4LMQD 4G7HC 2F0KA 2F0DA 1SXTA 1EIGA 3TZUA 5BN3A 3O13A 2J7ZA 5IT9L 3VYRA 3A56A 3R2TA 4HCSA 2NVXB 1OXSC 3DHQA 5K36G 1EY7A 5CBAE 5KYLA 4Y7NB 2X6GA 3NTIA 1X3QA 1A3TA 4DNRB 2L9HA 2KVMA 1F2LA 4FNFA 5EKIA 1PRTB 1WD1A 4YIJA 2F0EA 4K5WA 1L0YB 3VR6A 1UEAB 2TMPA 3D6WA 3MVVA 1V1PB 2NTTA 5JVG3 4A3DB 2PCFB 2KOLA 1SSOA 4DAPA 2A73B 1DD2A 5C0XI 2RDFA 4ILWA 4U68A 4DF7A 5DEHA 3NTHA 2JA8B 3D6CA 1EYDA 3FDTA 4K6DA 4X3KA 5M3FB 2MPMA 2KEEA 3OW7A 2ZXOA 3BS1A 3BYYB 3M4OB 3I73A 4OL7A 1MI2A 1Y8PB 3W3AA 2RKSA 4XYOA 1TWAB 1SNQA 1Y1WB 1GUOA 1F2YA 3Q22A 4EGVA 2R93B 3HOZB 4NW2A 1LTID 5KEEA 3T4AC 4IUPA 2XVSA 1VMPA 1STYA 1WD0A 1ZYRD 1Y8NB 3QJYA 1UAPA 3S15B 4C3IB 4XQNA 4L63B 2CVRA 3NE5B 4HCEA 4RHSA 5EQ0A 1H9MA 3E0JA 4K8JA 1V8QA 2VXWA 5I6WA 5CMDA 3HG9A 4PMWA 1SYFA 3HP3A 5C6AA 2F0TA 4XT1B 4MHEA 1Z6HA 1PRTD 1M4VA 3K59A 1JR0D 4A3JB 3HOXB 2EOTA 5M5YB 4C3JG 4OIKA 2HDLA 5E4XA 2AWNA 2Y0SB 3GTQB 1HTPA 2AQ2B 1HUNA 2HQEA 1I3QB 5JEAJ 4PV1C 1DJRD 2LFNA 5JVH3 2J0TD 3D3RA 1CA6A 3L7ZC 1JORA 1WTOA 3D4WA 3K5OA 1PTOC 2A6ED 4J8QA 3QIAA 1RDPD 3H6MA 5EKKA 1MGSA 2IX3A 1E2VA 1ENCA 5I2YA 5CBEE 2C9OA 1NR2A 4KY5A 4IFDJ 1QNKA 3ITPA 3HKZB 2O5IC 1FNVA 1SMYD 5C0XG 1QILA 2DY8A 3OMCA 1MSGA 2AUJD 1IKLA 3URYA 1H9SA 1Y8OB 3K7AB 3S16B 5IGFA 3HRZC 3G7LA 3DXJC 2Q8TA 1CQFA 2BDOA 4KD4A 1LACA 2D9UA 1LT4D 1BCPF 2XN9C 1XXGA 2EYJA 2MGSA 1SNMA 1L0XB 3NP8A 1EL0A 1JQYD 3I4MB 2ZXPA 4PMBA 2KUMA 4FF3A 3E5SA 2K5WA 2PZWA 1STNA 5M5XB 1YNJC 1VF7A 5FO8B 1I4GA 5C5MA 2ICEC 4C3JB 1CTMA 4QIWB 1OXUA 3FMCA 5I6YA 2EE1A 4RA8A 3CKIB 3I90A 2WAQB 4R8IA 2JYOA 1Z47A 2WKDA 3HZXA 3BDLA 3J80L 5KNBA 1EY9A 3I3CA 4F8MA 5C4XB 3VYUA 1X32A 2EYHA 5EPJA 3K5LA 3J7AF 2JP1A 1PTOH 3FEWX 1TWHB 5KIXA 3NQIA 3HOWB 5ISRA 1A2TA 4HSVA 2MP1A 4M8AA 2L1BA 2SEBD 2B2WA 1OXTA 2FINB 5JEAH 1EFID 5IGBA 1SYDA 1G6ZA 1RHPA 4HSPA 4IUVA 2HUGA 1W6JA 1EQVA 1O7YA 1STEA 2BA1A 2PO4A 1AZQA 4BWGB 4OO1H 3KLSA 1CZGA 5J39A 2ZT9C 4RFBA 4A93B 1C8CA 3HOVB 2I07B 1CQVA 3VA7A 1SNOA 3PUYA 2BA0A 4IFDH 4ZAIA 3S2DB 1PTOB 5KNCA 1AZPA 2X69A 3NQTA 5D3IB 3NBIA 1H9RA 2QKIC 5FLXL 1PFNA 1SYCA 4OGQC 1U4PA 3MEHA 3C3LA 3IFTA 5DM63 2B2WC 1HXYD 2B8FA 1U9RA 1E2ZA 2JXMB 4ZUJA 3I72A 2XIWA 3V05A 3KLSX 5BN4A 4G4KA 5CV6A 3MTSA 2HCCA 5CORA 3LWEA 2QEJC 1H9JA 2F1MA 1UNSA 4FXKC 1U4MA 2K05A 1EWCA 4CJ0B 4IUNA 3CRKC 1SAPA 4KKTA 2XSCA 1W6KA 3J7AV 2PQEA 1G8ZD 5ELFA 1FYCA 1CHQD 2BCOA 3T56B 5F2DA 3CU7A 2B2VA 4A3MB 2PPBC 3EA6A 2KEDA 1TS2A 3SK8A 3OPOA 1TY2A 4G7OC 1S5DD 1ICWA 5CV7A 4BA2I 1SNDA 2DN8A 1H9SB 2Z4IA 3V2TA 3PO3B 1DYQA 5TSSA 1I4QA 2WIIB 1EYAA 3TP5A 5E4WC 3P7JA 2F0PA 3NTKA 1D2BA 4L8JA 1F9SA 1SNCA 1ESRA 5CC4A 1QCBD 1ET9A 1FNWA 5I9OA 1G2SA 2E75C 1Z7TA 2AWOA 3MFGA 4WJWA 1PFBA 4QUCA 1Q1EA 1C4QA 5A2QE 5I2XA 1PTOD 3OWEB 1KABA 3T51B 3QOJA 4BY1B 2N88A 4RGMA 1TVXA 2WACA 2BE5C 2R7ZB 2B2VC 1QWYA 4L6TB 4KI0A 1DOMA 4B08A 3MXPA 1D1KA 1ML0D 3RD4A 2JSOA 3MFYA 3M7NA 2AQ1B 5LL6X 5A35A 5ELBA 3OOCA 1S5BD 2JA6B 1LT3D 3M3YB 3S1MB 1CM9A 4CKCA 1SNPA 2K7VA 3A7LA 1Q8IA 3BVMA 4K8IA 2ID0A 3Q6SA 4Z9CB 4K5VA 4TQUS 3IL8A 2XWBB 4QB4A 1GHJA 2EYPA 2FJ2A 2A69C 3N52A 3P20A 1E0BA 4PNYA 1RJTA 4KN7C 1XYIA 1YNJD 1R9TB 3RUZA 5K5PA 2FMMA 3MWYW 1CHPD 3E6ZX 1ENFA 2EYOA 4DN4M 3L3OC 4HR7B 3KBGA 1R4QB 5IGGA 4QUFA 3MA2B 1CK1A 5IIFA 4R9WA 3TMEA 4FXGC 1DXMA 5C44B 1YNND 4RKBA 2B2YA 1B53A 3TP8A 3GTJB 3VR5A 4CGYB 3RMHA 1IYUA 2N55A 5FKAC 2K03A 4C3IG 1S4ZA 4QF4A 2L55A 2MJ8A 2PW7A 4A3IB 2O5JC 3SK4A 5M5WB 5IGCA 1STHA 4RKLA 3TSSA 3DUZA 1S5ED 1SE4A 1TS4A 3HEJA 5EJWA 3LX0A 2QCPX 5D65A 1EY0A 4NKLA 4K5XA 1PZID 2B2YC 4OHJA 1D1IA 5IOCA 4FF4A 3BDOA 2EVBA 1B9NA 5AFWA 2CHBD 2NN6H 2K1BA 1I6VC 5D14A 3D4DA 4ZQ3A 5M3MB 3CHBD 1Y69U 3U9OA 4KN4C 4BY7B 1SYBA 1SJED 4FVMA 1D6EC 1S5CD 2L11A 1GOZA 1JICA 4Q0FA 4KKUA 1C48A 1STBA 3ND9A 2PYKA 1QOHA 2SNSA 4A3BB 5JJZA 5KGUA 2IX0A 3WOFA 1B44D 3S1NB 5HGTA 1GUSA 1PFMA 3C1FA 4UAIA 2EPBA 2DNEA 4CKEA 3PUWA 5EGTA 4KV6A 2XNAC 2B39A 5C3WA 4OO1I 4R8NA 4IQZA 4RGNA 1MBYA 1TS3A 1WTXA 2WINB 3DWAA 1EQTA 3GP7A 5DAUA 2RSNA 2Z8LA 5EBDA 4ME5A 4WRDA 5C0XJ 5DNFA 1FGBD 4DGZA 1PMRA 5LL6S 2IT1A 4KKSA 4RAUC 3K0YA 1BCPB 1PXUA 4JBWA 1U4RA 2B63B 5M9OA 3A54A 4BS9A 1TY0A 4IZ8A 3FKIB 1D5MC 1LTAD 1UUPA 4HMJA 2BE5D 2E2HB 4BA1I 1V43A 2R92B 1F9PA 1CZWA 3GTPB 4HN7A 3N6RA 3KBXA 4RH6A 5C3EB 1SYGA 4KY6A 1HA6A 4MN3A 3SDZA 1BO0A 2VB3X 1KNAA 3KUPA 1F2MA 1LO5D 1GJXA 2NZ1D 1KLGD 2EY5A 5E1FA 2PZUA 2H1EA 2KJXA 4ZLTF 5ELCA 1HQMC 2WKCA 4ZUIA 1TT2A 1V1OA 4C56C 1WTRA 3K57A 2F0UA 5CGKA 1NUCA 3MAQA 4CBVA 2EY6A 2NYZD 4CJ1B 2M2LA 1B1ZA 2O4XA 4DK1A 3IAYA 3A8KE 4TKOB 2A69D 2F03A 2RBMA 2DNCA 1EEFD 3GTGB 2LMCB 1RTOA 2L4NA 5JEAG 3DWPA 1Q90A 1QB5D 2EJFC 2K32A 1B4OA 3QOLA 3I70A 1ILPA 2KCNA 2B2TA 3I8ZA 4C1NK 3WOEA 2VUMB 1GXDC 1JWMD 2KECA 4OO1G 3CQZB 5CYUA 3TBIB 1SE3A 4XYQA 1YNNC 2V4DA 2IL8A 4IN3A 4IFDG 1ENAA 3A55A 2XWJB 1ZKOA 4XDXA 2LKVA 3A8JE 5EBCA 3A7AB 3DEOA 1H9KA 1SE2A 3JAME 2F0NA 1DCZA 2MUYA 3Q23A 1F9QA 4X3SA 1HUMA 1LT5D 1EU4A 5E3FA 3SR1A 3Q24A 2CQAA 2B2TC 3NWSA 2A68D 2EYMA 2TSSA 4IURA 4V0BA 5C4ZA 2E74C 1EOTA 3PUXA 4LAAA 3NSWA 5CV8A 4HEDA 1HTLD 1BR9A 1HHVA 3OHXC 5ELEA 1RKNA 3TP6A 3S14B 4XQJA 1WTWA 4KJOA 2B2UA 2HDMA 4K6LA 1CT1D 1DOKA 4QCLA 1TWCB 3DWQA 3VYSA 1DOLA 2D5DA 1JWUD 3NUCA 4ID6A 4K2KA 2ZXRA 2SNMA 2F0GA 3FPPA 3QG1A 5COYA 2WP8J 4DNTB 2QF7A 1GUGA 4BBSB 3RLFA 2C5CA 1GUNA 1JOKA 1IKMA 4A3KB 4HTHA 1NSNS 4RCNA 3J7YW 2F0FA 5JAVA 3GV6A 3J81E 1IYVA 3I4NB 1EIHA 4XT3B 1OO9B 5EPKA 1K83B 5JOBA 2JA7B 4O42A 4TRDA 3EQLC 2B2UC 1AP0A 4DU9A 2K01A 4J6HA 4JK1C 2BDNA 4DXGA 3RZOB 2RA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EPL A;  1G2S A;  2B2T C;  1B2T A;  1X3Q A;  4ZKB B;  1PFM A;  4RWS C;  1AZP A;  1NAP A;  2X69 A;  1VMC A;  2MGS A;  2FFK B;  4UAI A;  1B3A A;  2EPB A;  2VXW A;  1WTR A;  1QE6 A;  1PFB A;  2K04 A;  2L9H A;  4QUC A;  2KVM A;  5CMD A;  1EL0 A;  1IL8 A;  1F2L A;  2N55 A;  1PFN A;  2NYZ D;  4IUR A;  3HP3 A;  5EKI A;  3FPU B;  4CJ1 B;  2M2L A;  1U4P A;  1WD1 A;  1CA5 A;  2K03 A;  1EOT A;  2KUM A;  3SVM A;  2RSO A;  2B2W C;  4CJ2 C;  2N88 A;  4IUT A;  4X3U A;  1S4Z A;  3D6W A;  3F2U A;  1TVX A;  4XT1 B;  1PLF A;  2MJ8 A;  4MHE A;  1M8A A;  2NWG A;  1Q3L A;  4HED A;  2B2V C;  2EOT A;  1WTX A;  1HHV A;  4OIJ A;  1LV9 A;  4X3T A;  1EQT A;  3ONA B;  4OIK A;  2HDL A;  5E4X A;  2XIW A;  1JE4 A;  1ZXT A;  2SDF A;  1BBX C;  2KOL A;  1DOM A;  1SSO A;  1NCV A;  2RSN A;  1ML0 D;  1WTP A;  1WTW A;  1ROD A;  2RVL A;  2HCC A;  3MTS A;  2DY7 A;  5COR A;  3LWE A;  2EE1 A;  4RA8 A;  1G2T A;  1HUN A;  3I90 A;  1RTO A;  2L4N A;  3TZD A;  4U68 A;  2K28 A;  4R8I A;  2HCI A;  2JYO A;  3H91 A;  4IUQ A;  2B2U A;  1HFN A;  2HDM A;  1MSH A;  1RTN A;  1U4L A;  5EJW A;  1WTQ A;  1J8I A;  1DOK A;  3I3C A;  2R3Z A;  1U4M A;  2K05 A;  3FDT A;  4X3K A;  1CM9 A;  2MPM A;  4IUU A;  5D65 A;  5DNF A;  1DOL A;  1B4O A;  2KEE A;  1X32 A;  4CJ0 B;  1CA6 A;  5EPJ A;  1WTO A;  1ILP A;  2B2T A;  2B2Y C;  3I8Z A;  1SAP A;  4RAU C;  5T1G A;  2JP1 A;  3DM1 A;  5COY A;  2KEC A;  1DON A;  1BNZ A;  1NR4 A;  1GUW A;  1DZ1 A;  1J9O A;  5AFW A;  3Q6S A;  1SDF A;  4HSV A;  4ZK9 B;  1MI2 A;  1U4R A;  2MP1 A;  1MGS A;  2L1B A;  3IL8 A;  5CBE E;  1WTV A;  2B2W A;  1NR2 A;  1XX8 A;  2K1B A;  1IKM A;  3TN2 A;  4HAE A;  2FIN B;  3GV3 A;  5D14 A;  2FJ2 A;  1QNK A;  2IL8 A;  2B2V A;  5T1I A;  1G6Z A;  3UI2 A;  1RHP A;  3N52 A;  3DEP A;  4IUV A;  1E0B A;  2KED A;  2HUG A;  2Q8R E;  1RJT A;  1O7Z A;  4LMQ D;  1ICW A;  1B50 A;  3GV6 A;  1PDQ A;  1HFG A;  1O7Y A;  2L11 A;  1XYI A;  1BF4 A;  2DY8 A;  4XDX A;  1F9P A;  1EIH A;  1MSG A;  4NW2 A;  1JIC A;  4XT3 B;  1ILQ A;  1AZQ A;  1EIG A;  1IKL A;  2FMM A;  3KBX A;  4ZKC B;  3DEO A;  3MWY W;  5EPK A;  4IUP A;  2X6L A;  1KNE A;  4DN4 M;  1VMP A;  2J7Z A;  4HCS A;  1A15 A;  1F9R A;  1HA6 A;  1G91 A;  3G7L A;  4O42 A;  4MN3 A;  1QG7 A;  4QUF A;  3R93 A;  5JJZ A;  1BO0 A;  2Q8T A;  1O80 A;  1WD0 A;  5E4W C;  1F9Q A;  4R9W A;  4X3S A;  5CBA E;  1WVL A;  2B2U C;  1C8C A;  1AP0 A;  1KNA A;  2CVR A;  2K01 A;  3IFD A;  3KUP A;  1HUM A;  3P7J A;  5EQ0 A;  3I91 A;  2FHT A;  2NZ1 D;  2B2Y A;  1X3P A;  2D9U A;  1F9S A;  3QO2 A;  2L12 A;  1ESR A;  2X6G A;  1HRJ A;  2H1E A;  2BDN A;  4ZLT F;  1B53 A;  4ZAI A;  2RA4 A; 
#chains in the Genus database with same CATH topology
 1LAB A;  2OTJ A;  3K58 A;  2F0V A;  3H3V C;  1B3A A;  1IBM Q;  3H09 A;  1T5X D;  4DV3 Q;  5IWA L;  1IL8 A;  1P16 A;  1VQC A;  2E2I B;  3M4P A;  4C3H G;  5EAY A;  1JCK B;  1PZK D;  1BXT A;  1HJP A;  1I50 B;  1VQK A;  5C44 G;  2F0J A;  1RL2 A;  4LFB Q;  2MNA A;  3A0J A;  2XTI A;  4A3E B;  1JOQ A;  1XMQ L;  4V19 0;  1NE3 A;  2HQL A;  3AFQ A;  4JCV E;  1K0R A;  2SDF A;  2F0O A;  4EQP A;  2EXZ A;  3HGB A;  4IAL A;  4DV5 L;  3TZD A;  3PV0 A;  2E2J B;  3OTO L;  5BN5 A;  3MXN A;  1WYD A;  3L0O A;  2WV6 D;  2D2C C;  3C46 A;  4DR7 L;  1E1O A;  4B3S Q;  1AH9 A;  3TP7 A;  3PMF A;  5G3L F;  3K81 C;  2IX1 A;  1ZEQ X;  2Z4H A;  2RHQ B;  1FD7 D;  4AH6 A;  1VQJ A;  4XTC S;  4FYD A;  1NTG A;  1NJI C;  3MXG A;  4ULL A;  2UXD L;  3NK9 A;  2OWO A;  2CW0 C;  4LF8 L;  5J1Z A;  1UE5 A;  1VQE A;  1HQR D;  2KCC A;  2R6G A;  4ZK9 B;  1SEB D;  1JB7 A;  4POF A;  3CCR A;  1TS5 A;  1WTV A;  4GZY C;  1KL9 A;  3NBH B;  2EYF A;  5LHY 1;  5JPM C;  3TN2 A;  4E6I A;  3CCJ A;  2E76 C;  1BVS A;  2UUC Q;  3EN2 A;  4EVO A;  4DFA A;  4GLX A;  1Y1V B;  2JE6 I;  1XPU A;  4QQB X;  1I6H H;  3J81 c;  1I4X A;  1GO3 E;  3KDF A;  2Z6B A;  1BKB A;  1I4R A;  2K5V A;  2K5H A;  2DUD A;  4ZKC B;  3MHB A;  3S1R H;  4CDF C;  5EKL A;  4KTA A;  2LY7 A;  2GA4 B;  3VR3 A;  1G91 A;  5M3M G;  4BY7 G;  1WVL A;  2JJQ A;  2PW5 A;  1HH2 P;  5C4J H;  2FHT A;  3T1Y L;  3QO2 A;  1HRJ A;  1QVC A;  1S5F D;  1AFP A;  1X56 A;  2E2D C;  4NDX A;  1QE6 A;  1PZJ D;  4FXD A;  2ASB A;  4A3B G;  4KHP L;  4OEL B;  4U67 3;  3BYT B;  4CDE C;  1CA5 A;  4JI3 L;  5IWA Q;  4AYB B;  1AN8 A;  4C3H B;  2NVT H;  3GTK H;  1PLF A;  2KHS A;  4Y7N H;  3CW2 C;  3Q0A A;  4LK1 C;  1VDZ A;  1I6H B;  5JPN C;  5D3D A;  1XMQ Q;  1LTS D;  4CKB A;  4M1U B;  1P8L A;  5CV5 A;  1ROD A;  3SXH A;  2NVQ H;  3I4L A;  1BCP C;  2NN6 G;  3S1R B;  1EYG A;  4BXX G;  4X6A H;  2A74 C;  1K8M A;  3ZYY X;  4DV5 Q;  3V96 A;  1Q1B A;  2JK8 A;  3W5O A;  5C4J B;  3R2I A;  4DR7 Q;  4HIO A;  3VDY A;  1VQN A;  1ONL A;  3T13 A;  1DON A;  1NR4 A;  1DZ1 A;  3F1Z A;  5BR8 L;  1KAW A;  1EEI D;  4N9T A;  4C1N I;  3GD7 A;  2A6H C;  4LF8 Q;  1XWE A;  1ASZ A;  2R61 A;  4H13 C;  1Q81 C;  5M3F H;  3PF4 A;  1SFO B;  3UDX A;  2PNH A;  1S3O A;  4DA2 A;  3GTK B;  2NVT B;  3A8I E;  4QJF A;  1NMG A;  5FJ8 G;  2PQA B;  3U50 C;  4DR2 L;  3H0G H;  4DNI A;  4KJN A;  1VQD A;  1B50 A;  1SJH D;  1L0W A;  3D4R A;  1I4P A;  2A68 C;  4ZYS A;  1X65 A;  1ILQ A;  1W2B A;  5IGE A;  3GQB A;  1LTT D;  1WOC A;  5IT9 E;  2NVQ B;  3R3O A;  3TRZ A;  3NWT A;  3P75 A;  3CCV A;  4O1N A;  4TVA B;  1SRO A;  3FKI G;  3R93 A;  3PIO 3;  3A5Z B;  1A3V A;  2F3V A;  1Y1W H;  1IBK L;  2QDB A;  1IW7 C;  4NP5 A;  4RCO A;  4N9P A;  2R93 H;  2OXP A;  4S3S A;  3HOZ H;  2O2L D;  4DKA C;  4HMI A;  5EPL A;  3ZJY C;  2PZT A;  4LF5 L;  5C3E G;  4KY7 A;  4RWS C;  5KRU A;  4F87 A;  2FFK B;  1LTB D;  3M4Q A;  4B9W A;  4JI8 Q;  3D8G A;  3AMU A;  2YU9 B;  4J1M A;  4WFN 3;  3FPU B;  4A3C G;  1LTG D;  3PO2 G;  2OEO A;  4X3U A;  4KHP Q;  2L5T A;  3F2U A;  5K36 H;  2I0Q A;  4JI3 Q;  4LFA L;  4ABN A;  4LUO A;  1I5F A;  4GN3 B;  3SE0 A;  1ASY A;  2I5L X;  3H0G B;  3ONA B;  5DLQ E;  1D5X C;  1BBX C;  1VF5 C;  4I7Z C;  4N8F A;  2AUK A;  2EY1 A;  2HIX A;  2HCI A;  1VQ6 A;  2L0C A;  2UU9 L;  1MSH A;  4EX5 A;  4R4O A;  3STB C;  4A3J H;  3PUZ A;  5M5Y H;  1GHK A;  2LS0 1;  1YNX A;  4DR1 Q;  2EYL A;  1JWS D;  1Q82 C;  1JJG A;  3GTQ H;  1LLR D;  3SK5 A;  1PRT F;  5ELD A;  5IP9 H;  1F77 A;  1LT6 D;  1RIP A;  1I3Q H;  5GAG C;  4JBM A;  4FF2 A;  4JI0 L;  4IFD I;  1I94 L;  1SR3 A;  2SOB A;  3HOU G;  5BR8 Q;  2JA5 G;  2N78 A;  1KAA A;  1AEX A;  2EDG A;  3LWU A;  3W1B A;  5T1I A;  1HZA A;  3UI2 A;  2A19 A;  3ERS X;  3AYH B;  2Q8R E;  1FGU A;  2XRS D;  3EJI A;  2FMC A;  3WWV A;  1HFG A;  3NXW A;  4KK7 A;  3W2D A;  3TDQ A;  4DR2 Q;  3T53 B;  2VW9 A;  1AE3 A;  1O7L A;  1SN8 A;  5IT9 c;  1TXY A;  5CV4 A;  1F9R A;  1SE8 A;  1VQP A;  4JW0 A;  1X54 A;  2QEX A;  2QA4 A;  1FNU A;  2VS1 A;  3I91 A;  5I4D A;  3AB9 A;  3TS2 A;  1B8A A;  3MC0 B;  3K0X A;  5FO7 B;  3M85 A;  2EJM A;  1KIX A;  1RF2 D;  1N36 Q;  2MFI A;  4LWC A;  2HIV A;  2K04 A;  4I65 A;  1T5E A;  4LF5 Q;  1YBY A;  2CW0 D;  1N32 L;  3SK6 A;  4YCV A;  2LSS A;  4P2C B;  3HOU H;  3SVM A;  4CJ2 C;  2MHV A;  2JA5 H;  3A74 A;  3PO2 B;  2I46 A;  1EYC A;  1M8A A;  2NWG A;  4NXM Q;  4EQN A;  1BUV T;  1X6O A;  1TKW B;  3PSI A;  4RGT A;  1PFS A;  1STG A;  5GAD C;  4X3T A;  3E0E A;  4A75 A;  1A3U A;  4LFA Q;  1DM0 B;  3U4Z A;  1TWF H;  2MO0 A;  1BOS A;  1VQA A;  4GLV B;  4MTK A;  3QWN A;  5NUC A;  4LUV A;  1HZC A;  1S72 A;  2K28 A;  1XTC D;  4AYB E;  1J8I A;  1WCM G;  2UU9 Q;  1ICF B;  2R3Z A;  3CRL C;  1SBB B;  3RR5 A;  1WTH A;  3MXU A;  2YYZ A;  1FJG L;  5T1G A;  3J7Z C;  1PA6 A;  3KLR A;  5I9P A;  3ERQ A;  1K8O A;  1STA A;  1BNZ A;  3MZ5 A;  5L37 A;  3S2H H;  2ICI A;  3BDC A;  1QVG A;  2ZJQ A;  2F4V L;  4DR6 L;  4H44 C;  1QNU A;  2OT2 A;  1JOO A;  1XX8 A;  4JI0 Q;  4DV0 Q;  3HOU B;  3GV3 A;  1EIF A;  1I94 Q;  3R8B A;  1VCI A;  1EIY B;  2JA5 B;  3UE1 A;  1KDA A;  1SMX A;  1D8L A;  4LNQ A;  1K73 C;  4RGO S;  3WDN A;  4K14 A;  1TWG B;  1MKH A;  1O7Z A;  1G2T A;  3I56 A;  1PDQ A;  3K5M A;  4LF7 Q;  4P72 A;  3GTL H;  2F0M A;  4GNX A;  2RDG A;  4JI4 Q;  1TWF B;  1KNE A;  2IW3 A;  1KDC A;  1JC7 A;  1O78 A;  3VYT A;  2Q2U A;  4DAM A;  1K3B C;  3PGZ A;  3JAM L;  1QG7 A;  1BCP D;  3NBH A;  4MIU A;  1XTD A;  2F0H A;  1B3Q A;  3RN5 A;  2F0S A;  5IYC G;  2IJ0 A;  3ERO A;  4OON A;  1WCM H;  1X3P A;  4F7X A;  2K5D A;  5FO9 B;  5C0X H;  2M9V A;  3NPP A;  4XQQ A;  2KEN A;  2VQE L;  2R7D A;  2VNU D;  1LTR D;  4ZKB B;  3NEL A;  2F0Q A;  1KC8 C;  1FR3 A;  2VB2 X;  2JA7 G;  4CHT B;  3BVG A;  3S2H B;  2NUC A;  4QMG A;  2KBN A;  5IY0 A;  1XNR L;  4A93 H;  4DUZ L;  3HOV H;  2FXQ A;  2QDL A;  4UP8 A;  1CFM A;  2A6H D;  4R4T A;  1N32 Q;  2HT1 A;  3AFP A;  2VQF L;  2ZM6 L;  1II3 A;  1Q3L A;  4ME3 A;  5KND A;  1O7I A;  2A5H A;  4TSS A;  4XIG S;  3G4S A;  3D0F A;  1KHI A;  5C3X A;  1LTL A;  4HJA A;  1JE4 A;  1ZXT A;  2RQX A;  3GTL B;  4FP5 D;  4DV3 L;  1KTK A;  1NCV A;  2G9D A;  4ODG A;  4GNX C;  2F3W A;  3GTO B;  2QIL A;  5DM7 3;  1PYW D;  3H3V I;  3LGJ A;  4MTN A;  1I4H A;  4DV7 L;  4H0L C;  4DAY A;  4LFB L;  4IUQ A;  4DK0 A;  2K75 A;  1HFN A;  5LMN L;  4JOI A;  3J80 E;  2RDH A;  5IOD A;  2YTX A;  1U4L A;  3FVQ A;  1KDB A;  4A3L H;  1K0S A;  1BDO A;  4A3G H;  3MEF A;  3OMG A;  3HOY G;  1VQM A;  2NB0 A;  1WCM B;  3RNU A;  3OSO A;  1IW7 D;  1VQH A;  1OXX K;  4G7Z C;  4A4I A;  1GUT A;  1TU2 B;  3K6O A;  2RCN A;  3I7F A;  4UDU C;  5IYD H;  4DR4 L;  4C2M H;  5J22 A;  1QZG A;  2PMZ B;  2F4V Q;  4DR6 Q;  4PQX A;  4JV5 L;  3PQI A;  2NBF A;  2N49 A;  3GO5 A;  4B9X A;  2M00 A;  3BVZ A;  1JMC A;  3KF8 A;  1IHZ A;  1V9P A;  1BF4 A;  3J81 L;  4JI6 Q;  2F0I A;  3IKJ A;  2Z0S A;  3L2P A;  1UE6 A;  1YVC A;  1NBW A;  3TRE A;  3ICE A;  1G29 1;  1TII D;  4FF1 A;  2BH2 A;  1OXV A;  3M4Y A;  1B9M A;  3DMU A;  4B3M Q;  1O80 A;  3GTM B;  5CR3 A;  1EY4 A;  4JOI C;  3IFD A;  3D31 A;  1AW7 A;  5FOB B;  1EZ8 A;  4GOP B;  4A3G B;  3STB D;  1EZ6 A;  2L12 A;  4NB3 A;  2PQA A;  1TR5 A;  2EQS A;  3VR2 A;  4CDD C;  4DXF A;  3JAM i;  1PH6 A;  2NTS A;  2Q2T A;  4PMC A;  3P1H A;  2VQE Q;  5FLX E;  2K6A A;  5IGD A;  4KD3 A;  3PO3 H;  4QY7 A;  5E7N A;  3S17 H;  3JAM c;  2G9H D;  4C2M B;  1A6X A;  1X9N A;  2RSO A;  1SYE A;  1PVO A;  2VL6 A;  5FK9 C;  4IUT A;  1XNR Q;  4G57 A;  2IWH A;  1VS0 A;  1V1P A;  4DUZ Q;  1N34 L;  2CH4 W;  1PH7 A;  1EY8 A;  2NN6 I;  4OIJ A;  3F8T A;  2VQF Q;  2KQ3 A;  2ZM6 Q;  3NHH A;  5C4H A;  2EJG C;  1EU3 A;  3SHL A;  2ZJR A;  3EVQ A;  4X62 L;  1EY5 A;  2H4O A;  1ZYR C;  4ZRZ A;  4H7B A;  4AYB G;  5A2Q L;  1D5Z C;  4L5S A;  3GDE A;  3H91 A;  1EY6 A;  2WB1 B;  1RTN A;  1CI3 M;  2BOS A;  4DAV A;  4DV7 Q;  2NZO A;  1WTQ A;  3CD6 A;  3PIP 3;  3T16 A;  4IUU A;  3VA5 A;  5LMN Q;  3OWF A;  1PTO F;  1R4P B;  1HPC A;  1HA5 A;  1PYB A;  3HOY B;  3BG3 A;  2F0W A;  3OIP A;  4UHV A;  2EY2 A;  4NMZ A;  3DM1 A;  4BBR H;  1PH8 A;  1VQL A;  1J9O A;  2PNR C;  3S1Q H;  1Y14 B;  3QB3 A;  1A2U A;  1ET6 A;  2Z1C A;  1HNZ L;  1K28 A;  1KRT A;  3S17 B;  1X3E A;  4YWL A;  1VQ4 A;  1ESF A;  1PRT C;  4HAE A;  3M3Y H;  3M7G A;  2EZV A;  4DR4 Q;  3HS0 C;  2NVY H;  1HR0 Q;  1F2Z A;  4RHR A;  3OIQ A;  3DEP A;  3FRP B;  4LFC Q;  4JV5 Q;  4WJ4 A;  4Q5V A;  1J6Q A;  2J4X A;  2F4I A;  3KK7 A;  4GNX B;  2D62 A;  4NXN Q;  1Q12 A;  2JEA I;  1EUJ A;  2X6L A;  3RN2 A;  3S9W A;  4DK3 C;  1A15 A;  4A3F H;  3AU7 A;  1B7Y B;  3J81 i;  4IPH A;  4XXE A;  2K4K A;  3ND8 A;  4R4I A;  1E2W A;  3K5N A;  3E9I A;  2OF1 A;  2ZJP A;  3G6J B;  3VR4 A;  5IYB H;  2A6E C;  5GAH C;  4K2L A;  1B2T A;  3LNN A;  1NAP A;  1VMC A;  5FLX c;  4BBR B;  3X3M A;  1K8G A;  1QJO A;  1G6P A;  1EFW A;  2B8G A;  1U5K A;  2ENB A;  4L5T A;  1MD2 D;  1V1Q A;  5CV9 A;  3S1Q B;  3C1E A;  5G3L D;  3U9S A;  1KLU D;  1YJ9 A;  1A0I A;  1VQ7 A;  1SMY C;  5KYI A;  1JB3 A;  4LJZ C;  4HID A;  4JBJ A;  4QL5 A;  3RZD H;  1HCZ A;  2NVY B;  3PUV A;  4DR5 L;  4A3D G;  3G48 A;  1RD9 D;  1LV9 A;  1N34 Q;  4JI8 L;  2KA7 A;  4QIW E;  1WTP A;  2RVL A;  3H94 A;  3J81 j;  2DY7 A;  3UE0 A;  3C2P A;  4KMU C;  1RCV D;  2NVX H;  2YTY A;  3CMA A;  5HUR A;  2AQ3 B;  4WOR A;  2IPK D;  3L9A X;  4X62 Q;  4DAY B;  4A3F B;  5M3F G;  2JEB I;  3KYH C;  4A3I H;  3EIV A;  4UPA A;  3SEB A;  3UDG A;  2K33 A;  4F88 A;  1K8A C;  4DV6 L;  2Z6K A;  1HNW Q;  4KHV A;  3H0G G;  1H95 A;  2UXC L;  4QGU A;  1BQQ T;  3EFX D;  2CWP A;  3BZD B;  3EBE A;  1XMO L;  1GUW A;  2I5M X;  4N8X 1;  4JG2 A;  2UUB L;  1SDF A;  2XRQ D;  2YTV A;  4KHZ A;  4EQO A;  2I5H A;  4JYA L;  3X3N A;  1UE7 A;  2Q8I B;  2JN4 A;  4FO2 A;  1Y1W G;  5C5L A;  1Q8K A;  1HNZ Q;  4DR1 L;  2K5Q A;  5GAE C;  2R93 G;  2F0L A;  3RZD B;  4R4C A;  1EWH A;  1TQO A;  3HOZ G;  4A3D H;  3KLW A;  3KF8 B;  4LMQ D;  3ULP A;  5AJ3 L;  4G7H C;  2F0K A;  2F0D A;  1SXT A;  1EIG A;  2OCE A;  1NY4 A;  3TZU A;  5BN3 A;  3O13 A;  2J7Z A;  5IT9 L;  3VYR A;  3A56 A;  3R2T A;  4HCS A;  2RF4 A;  2NVX B;  1OXS C;  2JA8 H;  3DHQ A;  1KQS A;  5K36 G;  1EY7 A;  2PMZ E;  5CBA E;  2MO1 A;  3QR8 A;  2K5N A;  4IPC A;  5KYL A;  2Z6K C;  4Y7N B;  2X6G A;  3NTI A;  1S40 A;  2KCM A;  2CH4 A;  1X3Q A;  1A3T A;  3M4O H;  3A5U A;  4DNR B;  2L9H A;  2KVM A;  1F2L A;  4FNF A;  5JJK A;  2OQK A;  4WJ3 M;  5EKI A;  1PRT B;  1WD1 A;  1TWA H;  2P5Z X;  4YIJ A;  2IHE A;  2F0E A;  4K5W A;  4PG3 A;  5FLM H;  1MIU A;  1L0Y B;  3VR6 A;  1UEA B;  2TMP A;  3HOX G;  4A3J G;  3D6W A;  3MVV A;  2AHO B;  1V1P B;  2AKW B;  3CCQ A;  2NTT A;  1N36 L;  2OQ0 A;  5JVG 3;  3S1N H;  3F2C A;  4A3D B;  4DR5 Q;  2PCF B;  2KOL A;  3BZC A;  5IP9 G;  1SSO A;  1QVF A;  4DAP A;  2A73 B;  2DJF C;  1DD2 A;  5C0X I;  2RDF A;  4ILW A;  3FHW A;  4U68 A;  4UP9 A;  1E7Z A;  2LXK A;  4DF7 A;  5DEH A;  3NTH A;  2JA8 B;  4NPS A;  4NXM L;  3D6C A;  4C3I H;  3S15 H;  2ALY B;  1EYD A;  3FDT A;  4K6D A;  4X3K A;  4YY3 L;  5M3F B;  2MPM A;  2KEE A;  3OW7 A;  2ZXO A;  3BS1 A;  4DV6 Q;  3BYY B;  4OEM B;  2UXC Q;  3F2D A;  3M4O B;  3I73 A;  4OL7 A;  1MI2 A;  1Y8P B;  1XMO Q;  4LW1 A;  3CPW A;  3W3A A;  2RKS A;  4DV2 Q;  2UUB Q;  2JA9 A;  1JJC B;  2WB1 E;  4XYO A;  1TWA B;  3W1G A;  4YHH L;  4JYA Q;  1SNQ A;  1YIJ A;  3HOX H;  1Y1W B;  2ATW A;  1GUO A;  1F2Y A;  3CC7 A;  3Q22 A;  1YHQ A;  4EGV A;  2R93 B;  3HOZ B;  4NW2 A;  1HZB A;  1LTI D;  2B63 H;  5AJ3 Q;  4P71 A;  5KEE A;  3KF6 B;  4IUP A;  3T4A C;  2XVS A;  1VMP A;  4DV0 L;  1STY A;  1WD0 A;  1WJJ A;  1ZYR D;  1Y8N B;  3QJY A;  1UAP A;  3S15 B;  4C3I B;  4XQN A;  4L63 B;  2CVR A;  2B29 A;  2F52 A;  1AE2 A;  3NE5 B;  4HCE A;  4RHS A;  5EQ0 A;  1PH1 A;  4LF7 L;  1H9M A;  1BBW A;  4JI4 L;  3UDF A;  1EQQ A;  1YEZ A;  3E0J A;  4K8J A;  2F3I A;  1V8Q A;  1YZ6 A;  2VXW A;  5I6W A;  5CMD A;  1LM0 A;  3HG9 A;  4PMW A;  1SYF A;  3HP3 A;  3Q8D A;  5C6A A;  1QZH A;  2ES2 A;  1FL0 A;  2F0T A;  4HJ8 A;  4P74 A;  4XT1 B;  4MHE A;  1Z6H A;  1PRT D;  1M4V A;  3K59 A;  1JR0 D;  4A3J B;  3HOX B;  2EOT A;  4DV4 L;  4GOP A;  5M5Y B;  4C3J G;  4OIK A;  2HDL A;  5E4X A;  2AWN A;  2Y0S B;  3K7A H;  3GTQ B;  2VZA A;  4X66 L;  1HTP A;  2AQ2 B;  4R1J A;  3S16 H;  2HQE A;  1HUN A;  1I3Q B;  5JEA J;  4PV1 C;  5C4X G;  1DJR D;  2ZTD A;  1MJC A;  2LFN A;  5JVH 3;  3HFZ B;  2J0T D;  2DJG C;  3D3R A;  2OTL A;  1CA6 A;  3L7Z C;  1JOR A;  1WTO A;  1YJW A;  2V1C C;  4YY3 Q;  3D4W A;  3K5O A;  1N33 L;  3GTG H;  3BU2 A;  1PTO C;  2A6E D;  4J8Q A;  3QIA A;  3I4M H;  1RDP D;  3H6M A;  5EKK A;  1MGS A;  2IX3 A;  1E2V A;  1ENC A;  5I2Y A;  5CBE E;  3OYY A;  2C9O A;  1NR2 A;  4KY5 A;  4IFD J;  1QNK A;  3ITP A;  3HKZ B;  2O5I C;  5M5X H;  1FNV A;  1SMY D;  4IJH A;  5C0X G;  4YHH Q;  1QIL A;  4GOP C;  2DY8 A;  3OMC A;  1MSG A;  4C3J H;  2AUJ D;  1CKN B;  1IKL A;  1CSP A;  3URY A;  1H9S A;  1Y8O B;  1Q86 C;  3K7A B;  1XNQ Q;  3T1H L;  3S16 B;  5IGF A;  1IZ6 A;  3HRZ C;  1IL2 A;  4A93 G;  3G7L A;  3HOV G;  3DXJ C;  2Q8T A;  1CQF A;  2BDO A;  5C4X H;  1EWI A;  4KD4 A;  1LAC A;  2D9U A;  1LT4 D;  1BCP F;  4IPG A;  4JI6 L;  2XN9 C;  1TWH H;  1XXG A;  3RLO A;  2EYJ A;  3HOW H;  2MGS A;  1SNM A;  1L0X B;  3NP8 A;  3UDI A;  4B3R L;  2CFM A;  3DLL A;  1EL0 A;  5HY6 A;  1JQY D;  3I4M B;  4B3M L;  2ZXP A;  4PMB A;  4LF6 L;  1EOV A;  2KUM A;  1A62 A;  4A3L G;  4FF3 A;  4A3G G;  3E5S A;  2K5W A;  2PZW A;  1STN A;  5M5X B;  1YNJ C;  1VF7 A;  5FO8 B;  4RMF A;  1I4G A;  2C35 B;  5C5M A;  4IPD A;  3ULL A;  3CME A;  4DV4 Q;  2ICE C;  4C3J B;  4DPG A;  1CTM A;  4QIW B;  1OXU A;  1PV4 A;  4JI7 L;  4LF4 Q;  3FMC A;  5I6Y A;  1YHB A;  2EE1 A;  4RA8 A;  5IYD G;  3CCU A;  3CKI B;  3I90 A;  2WAQ B;  4R8I A;  4X66 Q;  2JYO A;  1Z47 A;  2WKD A;  3HZX A;  3BDL A;  1W3S A;  3J80 L;  4HIK A;  5KNB A;  1EY9 A;  3I3C A;  4F8M A;  5C4X B;  2CCZ A;  3VYU A;  1X32 A;  4JI1 L;  2EYH A;  5EPJ A;  3K5L A;  3J7A F;  3S14 H;  3S2D H;  2JP1 A;  1SRU A;  1PTO H;  3FEW X;  1TWH B;  5KIX A;  3NQI A;  3HOW B;  4DR3 L;  5ISR A;  1A2T A;  2EIF A;  4HSV A;  1N33 Q;  2MP1 A;  4M8A A;  2WB1 G;  2L1B A;  4A76 A;  2SEB D;  2B2W A;  3CAM A;  1OXT A;  2FIN B;  4YCW A;  3TQY A;  5JEA H;  1EFI D;  5IGB A;  1SYD A;  1G6Z A;  1RHP A;  4HSP A;  4IUV A;  1VQG A;  2HUG A;  1W6J A;  1EQV A;  1IBL L;  1O7Y A;  4OWW B;  1STE A;  4BBS H;  2BA1 A;  3PO3 G;  2PO4 A;  1AZQ A;  4BWG B;  4OO1 H;  1A8V A;  3KLS A;  1CZG A;  5J39 A;  2ZT9 C;  4RFB A;  3T1H Q;  1HR0 L;  1VQB A;  4A93 B;  4LFC L;  1C8C A;  3HOV B;  2I07 B;  1CQV A;  3VA7 A;  3S24 A;  1PH3 A;  2NZH A;  1SNO A;  3PUY A;  3CXC A;  2BA0 A;  4IFD H;  3I4N H;  1LUZ A;  4ZAI A;  1WI5 A;  4O0A A;  4NXN L;  3S2D B;  1PTO B;  5KNC A;  1AZP A;  2WFW A;  2X69 A;  3NQT A;  3NBI A;  5D3I B;  1H9R A;  2QKI C;  3CCS A;  5FLX L;  4LF9 Q;  2YV5 A;  1PFN A;  1SYC A;  3KFU A;  4OGQ C;  1U4P A;  4B3R Q;  4JI5 Q;  3MEH A;  3C3L A;  3IFT A;  1A63 A;  5DM6 3;  2B2W C;  3U58 A;  4MNO A;  4A3M H;  1HXY D;  4LF6 Q;  2B8F A;  1YI2 A;  1UE1 A;  1U9R A;  4P75 A;  3U4V A;  2VY3 A;  1E2Z A;  1LYL A;  2JXM B;  5JJI A;  4ZUJ A;  3I72 A;  2XIW A;  3V05 A;  3KLS X;  4BBR G;  3JC6 6;  2UUA L;  2JQO A;  5BN4 A;  1C0A A;  4G4K A;  5CV6 A;  3MTS A;  2HCC A;  5COR A;  3LWE A;  1GKH A;  2QEJ C;  2PI2 E;  1H9J A;  1I50 H;  4MZ9 A;  4JI7 Q;  2F1M A;  4LUZ A;  3OW2 A;  1WFQ A;  1UNS A;  4Y52 H;  4FXK C;  1Z9F A;  1U4M A;  2K05 A;  3I4O A;  1EWC A;  4CJ0 B;  4IUN A;  3CRK C;  1SAP A;  2A1A A;  4JI1 Q;  2Y0S E;  2HD3 A;  4KKT A;  1M1K C;  3J80 i;  2XSC A;  1W6K A;  3J7A V;  2PQE A;  4B3T L;  1G8Z D;  2E2J H;  1L2F A;  5ELF A;  4A3F G;  3TEH B;  1FYC A;  4DR3 Q;  1CHQ D;  2BCO A;  3T56 B;  5F2D A;  4BY1 H;  1E22 A;  1HNW L;  1NNX A;  3J80 c;  1VQ5 A;  1UWV A;  3CU7 A;  2B2V A;  2R7Z H;  5H1S E;  4A3M B;  2PPB C;  3EA6 A;  2KED A;  3OPO A;  1TS2 A;  3SK8 A;  1TY2 A;  4G7O C;  1S5D D;  5IYB G;  1ICW A;  1JE5 A;  5CV7 A;  4JI2 Q;  4BA2 I;  1SND A;  2DN8 A;  1IBL Q;  1H9S B;  2Z4I A;  3V2T A;  2RCF A;  5IP7 G;  1HNX L;  3PO3 B;  2KCT A;  1DYQ A;  5TSS A;  1I4Q A;  4DK6 C;  2WII B;  1EYA A;  1VQF A;  5E4W C;  3TP5 A;  2JA6 H;  4I7A A;  3S1M H;  3P7J A;  3HKZ E;  1Y1V H;  2F0P A;  3NTK A;  1D2B A;  4L8J A;  1F9S A;  1SNC A;  3CCM A;  1ESR A;  5CC4 A;  1QCB D;  2QW7 A;  1ET9 A;  1FNW A;  5I9O A;  1G2S A;  2HHH L;  2E75 C;  1Z7T A;  2AWO A;  3MFG A;  2KHJ A;  4WJW A;  1PFB A;  4QUC A;  1Q1E A;  1C4Q A;  3KF6 A;  5A2Q E;  5I2X A;  1PTO D;  3OWE B;  1KAB A;  1IXR A;  4JC0 A;  4A3I G;  3T51 B;  3QOJ A;  4BY1 B;  2N88 A;  4RGM A;  1TVX A;  1NMF A;  2WAC A;  2BE5 C;  2R7Z B;  1K9M C;  4KLK A;  2B2V C;  3IRB A;  2Q2H A;  4PZ8 A;  2XGT A;  1CSQ A;  1QWY A;  1R9T H;  4L6T B;  4KI0 A;  1DOM A;  3CC4 A;  4UP7 A;  4B08 A;  3MXP A;  1D1K A;  1ML0 D;  3RD4 A;  2JSO A;  3MFY A;  4OX9 L;  1JJ2 A;  2UUA Q;  3M7N A;  2AQ1 B;  4K0K L;  5LL6 X;  2PI2 A;  4CDC C;  5A35 A;  5IP7 H;  4C3H H;  1VQ8 A;  5ELB A;  3OOC A;  1YHA A;  4YCU A;  1S5B D;  5C44 H;  2JA6 B;  1LT3 D;  3M3Y B;  3SGI A;  3S1M B;  1CM9 A;  4CKC A;  1SNP A;  2K7V A;  3A7L A;  1FVI A;  1X55 A;  1IYJ B;  3KOJ A;  3GTJ H;  1Q8I A;  3BVM A;  4K8I A;  4APV A;  3ULJ A;  2ID0 A;  2EXD A;  3Q6S A;  3PIO A;  4GS3 A;  1XPR A;  4Z9C B;  1G51 A;  4K5V A;  4TQU S;  2JA8 G;  2WAQ E;  3IL8 A;  2XWB B;  4QB4 A;  1GHJ A;  4B3T Q;  1CKM A;  3ER0 A;  2EYP A;  2FJ2 A;  2ZTC A;  2A69 C;  5M5W H;  2DGY A;  3N52 A;  3P20 A;  4L5Q A;  1E0B A;  3CF5 A;  4PNY A;  3H3V H;  1RJT A;  4KN7 C;  5GQO A;  3I2Z A;  1XYI A;  1YNJ D;  2CKZ B;  1R9T B;  3RUZ A;  1C9O A;  5K5P A;  2FMM A;  4POG A;  3MWY W;  1CHP D;  4DV2 L;  3E6Z X;  1ENF A;  2EYO A;  3L3O C;  4HR7 B;  4DN4 M;  3KBG A;  1R4Q B;  5IGG A;  1SFO H;  5FLM G;  4QUF A;  3MA2 B;  1BBU A;  1CK1 A;  1HNX Q;  5IIF A;  4R9W A;  3TME A;  4FXG C;  1Q7Y C;  1DXM A;  5C44 B;  1YNN D;  4RKB A;  2B2Y A;  1PH2 A;  4OWT B;  3PF5 A;  1B53 A;  1GM5 A;  3TP8 A;  3GTJ B;  3VR5 A;  4P73 A;  1CKN A;  4CGY B;  3RMH A;  2N8N A;  2HHH Q;  1IYU A;  2N55 A;  1T9H A;  1X3G A;  5FKA C;  2K03 A;  4C3I G;  1QUQ B;  3FP9 A;  5M3M H;  1S4Z A;  4QF4 A;  3OTO Q;  4BY7 H;  2L55 A;  2MJ8 A;  2PW7 A;  4A3I B;  2O5J C;  3SK4 A;  5M5W B;  4HJ5 A;  5IGC A;  1STH A;  4RKL A;  3TSS A;  3DUZ A;  4GLA C;  4HJ7 A;  3NEN A;  2YU9 H;  4GKJ L;  1S5E D;  3KJP A;  4O2D A;  2UXD Q;  1SE4 A;  1TS4 A;  4A3B H;  3HEJ A;  4RG1 A;  4OX9 Q;  4K0K Q;  5EJW A;  3LX0 A;  2IY5 B;  2QCP X;  4UY8 C;  5D65 A;  1EY0 A;  4IOA A;  4NKL A;  5GRO A;  4K5X A;  1PZI D;  1SLJ A;  2Y0S G;  2KHI A;  1HZ9 A;  2B2Y C;  4OHJ A;  1D1I A;  5IOC A;  4FF4 A;  3BDO A;  2B63 G;  2EVB A;  1B9N A;  3HKS A;  5AFW A;  2CHB D;  1L1O A;  2NN6 H;  3DM3 A;  4BXX H;  2K1B A;  1I6V C;  5D14 A;  3D4D A;  4ZQ3 A;  5M3M B;  3CHB D;  1Y69 U;  3U9O A;  1KXL A;  4KN4 C;  4BY7 B;  1SYB A;  1SJE D;  2B3G A;  4FVM A;  1OTC A;  2R92 G;  1D6E C;  2AMC B;  1S5C D;  2L11 A;  3T1Y Q;  1GOZ A;  1JIC A;  4PZ6 A;  4Q0F A;  1YJN A;  4KKU A;  1C48 A;  1STB A;  3ND9 A;  2PYK A;  1QOH A;  2SNS A;  2IHF A;  4A3B B;  5JJZ A;  3H15 A;  5KGU A;  3HKZ G;  2E5L L;  3PCO B;  2IX0 A;  3CPF A;  2H5X A;  3WOF A;  5FJ8 H;  1B44 D;  1XNQ L;  2QGQ A;  3S1N B;  5HGT A;  3E3X A;  1GUS A;  1PFM A;  3C1F A;  4UAI A;  2EPB A;  2DNE A;  4CKE A;  3PUW A;  2D0P A;  5EGT A;  4KV6 A;  4L5R C;  2CWA A;  2XNA C;  2B39 A;  4X65 L;  1L1O C;  3MXN B;  5C3W A;  3FKI H;  4OO1 I;  4R8N A;  4IQZ A;  4RGN A;  1MBY A;  1TS3 A;  2K14 A;  1WTX A;  2WIN B;  3DWA A;  2E2H H;  3G71 A;  2R92 H;  1EQT A;  1XPO A;  3GTP H;  2Q2I A;  3GP7 A;  1YIT A;  5LMU L;  2A8V A;  5DAU A;  3J7A 5;  5C3E H;  2RSN A;  3I4M G;  2Z8L A;  1E24 A;  5EBD A;  4ME5 A;  4WRD A;  4GKJ Q;  4A3C H;  3PO2 H;  5C0X J;  5DNF A;  1FGB D;  2VUM G;  4DGZ A;  1PMR A;  4OWX B;  5LL6 S;  2IT1 A;  3KDF B;  4KKS A;  4RAU C;  4LF4 L;  3K0Y A;  4DV1 L;  3CC2 A;  1BCP B;  1PXU A;  4JBW A;  2WAQ G;  1U4R A;  2B63 B;  5M9O A;  3A54 A;  3BZK A;  4BS9 A;  1DGS A;  2Z9H A;  4GN4 B;  2RHS B;  1TY0 A;  4IZ8 A;  3FKI B;  1D5M C;  1LTA D;  1UUP A;  1KD1 C;  4GKK L;  1IBK Q;  4HMJ A;  2BE5 D;  2E2H B;  2ZTE A;  1V43 A;  4BA1 I;  3AEV A;  2R92 B;  3HOW G;  4AQY L;  1F9P A;  1CZW A;  3GTP B;  2LXJ A;  4HN7 A;  3N6R A;  3KBX A;  4RH6 A;  5C3E B;  1SYG A;  4R4Q A;  3K80 C;  5ELN A;  4KY6 A;  1U0L A;  1HA6 A;  4MN3 A;  2MQH A;  3SDZ A;  1BO0 A;  2VB3 X;  1MJE A;  4ZCK A;  1KNA A;  3KUP A;  1F2M A;  4ALP A;  1LO5 D;  1GJX A;  1TWG H;  2NZ1 D;  1KLG D;  2EY5 A;  2N3S A;  5E1F A;  2E5L Q;  5IE8 A;  2PZU A;  2UXB L;  2H1E A;  2KJX A;  4ZLT F;  5ELC A;  2VUM H;  1HQM C;  2WKC A;  1CKO A;  1TT2 A;  4ZUI A;  1V1O A;  3F2B A;  4C56 C;  1WTR A;  3K57 A;  3CQZ H;  2F0U A;  5CGK A;  1NUC A;  3MAQ A;  4CBV A;  2EY6 A;  2NYZ D;  4CJ1 B;  2M2L A;  4JPB W;  1B1Z A;  1C7Y A;  1N8R C;  2O4X A;  4DK1 A;  4HJ9 A;  4X65 Q;  3IAY A;  3A8K E;  4GN5 A;  2D0O A;  1M90 C;  4TKO B;  2A69 D;  2F03 A;  2RBM A;  2DNC A;  4LF9 L;  1EEF D;  3GTG B;  2LMC B;  1B70 B;  4JI5 L;  5LMU Q;  1RTO A;  2L4N A;  1GD7 A;  2GN5 A;  5JEA G;  1PHJ A;  3DWP A;  1Q90 A;  1EQR A;  1E1T A;  1QB5 D;  2EJF C;  2K32 A;  1B4O A;  3QOL A;  3I70 A;  1ILP A;  2KCN A;  2B2T A;  3I8Z A;  4C1N K;  1UEB A;  3WOE A;  4BBS G;  2VUM B;  1GXD C;  1JWM D;  1PYS B;  2KEC A;  4IOC A;  3GTO H;  4OO1 G;  4YWK A;  5LMN W;  4X64 L;  1KRS A;  1J5E L;  3G6E A;  3CQZ B;  5CYU A;  4DV1 Q;  3TBI B;  1PH9 A;  1L1O B;  1K3R A;  3RLN A;  4A3K G;  1SE3 A;  4XYQ A;  3CCE A;  1GVP A;  1YNN C;  2V4D A;  2IL8 A;  4IN3 A;  4OXP A;  4IFD G;  3I4N G;  1ENA A;  3A55 A;  3K8A A;  2XWJ B;  1ZKO A;  4GKK Q;  1CUK A;  4XDX A;  2LKV A;  3A8J E;  2K52 A;  5J3B A;  3NEM A;  1HR0 W;  5EBC A;  3A7A B;  4JBK A;  3DEO A;  2K50 A;  1N9W A;  1H9K A;  1SE2 A;  4AQY Q;  3JAM E;  2F0N A;  4DUY L;  1X3F A;  2GVA A;  1DCZ A;  5JJL A;  2MUY A;  4A3M G;  3Q23 A;  1F9Q A;  4X3S A;  1TWC H;  1HUM A;  1LT5 D;  3K7U C;  1D7Q A;  1EU4 A;  5E3F A;  3CCL A;  4JI2 L;  3SR1 A;  3Q24 A;  4FDB A;  2CQA A;  1IBM L;  5HGQ A;  4PZ7 A;  2B2T C;  1VQO A;  3NWS A;  4JVZ A;  2UXB Q;  2A68 D;  4AIM A;  2EYM A;  1E3P A;  2TSS A;  4IUR A;  4V0B A;  4J15 A;  3PIP A;  5C4Z A;  2E74 C;  3GTM H;  2G5D A;  4A3E G;  1EOT A;  3PUX A;  2E8G A;  4LAA A;  4A3K H;  3NSW A;  5CV8 A;  1PH5 A;  3KJO A;  4HED A;  3M9B A;  1HTL D;  5IYC H;  1BR9 A;  1HHV A;  5ELO A;  3OHX C;  5ELE A;  1RKN A;  3TP6 A;  3S14 B;  2R7F A;  1FJG Q;  4XQJ A;  3TS0 A;  1WTW A;  1K83 H;  2JA7 H;  4EQ5 A;  4KJO A;  4BY1 G;  4IO9 A;  4HIM A;  1JT8 A;  4IJL A;  2B2U A;  2HDM A;  4K6L A;  1QUQ A;  4B3S L;  2R7Z G;  1CT1 D;  1DOK A;  4QCL A;  1TWC B;  3DWQ A;  3VYS A;  1DOL A;  2D5D A;  1JWU D;  3NUC A;  4ID6 A;  4K2K A;  3RZO H;  2ZXR A;  2SNM A;  2F0G A;  3FPP A;  3QG1 A;  5COY A;  2WP8 J;  4DNT B;  2QF7 A;  1GUG A;  4BBS B;  3RLF A;  2C5C A;  1XJV A;  2E2I H;  1GUN A;  3AQQ A;  4YWM A;  1JOK A;  1PH4 A;  4X64 Q;  1J5E Q;  2JA6 G;  2UUC L;  1IKM A;  4A3E H;  4A3K B;  1Y1V G;  4HTH A;  1NSN S;  2GVB A;  3HOY H;  4RCN A;  3J7Y W;  2F0F A;  5JAV A;  3GV6 A;  3J81 E;  1IYV A;  3I4N B;  1EIH A;  2L15 A;  4XT3 B;  1OO9 B;  5EPK A;  1K83 B;  1Q46 A;  5JOB A;  2JA7 B;  4H02 A;  1MHW C;  3B6Y A;  2CQO A;  4O42 A;  4TRD A;  3EQL C;  3E9H A;  3BJU A;  2B2U C;  3CP0 A;  4DU9 A;  1AP0 A;  2K01 A;  4DUY Q;  3I55 A;  1VQI A;  4J6H A;  1VQ9 A;  4JK1 C;  2BH8 A;  2BDN A;  4DXG A;  3RZO B;  2RA4 A; 
#chains in the Genus database with same CATH homology
 1LAB A;  3K58 A;  2F0V A;  3H3V C;  1B3A A;  3H09 A;  1T5X D;  1IL8 A;  2E2I B;  4C3H G;  1JCK B;  1PZK D;  1BXT A;  1I50 B;  2F0J A;  4A3E B;  1JOQ A;  4V19 0;  2SDF A;  2F0O A;  4EQP A;  2EXZ A;  3HGB A;  4IAL A;  3TZD A;  3PV0 A;  2E2J B;  5BN5 A;  3MXN A;  2WV6 D;  2D2C C;  3C46 A;  3TP7 A;  3PMF A;  5G3L F;  2IX1 A;  1ZEQ X;  2Z4H A;  1FD7 D;  4XTC S;  4FYD A;  3MXG A;  4ULL A;  3NK9 A;  2CW0 C;  5J1Z A;  1HQR D;  2KCC A;  2R6G A;  4ZK9 B;  1SEB D;  1TS5 A;  1WTV A;  4GZY C;  2EYF A;  5LHY 1;  5JPM C;  3TN2 A;  4E6I A;  2E76 C;  4EVO A;  4DFA A;  1Y1V B;  2JE6 I;  1I4X A;  1I4R A;  4ZKC B;  3MHB A;  5EKL A;  4KTA A;  2LY7 A;  2GA4 B;  3VR3 A;  1G91 A;  1WVL A;  2PW5 A;  2FHT A;  3QO2 A;  1HRJ A;  1S5F D;  1AFP A;  2E2D C;  4NDX A;  1QE6 A;  1PZJ D;  4FXD A;  4U67 3;  3BYT B;  1CA5 A;  4AYB B;  1AN8 A;  4C3H B;  1PLF A;  2KHS A;  3Q0A A;  4LK1 C;  1VDZ A;  1I6H B;  5JPN C;  5D3D A;  1LTS D;  4CKB A;  4M1U B;  5CV5 A;  1ROD A;  3SXH A;  3I4L A;  1BCP C;  2NN6 G;  3S1R B;  2A74 C;  1K8M A;  3ZYY X;  3V96 A;  1Q1B A;  5C4J B;  3R2I A;  1ONL A;  3T13 A;  1DON A;  1NR4 A;  1DZ1 A;  1EEI D;  4N9T A;  4C1N I;  3GD7 A;  2A6H C;  1XWE A;  2R61 A;  4H13 C;  1SFO B;  4DA2 A;  3GTK B;  2NVT B;  3A8I E;  4KJN A;  1B50 A;  1SJH D;  3D4R A;  1I4P A;  2A68 C;  4ZYS A;  1ILQ A;  5IGE A;  3GQB A;  1LTT D;  5IT9 E;  2NVQ B;  3R3O A;  3NWT A;  3P75 A;  4O1N A;  3R93 A;  3PIO 3;  1A3V A;  2F3V A;  2QDB A;  1IW7 C;  4NP5 A;  4RCO A;  4N9P A;  2OXP A;  4S3S A;  2O2L D;  4HMI A;  5EPL A;  2PZT A;  4KY7 A;  4RWS C;  5KRU A;  4F87 A;  2FFK B;  1LTB D;  4B9W A;  3D8G A;  3AMU A;  2YU9 B;  4J1M A;  4WFN 3;  3FPU B;  1LTG D;  2OEO A;  4X3U A;  2L5T A;  3F2U A;  5K36 H;  4ABN A;  3SE0 A;  3H0G B;  3ONA B;  1D5X C;  1BBX C;  1VF5 C;  4I7Z C;  2AUK A;  2EY1 A;  2HCI A;  2L0C A;  1MSH A;  3PUZ A;  1GHK A;  2LS0 1;  2EYL A;  1JWS D;  1LLR D;  3SK5 A;  1PRT F;  5ELD A;  1F77 A;  1LT6 D;  4FF2 A;  4IFD I;  2SOB A;  1KAA A;  1AEX A;  2EDG A;  3LWU A;  5T1I A;  3UI2 A;  2Q8R E;  2XRS D;  3EJI A;  2FMC A;  1HFG A;  3NXW A;  4KK7 A;  3W2D A;  3TDQ A;  3T53 B;  1O7L A;  5CV4 A;  1F9R A;  1FNU A;  3I91 A;  5I4D A;  3AB9 A;  3MC0 B;  5FO7 B;  3M85 A;  2EJM A;  1RF2 D;  2K04 A;  4I65 A;  1T5E A;  2CW0 D;  3SK6 A;  4P2C B;  3SVM A;  4CJ2 C;  2MHV A;  3PO2 B;  2I46 A;  1EYC A;  1M8A A;  2NWG A;  4EQN A;  1BUV T;  1TKW B;  4RGT A;  1STG A;  4X3T A;  1A3U A;  1DM0 B;  1BOS A;  3QWN A;  5NUC A;  2K28 A;  1XTC D;  1J8I A;  2R3Z A;  3CRL C;  1SBB B;  3MXU A;  2YYZ A;  5T1G A;  3KLR A;  5I9P A;  3ERQ A;  1K8O A;  1STA A;  1BNZ A;  3MZ5 A;  2ICI A;  3BDC A;  4H44 C;  1QNU A;  2OT2 A;  1JOO A;  1XX8 A;  3HOU B;  3GV3 A;  3R8B A;  1VCI A;  2JA5 B;  1KDA A;  4RGO S;  3WDN A;  4K14 A;  1TWG B;  1O7Z A;  1G2T A;  1PDQ A;  3K5M A;  2F0M A;  2RDG A;  1TWF B;  1KNE A;  2IW3 A;  1KDC A;  1JC7 A;  1O78 A;  3VYT A;  3JAM L;  1QG7 A;  1BCP D;  3NBH A;  4MIU A;  2F0H A;  2F0S A;  2IJ0 A;  3ERO A;  1X3P A;  4F7X A;  2K5D A;  5FO9 B;  5C0X H;  2M9V A;  4XQQ A;  3NPP A;  2VNU D;  1LTR D;  4ZKB B;  2F0Q A;  1FR3 A;  2VB2 X;  4CHT B;  3BVG A;  3S2H B;  2NUC A;  4QMG A;  1CFM A;  2A6H D;  1II3 A;  1Q3L A;  5KND A;  2A5H A;  4TSS A;  4XIG S;  5C3X A;  1JE4 A;  1ZXT A;  2RQX A;  3GTL B;  4FP5 D;  1KTK A;  1NCV A;  2G9D A;  4ODG A;  3GTO B;  2F3W A;  2QIL A;  5DM7 3;  1PYW D;  1I4H A;  4H0L C;  4DAY A;  4IUQ A;  4DK0 A;  1HFN A;  3J80 E;  2RDH A;  5IOD A;  1U4L A;  3FVQ A;  1KDB A;  1BDO A;  3OMG A;  2NB0 A;  1WCM B;  3OSO A;  1IW7 D;  1OXX K;  4G7Z C;  1GUT A;  1TU2 B;  3K6O A;  4UDU C;  5J22 A;  2PMZ B;  4PQX A;  2NBF A;  3GO5 A;  4B9X A;  2M00 A;  3BVZ A;  3KF8 A;  1IHZ A;  1BF4 A;  3J81 L;  2F0I A;  3IKJ A;  1G29 1;  1TII D;  4FF1 A;  1OXV A;  3M4Y A;  1B9M A;  3DMU A;  3GTM B;  1O80 A;  5CR3 A;  1EY4 A;  3IFD A;  3D31 A;  1AW7 A;  5FOB B;  1EZ8 A;  4A3G B;  1EZ6 A;  2L12 A;  1TR5 A;  3VR2 A;  4DXF A;  2NTS A;  4PMC A;  3P1H A;  5FLX E;  2K6A A;  5IGD A;  4KD3 A;  2G9H D;  4C2M B;  1A6X A;  2RSO A;  1SYE A;  5FK9 C;  4IUT A;  2IWH A;  4G57 A;  1V1P A;  1EY8 A;  2NN6 I;  4OIJ A;  2KQ3 A;  3NHH A;  5C4H A;  2EJG C;  1EU3 A;  3SHL A;  3EVQ A;  1EY5 A;  2H4O A;  1ZYR C;  4ZRZ A;  4H7B A;  5A2Q L;  1D5Z C;  3H91 A;  1EY6 A;  2WB1 B;  1RTN A;  1CI3 M;  2BOS A;  4DAV A;  1WTQ A;  3PIP 3;  3T16 A;  4IUU A;  3VA5 A;  3OWF A;  1PTO F;  1R4P B;  1HPC A;  1HA5 A;  3HOY B;  3BG3 A;  2F0W A;  3OIP A;  2EY2 A;  4NMZ A;  3DM1 A;  1J9O A;  2PNR C;  3QB3 A;  1A2U A;  1ET6 A;  2Z1C A;  3S17 B;  1ESF A;  1PRT C;  4HAE A;  3M7G A;  2EZV A;  3HS0 C;  1F2Z A;  4RHR A;  3OIQ A;  3DEP A;  3FRP B;  4Q5V A;  2J4X A;  2F4I A;  3KK7 A;  2D62 A;  1Q12 A;  2JEA I;  2X6L A;  3S9W A;  1A15 A;  3AU7 A;  4XXE A;  3ND8 A;  1E2W A;  3K5N A;  2OF1 A;  3G6J B;  3VR4 A;  2A6E C;  4K2L A;  1B2T A;  3LNN A;  1NAP A;  1VMC A;  4BBR B;  3X3M A;  1QJO A;  2B8G A;  2ENB A;  1MD2 D;  5CV9 A;  3S1Q B;  3C1E A;  5G3L D;  3U9S A;  1KLU D;  1SMY C;  5KYI A;  1JB3 A;  4LJZ C;  1HCZ A;  2NVY B;  3PUV A;  1RD9 D;  1LV9 A;  2KA7 A;  1WTP A;  2RVL A;  3H94 A;  3C2P A;  2DY7 A;  4KMU C;  1RCV D;  5HUR A;  2AQ3 B;  4WOR A;  2IPK D;  3L9A X;  4A3F B;  2JEB I;  3SEB A;  2K33 A;  4F88 A;  4KHV A;  1BQQ T;  3EFX D;  3BZD B;  1GUW A;  1SDF A;  2XRQ D;  4KHZ A;  4EQO A;  3X3N A;  2Q8I B;  4FO2 A;  5C5L A;  2K5Q A;  2F0L A;  3RZD B;  1EWH A;  1TQO A;  4LMQ D;  4G7H C;  2F0K A;  2F0D A;  1SXT A;  1EIG A;  3TZU A;  5BN3 A;  3O13 A;  2J7Z A;  5IT9 L;  3VYR A;  3A56 A;  3R2T A;  4HCS A;  2NVX B;  1OXS C;  3DHQ A;  5K36 G;  1EY7 A;  5CBA E;  5KYL A;  4Y7N B;  2X6G A;  3NTI A;  1X3Q A;  1A3T A;  4DNR B;  2L9H A;  2KVM A;  1F2L A;  4FNF A;  5EKI A;  1PRT B;  1WD1 A;  4YIJ A;  2F0E A;  4K5W A;  1L0Y B;  3VR6 A;  1UEA B;  2TMP A;  3D6W A;  3MVV A;  1V1P B;  2NTT A;  5JVG 3;  4A3D B;  2PCF B;  2KOL A;  1SSO A;  4DAP A;  2A73 B;  1DD2 A;  5C0X I;  2RDF A;  4ILW A;  4U68 A;  4DF7 A;  5DEH A;  3NTH A;  2JA8 B;  3D6C A;  1EYD A;  3FDT A;  4K6D A;  4X3K A;  5M3F B;  2MPM A;  2KEE A;  3OW7 A;  2ZXO A;  3BS1 A;  3BYY B;  3M4O B;  3I73 A;  4OL7 A;  1MI2 A;  1Y8P B;  3W3A A;  2RKS A;  4XYO A;  1TWA B;  1SNQ A;  1Y1W B;  1GUO A;  1F2Y A;  3Q22 A;  4EGV A;  2R93 B;  3HOZ B;  4NW2 A;  1LTI D;  5KEE A;  3T4A C;  4IUP A;  2XVS A;  1VMP A;  1STY A;  1WD0 A;  1ZYR D;  1Y8N B;  3QJY A;  1UAP A;  3S15 B;  4C3I B;  4XQN A;  4L63 B;  2CVR A;  3NE5 B;  4HCE A;  4RHS A;  5EQ0 A;  1H9M A;  3E0J A;  4K8J A;  1V8Q A;  2VXW A;  5I6W A;  5CMD A;  3HG9 A;  4PMW A;  1SYF A;  3HP3 A;  5C6A A;  2F0T A;  4XT1 B;  4MHE A;  1Z6H A;  1PRT D;  1M4V A;  3K59 A;  1JR0 D;  4A3J B;  3HOX B;  2EOT A;  5M5Y B;  4C3J G;  4OIK A;  2HDL A;  5E4X A;  2AWN A;  2Y0S B;  3GTQ B;  1HTP A;  2AQ2 B;  1HUN A;  2HQE A;  1I3Q B;  5JEA J;  4PV1 C;  1DJR D;  2LFN A;  5JVH 3;  2J0T D;  3D3R A;  1CA6 A;  3L7Z C;  1JOR A;  1WTO A;  3D4W A;  3K5O A;  1PTO C;  2A6E D;  4J8Q A;  3QIA A;  1RDP D;  3H6M A;  5EKK A;  1MGS A;  2IX3 A;  1E2V A;  1ENC A;  5I2Y A;  5CBE E;  2C9O A;  1NR2 A;  4KY5 A;  4IFD J;  1QNK A;  3ITP A;  3HKZ B;  2O5I C;  1FNV A;  1SMY D;  5C0X G;  1QIL A;  2DY8 A;  3OMC A;  1MSG A;  2AUJ D;  1IKL A;  3URY A;  1H9S A;  1Y8O B;  3K7A B;  3S16 B;  5IGF A;  3HRZ C;  3G7L A;  3DXJ C;  2Q8T A;  1CQF A;  2BDO A;  4KD4 A;  1LAC A;  2D9U A;  1LT4 D;  1BCP F;  2XN9 C;  1XXG A;  2EYJ A;  2MGS A;  1SNM A;  1L0X B;  3NP8 A;  1EL0 A;  1JQY D;  3I4M B;  2ZXP A;  4PMB A;  2KUM A;  4FF3 A;  3E5S A;  2K5W A;  2PZW A;  1STN A;  5M5X B;  1YNJ C;  1VF7 A;  5FO8 B;  1I4G A;  5C5M A;  2ICE C;  4C3J B;  1CTM A;  4QIW B;  1OXU A;  3FMC A;  5I6Y A;  2EE1 A;  4RA8 A;  3CKI B;  3I90 A;  2WAQ B;  4R8I A;  2JYO A;  1Z47 A;  2WKD A;  3HZX A;  3BDL A;  3J80 L;  5KNB A;  1EY9 A;  3I3C A;  4F8M A;  5C4X B;  3VYU A;  1X32 A;  2EYH A;  5EPJ A;  3K5L A;  3J7A F;  2JP1 A;  1PTO H;  3FEW X;  1TWH B;  5KIX A;  3NQI A;  3HOW B;  5ISR A;  1A2T A;  4HSV A;  2MP1 A;  4M8A A;  2L1B A;  2SEB D;  2B2W A;  1OXT A;  2FIN B;  5JEA H;  1EFI D;  5IGB A;  1SYD A;  1G6Z A;  1RHP A;  4HSP A;  4IUV A;  2HUG A;  1W6J A;  1EQV A;  1O7Y A;  1STE A;  2BA1 A;  2PO4 A;  1AZQ A;  4BWG B;  4OO1 H;  3KLS A;  1CZG A;  5J39 A;  2ZT9 C;  4RFB A;  4A93 B;  1C8C A;  3HOV B;  2I07 B;  1CQV A;  3VA7 A;  1SNO A;  3PUY A;  2BA0 A;  4IFD H;  4ZAI A;  3S2D B;  1PTO B;  5KNC A;  1AZP A;  2X69 A;  3NQT A;  5D3I B;  3NBI A;  1H9R A;  2QKI C;  5FLX L;  1PFN A;  1SYC A;  4OGQ C;  1U4P A;  3MEH A;  3C3L A;  3IFT A;  5DM6 3;  2B2W C;  1HXY D;  2B8F A;  1U9R A;  1E2Z A;  2JXM B;  4ZUJ A;  3I72 A;  2XIW A;  3V05 A;  3KLS X;  5BN4 A;  4G4K A;  5CV6 A;  3MTS A;  2HCC A;  5COR A;  3LWE A;  2QEJ C;  1H9J A;  2F1M A;  1UNS A;  4FXK C;  1U4M A;  2K05 A;  1EWC A;  4CJ0 B;  4IUN A;  3CRK C;  1SAP A;  4KKT A;  2XSC A;  1W6K A;  3J7A V;  2PQE A;  1G8Z D;  5ELF A;  1FYC A;  1CHQ D;  2BCO A;  3T56 B;  5F2D A;  3CU7 A;  2B2V A;  4A3M B;  2PPB C;  3EA6 A;  2KED A;  1TS2 A;  3SK8 A;  3OPO A;  1TY2 A;  4G7O C;  1S5D D;  1ICW A;  5CV7 A;  4BA2 I;  1SND A;  2DN8 A;  1H9S B;  2Z4I A;  3V2T A;  3PO3 B;  1DYQ A;  5TSS A;  1I4Q A;  2WII B;  1EYA A;  3TP5 A;  5E4W C;  3P7J A;  2F0P A;  3NTK A;  1D2B A;  4L8J A;  1F9S A;  1SNC A;  1ESR A;  5CC4 A;  1QCB D;  1ET9 A;  1FNW A;  5I9O A;  1G2S A;  2E75 C;  1Z7T A;  2AWO A;  3MFG A;  4WJW A;  1PFB A;  4QUC A;  1Q1E A;  1C4Q A;  5A2Q E;  5I2X A;  1PTO D;  3OWE B;  1KAB A;  3T51 B;  3QOJ A;  4BY1 B;  2N88 A;  4RGM A;  1TVX A;  2WAC A;  2BE5 C;  2R7Z B;  2B2V C;  1QWY A;  4L6T B;  4KI0 A;  1DOM A;  4B08 A;  3MXP A;  1D1K A;  1ML0 D;  3RD4 A;  2JSO A;  3MFY A;  3M7N A;  2AQ1 B;  5LL6 X;  5A35 A;  5ELB A;  3OOC A;  1S5B D;  2JA6 B;  1LT3 D;  3M3Y B;  3S1M B;  1CM9 A;  4CKC A;  1SNP A;  2K7V A;  3A7L A;  1Q8I A;  3BVM A;  4K8I A;  2ID0 A;  3Q6S A;  4Z9C B;  4K5V A;  4TQU S;  3IL8 A;  2XWB B;  4QB4 A;  1GHJ A;  2EYP A;  2FJ2 A;  2A69 C;  3N52 A;  3P20 A;  1E0B A;  4PNY A;  1RJT A;  4KN7 C;  1XYI A;  1YNJ D;  1R9T B;  3RUZ A;  5K5P A;  2FMM A;  3MWY W;  1CHP D;  3E6Z X;  1ENF A;  2EYO A;  4DN4 M;  3L3O C;  4HR7 B;  3KBG A;  1R4Q B;  5IGG A;  4QUF A;  3MA2 B;  1CK1 A;  5IIF A;  4R9W A;  3TME A;  4FXG C;  1DXM A;  5C44 B;  1YNN D;  4RKB A;  2B2Y A;  1B53 A;  3TP8 A;  3GTJ B;  3VR5 A;  4CGY B;  3RMH A;  1IYU A;  2N55 A;  5FKA C;  2K03 A;  4C3I G;  1S4Z A;  4QF4 A;  2L55 A;  2MJ8 A;  2PW7 A;  4A3I B;  2O5J C;  3SK4 A;  5M5W B;  5IGC A;  1STH A;  4RKL A;  3TSS A;  3DUZ A;  1S5E D;  1SE4 A;  1TS4 A;  3HEJ A;  5EJW A;  3LX0 A;  2QCP X;  5D65 A;  1EY0 A;  4NKL A;  4K5X A;  1PZI D;  2B2Y C;  4OHJ A;  1D1I A;  5IOC A;  4FF4 A;  3BDO A;  2EVB A;  1B9N A;  5AFW A;  2CHB D;  2NN6 H;  2K1B A;  1I6V C;  5D14 A;  3D4D A;  4ZQ3 A;  5M3M B;  3CHB D;  1Y69 U;  3U9O A;  4KN4 C;  4BY7 B;  1SYB A;  1SJE D;  4FVM A;  1D6E C;  1S5C D;  2L11 A;  1GOZ A;  1JIC A;  4Q0F A;  4KKU A;  1C48 A;  1STB A;  3ND9 A;  2PYK A;  1QOH A;  2SNS A;  4A3B B;  5JJZ A;  5KGU A;  2IX0 A;  3WOF A;  1B44 D;  3S1N B;  5HGT A;  1GUS A;  1PFM A;  3C1F A;  4UAI A;  2EPB A;  2DNE A;  4CKE A;  3PUW A;  5EGT A;  4KV6 A;  2XNA C;  2B39 A;  5C3W A;  4OO1 I;  4R8N A;  4IQZ A;  4RGN A;  1MBY A;  1TS3 A;  1WTX A;  2WIN B;  3DWA A;  1EQT A;  3GP7 A;  5DAU A;  2RSN A;  2Z8L A;  5EBD A;  4ME5 A;  4WRD A;  5C0X J;  5DNF A;  1FGB D;  4DGZ A;  1PMR A;  5LL6 S;  2IT1 A;  4KKS A;  4RAU C;  3K0Y A;  1BCP B;  1PXU A;  4JBW A;  1U4R A;  2B63 B;  5M9O A;  3A54 A;  4BS9 A;  1TY0 A;  4IZ8 A;  3FKI B;  1D5M C;  1LTA D;  1UUP A;  4HMJ A;  2BE5 D;  2E2H B;  4BA1 I;  1V43 A;  2R92 B;  1F9P A;  1CZW A;  3GTP B;  4HN7 A;  3N6R A;  3KBX A;  4RH6 A;  5C3E B;  1SYG A;  4KY6 A;  1HA6 A;  4MN3 A;  3SDZ A;  1BO0 A;  2VB3 X;  1KNA A;  3KUP A;  1F2M A;  1LO5 D;  1GJX A;  2NZ1 D;  1KLG D;  2EY5 A;  5E1F A;  2PZU A;  2H1E A;  2KJX A;  4ZLT F;  5ELC A;  1HQM C;  2WKC A;  4ZUI A;  1TT2 A;  1V1O A;  4C56 C;  1WTR A;  3K57 A;  2F0U A;  5CGK A;  1NUC A;  3MAQ A;  4CBV A;  2EY6 A;  2NYZ D;  4CJ1 B;  2M2L A;  1B1Z A;  2O4X A;  4DK1 A;  3IAY A;  3A8K E;  4TKO B;  2A69 D;  2F03 A;  2RBM A;  2DNC A;  1EEF D;  3GTG B;  2LMC B;  1RTO A;  2L4N A;  5JEA G;  3DWP A;  1Q90 A;  1QB5 D;  2EJF C;  2K32 A;  1B4O A;  3QOL A;  3I70 A;  1ILP A;  2KCN A;  2B2T A;  3I8Z A;  4C1N K;  3WOE A;  2VUM B;  1GXD C;  1JWM D;  2KEC A;  4OO1 G;  3CQZ B;  5CYU A;  3TBI B;  1SE3 A;  4XYQ A;  1YNN C;  2V4D A;  2IL8 A;  4IN3 A;  4IFD G;  1ENA A;  3A55 A;  2XWJ B;  1ZKO A;  4XDX A;  2LKV A;  3A8J E;  5EBC A;  3A7A B;  3DEO A;  1H9K A;  1SE2 A;  3JAM E;  2F0N A;  1DCZ A;  2MUY A;  3Q23 A;  1F9Q A;  4X3S A;  1HUM A;  1LT5 D;  1EU4 A;  5E3F A;  3SR1 A;  3Q24 A;  2CQA A;  2B2T C;  3NWS A;  2A68 D;  2EYM A;  2TSS A;  4IUR A;  4V0B A;  5C4Z A;  2E74 C;  1EOT A;  3PUX A;  4LAA A;  3NSW A;  5CV8 A;  4HED A;  1HTL D;  1BR9 A;  1HHV A;  3OHX C;  5ELE A;  1RKN A;  3TP6 A;  3S14 B;  4XQJ A;  1WTW A;  4KJO A;  2B2U A;  2HDM A;  4K6L A;  1CT1 D;  1DOK A;  4QCL A;  1TWC B;  3DWQ A;  3VYS A;  1DOL A;  2D5D A;  1JWU D;  3NUC A;  4ID6 A;  4K2K A;  2ZXR A;  2SNM A;  2F0G A;  3FPP A;  3QG1 A;  5COY A;  2WP8 J;  4DNT B;  2QF7 A;  1GUG A;  4BBS B;  3RLF A;  2C5C A;  1GUN A;  1JOK A;  1IKM A;  4A3K B;  4HTH A;  1NSN S;  4RCN A;  3J7Y W;  2F0F A;  5JAV A;  3GV6 A;  3J81 E;  1IYV A;  3I4N B;  1EIH A;  4XT3 B;  1OO9 B;  5EPK A;  1K83 B;  5JOB A;  2JA7 B;  4O42 A;  4TRD A;  3EQL C;  2B2U C;  1AP0 A;  4DU9 A;  2K01 A;  4J6H A;  4JK1 C;  2BDN A;  4DXG A;  3RZO B;  2RA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...