1HA6A

Nmr solution structure of murine ccl20/mip-3a chemokine
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of Murine Ccl20/Mip3-A, a Chemiokine that Specifically Chemoattracs Immature Dendritic Cells and Lymphocytes Through its Highly Specific Interaction with the Beta-Chemokine Receptor Ccr6
pubmed doi rcsb
molecule tags Immune system
molecule keywords MACROPHAGE INFLAMMATORY PROTEIN 3 ALPHA
total genus 9
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ha6A00
4HCSA 2N55A 5AFWA 3I90A 2DY8A 2JP1A 1WTXA 2FHTA 3QO2A 1G6ZA 1AP0A 2B2WA 1B50A 1QNKA 1RTNA 1X3PA 5E4XA 1HHVA 1X3QA 1U4PA 1VMCA 1MI2A 1EL0A 1A15A 4CJ0B 1WD1A 1SAPA 5JJZA 1DONA 1G2TA 1IKLA 1WD0A 2Q8TA 1B4OA 1TVXA 2K1BA 2L9HA 1HA6A 5EJWA 1GUWA 2R3ZA 2K05A 3DEPA 3I91A 4ZLTF 3IL8A 3MWYW 2B2YC 2MP1A 4HSVA 4IUQA 1DZ1A 4UAIA 1ICWA 2RA4A 1PFBA 1BNZA 2NZ1D 1EIHA 4OIKA 1RJTA 2B2VC 1B53A 2L12A 4QUFA 4ZK9B 3IFDA 1F9PA 2KEEA 2L11A 3TZDA 1F2LA 2RSNA 4HEDA 4ZKCB 1Q3LA 1HUMA 2KECA 4LMQD 4ZAIA 1ILQA 1ILPA 1BBXC 3DEOA 3DM1A 4IUVA 4IUPA 4QUCA 5D65A 1ZXTA 1QG7A 1SDFA 1G91A 4U68A 2MPMA 2L1BA 3GV3A 1EIGA 1MGSA 1MSGA 1XX8A 2X69A 3MTSA 4NW2A 4XT3B 1F9QA 3R93A 4R9WA 2FINB 1CA5A 5EPKA 2D9UA 2KVMA 4R8IA 3GV6A 2JYOA 1U4RA 2KEDA 2L4NA 3FPUB 5CORA 3D6WA 1BO0A 2B2TA 2B2WC 2EPBA 2B2YA 2KOLA 2NWGA 3G7LA 1ML0D 1S4ZA 2IL8A 2K04A 2MJ8A 3Q6SA 2K28A 5EQ0A 1HRJA 1NAPA 4XDXA 1BF4A 1NR2A 2FJ2A 4O42A 5EPLA 2K03A 5DNFA 1SSOA 3I8ZA 3UI2A 4IURA 2K01A 5EPJA 2X6GA 1ESRA 1WTPA 3F2UA 2H1EA 1G2SA 1DOKA 2B2TC 4X3TA 2FFKB 1WTRA 1F9SA 1RODA 1XYIA 1KNAA 3ONAB 1PFNA 1E0BA 1F9RA 1PFMA 2HCCA 1AZQA 1CM9A 4X3SA 1U4LA 3TN2A 1RHPA 1C8CA 1CA6A 4X3UA 4DN4M 2RVLA 2J7ZA 2HCIA 3KUPA 5CBAE 1WTOA 4CJ2C 1QE6A 2HUGA 1HFNA 1U4MA 2FMMA 2EOTA 1J8IA 3KBXA 4RWSC 1O7YA 3H91A 1M8AA 1WTWA 5CBEE 1WTVA 1O7ZA 1B3AA 2B2VA 4HAEA 4RA8A 1EQTA 2Q8RE 2X6LA 3HP3A 4RAUC 3LWEA 1IL8A 2NYZD 1JICA 1X32A 2CVRA 1WVLA 2BDNA 5T1IA 3N52A 3FDTA 1HFGA 1NCVA 3SVMA 2MGSA 5T1GA 2HDLA 1PLFA 1WTQA 4CJ1B 1DOLA 1NR4A 1RTOA 1VMPA 2M2LA 3I3CA 2HDMA 2N88A 1EOTA 4IUTA 1B2TA 1HUNA 4XT1B 2DY7A 5D14A 1KNEA 4OIJA 2SDFA 1JE4A 2XIWA 4IUUA 1DOMA 2RSOA 5COYA 1J9OA 1O80A 2EE1A 4MHEA 1MSHA 3P7JA 4ZKBB 2KUMA 1PDQA 2VXWA 1LV9A 1IKMA 4MN3A 5EKIA 1AZPA 2B2UC 5CMDA 5E4WC 2B2UA 4X3KA
chains in the Genus database with same CATH superfamily
1PH2A 4TQUS 1XJVA 4KJOA 1K28A 3QO2A 2R93H 3ULLA 5H1SE 3SK6A 1QNKA 5CV4A 1VQ5A 1RKNA 1WTHA 1X3QA 4IOCA 2F3WA 2TSSA 1D1IA 4DV0L 2UUCL 1FL0A 1V1OA 4GOPB 4XTCS 1JB7A 2ATWA 1Y1VH 1Y1WB 5C0XG 3A8IE 1N34L 2L12A 3HOYB 4RH6A 2A69C 2EY5A 2JSOA 4RCOA 1VQIA 4DK6C 1ILQA 3FVQA 4HJ9A 4JI6Q 3HOYH 3A0JA 2Q2TA 1FR3A 5L37A 4NW2A 1QZGA 5AJ3L 2K6AA 3HOZG 1Q82C 1Y8PB 2L0CA 2NUCA 4IPHA 1Q86C 1I94Q 2A6EC 5CV6A 1S4ZA 1G291 4DF7A 1E2WA 2WINB 3NSWA 2ZJQA 1EWCA 4XQQA 1SLJA 1YNNC 1A3TA 1Q1BA 4DR2Q 4A3MH 3S14H 4A3BH 2R92G 4CBVA 5CV9A 4C3HB 3OPOA 1RODA 1LO5D 1TWAB 1PFNA 1H9MA 1JOKA 3HS0C 3S1NB 2NVXH 2JA8B 2K7VA 2VB2X 2WFWA 3MEHA 1NNXA 4YCUA 1TWCB 2KBNA 1A6XA 4CJ2C 4WORA 1GXDC 1ASYA 4UP8A 1PRTB 4C3HH 1JR0D 3MAQA 2VQEQ 3FEWX 5TSSA 2HD3A 3J81L 3AFQA 1VQJA 2CVRA 2UXDL 1HFGA 1VQBA 2BDOA 1AE3A 1R4QB 1PLFA 1ESFA 3MXNB 1VQCA 1GUOA 2A1AA 2KA7A 5CGKA 3OOCA 3Q24A 2UXDQ 3J80L 5ELNA 3TS2A 4OO1H 2DGYA 1KNEA 1VQFA 2D5DA 2A6HD 2OWOA 3CCEA 1YITA 3Q0AA 5IGFA 1S5BD 1WTXA 1GD7A 1K0RA 3CC4A 4BBRG 1X3PA 1GO3E 1B8AA 3GTOB 4KTAA 5FO8B 3TBIB 1KABA 1G2TA 2AWNA 4HIMA 1RL2A 2K14A 4UAIA 5GAHC 1CK1A 5C4JH 4JI2L 3HZXA 3HOXB 1BCPC 1RF2D 4F7XA 4BBSB 3URYA 4ZAIA 3QJYA 1VQ9A 2ICIA 3QG1A 4IN3A 5C3XA 3ICEA 2D2CC 3D6CA 5IGDA 4R9WA 3GTKH 5EPKA 2KVMA 3CMAA 5GADC 4EQOA 1F2YA 2B2WC 3G7LA 2NWGA 4B08A 1OO9B 2CWPA 1I4RA 1VQ8A 4H02A 5JEAG 4A76A 5M3MG 1NJIC 5HY6A 3J81j 5FOBB 5CR3A 4BWGB 1CFMA 4DA2A 3K5LA 4OEMB 3U4ZA 3SR1A 4UPAA 5I9PA 1XMOQ 4LNQA 1U4MA 2K33A 5EAYA 4POGA 1YHBA 5JJKA 1EQTA 2NB0A 1EZ6A 3Q22A 2KHSA 3PUWA 3JAML 2XTIA 3T13A 3M9BA 3A5ZB 4QJFA 3I55A 3HKZG 5JVG3 4DR5Q 4LF6Q 2IJ0A 3J7ZC 3PUYA 5C3EH 1EQQA 3OW2A 1NR4A 5IT9c 2EIFA 2NVYB 2MFIA 5FK9C 2Q2IA 4N9TA 1GUTA 3KK7A 4IUUA 1T5XD 4WJ3M 4WRDA 1MJEA 3MXNA 1I4QA 2RF4A 3VA5A 4IPDA 3CRLC 3MVVA 2G5DA 2IHFA 4CGYB 4EVOA 3TP6A 4TSSA 3H0GH 3L3OC 4KHZA 1CSQA 4LFBL 1HQMC 2EYOA 1FNVA 3VR5A 4RKBA 4JG2A 3QWNA 3HKSA 1EL0A 4QB4A 3GTQB 4DR4L 2F52A 1LTID 2CKZB 1CKNA 3F2DA 4XQNA 4BY1B 1HA6A 4DAYB 3I91A 1QCBD 3BZDB 4MTKA 3GTLH 1SJHD 3NTKA 5J22A 1TWGH 3NBHB 3RLFA 4KK7A 1TT2A 5C44G 3TP7A 1Q90A 1KQSA 3NE5B 1PZID 4N8X1 3T4AC 4YCVA 1HH2P 3R2TA 5D65A 2NTSA 1G91A 4IJLA 1HTLD 1XXGA 3C2PA 1UE5A 3CP0A 3NHHA 5DLQE 4R8IA 1U4RA 2E75C 3D6WA 4LJZC 5HGQA 4BY7H 3MXGA 4I7AA 2PPBC 4GN4B 2AWOA 2VNUD 5C4JB 4CDFC 2CFMA 4DV5L 1STEA 4DXFA 3NBHA 1AN8A 3T51B 3H3VC 4A3EH 5CYUA 1E2ZA 3TRZA 1E0BA 4BBRH 1X9NA 1IYJB 1PTOB 1U4LA 3TN2A 1EOVA 1RHPA 3GTOH 3J81c 2PW5A 2VY3A 4LFAQ 3E0EA 1Z47A 2MHVA 2AQ3B 2YTYA 4C3JB 3GTLB 2SNMA 4BS9A 2YTXA 4NPSA 2DN8A 2GN5A 1JQYD 2I07B 3S1RB 4YWKA 3PCOB 2UUAL 1UE7A 3GTQH 1JICA 3EIVA 5M3FH 1WVLA 3KBGA 1NCVA 1XMQQ 2VB3X 4JC0A 2OEOA 4OO1I 2PQEA 4JI5L 1B9NA 1KDAA 1LTBD 1Q12A 3J80i 3AFPA 3TSSA 2AMCB 1N34Q 3BDLA 3S15B 3E9HA 4RKLA 3H3VH 3HOWB 2EYMA 5KNDA 1EUJA 2VXWA 2H5XA 4X3KA 2N3SA 1LTTD 4AYBB 2VQEL 1DJRD 4LAAA 1IW7D 1EQRA 2JE6I 4GKJQ 1II3A 1B50A 5CV5A 5E7NA 4DR7L 1SMYC 1A15A 4FF2A 1PFSA 1VQLA 3QOJA 2XRSD 5C0XI 2CHBD 4TVAB 4DK3C 1A3UA 3EN2A 1OXVA 4DR2L 5LL6S 4HJ8A 4HTHA 4X64Q 1I6HH 1I50H 4A3JG 4ALPA 1UAPA 2JK8A 4RGTA 4B3SL 3VR4A 4DV7Q 2OTJA 1GUGA 1NSNS 1S72A 1R9TH 2N8NA 3K5NA 5IODA 5M9OA 1C9OA 5J3BA 1KXLA 5DEHA 5LMNQ 2JA7G 4NMZA 2ZJRA 1BXTA 3CU7A 2Y0SB 4BY1H 3ERQA 2JA6B 4FO2A 4A3FB 1HRJA 3OWEB 4C3JH 4P74A 2FJ2A 3CC7A 1QZHA 1WTPA 4C1NI 2H1EA 3KLRA 2H4OA 1DM0B 4G7ZC 2R7DA 3D4DA 3HOXH 3IRBA 4DV1L 5GAGC 1XTCD 2HCCA 4DV0Q 4FXKC 1AZQA 1IBKL 2QGQA 3CXCA 5KNCA 3A54A 5NUCA 1PTOD 2DJGC 1QE6A 3MHBA 2G9DA 2NVQH 4A3GG 3H91A 4IOAA 5FO7B 2F4VQ 1TS3A 2LXKA 2KENA 2RDHA 2X6LA 2PMZE 3SEBA 1O7IA 2UXBL 2ZTEA 4A3MG 1EYCA 3SVMA 1OTCA 1YHQA 4PV1C 4X66L 3PGZA 3BDOA 1VMPA 4F88A 5IYCH 4MZ9A 1GM5A 4KHPQ 1I4GA 3EBEA 3DWPA 1N36Q 2LS01 2XIWA 1JCKB 4S3SA 5M5WB 5COYA 5C44H 1L1OB 1J9OA 1MSHA 4ZKBB 3AU7A 1LV9A 2B3GA 2FXQA 1IKMA 2ZXRA 3FKIG 4GN3B 3EVQA 4JV5L 4B3RQ 1AH9A 4N8FA 4DUZQ 4A3IG 1KTKA 3BJUA 4X62L 1FJGQ 4RMFA 1FGUA 2NN6H 4DUYQ 4JPBW 3NQTA 5ELEA 4YHHQ 1L2FA 3RD4A 1SAPA 5HGTA 2L9HA 2R7FA 2XRQD 5LL6X 2LKVA 4NB3A 5M5YB 3IL8A 5BN5A 1TKWB 2I5LX 1PFBA 1Y14B 4A3FG 4P2CB 2ENBA 2V1CC 4C3IB 1ONLA 4DAMA 3HOVG 1F9PA 2BCOA 3I4NH 2RCNA 1E3PA 3UE0A 4PZ6A 2F0TA 5FO9B 3DM1A 3S1QH 2NVYH 5C0XH 1SDFA 3B6YA 4U68A 3NUCA 1B7YB 3N6RA 1YEZA 2ICEC 2IX3A 2FINB 4JBWA 3VYSA 4CHTB 3OHXC 4H13C 3GV6A 3KLSX 2YYZA 4ZCKA 4B3RL 3WOFA 1STAA 3M85A 5EQ0A 4FXDA 3BYTB 4PG3A 5JAVA 4X6AH 2PW7A 4KLKA 3CCMA 2OTLA 2K50A 5IGCA 4IURA 4AH6A 4A93G 5J39A 1CUKA 4KKTA 4HJ5A 1SFOH 3NEMA 4ODGA 3ONAB 4B3MQ 4X66Q 1LT5D 3SK8A 2B63H 1PH4A 4K8JA 3MC0B 4A3BG 2UXBQ 2VS1A 4CDDC 2ES2A 1RIPA 2J7ZA 2EVBA 4LF7Q 3KFUA 3KLSA 1O7YA 1IXRA 1GUNA 1M8AA 1V1PB 1PA6A 2JA7B 1YHAA 2SNSA 1T9HA 1D1KA 5IYDG 2KJXA 1W2BA 3N52A 3G4SA 2XN9C 4Y7NB 4DV1Q 1WTQA 1A62A 3R8BA 3BZCA 2ZM6L 3S2DH 2HDMA 1X3EA 1VF7A 4A4IA 4YCWA 2B29A 3L0OA 2K5WA 4J15A 5C4ZA 3W2DA 5ISRA 1LABA 2KUMA 1K9MC 2E2DC 2VQFQ 1HNXQ 1B44D 4ZYSA 3I72A 3J80E 2JXMB 3MA2B 4DNTB 1QJOA 4DAVA 1I3QB 3A7AB 4DV3L 4AYBE 1LTAD 2DNCA 1BCPF 2E5LL 2Z0SA 5I6WA 1IKLA 2OT2A 3OIQA 5KEEA 1VQNA 4I7ZC 1VQHA 1DYQA 4FF3A 2BE5C 4IUQA 2I46A 3OTOL 4HIKA 4FVMA 4X64L 2RA4A 5FJ8H 1D2BA 4CDEC 4GKKL 4PMBA 1QOHA 4MNOA 3IFDA 1SYCA 4EQNA 1PH7A 5ELOA 4IO9A 3NELA 1X56A 1N8RC 4GLXA 1FGBD 1SE2A 1JC7A 4IPCA 4Y52H 4DR7Q 4FYDA 2KCTA 3JAMi 5JPNC 3I2ZA 2L15A 4R1JA 4HSPA 1AEXA 4JI0L 3RR5A 4DV2Q 4UHVA 4EQ5A 1EWIA 1L1OA 2VW9A 1BF4A 3ITPA 1Q8KA 1F77A 1SSOA 3KOJA 2IWHA 2NVTH 1RD9D 2B2TC 2WACA 1PH3A 2CCZA 2K5HA 1QVCA 2MO0A 1UEBA 1F9RA 2NN6G 1GVPA 3U9OA 5IOCA 4DR1Q 2RVLA 2J0TD 4JI7L 1K73C 1BKBA 3D4WA 2AUKA 1J8IA 3KF6A 4RWSC 4JBMA 2WAQE 2F3VA 1GKHA 3CQZB 3A8JE 1CZWA 4RHRA 1QILA 4DU9A 1LUZA 2EYPA 3OMCA 3UDFA 1EY6A 1SYEA 4BBRB 1QNUA 2A68C 2UU9L 2Z6KA 3PIO3 3BG3A 4L6TB 1XPUA 4ILWA 4X62Q 2PQAA 1WOCA 1DOMA 3A55A 2R92B 3I4NG 2EE1A 2Z4IA 1SRUA 1Y1VB 1SROA 2K4KA 1HZBA 1I50B 1JWMD 1QB5D 1WCMH 3X3MA 2WKDA 1TXYA 4ID6A 2NVQB 4BBSH 1BR9A 4DNRB 3WDNA 5BR8L 3LGJA 4X65Q 3EQLC 3IKJA 1SNMA 2K5VA 3V2TA 3KDFA 2A5HA 2OQKA 4O1NA 3I7FA 3MWYW 4ULLA 1DZ1A 2F4VL 4WFN3 1VQOA 4FXGC 1RJTA 2UXCL 1SR3A 2F0FA 2PZWA 4OWTB 3K7UC 2NZHA 4FF1A 4OGQC 4RGMA 3VR6A 3E9IA 2B63B 4AQYL 2VZAA 4IJHA 3S2HH 5EKKA 4K5XA 4B9WA 4QUCA 3E6ZX 4MIUA 1YIJA 3LX0A 3W3AA 2RDGA 3BVZA 1MGSA 1MSGA 1PH9A 3A56A 4QL5A 4DV3Q 4U673 2F3IA 3AMUA 2WV6D 4K5WA 3JAMc 1Q46A 5T1GA 5KNBA 1OXSC 3Q6SA 3PIOA 1D8LA 1L0XB 3I8ZA 4NP5A 3UI2A 2KCMA 4JI3Q 3P20A 4RG1A 5LMNL 3H0GG 3OIPA 1K83B 1TY0A 1YNND 2Z6BA 2MQHA 3K0YA 3G71A 4A3KG 4QMGA 4DV7L 2ZM6Q 1QVGA 1CA6A 3J7A5 1Z6HA 3L2PA 2IX1A 2JA6G 4DN4M 4ABNA 1EY8A 2HCIA 1XPOA 4CKCA 3D8GA 5J1ZA 3HOZB 4AQYQ 4DR6L 1LYLA 1JJCB 5D3DA 3PO3H 3T16A 1WTWA 2JJQA 5IT9L 2B2VA 3MFYA 4BA2I 1S5CD 3HP3A 1X32A 3ERSX 4RFBA 2RCFA 5T1IA 4RCNA 1PVOA 3S14B 1PH8A 4CJ1B 4DR3L 3UDIA 3STBD 3PUXA 4LW1A 5IY0A 3HOVB 5M3FG 2A74C 4OIJA 2AQ2B 1JE4A 2F0HA 4MHEA 1BBUA 2QCPX 1PDQA 1SYDA 3RZOB 1EEFD 1KIXA 4LFCQ 3PO3G 2JA9A 2AKWB 1CQFA 3RUZA 4XXEA 2PCFB 2RDFA 1EY7A 5AFWA 2N55A 4WJWA 2NZOA 5M3FB 1WYDA 4BA1I 2FHTA 3AQQA 2OXPA 3DMUA 3LWUA 2F4IA 1H9SA 1X3FA 2SEBD 4RGOS 1ZKOA 1EY4A 5CV7A 1SE4A 2UUBQ 3FPPA 5IT9E 2R3ZA 2K05A 1HA5A 1PYWD 2MP1A 1JWSD 1C0AA 4GOPA 1X3GA 2PNRC 2NZ1D 1D5ZC 2Y0SG 4OX9Q 5D3IB 3GDEA 4KY7A 4BY7B 1GUSA 1MKHA 2RSNA 4HEDA 5BN3A 5FLMH 3K59A 4JI7Q 3I4NB 3DEOA 4IUPA 2C9OA 4DR1L 1Q1EA 1Y1VG 1PRTF 4C3IH 4GNXC 2CQOA 3S1QB 2XWJB 1TU2B 3T1HQ 2RHSB 3S16B 4RHSA 5IGBA 4K8IA 4DKAC 1SBBB 2A73B 1XTDA 1EEID 1CZGA 2KEDA 2BA1A 1XNQQ 2F1MA 4CKEA 2K28A 4JW0A 2E8GA 3BDCA 3JAME 3NXWA 4ZRZA 1U9RA 4EX5A 4GZYC 5JJLA 4I65A 3U9SA 3CCSA 3NTHA 3TDQA 1A63A 4N9PA 1IHZA 1PTOF 1V43A 1PZJD 1MHWC 4G57A 4KN7C 1WTOA 2HUGA 3OSOA 2D62A 1PYBA 2EOTA 1IYVA 3PMFA 5CBEE 3MZ5A 3HOWG 1TS5A 2QF7A 2XSCA 1LLRD 3K8AA 2O5JC 2ZTDA 2XVSA 1AW7A 2JA5B 3S1NH 5DAUA 1IBKQ 4JI1L 2F0DA 4ZUJA 2DUDA 1OXXK 1EOTA 4IUTA 1TQOA 4LFBQ 5D14A 1QUQA 3HGBA 1F2MA 3C1FA 3FMCA 1EU4A 3HFZB 4QIWB 3C46A 3P7JA 2D0OA 2K52A 2Q2UA 4R4IA 3VR2A 1P16A 2F0OA 2F03A 4JBKA 5E4WC 3H09A 2RKSA 3RLNA 3VYTA 1PHJA 4A3DB 1GOZA 5A2QL 5AJ3Q 3CCUA 4HIOA 2E2IB 4G7OC 3FKIH 4UY8C 1QWYA 4F8MA 2XGTA 4DR5L 4LF6L 3I4MH 3WOEA 2Z9HA 4H0LC 1K8OA 2BH8A 3K57A 1Q81C 5JJIA 5JOBA 2ZT9C 2A6ED 3U4VA 2C35B 1JB3A 4A3FH 1EIHA 1XMOL 4L5RC 2B8GA 1TWGB 4WJ4A 4A3EG 1PZKD 4DK0A 3TZDA 3M4QA 4PMCA 3TP5A 3KF6B 3BYYB 4JVZA 3GTPH 1H9SB 4GN5A 2B39A 3CKIB 1HZ9A 3CQZH 3WWVA 4FDBA 1SFOB 1FD7D 2HIXA 1OXUA 1L0WA 1YNJD 3NP8A 1Q7YC 4GKJL 4IFDG 2OQ0A 2L4NA 4IALA 2MUYA 3CCRA 5FJ8G 4FF4A 2R6GA 4JYAQ 1M1KC 3J7YW 3PO2G 5IE8A 3GTMB 5EPLA 3CCLA 3W1BA 5E3FA 4X3TA 1HNZL 3U50C 1EFID 1XYIA 2R7ZG 1K3RA 1JMCA 1B1ZA 3K80C 5KYLA 1XMQL 3HOUH 4OONA 4L5SA 2F0KA 4DV6Q 1E22A 4LWCA 4JI2Q 2UUAQ 3M7GA 3KBXA 3PF4A 1MJCA 1SE8A 2LXJA 3C3LA 2PNHA 2BH2A 1B3AA 4GLAC 2PI2A 3ER0A 3BZKA 4RA8A 2EYHA 4F87A 3QB3A 1MIUA 4JBJA 5C0XJ 4A3DG 3V05A 1M90C 1RTOA 5IGGA 1W6KA 3J80c 1UE1A 4XT1B 4ME5A 1FJGL 3HOVH 1AE2A 5JPMC 1D5XC 1B3QA 1O80A 2D0PA 4R4TA 4MN3A 1G51A 4KY5A 4JV5Q 3S1MH 4C3IG 3RN5A 4BY7G 5C4XH 4HCSA 3KJOA 4IZ8A 2R61A 4A3EB 3D0FA 2AQ1B 5FLXc 2QW7A 1Z9FA 1FYCA 5IIFA 4DGZA 2YTVA 3R2IA 3GTGH 2LMCB 3UDGA 1GHJA 1IW7C 1B9MA 1C7YA 5EJWA 3GTMH 4JYAL 3EA6A 3MXUA 1NBWA 4LUVA 4GOPC 1ICWA 2EY1A 3X3NA 1HNWL 1SMYD 2QEJC 3VDYA 2IY5B 4A3LG 1CSPA 2RQXA 1EFWA 2R7ZB 1U0LA 1QG7A 1X65A 4A93B 2MPMA 1VS0A 3SE0A 1VQDA 2RBMA 1XX8A 5EKLA 1A2UA 3K5OA 4ME3A 4NXNQ 3J7AF 4K0KQ 5M5WH 2KOLA 2K04A 4Q0FA 4R4CA 5E1FA 1I94L 2PQAB 2K5DA 5DNFA 3L9AX 3S2HB 1CKMA 4L5TA 2EZVA 2Z8LA 1VQEA 1UE6A 3I4MB 4DV6L 3TP8A 3E0JA 4PNYA 2F0PA 1E2VA 1PH5A 1F9SA 1KNAA 1SJED 1HJPA 2NBFA 1R9TB 4X3SA 2Z6KC 3O13A 1H9JA 4A3DH 1HTPA 1U5KA 1VQMA 3CF5A 1HPCA 5LMNW 5DM73 3NWTA 2FMCA 4K0KL 3DXJC 1IL2A 4NXNL 1O7ZA 1BDOA 1TS4A 3J81E 3ZJYC 2LFNA 1CHPD 2QA4A 3HOZH 3MXPA 2JA5H 4A3KB 1CKNB 1DD2A 2N88A 1VQKA 4LF4L 4Q5VA 3G48A 1W6JA 1YJ9A 3DM3A 3A74A 3NK9A 1VQ7A 1GHKA 1JJ2A 2JA6H 2F0NA 3DLLA 4YIJA 4LF8L 3R3OA 4A3CG 3GTJH 1JT8A 1K8MA 1YNJC 1WCMG 2BOSA 3CAMA 5F2DA 5I2XA 4BXXH 2B2UA 2AHOB 2F0JA 4A3GB 1N33L 1SNQA 2EYLA 1PYSB 2VL6A 3BU2A 4KJNA 4IFDH 4HMJA 3I70A 1S5ED 2JA5G 5C4HA 1SYGA 1K8GA 3IFTA 3A5UA 3HG9A 1TVXA 3M3YH 3RMHA 4QIWE 2ALYB 4K6LA 1PRTC 4M1UB 1ZYRD 2A6HC 4HSVA 1V1QA 1KDBA 2ID0A 1EQVA 1TIID 4OIKA 4BXXG 4DV4L 3PSIA 1TWHB 1CQVA 3F8TA 3T1HL 1TWAH 1HR0W 4DPGA 3I4MG 1EIFA 4L8JA 3E3XA 3KLWA 4FNFA 2X69A 3MTSA 2E2JB 2CQAA 2Z1CA 1CA5A 4P73A 2HT1A 2D9UA 4P71A 2YU9B 3BVGA 4PMWA 2A68D 2EPBA 4PZ8A 4DV5Q 2R93B 3KDFB 4A3JB 3M4OB 1HNWQ 3TEHB 2PYKA 1XNRQ 1TWHH 1LTSD 5C4XG 4KD4A 1ENAA 1S3OA 4C3JG 3A8KE 1HNZQ 2ZTCA 3H15A 4DAYA 2EJFC 5M5XH 5IYBH 1STNA 1CT1D 1YBYA 5CBAE 1IYUA 3AB9A 1SEBD 1EU3A 3FRPB 2ASBA 4TKOB 3PO2H 2FMMA 1VCIA 2N78A 1RDPD 3M4PA 4QY7A 1PXUA 5EBCA 3F2BA 1SYBA 3DWAA 2YV5A 4ZQ3A 1X55A 1ZEQX 2EY2A 3DHQA 3GTKB 5EGTA 1OXTA 4IPGA 2L5TA 2KCNA 4HJAA 3P75A 2EXZA 2SDFA 1B70B 1LTGD 1SN8A 3GTJB 1STYA 3OWFA 3K6OA 2NVXB 5EKIA 1WFQA 4DR6Q 2IHEA 2B2UC 5CMDA 3OYYA 3W5OA 3H3VI 1E24A 4KKSA 4HR7B 2JA8H 2QEXA 1AP0A 5M3MH 2B63G 4LUZA 1D5MC 3K0XA 5JEAJ 1UEAB 5E4XA 2WAQB 3OW7A 2K75A 3GQBA 4JI3L 1WD0A 4AYBG 5C5MA 3K58A 1B4OA 2K1BA 4OO1G 3DEPA 4CDCC 5GAEC 3A7LA 2EDGA 5KGUA 1L1OC 4V190 1JJGA 4QUFA 2EQSA 3BS1A 3G6JB 2KEEA 1K0SA 2L11A 1KC8C 5FLMG 4K6DA 4LMQD 4JI1Q 1Y8OB 1ZXTA 2IT1A 4KKUA 3M4YA 5C3WA 3R93A 2V4DA 3HOUG 4NDXA 3G6EA 2Z4HA 3GTPB 2JYOA 4AIMA 3FPUB 4GNXB 5CORA 5IYBG 4XDXA 1ASZA 1HXYD 1H9KA 3CCQA 1NR2A 3HEJA 3U58A 1EWHA 3TS0A 4QCLA 3PQIA 3CPWA 1VQPA 2K32A 4UP7A 3ND9A 1BVSA 2E76C 3SGIA 2F0SA 3SHLA 4QGUA 4JI8Q 3SDZA 5ELBA 3NTIA 2J4XA 4NKLA 3GTGB 1VQ4A 1WTVA 1ZYRC 4POFA 3SXHA 4CKBA 4HAEA 1PRTD 4GS3A 2Q8RE 4EQPA 2CH4A 2QILA 2UU9Q 4IQZA 1V8QA 2WAQG 2CW0C 2M2LA 5IWAQ 3I3CA 1PH6A 1H95A 3S15H 1PTOC 1D7QA 4P72A 2LY7A 4ZUIA 3NQIA 1WJJA 1AZPA 3KF8A 1PH1A 3M7NA 2WKCA 3EROA 1BBXC 2NN6I 2UXCQ 5FKAC 4J1MA 3CCJA 4B3TL 2DY8A 2E2HH 2UUBL 1STHA 2Q2HA 1WI5A 3VR3A 5A2QE 1RTNA 3HKZB 3Q8DA 1MI2A 1YZ6A 1NMFA 5LHY1 4X65L 4CJ0B 5C3EG 1DONA 2F0IA 3ULPA 2Q8TA 5BR8Q 2F0GA 3HOUB 5I9OA 2O2LD 1CHQD 2Q8IB 5ELFA 4LFCL 1BNZA 4DV2L 2K5NA 4KY6A 1B53A 3ULJA 1BCPB 4K2KA 5LMUQ 2F0QA 1I4PA 3H6MA 4A75A 1VQGA 1XNQL 4IUNA 4IUVA 4A3KH 1EY5A 1AFPA 3T1YQ 3PF5A 3S16H 4H7BA 3CPFA 3ND8A 1ET6A 3GD7A 1O78A 4YWMA 4KV6A 2EJMA 4B3TQ 4YWLA 3HRZC 1EYAA 1D6EC 1NAPA 3HOXG 2EJGC 4OX9L 4K2LA 4KI0A 3K7AH 2F0EA 2GVBA 2IX0A 3ZYYX 3D3RA 3GP7A 1LTLA 5GQOA 5EPJA 1ESRA 3S24A 4JCVE 5A35A 1G2SA 3TREA 1PTOH 3VYRA 3PIP3 2EY6A 1PFMA 4Z9CB 4R8NA 5IGEA 4JI6L 5M5XB 4C2MB 3PO2B 1BCPD 1XWEA 2VQFL 4XYQA 1HNXL 2VUMG 3TMEA 3K7AB 4C3HG 1IBLQ 1G8ZD 3FKIB 3I4LA 3KYHC 4JI8L 1M4VA 4G4KA 1KL9A 2ZXPA 3T53B 3IAYA 2NYZD 2R93G 2VUMB 4A3JH 3FDTA 3W1GA 4OWXB 2HDLA 4R4OA 2UUCQ 4C56C 2WB1E 2PI2E 2OF1A 3UE1A 2SOBA 3MEFA 1HUNA 1DCZA 3M4OH 1QUQB 2I0QA 2NVTB 2HHHQ 4DR3Q 4A3IH 3T56B 2TMPA 4V0BA 1BOSA 2E2JH 2HIVA 3RN2A 3STBC 3F1ZA 4APVA 3RLOA 3I56A 1Y1WG 1VDZA 3K81C 1TR5A 4L63B 2HHHL 1SNPA 3FP9A 3OTOQ 4FP5D 3S1RH 2PMZB 1HHVA 4R4QA 1U4PA 3QIAA 4LK1C 4OHJA 1KLGD 5JJZA 3JC66 4PQXA 2E74C 1K83H 1A0IA 3TQYA 3J81i 5C4XB 1EY9A 1BBWA 1JWUD 4ZLTF 1IBLL 1KRSA 1FNUA 1IBML 5KIXA 4IFDI 1MBYA 2A69D 3D31A 4H44C 1YVCA 2R7ZH 4A3GH 4OL7A 2OCEA 3I4OA 5C6AA 3S9WA 1NY4A 1HR0L 4LUOA 1EIGA 2CW0D 3FHWA 3GO5A 1N32L 1JOOA 2JQOA 5BN4A 1Q8IA 4PZ7A 2Y0SE 1CKOA 1BO0A 2M9VA 4QF4A 1G6PA 1SNCA 2IL8A 4EGVA 2JEBI 1F2ZA 1HZAA 4GLVB 5IP7H 1J5EQ 2QDLA 4JI4Q 4O42A 4A3MB 2X6GA 2BE5D 3EJIA 2EYJA 2DJFC 1EY0A 4L5QA 1GJXA 3Q23A 3HOYG 4LF9L 1LT3D 4B3ML 1SXTA 1SNDA 2JA7H 2F0UA 3S17H 1DXMA 1KRTA 4K14A 5K5PA 4YY3Q 5K36H 4TRDA 2WB1B 4NXMQ 1I5FA 4JI0Q 1STGA 3EFXD 4YY3L 2E2HB 3BVMA 1A8VA 1IL8A 5IYDH 3H0GB 4JOIC 4HN7A 4KHVA 1W3SA 2G9HD 1BUVT 1Y1WH 2MGSA 5CC4A 1DOLA 4G7HC 5C5LA 1KAWA 4LF9Q 1B2TA 4K5VA 3P1HA 2DY7A 2A19A 1I4HA 3S17B 3OMGA 2O5IC 2QKIC 1ET9A 4GKKQ 1CTMA 4XQJA 5FLXL 2IW3A 2F0WA 1BQQT 4GNXA 4JI4L 5K36G 3I73A 2O4XA 4HCEA 1J5EL 3NPPA 3CC2A 4A93H 3I90A 2GA4B 2JP1A 4P75A 1G6ZA 2B2WA 1N32Q 1CI3M 4UP9A 1SYFA 2MNAA 4RGNA 2L55A 1FVIA 3PUZA 3CD6A 3KJPA 5ELCA 4KD3A 2PZUA 4MTNA 2EXDA 3E5SA 1WCMB 1LT4D 1ICFB 4DV4Q 3C1EA 3UDXA 2B2YC 4M8AA 3PO3B 2CH4W 1TWFB 2B2VC 1VQ6A 4ZK9B 5IP7G 1IBMQ 5EBDA 1F2LA 4ZKCB 1Y8NB 1HUMA 4JOIA 5JVH3 2JA8G 1T5EA 1YJNA 5DM63 4LF5Q 1SMXA 2BA0A 3VYUA 4B3SQ 2KCCA 1F9QA 1S5FD 4KMUC 2QDBA 1NE3A 3L7ZC 1I6HB 1ML0D 4LF7L 3DWQA 1YJWA 1O7LA 4J8QA 4J6HA 3AYHB 2KHJA 4C1NK 2K03A 4DXGA 2K01A 1KLUD 2AUJD 4LF4Q 1DOKA 2NTTA 3RZDB 3CHBD 4A3CH 1C4QA 3J7AV 1SE3A 1C8CA 1V9PA 4UDUC 3KF8B 1L0YB 4LF5L 1LTRD 4X3UA 1X6OA 2E5LQ 4O2DA 1PMRA 1HFNA 1C48A 1EZ8A 5GROA 3HOWH 4KN4C 3NWSA 2A8VA 4DK1A 5C3EB 1VF5C 3HKZE 5IP9H 5M5YH 3LWEA 3H94A 3LNNA 2EYFA 1UUPA 1J6QA 4IFDJ 4OELB 2P5ZX 1HCZA 2LSSA 3S2DB 1LT6D 1E1TA 1SNOA 4BY1G 2R92H 2ZXOA 1P8LA 1UWVA 3AEVA 1UNSA 2I5HA 1YI2A 4C2MH 1Y69U 3F2CA 4HIDA 2ZJPA 3CMEA 4XYOA 4LFAL 5C44B 4A3LH 4DNIA 1LM0A 2PO4A 4YHHL 1I3QH 1EYDA 5KYIA 1X54A 1MD2D 2HQEA 3QOLA 1KAAA 1VMCA 5CV8A 3T1YL 1TWFH 3MFGA 3PUVA 1TWCH 3CRKC 1JOQA 1NUCA 1KD1C 4JK1C 4DUZL 1QVFA 2C5CA 2KQ3A 1GUWA 1IZ6A 5I4DA 1S5DD 2CWAA 2KHIA 3CW2C 5LMUL 3TZUA 2WIIB 3SK5A 1ENFA 1K3BC 4NXML 4A3IB 1V1PA 4A3BB 1E7ZA 5ELDA 1E1OA 2DNEA 1HQRD 1Q3LA 1DGSA 2KECA 4Y7NH 1ILPA 1R4PB 3CCVA 4HMIA 2YU9H 3NBIA 1EIYB 3DUZA 5G3LD 2B8FA 5HURA 2F0VA 1FNWA 2L1BA 3GV3A 4XT3B 3V96A 1LACA 2VUMH 1N9WA 2N49A 2HQLA 2JN4A 2M00A 2XWBB 3VA7A 2RHQB 4DAPA 4JI5Q 3RNUA 1HZCA 2B2TA 1WD1A 2PZTA 2B2YA 1XNRL 2F0LA 1ENCA 2MJ8A 3S1MB 4XIGS 5I6YA 1H9RA 3D4RA 4B9XA 4OWWB 4DR4Q 1NTGA 3F2UA 3RZDH 4QQBX 3QR8A 5I2YA 5IP9G 3M3YB 1EYGA 1A2TA 2FFKB 1WTRA 4DFAA 2WP8J 2IPKD 4E6IA 3SK4A 4BBSG 1CM9A 3RZOH 5IWAL 1K8AC 3K5MA 1A3VA 1I6VC 1TS2A 2MO1A 1S40A 1HR0Q 3KUPA 4DUYL 5G3LF 3NENA 3PV0A 2JEAI 1NMGA 3PIPA 1Z7TA 2GVAA 4RAUC 1VQAA 4O0AA 1JORA 2BDNA 4HJ7A 5KRUA 5M3MB 1N36L 5JEAH 1I4XA 5IYCG 1KHIA 1JE5A 2I5MX 4KHPL 1N33Q 2F0MA 1TY2A 1XPRA 1YNXA 2RSOA 1PV4A 5FLXE 2K5QA 4OXPA 1KDCA 2E2IH 1STBA 4LF8Q 2WB1G 2XNAC 1RCVD
chains in the Genus database with same CATH topology
4TQUS 4KJOA 3QO2A 3SK6A 1QNKA 5CV4A 1RKNA 1X3QA 2F3WA 2TSSA 1D1IA 1V1OA 4XTCS 1Y1WB 5C0XG 3A8IE 2L12A 3HOYB 4RH6A 2A69C 2EY5A 2JSOA 4RCOA 1ILQA 3FVQA 1FR3A 4NW2A 2K6AA 1Y8PB 2L0CA 2NUCA 2A6EC 5CV6A 1S4ZA 1G291 4DF7A 1E2WA 2WINB 3NSWA 1EWCA 4XQQA 1YNNC 1A3TA 1Q1BA 4CBVA 5CV9A 4C3HB 3OPOA 1RODA 1LO5D 1TWAB 1PFNA 1H9MA 1JOKA 3HS0C 3S1NB 2JA8B 2K7VA 2VB2X 3MEHA 1TWCB 1A6XA 4CJ2C 4WORA 1GXDC 1PRTB 1JR0D 3MAQA 3FEWX 5TSSA 3J81L 2CVRA 1HFGA 2BDOA 1R4QB 1PLFA 1ESFA 1GUOA 2KA7A 5CGKA 3OOCA 3Q24A 3J80L 4OO1H 1KNEA 2D5DA 2A6HD 3Q0AA 5IGFA 1S5BD 1WTXA 1X3PA 3GTOB 4KTAA 5FO8B 3TBIB 1KABA 1G2TA 2AWNA 4UAIA 1CK1A 3HZXA 3HOXB 1BCPC 1RF2D 4F7XA 4BBSB 3URYA 4ZAIA 3QJYA 2ICIA 3QG1A 4IN3A 5C3XA 2D2CC 3D6CA 5IGDA 4R9WA 5EPKA 2KVMA 4EQOA 1F2YA 2B2WC 3G7LA 2NWGA 4B08A 1OO9B 1I4RA 5JEAG 5FOBB 5CR3A 4BWGB 1CFMA 4DA2A 3K5LA 3SR1A 5I9PA 1U4MA 2K33A 1EQTA 2NB0A 1EZ6A 3Q22A 2KHSA 3PUWA 3JAML 3T13A 5JVG3 2IJ0A 3PUYA 1NR4A 2NVYB 5FK9C 1GUTA 4N9TA 3KK7A 4IUUA 1T5XD 4WRDA 3MXNA 1I4QA 3VA5A 3CRLC 3MVVA 4CGYB 4EVOA 3TP6A 4TSSA 3L3OC 4KHZA 1HQMC 2EYOA 1FNVA 3VR5A 4RKBA 3QWNA 1EL0A 4QB4A 3GTQB 1LTID 4XQNA 4BY1B 1HA6A 3I91A 1QCBD 3BZDB 1SJHD 3NTKA 5J22A 3RLFA 4KK7A 1TT2A 3TP7A 1Q90A 3NE5B 1PZID 3T4AC 3R2TA 5D65A 2NTSA 1G91A 1HTLD 1XXGA 3C2PA 3NHHA 4R8IA 1U4RA 2E75C 3D6WA 4LJZC 3MXGA 2PPBC 2AWOA 2VNUD 5C4JB 1STEA 4DXFA 3NBHA 1AN8A 3T51B 3H3VC 5CYUA 1E2ZA 1E0BA 1PTOB 3TN2A 1U4LA 1RHPA 2PW5A 1Z47A 2MHVA 2AQ3B 4C3JB 3GTLB 2SNMA 4BS9A 2DN8A 3S1RB 1JQYD 2I07B 1JICA 1WVLA 3KBGA 1NCVA 2VB3X 4OO1I 2OEOA 2PQEA 1B9NA 1KDAA 1LTBD 1Q12A 3TSSA 3BDLA 3S15B 4RKLA 3HOWB 2EYMA 5KNDA 2VXWA 4X3KA 1LTTD 4AYBB 1DJRD 4LAAA 1IW7D 1B50A 2JE6I 1II3A 5CV5A 1SMYC 1A15A 4FF2A 3QOJA 2XRSD 5C0XI 2CHBD 1A3UA 1OXVA 5LL6S 4HTHA 1UAPA 4RGTA 3VR4A 1GUGA 1NSNS 3K5NA 5IODA 5M9OA 5DEHA 4NMZA 1BXTA 3CU7A 2Y0SB 3ERQA 2JA6B 4FO2A 4A3FB 1HRJA 3OWEB 2FJ2A 1WTPA 4C1NI 2H1EA 3KLRA 2H4OA 1DM0B 4G7ZC 3D4DA 1XTCD 2HCCA 4FXKC 1AZQA 5KNCA 3A54A 5NUCA 1PTOD 1QE6A 3MHBA 2G9DA 3H91A 5FO7B 1TS3A 2RDHA 2X6LA 3SEBA 1EYCA 3SVMA 4PV1C 3BDOA 1VMPA 4F88A 1I4GA 3DWPA 2LS01 2XIWA 1JCKB 4S3SA 5M5WB 5COYA 1J9OA 1MSHA 4ZKBB 3AU7A 1LV9A 1IKMA 2ZXRA 3EVQA 1KTKA 2NN6H 3NQTA 5ELEA 3RD4A 1SAPA 5HGTA 2L9HA 2XRQD 5LL6X 2LKVA 5M5YB 3IL8A 5BN5A 1TKWB 1PFBA 4P2CB 2ENBA 4C3IB 1ONLA 1F9PA 2BCOA 2F0TA 5FO9B 3DM1A 5C0XH 1SDFA 4U68A 3NUCA 3N6RA 2ICEC 2IX3A 2FINB 4JBWA 3VYSA 4CHTB 3OHXC 4H13C 3GV6A 3KLSX 2YYZA 3WOFA 1STAA 3M85A 5EQ0A 4FXDA 3BYTB 5JAVA 2PW7A 5IGCA 4IURA 5J39A 4KKTA 4ODGA 3ONAB 1LT5D 3SK8A 4K8JA 3MC0B 2J7ZA 2EVBA 3KLSA 1O7YA 1GUNA 1M8AA 1V1PB 2JA7B 2SNSA 1D1KA 2KJXA 3N52A 2XN9C 4Y7NB 1WTQA 3R8BA 2HDMA 1VF7A 2K5WA 5C4ZA 3W2DA 5ISRA 1LABA 2KUMA 2E2DC 1B44D 4ZYSA 3I72A 3J80E 2JXMB 3MA2B 4DNTB 1QJOA 4DAVA 1I3QB 3A7AB 1LTAD 2DNCA 1BCPF 5I6WA 1IKLA 2OT2A 3OIQA 5KEEA 4I7ZC 1DYQA 4FF3A 2BE5C 4IUQA 2I46A 4FVMA 2RA4A 1D2BA 4PMBA 1QOHA 3IFDA 1SYCA 4EQNA 1FGBD 1SE2A 1JC7A 4FYDA 5JPNC 4HSPA 1AEXA 1BF4A 3ITPA 1F77A 1SSOA 2IWHA 1RD9D 2B2TC 2WACA 1F9RA 2NN6G 3U9OA 5IOCA 2RVLA 2J0TD 3D4WA 2AUKA 1J8IA 4RWSC 2F3VA 3CQZB 3A8JE 1CZWA 4RHRA 1QILA 4DU9A 2EYPA 3OMCA 1EY6A 1SYEA 4BBRB 1QNUA 2A68C 3PIO3 3BG3A 4L6TB 4ILWA 1DOMA 3A55A 2R92B 2EE1A 2Z4IA 1Y1VB 1I50B 1JWMD 1QB5D 3X3MA 2WKDA 4ID6A 2NVQB 1BR9A 4DNRB 3WDNA 3EQLC 3IKJA 1SNMA 3V2TA 2A5HA 4O1NA 3MWYW 4ULLA 1DZ1A 4WFN3 4FXGC 1RJTA 2PZWA 2F0FA 4FF1A 4OGQC 4RGMA 3VR6A 2B63B 5EKKA 4K5XA 4B9WA 4QUCA 3E6ZX 4MIUA 3LX0A 3W3AA 2RDGA 3BVZA 1MGSA 1MSGA 3A56A 4U673 3AMUA 2WV6D 4K5WA 5T1GA 5KNBA 1OXSC 3Q6SA 1L0XB 3I8ZA 4NP5A 3UI2A 3P20A 3OIPA 1K83B 1TY0A 1YNND 3K0YA 4QMGA 1CA6A 1Z6HA 2IX1A 4DN4M 4ABNA 1EY8A 2HCIA 3HOZB 4CKCA 3D8GA 5J1ZA 5D3DA 3T16A 1WTWA 5IT9L 2B2VA 3MFYA 4BA2I 1S5CD 3HP3A 1X32A 4RFBA 5T1IA 4RCNA 3S14B 4CJ1B 3PUXA 3HOVB 2A74C 4OIJA 2AQ2B 1JE4A 2F0HA 4MHEA 2QCPX 1PDQA 1SYDA 3RZOB 1EEFD 1CQFA 3RUZA 4XXEA 2PCFB 2RDFA 1EY7A 5AFWA 2N55A 4WJWA 5M3FB 4BA1I 2FHTA 2OXPA 3DMUA 3LWUA 2F4IA 1H9SA 2SEBD 4RGOS 1ZKOA 1EY4A 5CV7A 1SE4A 3FPPA 5IT9E 2R3ZA 2K05A 1HA5A 1PYWD 2MP1A 1JWSD 2PNRC 2NZ1D 1D5ZC 5D3IB 4KY7A 4BY7B 1GUSA 2RSNA 4HEDA 5BN3A 3K59A 3I4NB 3DEOA 4IUPA 2C9OA 1Q1EA 1PRTF 3S1QB 2XWJB 1TU2B 3S16B 4RHSA 5IGBA 4K8IA 1SBBB 2A73B 1EEID 1CZGA 2KEDA 2BA1A 2F1MA 4CKEA 2K28A 3BDCA 3JAME 3NXWA 4ZRZA 1U9RA 4GZYC 4I65A 3U9SA 3NTHA 3TDQA 4N9PA 1IHZA 1PTOF 1V43A 1PZJD 4G57A 4KN7C 1WTOA 2HUGA 3OSOA 2D62A 2EOTA 1IYVA 3PMFA 5CBEE 3MZ5A 1TS5A 2QF7A 2XSCA 1LLRD 2O5JC 2XVSA 1AW7A 2JA5B 5DAUA 2F0DA 4ZUJA 1OXXK 1EOTA 4IUTA 1TQOA 5D14A 1F2MA 3C1FA 3HGBA 3FMCA 1EU4A 4QIWB 3C46A 3P7JA 3VR2A 2F03A 2F0OA 5E4WC 3H09A 2RKSA 3VYTA 4A3DB 1GOZA 5A2QL 2E2IB 4G7OC 1QWYA 4F8MA 3WOEA 4H0LC 1K8OA 3K57A 5JOBA 2ZT9C 2A6ED 1EIHA 1JB3A 2B8GA 1TWGB 1PZKD 4DK0A 3TZDA 4PMCA 3TP5A 3BYYB 1H9SB 2B39A 3CKIB 1SFOB 1FD7D 1OXUA 1YNJD 3NP8A 4IFDG 2L4NA 4IALA 2MUYA 4FF4A 2R6GA 3J7YW 3GTMB 5EPLA 5E3FA 4X3TA 1EFID 1XYIA 1B1ZA 5KYLA 2F0KA 3M7GA 3KBXA 3C3LA 1B3AA 4RA8A 2EYHA 4F87A 3QB3A 5C0XJ 3V05A 1RTOA 5IGGA 1W6KA 4XT1B 4ME5A 5JPMC 1D5XC 1O80A 4MN3A 4KY5A 4C3IG 4HCSA 4IZ8A 2R61A 4A3EB 2AQ1B 1FYCA 5IIFA 4DGZA 3R2IA 2LMCB 1GHJA 1IW7C 1B9MA 5EJWA 3EA6A 3MXUA 1ICWA 2EY1A 3X3NA 1SMYD 2QEJC 2RQXA 2R7ZB 1QG7A 4A93B 2MPMA 3SE0A 2RBMA 1XX8A 5EKLA 1A2UA 3K5OA 3J7AF 2KOLA 2K04A 4Q0FA 5E1FA 2K5DA 5DNFA 3L9AX 3S2HB 2EZVA 2Z8LA 3I4MB 3TP8A 3E0JA 4PNYA 2F0PA 1E2VA 1F9SA 1KNAA 1SJED 2NBFA 1R9TB 4X3SA 3O13A 1H9JA 1HTPA 1HPCA 5DM73 3NWTA 2FMCA 3DXJC 1O7ZA 1BDOA 1TS4A 3J81E 2LFNA 1CHPD 3MXPA 4A3KB 1DD2A 2N88A 4Q5VA 1W6JA 3NK9A 1GHKA 2F0NA 4YIJA 3R3OA 1K8MA 1YNJC 2BOSA 5F2DA 5I2XA 2B2UA 2F0JA 4A3GB 1SNQA 2EYLA 4KJNA 4IFDH 4HMJA 3I70A 1S5ED 5C4HA 1SYGA 3IFTA 3HG9A 1TVXA 3RMHA 4K6LA 1PRTC 4M1UB 1ZYRD 2A6HC 4HSVA 1KDBA 2ID0A 1EQVA 1TIID 4OIKA 1TWHB 1CQVA 4L8JA 4FNFA 2X69A 3MTSA 2E2JB 2CQAA 2Z1CA 1CA5A 2D9UA 2YU9B 3BVGA 4PMWA 2A68D 2EPBA 2R93B 4A3JB 3M4OB 2PYKA 1LTSD 4KD4A 1ENAA 4C3JG 3A8KE 4DAYA 2EJFC 1STNA 1CT1D 5CBAE 1IYUA 3AB9A 1SEBD 1EU3A 3FRPB 4TKOB 2FMMA 1VCIA 1RDPD 1PXUA 5EBCA 1SYBA 3DWAA 4ZQ3A 1ZEQX 2EY2A 3DHQA 3GTKB 5EGTA 1OXTA 2L5TA 2KCNA 3P75A 2EXZA 2SDFA 1LTGD 3GTJB 1STYA 3OWFA 3K6OA 2NVXB 5EKIA 2B2UC 5CMDA 4KKSA 4HR7B 1AP0A 1D5MC 5JEAJ 1UEAB 5E4XA 2WAQB 3OW7A 3GQBA 1WD0A 3K58A 5C5MA 1B4OA 2K1BA 4OO1G 3DEPA 3A7LA 2EDGA 5KGUA 4V190 4QUFA 3BS1A 3G6JB 2KEEA 2L11A 4K6DA 4LMQD 1Y8OB 1ZXTA 2IT1A 4KKUA 3M4YA 5C3WA 3R93A 2V4DA 4NDXA 3GTPB 2Z4HA 2JYOA 3FPUB 5CORA 4XDXA 1HXYD 1H9KA 1NR2A 3HEJA 1EWHA 4QCLA 2K32A 3ND9A 2E76C 2F0SA 3SHLA 3SDZA 5ELBA 3NTIA 2J4XA 4NKLA 3GTGB 1WTVA 1ZYRC 3SXHA 4CKBA 1PRTD 4HAEA 2Q8RE 4EQPA 2QILA 4IQZA 1V8QA 2CW0C 2M2LA 3I3CA 1PTOC 2LY7A 4ZUIA 3NQIA 1AZPA 3KF8A 3M7NA 2WKCA 3EROA 1BBXC 2NN6I 5FKAC 4J1MA 2DY8A 1STHA 3VR3A 5A2QE 1RTNA 3HKZB 5LHY1 1MI2A 4CJ0B 1DONA 2F0IA 2Q8TA 2F0GA 3HOUB 5I9OA 2O2LD 1CHQD 2Q8IB 5ELFA 1BNZA 4KY6A 1B53A 1BCPB 4K2KA 2F0QA 1I4PA 3H6MA 4IUNA 4IUVA 1EY5A 1AFPA 4H7BA 3ND8A 1ET6A 3GD7A 1O78A 4KV6A 2EJMA 3HRZC 1EYAA 1D6EC 1NAPA 2EJGC 4K2LA 4KI0A 2F0EA 3ZYYX 2IX0A 3D3RA 3GP7A 5EPJA 1ESRA 5A35A 1G2SA 1PTOH 3VYRA 3PIP3 2EY6A 1PFMA 4Z9CB 4R8NA 5IGEA 5M5XB 4C2MB 3PO2B 1BCPD 1XWEA 4XYQA 3TMEA 3K7AB 4C3HG 1G8ZD 3FKIB 3I4LA 1M4VA 4G4KA 2ZXPA 3T53B 3IAYA 2NYZD 2VUMB 3FDTA 2HDLA 4C56C 2OF1A 2SOBA 1HUNA 1DCZA 2NVTB 3T56B 2TMPA 4V0BA 1BOSA 1VDZA 1TR5A 4L63B 1SNPA 4FP5D 2PMZB 1HHVA 1U4PA 3QIAA 4LK1C 4OHJA 1KLGD 5JJZA 4PQXA 2E74C 5C4XB 1EY9A 1JWUD 4ZLTF 1FNUA 5KIXA 4IFDI 1MBYA 2A69D 3D31A 4H44C 4OL7A 5C6AA 3S9WA 1EIGA 2CW0D 3GO5A 1JOOA 5BN4A 1Q8IA 1BO0A 2M9VA 4QF4A 1SNCA 2IL8A 4EGVA 2JEBI 1F2ZA 4O42A 4A3MB 2X6GA 2BE5D 3EJIA 2EYJA 1EY0A 1GJXA 3Q23A 1LT3D 1SXTA 1SNDA 2F0UA 1DXMA 4K14A 5K5PA 5K36H 4TRDA 2WB1B 1STGA 3EFXD 2E2HB 3BVMA 1IL8A 3H0GB 4HN7A 4KHVA 2G9HD 1BUVT 2MGSA 5CC4A 1DOLA 4G7HC 5C5LA 1B2TA 4K5VA 3P1HA 2DY7A 1I4HA 3S17B 3OMGA 2O5IC 2QKIC 1ET9A 1CTMA 4XQJA 5FLXL 2IW3A 2F0WA 1BQQT 5K36G 3I73A 2O4XA 4HCEA 3NPPA 3I90A 2GA4B 2JP1A 1G6ZA 2B2WA 1CI3M 1SYFA 4RGNA 2L55A 3PUZA 5ELCA 4KD3A 2PZUA 3E5SA 1WCMB 1LT4D 3C1EA 3PO3B 2B2YC 4M8AA 1TWFB 2B2VC 4ZK9B 5EBDA 1F2LA 4ZKCB 1Y8NB 1HUMA 5JVH3 1T5EA 5DM63 2BA0A 3VYUA 2KCCA 1F9QA 1S5FD 4KMUC 2QDBA 3L7ZC 1I6HB 1ML0D 3DWQA 1O7LA 4J8QA 4J6HA 4C1NK 2K03A 4DXGA 2K01A 1KLUD 2AUJD 1DOKA 2NTTA 3RZDB 3CHBD 1C4QA 3J7AV 1C8CA 1SE3A 4UDUC 1L0YB 1LTRD 4X3UA 1PMRA 1HFNA 1C48A 1EZ8A 4KN4C 3NWSA 4DK1A 5C3EB 1VF5C 3LWEA 3H94A 3LNNA 2EYFA 1UUPA 4IFDJ 1HCZA 3S2DB 1LT6D 1SNOA 2ZXOA 1UNSA 1Y69U 4XYOA 5C44B 2PO4A 5KYIA 1EYDA 1MD2D 2HQEA 3QOLA 1KAAA 1VMCA 5CV8A 3MFGA 3PUVA 3CRKC 1JOQA 1NUCA 4JK1C 2C5CA 2KQ3A 1GUWA 5I4DA 1S5DD 3TZUA 2WIIB 3SK5A 1ENFA 4A3IB 1V1PA 4A3BB 5ELDA 2DNEA 1HQRD 1Q3LA 1ILPA 2KECA 1R4PB 4HMIA 3NBIA 3DUZA 5G3LD 5HURA 2B8FA 2F0VA 1FNWA 2L1BA 3GV3A 4XT3B 3V96A 1LACA 2M00A 2XWBB 3VA7A 4DAPA 2B2TA 1WD1A 2PZTA 2B2YA 2F0LA 1ENCA 2MJ8A 3S1MB 4XIGS 5I6YA 1H9RA 3D4RA 4B9XA 3F2UA 5I2YA 3M3YB 1A2TA 2FFKB 1WTRA 4DFAA 2WP8J 2IPKD 4E6IA 3SK4A 1CM9A 3K5MA 1A3VA 1I6VC 1TS2A 3KUPA 5G3LF 3PV0A 2JEAI 1Z7TA 4RAUC 1JORA 2BDNA 5KRUA 5M3MB 5JEAH 1I4XA 2F0MA 1TY2A 2RSOA 5FLXE 2K5QA 1KDCA 1STBA 2XNAC 1RCVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HCS A;  2N55 A;  5AFW A;  3I90 A;  2DY8 A;  2JP1 A;  1WTX A;  2FHT A;  3QO2 A;  1G6Z A;  1AP0 A;  2B2W A;  1B50 A;  1QNK A;  1RTN A;  1X3P A;  5E4X A;  1HHV A;  1X3Q A;  1U4P A;  1VMC A;  1MI2 A;  1EL0 A;  1A15 A;  4CJ0 B;  1WD1 A;  1SAP A;  5JJZ A;  1DON A;  1G2T A;  1IKL A;  1WD0 A;  2Q8T A;  1B4O A;  1TVX A;  2K1B A;  2L9H A;  1HA6 A;  5EJW A;  1GUW A;  2R3Z A;  2K05 A;  3DEP A;  3I91 A;  4ZLT F;  3IL8 A;  3MWY W;  2B2Y C;  2MP1 A;  4HSV A;  4IUQ A;  1DZ1 A;  4UAI A;  1ICW A;  2RA4 A;  1PFB A;  1BNZ A;  2NZ1 D;  1EIH A;  4OIK A;  1RJT A;  2B2V C;  1B53 A;  2L12 A;  4QUF A;  4ZK9 B;  3IFD A;  1F9P A;  2KEE A;  2L11 A;  3TZD A;  1F2L A;  2RSN A;  4HED A;  4ZKC B;  1Q3L A;  1HUM A;  2KEC A;  4LMQ D;  4ZAI A;  1ILQ A;  1ILP A;  1BBX C;  3DEO A;  3DM1 A;  4IUV A;  4IUP A;  4QUC A;  5D65 A;  1ZXT A;  1QG7 A;  1SDF A;  1G91 A;  4U68 A;  2MPM A;  2L1B A;  3GV3 A;  1EIG A;  1MGS A;  1MSG A;  1XX8 A;  2X69 A;  3MTS A;  4NW2 A;  4XT3 B;  1F9Q A;  3R93 A;  4R9W A;  2FIN B;  1CA5 A;  5EPK A;  2D9U A;  2KVM A;  4R8I A;  3GV6 A;  2JYO A;  1U4R A;  2KED A;  2L4N A;  3FPU B;  5COR A;  3D6W A;  1BO0 A;  2B2T A;  2B2W C;  2EPB A;  2B2Y A;  2KOL A;  2NWG A;  3G7L A;  1ML0 D;  1S4Z A;  2IL8 A;  2K04 A;  2MJ8 A;  3Q6S A;  2K28 A;  5EQ0 A;  1HRJ A;  1NAP A;  4XDX A;  1BF4 A;  1NR2 A;  2FJ2 A;  4O42 A;  5EPL A;  2K03 A;  5DNF A;  1SSO A;  3I8Z A;  3UI2 A;  4IUR A;  2K01 A;  5EPJ A;  2X6G A;  1ESR A;  1WTP A;  3F2U A;  2H1E A;  1G2S A;  1DOK A;  2B2T C;  4X3T A;  2FFK B;  1WTR A;  1F9S A;  1ROD A;  1XYI A;  1KNA A;  3ONA B;  1PFN A;  1E0B A;  1F9R A;  1PFM A;  2HCC A;  1AZQ A;  1CM9 A;  4X3S A;  1U4L A;  3TN2 A;  1RHP A;  1C8C A;  1CA6 A;  4X3U A;  4DN4 M;  2RVL A;  2J7Z A;  2HCI A;  3KUP A;  5CBA E;  1WTO A;  4CJ2 C;  1QE6 A;  2HUG A;  1HFN A;  1U4M A;  2FMM A;  2EOT A;  1J8I A;  3KBX A;  4RWS C;  1O7Y A;  3H91 A;  1M8A A;  1WTW A;  5CBE E;  1WTV A;  1O7Z A;  1B3A A;  2B2V A;  4HAE A;  4RA8 A;  1EQT A;  2Q8R E;  2X6L A;  3HP3 A;  4RAU C;  3LWE A;  1IL8 A;  2NYZ D;  1JIC A;  1X32 A;  2CVR A;  1WVL A;  2BDN A;  5T1I A;  3N52 A;  3FDT A;  1HFG A;  1NCV A;  3SVM A;  2MGS A;  5T1G A;  2HDL A;  1PLF A;  1WTQ A;  4CJ1 B;  1DOL A;  1NR4 A;  1RTO A;  1VMP A;  2M2L A;  3I3C A;  2HDM A;  2N88 A;  1EOT A;  4IUT A;  1B2T A;  1HUN A;  4XT1 B;  2DY7 A;  5D14 A;  1KNE A;  4OIJ A;  2SDF A;  1JE4 A;  2XIW A;  4IUU A;  1DOM A;  2RSO A;  5COY A;  1J9O A;  1O80 A;  2EE1 A;  4MHE A;  1MSH A;  3P7J A;  4ZKB B;  2KUM A;  1PDQ A;  2VXW A;  1LV9 A;  1IKM A;  4MN3 A;  5EKI A;  1AZP A;  2B2U C;  5CMD A;  5E4W C;  2B2U A;  4X3K A; 
#chains in the Genus database with same CATH topology
 1PH2 A;  4TQU S;  1XJV A;  4KJO A;  1K28 A;  3QO2 A;  2R93 H;  3ULL A;  5H1S E;  3SK6 A;  1QNK A;  5CV4 A;  1VQ5 A;  1RKN A;  1WTH A;  1X3Q A;  4IOC A;  2F3W A;  2TSS A;  1D1I A;  4DV0 L;  2UUC L;  1FL0 A;  1V1O A;  4GOP B;  4XTC S;  1JB7 A;  2ATW A;  1Y1V H;  1Y1W B;  5C0X G;  3A8I E;  1N34 L;  2L12 A;  3HOY B;  4RH6 A;  2A69 C;  2EY5 A;  2JSO A;  4RCO A;  1VQI A;  4DK6 C;  1ILQ A;  3FVQ A;  4HJ9 A;  4JI6 Q;  3HOY H;  3A0J A;  2Q2T A;  1FR3 A;  5L37 A;  4NW2 A;  1QZG A;  5AJ3 L;  2K6A A;  3HOZ G;  1Q82 C;  1Y8P B;  2L0C A;  2NUC A;  4IPH A;  1Q86 C;  1I94 Q;  2A6E C;  5CV6 A;  1S4Z A;  1G29 1;  4DF7 A;  1E2W A;  2WIN B;  3NSW A;  2ZJQ A;  1EWC A;  4XQQ A;  1SLJ A;  1YNN C;  1A3T A;  1Q1B A;  4DR2 Q;  4A3M H;  3S14 H;  4A3B H;  2R92 G;  4CBV A;  5CV9 A;  4C3H B;  3OPO A;  1ROD A;  1LO5 D;  1TWA B;  1PFN A;  1H9M A;  1JOK A;  3HS0 C;  3S1N B;  2NVX H;  2JA8 B;  2K7V A;  2VB2 X;  2WFW A;  3MEH A;  1NNX A;  4YCU A;  1TWC B;  2KBN A;  1A6X A;  4CJ2 C;  4WOR A;  1GXD C;  1ASY A;  4UP8 A;  1PRT B;  4C3H H;  1JR0 D;  3MAQ A;  2VQE Q;  3FEW X;  5TSS A;  2HD3 A;  3J81 L;  3AFQ A;  1VQJ A;  2CVR A;  2UXD L;  1HFG A;  1VQB A;  2BDO A;  1AE3 A;  1R4Q B;  1PLF A;  1ESF A;  3MXN B;  1VQC A;  1GUO A;  2A1A A;  2KA7 A;  5CGK A;  3OOC A;  3Q24 A;  2UXD Q;  3J80 L;  5ELN A;  3TS2 A;  4OO1 H;  2DGY A;  1KNE A;  1VQF A;  2D5D A;  2A6H D;  2OWO A;  3CCE A;  1YIT A;  3Q0A A;  5IGF A;  1S5B D;  1WTX A;  1GD7 A;  1K0R A;  3CC4 A;  4BBR G;  1X3P A;  1GO3 E;  1B8A A;  3GTO B;  4KTA A;  5FO8 B;  3TBI B;  1KAB A;  1G2T A;  2AWN A;  4HIM A;  1RL2 A;  2K14 A;  4UAI A;  5GAH C;  1CK1 A;  5C4J H;  4JI2 L;  3HZX A;  3HOX B;  1BCP C;  1RF2 D;  4F7X A;  4BBS B;  3URY A;  4ZAI A;  3QJY A;  1VQ9 A;  2ICI A;  3QG1 A;  4IN3 A;  5C3X A;  3ICE A;  2D2C C;  3D6C A;  5IGD A;  4R9W A;  3GTK H;  5EPK A;  2KVM A;  3CMA A;  5GAD C;  4EQO A;  1F2Y A;  2B2W C;  3G7L A;  2NWG A;  4B08 A;  1OO9 B;  2CWP A;  1I4R A;  1VQ8 A;  4H02 A;  5JEA G;  4A76 A;  5M3M G;  1NJI C;  5HY6 A;  3J81 j;  5FOB B;  5CR3 A;  4BWG B;  1CFM A;  4DA2 A;  3K5L A;  4OEM B;  3U4Z A;  3SR1 A;  4UPA A;  5I9P A;  1XMO Q;  4LNQ A;  1U4M A;  2K33 A;  5EAY A;  4POG A;  1YHB A;  5JJK A;  1EQT A;  2NB0 A;  1EZ6 A;  3Q22 A;  2KHS A;  3PUW A;  3JAM L;  2XTI A;  3T13 A;  3M9B A;  3A5Z B;  4QJF A;  3I55 A;  3HKZ G;  5JVG 3;  4DR5 Q;  4LF6 Q;  2IJ0 A;  3J7Z C;  3PUY A;  5C3E H;  1EQQ A;  3OW2 A;  1NR4 A;  5IT9 c;  2EIF A;  2NVY B;  2MFI A;  5FK9 C;  2Q2I A;  4N9T A;  1GUT A;  3KK7 A;  4IUU A;  1T5X D;  4WJ3 M;  4WRD A;  1MJE A;  3MXN A;  1I4Q A;  2RF4 A;  3VA5 A;  4IPD A;  3CRL C;  3MVV A;  2G5D A;  2IHF A;  4CGY B;  4EVO A;  3TP6 A;  4TSS A;  3H0G H;  3L3O C;  4KHZ A;  1CSQ A;  4LFB L;  1HQM C;  2EYO A;  1FNV A;  3VR5 A;  4RKB A;  4JG2 A;  3QWN A;  3HKS A;  1EL0 A;  4QB4 A;  3GTQ B;  4DR4 L;  2F52 A;  1LTI D;  2CKZ B;  1CKN A;  3F2D A;  4XQN A;  4BY1 B;  1HA6 A;  4DAY B;  3I91 A;  1QCB D;  3BZD B;  4MTK A;  3GTL H;  1SJH D;  3NTK A;  5J22 A;  1TWG H;  3NBH B;  3RLF A;  4KK7 A;  1TT2 A;  5C44 G;  3TP7 A;  1Q90 A;  1KQS A;  3NE5 B;  1PZI D;  4N8X 1;  3T4A C;  4YCV A;  1HH2 P;  3R2T A;  5D65 A;  2NTS A;  1G91 A;  4IJL A;  1HTL D;  1XXG A;  3C2P A;  1UE5 A;  3CP0 A;  3NHH A;  5DLQ E;  4R8I A;  1U4R A;  2E75 C;  3D6W A;  4LJZ C;  5HGQ A;  4BY7 H;  3MXG A;  4I7A A;  2PPB C;  4GN4 B;  2AWO A;  2VNU D;  5C4J B;  4CDF C;  2CFM A;  4DV5 L;  1STE A;  4DXF A;  3NBH A;  1AN8 A;  3T51 B;  3H3V C;  4A3E H;  5CYU A;  1E2Z A;  3TRZ A;  1E0B A;  4BBR H;  1X9N A;  1IYJ B;  1PTO B;  1U4L A;  3TN2 A;  1EOV A;  1RHP A;  3GTO H;  3J81 c;  2PW5 A;  2VY3 A;  4LFA Q;  3E0E A;  1Z47 A;  2MHV A;  2AQ3 B;  2YTY A;  4C3J B;  3GTL B;  2SNM A;  4BS9 A;  2YTX A;  4NPS A;  2DN8 A;  2GN5 A;  1JQY D;  2I07 B;  3S1R B;  4YWK A;  3PCO B;  2UUA L;  1UE7 A;  3GTQ H;  1JIC A;  3EIV A;  5M3F H;  1WVL A;  3KBG A;  1NCV A;  1XMQ Q;  2VB3 X;  4JC0 A;  2OEO A;  4OO1 I;  2PQE A;  4JI5 L;  1B9N A;  1KDA A;  1LTB D;  1Q12 A;  3J80 i;  3AFP A;  3TSS A;  2AMC B;  1N34 Q;  3BDL A;  3S15 B;  3E9H A;  4RKL A;  3H3V H;  3HOW B;  2EYM A;  5KND A;  1EUJ A;  2VXW A;  2H5X A;  4X3K A;  2N3S A;  1LTT D;  4AYB B;  2VQE L;  1DJR D;  4LAA A;  1IW7 D;  1EQR A;  2JE6 I;  4GKJ Q;  1II3 A;  1B50 A;  5CV5 A;  5E7N A;  4DR7 L;  1SMY C;  1A15 A;  4FF2 A;  1PFS A;  1VQL A;  3QOJ A;  2XRS D;  5C0X I;  2CHB D;  4TVA B;  4DK3 C;  1A3U A;  3EN2 A;  1OXV A;  4DR2 L;  5LL6 S;  4HJ8 A;  4HTH A;  4X64 Q;  1I6H H;  1I50 H;  4A3J G;  4ALP A;  1UAP A;  2JK8 A;  4RGT A;  4B3S L;  3VR4 A;  4DV7 Q;  2OTJ A;  1GUG A;  1NSN S;  1S72 A;  1R9T H;  2N8N A;  3K5N A;  5IOD A;  5M9O A;  1C9O A;  5J3B A;  1KXL A;  5DEH A;  5LMN Q;  2JA7 G;  4NMZ A;  2ZJR A;  1BXT A;  3CU7 A;  2Y0S B;  4BY1 H;  3ERQ A;  2JA6 B;  4FO2 A;  4A3F B;  1HRJ A;  3OWE B;  4C3J H;  4P74 A;  2FJ2 A;  3CC7 A;  1QZH A;  1WTP A;  4C1N I;  2H1E A;  3KLR A;  2H4O A;  1DM0 B;  4G7Z C;  2R7D A;  3D4D A;  3HOX H;  3IRB A;  4DV1 L;  5GAG C;  1XTC D;  2HCC A;  4DV0 Q;  4FXK C;  1AZQ A;  1IBK L;  2QGQ A;  3CXC A;  5KNC A;  3A54 A;  5NUC A;  1PTO D;  2DJG C;  1QE6 A;  3MHB A;  2G9D A;  2NVQ H;  4A3G G;  3H91 A;  4IOA A;  5FO7 B;  2F4V Q;  1TS3 A;  2LXK A;  2KEN A;  2RDH A;  2X6L A;  2PMZ E;  3SEB A;  1O7I A;  2UXB L;  2ZTE A;  4A3M G;  1EYC A;  3SVM A;  1OTC A;  1YHQ A;  4PV1 C;  4X66 L;  3PGZ A;  3BDO A;  1VMP A;  4F88 A;  5IYC H;  4MZ9 A;  1GM5 A;  4KHP Q;  1I4G A;  3EBE A;  3DWP A;  1N36 Q;  2LS0 1;  2XIW A;  1JCK B;  4S3S A;  5M5W B;  5COY A;  5C44 H;  1L1O B;  1J9O A;  1MSH A;  4ZKB B;  3AU7 A;  1LV9 A;  2B3G A;  2FXQ A;  1IKM A;  2ZXR A;  3FKI G;  4GN3 B;  3EVQ A;  4JV5 L;  4B3R Q;  1AH9 A;  4N8F A;  4DUZ Q;  4A3I G;  1KTK A;  3BJU A;  4X62 L;  1FJG Q;  4RMF A;  1FGU A;  2NN6 H;  4DUY Q;  4JPB W;  3NQT A;  5ELE A;  4YHH Q;  1L2F A;  3RD4 A;  1SAP A;  5HGT A;  2L9H A;  2R7F A;  2XRQ D;  5LL6 X;  2LKV A;  4NB3 A;  5M5Y B;  3IL8 A;  5BN5 A;  1TKW B;  2I5L X;  1PFB A;  1Y14 B;  4A3F G;  4P2C B;  2ENB A;  2V1C C;  4C3I B;  1ONL A;  4DAM A;  3HOV G;  1F9P A;  2BCO A;  3I4N H;  2RCN A;  1E3P A;  3UE0 A;  4PZ6 A;  2F0T A;  5FO9 B;  3DM1 A;  3S1Q H;  2NVY H;  5C0X H;  1SDF A;  3B6Y A;  4U68 A;  3NUC A;  1B7Y B;  3N6R A;  1YEZ A;  2ICE C;  2IX3 A;  2FIN B;  4JBW A;  3VYS A;  4CHT B;  3OHX C;  4H13 C;  3GV6 A;  3KLS X;  2YYZ A;  4ZCK A;  4B3R L;  3WOF A;  1STA A;  3M85 A;  5EQ0 A;  4FXD A;  3BYT B;  4PG3 A;  5JAV A;  4X6A H;  2PW7 A;  4KLK A;  3CCM A;  2OTL A;  2K50 A;  5IGC A;  4IUR A;  4AH6 A;  4A93 G;  5J39 A;  1CUK A;  4KKT A;  4HJ5 A;  1SFO H;  3NEM A;  4ODG A;  3ONA B;  4B3M Q;  4X66 Q;  1LT5 D;  3SK8 A;  2B63 H;  1PH4 A;  4K8J A;  3MC0 B;  4A3B G;  2UXB Q;  2VS1 A;  4CDD C;  2ES2 A;  1RIP A;  2J7Z A;  2EVB A;  4LF7 Q;  3KFU A;  3KLS A;  1O7Y A;  1IXR A;  1GUN A;  1M8A A;  1V1P B;  1PA6 A;  2JA7 B;  1YHA A;  2SNS A;  1T9H A;  1D1K A;  5IYD G;  2KJX A;  1W2B A;  3N52 A;  3G4S A;  2XN9 C;  4Y7N B;  4DV1 Q;  1WTQ A;  1A62 A;  3R8B A;  3BZC A;  2ZM6 L;  3S2D H;  2HDM A;  1X3E A;  1VF7 A;  4A4I A;  4YCW A;  2B29 A;  3L0O A;  2K5W A;  4J15 A;  5C4Z A;  3W2D A;  5ISR A;  1LAB A;  2KUM A;  1K9M C;  2E2D C;  2VQF Q;  1HNX Q;  1B44 D;  4ZYS A;  3I72 A;  3J80 E;  2JXM B;  3MA2 B;  4DNT B;  1QJO A;  4DAV A;  1I3Q B;  3A7A B;  4DV3 L;  4AYB E;  1LTA D;  2DNC A;  1BCP F;  2E5L L;  2Z0S A;  5I6W A;  1IKL A;  2OT2 A;  3OIQ A;  5KEE A;  1VQN A;  4I7Z C;  1VQH A;  1DYQ A;  4FF3 A;  2BE5 C;  4IUQ A;  2I46 A;  3OTO L;  4HIK A;  4FVM A;  4X64 L;  2RA4 A;  5FJ8 H;  1D2B A;  4CDE C;  4GKK L;  4PMB A;  1QOH A;  4MNO A;  3IFD A;  1SYC A;  4EQN A;  1PH7 A;  5ELO A;  4IO9 A;  3NEL A;  1X56 A;  1N8R C;  4GLX A;  1FGB D;  1SE2 A;  1JC7 A;  4IPC A;  4Y52 H;  4DR7 Q;  4FYD A;  2KCT A;  3JAM i;  5JPN C;  3I2Z A;  2L15 A;  4R1J A;  4HSP A;  1AEX A;  4JI0 L;  3RR5 A;  4DV2 Q;  4UHV A;  4EQ5 A;  1EWI A;  1L1O A;  2VW9 A;  1BF4 A;  3ITP A;  1Q8K A;  1F77 A;  1SSO A;  3KOJ A;  2IWH A;  2NVT H;  1RD9 D;  2B2T C;  2WAC A;  1PH3 A;  2CCZ A;  2K5H A;  1QVC A;  2MO0 A;  1UEB A;  1F9R A;  2NN6 G;  1GVP A;  3U9O A;  5IOC A;  4DR1 Q;  2RVL A;  2J0T D;  4JI7 L;  1K73 C;  1BKB A;  3D4W A;  2AUK A;  1J8I A;  3KF6 A;  4RWS C;  4JBM A;  2WAQ E;  2F3V A;  1GKH A;  3CQZ B;  3A8J E;  1CZW A;  4RHR A;  1QIL A;  4DU9 A;  1LUZ A;  2EYP A;  3OMC A;  3UDF A;  1EY6 A;  1SYE A;  4BBR B;  1QNU A;  2A68 C;  2UU9 L;  2Z6K A;  3PIO 3;  3BG3 A;  4L6T B;  1XPU A;  4ILW A;  4X62 Q;  2PQA A;  1WOC A;  1DOM A;  3A55 A;  2R92 B;  3I4N G;  2EE1 A;  2Z4I A;  1SRU A;  1Y1V B;  1SRO A;  2K4K A;  1HZB A;  1I50 B;  1JWM D;  1QB5 D;  1WCM H;  3X3M A;  2WKD A;  1TXY A;  4ID6 A;  2NVQ B;  4BBS H;  1BR9 A;  4DNR B;  3WDN A;  5BR8 L;  3LGJ A;  4X65 Q;  3EQL C;  3IKJ A;  1SNM A;  2K5V A;  3V2T A;  3KDF A;  2A5H A;  2OQK A;  4O1N A;  3I7F A;  3MWY W;  4ULL A;  1DZ1 A;  2F4V L;  4WFN 3;  1VQO A;  4FXG C;  1RJT A;  2UXC L;  1SR3 A;  2F0F A;  2PZW A;  4OWT B;  3K7U C;  2NZH A;  4FF1 A;  4OGQ C;  4RGM A;  3VR6 A;  3E9I A;  2B63 B;  4AQY L;  2VZA A;  4IJH A;  3S2H H;  5EKK A;  4K5X A;  4B9W A;  4QUC A;  3E6Z X;  4MIU A;  1YIJ A;  3LX0 A;  3W3A A;  2RDG A;  3BVZ A;  1MGS A;  1MSG A;  1PH9 A;  3A56 A;  4QL5 A;  4DV3 Q;  4U67 3;  2F3I A;  3AMU A;  2WV6 D;  4K5W A;  3JAM c;  1Q46 A;  5T1G A;  5KNB A;  1OXS C;  3Q6S A;  3PIO A;  1D8L A;  1L0X B;  3I8Z A;  4NP5 A;  3UI2 A;  2KCM A;  4JI3 Q;  3P20 A;  4RG1 A;  5LMN L;  3H0G G;  3OIP A;  1K83 B;  1TY0 A;  1YNN D;  2Z6B A;  2MQH A;  3K0Y A;  3G71 A;  4A3K G;  4QMG A;  4DV7 L;  2ZM6 Q;  1QVG A;  1CA6 A;  3J7A 5;  1Z6H A;  3L2P A;  2IX1 A;  2JA6 G;  4DN4 M;  4ABN A;  1EY8 A;  2HCI A;  1XPO A;  4CKC A;  3D8G A;  5J1Z A;  3HOZ B;  4AQY Q;  4DR6 L;  1LYL A;  1JJC B;  5D3D A;  3PO3 H;  3T16 A;  1WTW A;  2JJQ A;  5IT9 L;  2B2V A;  3MFY A;  4BA2 I;  1S5C D;  3HP3 A;  1X32 A;  3ERS X;  4RFB A;  2RCF A;  5T1I A;  4RCN A;  1PVO A;  3S14 B;  1PH8 A;  4CJ1 B;  4DR3 L;  3UDI A;  3STB D;  3PUX A;  4LW1 A;  5IY0 A;  3HOV B;  5M3F G;  2A74 C;  4OIJ A;  2AQ2 B;  1JE4 A;  2F0H A;  4MHE A;  1BBU A;  2QCP X;  1PDQ A;  1SYD A;  3RZO B;  1EEF D;  1KIX A;  4LFC Q;  3PO3 G;  2JA9 A;  2AKW B;  1CQF A;  3RUZ A;  4XXE A;  2PCF B;  2RDF A;  1EY7 A;  5AFW A;  2N55 A;  4WJW A;  2NZO A;  5M3F B;  1WYD A;  4BA1 I;  2FHT A;  3AQQ A;  2OXP A;  3DMU A;  3LWU A;  2F4I A;  1H9S A;  1X3F A;  2SEB D;  4RGO S;  1ZKO A;  1EY4 A;  5CV7 A;  1SE4 A;  2UUB Q;  3FPP A;  5IT9 E;  2R3Z A;  2K05 A;  1HA5 A;  1PYW D;  2MP1 A;  1JWS D;  1C0A A;  4GOP A;  1X3G A;  2PNR C;  2NZ1 D;  1D5Z C;  2Y0S G;  4OX9 Q;  5D3I B;  3GDE A;  4KY7 A;  4BY7 B;  1GUS A;  1MKH A;  2RSN A;  4HED A;  5BN3 A;  5FLM H;  3K59 A;  4JI7 Q;  3I4N B;  3DEO A;  4IUP A;  2C9O A;  4DR1 L;  1Q1E A;  1Y1V G;  1PRT F;  4C3I H;  4GNX C;  2CQO A;  3S1Q B;  2XWJ B;  1TU2 B;  3T1H Q;  2RHS B;  3S16 B;  4RHS A;  5IGB A;  4K8I A;  4DKA C;  1SBB B;  2A73 B;  1XTD A;  1EEI D;  1CZG A;  2KED A;  2BA1 A;  1XNQ Q;  2F1M A;  4CKE A;  2K28 A;  4JW0 A;  2E8G A;  3BDC A;  3JAM E;  3NXW A;  4ZRZ A;  1U9R A;  4EX5 A;  4GZY C;  5JJL A;  4I65 A;  3U9S A;  3CCS A;  3NTH A;  3TDQ A;  1A63 A;  4N9P A;  1IHZ A;  1PTO F;  1V43 A;  1PZJ D;  1MHW C;  4G57 A;  4KN7 C;  1WTO A;  2HUG A;  3OSO A;  2D62 A;  1PYB A;  2EOT A;  1IYV A;  3PMF A;  5CBE E;  3MZ5 A;  3HOW G;  1TS5 A;  2QF7 A;  2XSC A;  1LLR D;  3K8A A;  2O5J C;  2ZTD A;  2XVS A;  1AW7 A;  2JA5 B;  3S1N H;  5DAU A;  1IBK Q;  4JI1 L;  2F0D A;  4ZUJ A;  2DUD A;  1OXX K;  1EOT A;  4IUT A;  1TQO A;  4LFB Q;  5D14 A;  1QUQ A;  3HGB A;  1F2M A;  3C1F A;  3FMC A;  1EU4 A;  3HFZ B;  4QIW B;  3C46 A;  3P7J A;  2D0O A;  2K52 A;  2Q2U A;  4R4I A;  3VR2 A;  1P16 A;  2F0O A;  2F03 A;  4JBK A;  5E4W C;  3H09 A;  2RKS A;  3RLN A;  3VYT A;  1PHJ A;  4A3D B;  1GOZ A;  5A2Q L;  5AJ3 Q;  3CCU A;  4HIO A;  2E2I B;  4G7O C;  3FKI H;  4UY8 C;  1QWY A;  4F8M A;  2XGT A;  4DR5 L;  4LF6 L;  3I4M H;  3WOE A;  2Z9H A;  4H0L C;  1K8O A;  2BH8 A;  3K57 A;  1Q81 C;  5JJI A;  5JOB A;  2ZT9 C;  2A6E D;  3U4V A;  2C35 B;  1JB3 A;  4A3F H;  1EIH A;  1XMO L;  4L5R C;  2B8G A;  1TWG B;  4WJ4 A;  4A3E G;  1PZK D;  4DK0 A;  3TZD A;  3M4Q A;  4PMC A;  3TP5 A;  3KF6 B;  3BYY B;  4JVZ A;  3GTP H;  1H9S B;  4GN5 A;  2B39 A;  3CKI B;  1HZ9 A;  3CQZ H;  3WWV A;  4FDB A;  1SFO B;  1FD7 D;  2HIX A;  1OXU A;  1L0W A;  1YNJ D;  3NP8 A;  1Q7Y C;  4GKJ L;  4IFD G;  2OQ0 A;  2L4N A;  4IAL A;  2MUY A;  3CCR A;  5FJ8 G;  4FF4 A;  2R6G A;  4JYA Q;  1M1K C;  3J7Y W;  3PO2 G;  5IE8 A;  3GTM B;  5EPL A;  3CCL A;  3W1B A;  5E3F A;  4X3T A;  1HNZ L;  3U50 C;  1EFI D;  1XYI A;  2R7Z G;  1K3R A;  1JMC A;  1B1Z A;  3K80 C;  5KYL A;  1XMQ L;  3HOU H;  4OON A;  4L5S A;  2F0K A;  4DV6 Q;  1E22 A;  4LWC A;  4JI2 Q;  2UUA Q;  3M7G A;  3KBX A;  3PF4 A;  1MJC A;  1SE8 A;  2LXJ A;  3C3L A;  2PNH A;  2BH2 A;  1B3A A;  4GLA C;  2PI2 A;  3ER0 A;  3BZK A;  4RA8 A;  2EYH A;  4F87 A;  3QB3 A;  1MIU A;  4JBJ A;  5C0X J;  4A3D G;  3V05 A;  1M90 C;  1RTO A;  5IGG A;  1W6K A;  3J80 c;  1UE1 A;  4XT1 B;  4ME5 A;  1FJG L;  3HOV H;  1AE2 A;  5JPM C;  1D5X C;  1B3Q A;  1O80 A;  2D0P A;  4R4T A;  4MN3 A;  1G51 A;  4KY5 A;  4JV5 Q;  3S1M H;  4C3I G;  3RN5 A;  4BY7 G;  5C4X H;  4HCS A;  3KJO A;  4IZ8 A;  2R61 A;  4A3E B;  3D0F A;  2AQ1 B;  5FLX c;  2QW7 A;  1Z9F A;  1FYC A;  5IIF A;  4DGZ A;  2YTV A;  3R2I A;  3GTG H;  2LMC B;  3UDG A;  1GHJ A;  1IW7 C;  1B9M A;  1C7Y A;  5EJW A;  3GTM H;  4JYA L;  3EA6 A;  3MXU A;  1NBW A;  4LUV A;  4GOP C;  1ICW A;  2EY1 A;  3X3N A;  1HNW L;  1SMY D;  2QEJ C;  3VDY A;  2IY5 B;  4A3L G;  1CSP A;  2RQX A;  1EFW A;  2R7Z B;  1U0L A;  1QG7 A;  1X65 A;  4A93 B;  2MPM A;  1VS0 A;  3SE0 A;  1VQD A;  2RBM A;  1XX8 A;  5EKL A;  1A2U A;  3K5O A;  4ME3 A;  4NXN Q;  3J7A F;  4K0K Q;  5M5W H;  2KOL A;  2K04 A;  4Q0F A;  4R4C A;  5E1F A;  1I94 L;  2PQA B;  2K5D A;  5DNF A;  3L9A X;  3S2H B;  1CKM A;  4L5T A;  2EZV A;  2Z8L A;  1VQE A;  1UE6 A;  3I4M B;  4DV6 L;  3TP8 A;  3E0J A;  4PNY A;  2F0P A;  1E2V A;  1PH5 A;  1F9S A;  1KNA A;  1SJE D;  1HJP A;  2NBF A;  1R9T B;  4X3S A;  2Z6K C;  3O13 A;  1H9J A;  4A3D H;  1HTP A;  1U5K A;  1VQM A;  3CF5 A;  1HPC A;  5LMN W;  5DM7 3;  3NWT A;  2FMC A;  4K0K L;  3DXJ C;  1IL2 A;  4NXN L;  1O7Z A;  1BDO A;  1TS4 A;  3J81 E;  3ZJY C;  2LFN A;  1CHP D;  2QA4 A;  3HOZ H;  3MXP A;  2JA5 H;  4A3K B;  1CKN B;  1DD2 A;  2N88 A;  1VQK A;  4LF4 L;  4Q5V A;  3G48 A;  1W6J A;  1YJ9 A;  3DM3 A;  3A74 A;  3NK9 A;  1VQ7 A;  1GHK A;  1JJ2 A;  2JA6 H;  2F0N A;  3DLL A;  4YIJ A;  4LF8 L;  3R3O A;  4A3C G;  3GTJ H;  1JT8 A;  1K8M A;  1YNJ C;  1WCM G;  2BOS A;  3CAM A;  5F2D A;  5I2X A;  4BXX H;  2B2U A;  2AHO B;  2F0J A;  4A3G B;  1N33 L;  1SNQ A;  2EYL A;  1PYS B;  2VL6 A;  3BU2 A;  4KJN A;  4IFD H;  4HMJ A;  3I70 A;  1S5E D;  2JA5 G;  5C4H A;  1SYG A;  1K8G A;  3IFT A;  3A5U A;  3HG9 A;  1TVX A;  3M3Y H;  3RMH A;  4QIW E;  2ALY B;  4K6L A;  1PRT C;  4M1U B;  1ZYR D;  2A6H C;  4HSV A;  1V1Q A;  1KDB A;  2ID0 A;  1EQV A;  1TII D;  4OIK A;  4BXX G;  4DV4 L;  3PSI A;  1TWH B;  1CQV A;  3F8T A;  3T1H L;  1TWA H;  1HR0 W;  4DPG A;  3I4M G;  1EIF A;  4L8J A;  3E3X A;  3KLW A;  4FNF A;  2X69 A;  3MTS A;  2E2J B;  2CQA A;  2Z1C A;  1CA5 A;  4P73 A;  2HT1 A;  2D9U A;  4P71 A;  2YU9 B;  3BVG A;  4PMW A;  2A68 D;  2EPB A;  4PZ8 A;  4DV5 Q;  2R93 B;  3KDF B;  4A3J B;  3M4O B;  1HNW Q;  3TEH B;  2PYK A;  1XNR Q;  1TWH H;  1LTS D;  5C4X G;  4KD4 A;  1ENA A;  1S3O A;  4C3J G;  3A8K E;  1HNZ Q;  2ZTC A;  3H15 A;  4DAY A;  2EJF C;  5M5X H;  5IYB H;  1STN A;  1CT1 D;  1YBY A;  5CBA E;  1IYU A;  3AB9 A;  1SEB D;  1EU3 A;  3FRP B;  2ASB A;  4TKO B;  3PO2 H;  2FMM A;  1VCI A;  2N78 A;  1RDP D;  3M4P A;  4QY7 A;  1PXU A;  5EBC A;  3F2B A;  1SYB A;  3DWA A;  2YV5 A;  4ZQ3 A;  1X55 A;  1ZEQ X;  2EY2 A;  3DHQ A;  3GTK B;  5EGT A;  1OXT A;  4IPG A;  2L5T A;  2KCN A;  4HJA A;  3P75 A;  2EXZ A;  2SDF A;  1B70 B;  1LTG D;  1SN8 A;  3GTJ B;  1STY A;  3OWF A;  3K6O A;  2NVX B;  5EKI A;  1WFQ A;  4DR6 Q;  2IHE A;  2B2U C;  5CMD A;  3OYY A;  3W5O A;  3H3V I;  1E24 A;  4KKS A;  4HR7 B;  2JA8 H;  2QEX A;  1AP0 A;  5M3M H;  2B63 G;  4LUZ A;  1D5M C;  3K0X A;  5JEA J;  1UEA B;  5E4X A;  2WAQ B;  3OW7 A;  2K75 A;  3GQB A;  4JI3 L;  1WD0 A;  4AYB G;  5C5M A;  3K58 A;  1B4O A;  2K1B A;  4OO1 G;  3DEP A;  4CDC C;  5GAE C;  3A7L A;  2EDG A;  5KGU A;  1L1O C;  4V19 0;  1JJG A;  4QUF A;  2EQS A;  3BS1 A;  3G6J B;  2KEE A;  1K0S A;  2L11 A;  1KC8 C;  5FLM G;  4K6D A;  4LMQ D;  4JI1 Q;  1Y8O B;  1ZXT A;  2IT1 A;  4KKU A;  3M4Y A;  5C3W A;  3R93 A;  2V4D A;  3HOU G;  4NDX A;  3G6E A;  2Z4H A;  3GTP B;  2JYO A;  4AIM A;  3FPU B;  4GNX B;  5COR A;  5IYB G;  4XDX A;  1ASZ A;  1HXY D;  1H9K A;  3CCQ A;  1NR2 A;  3HEJ A;  3U58 A;  1EWH A;  3TS0 A;  4QCL A;  3PQI A;  3CPW A;  1VQP A;  2K32 A;  4UP7 A;  3ND9 A;  1BVS A;  2E76 C;  3SGI A;  2F0S A;  3SHL A;  4QGU A;  4JI8 Q;  3SDZ A;  5ELB A;  3NTI A;  2J4X A;  4NKL A;  3GTG B;  1VQ4 A;  1WTV A;  1ZYR C;  4POF A;  3SXH A;  4CKB A;  4HAE A;  1PRT D;  4GS3 A;  2Q8R E;  4EQP A;  2CH4 A;  2QIL A;  2UU9 Q;  4IQZ A;  1V8Q A;  2WAQ G;  2CW0 C;  2M2L A;  5IWA Q;  3I3C A;  1PH6 A;  1H95 A;  3S15 H;  1PTO C;  1D7Q A;  4P72 A;  2LY7 A;  4ZUI A;  3NQI A;  1WJJ A;  1AZP A;  3KF8 A;  1PH1 A;  3M7N A;  2WKC A;  3ERO A;  1BBX C;  2NN6 I;  2UXC Q;  5FKA C;  4J1M A;  3CCJ A;  4B3T L;  2DY8 A;  2E2H H;  2UUB L;  1STH A;  2Q2H A;  1WI5 A;  3VR3 A;  5A2Q E;  1RTN A;  3HKZ B;  3Q8D A;  1MI2 A;  1YZ6 A;  1NMF A;  5LHY 1;  4X65 L;  4CJ0 B;  5C3E G;  1DON A;  2F0I A;  3ULP A;  2Q8T A;  5BR8 Q;  2F0G A;  3HOU B;  5I9O A;  2O2L D;  1CHQ D;  2Q8I B;  5ELF A;  4LFC L;  1BNZ A;  4DV2 L;  2K5N A;  4KY6 A;  1B53 A;  3ULJ A;  1BCP B;  4K2K A;  5LMU Q;  2F0Q A;  1I4P A;  3H6M A;  4A75 A;  1VQG A;  1XNQ L;  4IUN A;  4IUV A;  4A3K H;  1EY5 A;  1AFP A;  3T1Y Q;  3PF5 A;  3S16 H;  4H7B A;  3CPF A;  3ND8 A;  1ET6 A;  3GD7 A;  1O78 A;  4YWM A;  4KV6 A;  2EJM A;  4B3T Q;  4YWL A;  3HRZ C;  1EYA A;  1D6E C;  1NAP A;  3HOX G;  2EJG C;  4OX9 L;  4K2L A;  4KI0 A;  3K7A H;  2F0E A;  2GVB A;  2IX0 A;  3ZYY X;  3D3R A;  3GP7 A;  1LTL A;  5GQO A;  5EPJ A;  1ESR A;  3S24 A;  4JCV E;  5A35 A;  1G2S A;  3TRE A;  1PTO H;  3VYR A;  3PIP 3;  2EY6 A;  1PFM A;  4Z9C B;  4R8N A;  5IGE A;  4JI6 L;  5M5X B;  4C2M B;  3PO2 B;  1BCP D;  1XWE A;  2VQF L;  4XYQ A;  1HNX L;  2VUM G;  3TME A;  3K7A B;  4C3H G;  1IBL Q;  1G8Z D;  3FKI B;  3I4L A;  3KYH C;  4JI8 L;  1M4V A;  4G4K A;  1KL9 A;  2ZXP A;  3T53 B;  3IAY A;  2NYZ D;  2R93 G;  2VUM B;  4A3J H;  3FDT A;  3W1G A;  4OWX B;  2HDL A;  4R4O A;  2UUC Q;  4C56 C;  2WB1 E;  2PI2 E;  2OF1 A;  3UE1 A;  2SOB A;  3MEF A;  1HUN A;  1DCZ A;  3M4O H;  1QUQ B;  2I0Q A;  2NVT B;  2HHH Q;  4DR3 Q;  4A3I H;  3T56 B;  2TMP A;  4V0B A;  1BOS A;  2E2J H;  2HIV A;  3RN2 A;  3STB C;  3F1Z A;  4APV A;  3RLO A;  3I56 A;  1Y1W G;  1VDZ A;  3K81 C;  1TR5 A;  4L63 B;  2HHH L;  1SNP A;  3FP9 A;  3OTO Q;  4FP5 D;  3S1R H;  2PMZ B;  1HHV A;  4R4Q A;  1U4P A;  3QIA A;  4LK1 C;  4OHJ A;  1KLG D;  5JJZ A;  3JC6 6;  4PQX A;  2E74 C;  1K83 H;  1A0I A;  3TQY A;  3J81 i;  5C4X B;  1EY9 A;  1BBW A;  1JWU D;  4ZLT F;  1IBL L;  1KRS A;  1FNU A;  1IBM L;  5KIX A;  4IFD I;  1MBY A;  2A69 D;  3D31 A;  4H44 C;  1YVC A;  2R7Z H;  4A3G H;  4OL7 A;  2OCE A;  3I4O A;  5C6A A;  3S9W A;  1NY4 A;  1HR0 L;  4LUO A;  1EIG A;  2CW0 D;  3FHW A;  3GO5 A;  1N32 L;  1JOO A;  2JQO A;  5BN4 A;  1Q8I A;  4PZ7 A;  2Y0S E;  1CKO A;  1BO0 A;  2M9V A;  4QF4 A;  1G6P A;  1SNC A;  2IL8 A;  4EGV A;  2JEB I;  1F2Z A;  1HZA A;  4GLV B;  5IP7 H;  1J5E Q;  2QDL A;  4JI4 Q;  4O42 A;  4A3M B;  2X6G A;  2BE5 D;  3EJI A;  2EYJ A;  2DJF C;  1EY0 A;  4L5Q A;  1GJX A;  3Q23 A;  3HOY G;  4LF9 L;  1LT3 D;  4B3M L;  1SXT A;  1SND A;  2JA7 H;  2F0U A;  3S17 H;  1DXM A;  1KRT A;  4K14 A;  5K5P A;  4YY3 Q;  5K36 H;  4TRD A;  2WB1 B;  4NXM Q;  1I5F A;  4JI0 Q;  1STG A;  3EFX D;  4YY3 L;  2E2H B;  3BVM A;  1A8V A;  1IL8 A;  5IYD H;  3H0G B;  4JOI C;  4HN7 A;  4KHV A;  1W3S A;  2G9H D;  1BUV T;  1Y1W H;  2MGS A;  5CC4 A;  1DOL A;  4G7H C;  5C5L A;  1KAW A;  4LF9 Q;  1B2T A;  4K5V A;  3P1H A;  2DY7 A;  2A19 A;  1I4H A;  3S17 B;  3OMG A;  2O5I C;  2QKI C;  1ET9 A;  4GKK Q;  1CTM A;  4XQJ A;  5FLX L;  2IW3 A;  2F0W A;  1BQQ T;  4GNX A;  4JI4 L;  5K36 G;  3I73 A;  2O4X A;  4HCE A;  1J5E L;  3NPP A;  3CC2 A;  4A93 H;  3I90 A;  2GA4 B;  2JP1 A;  4P75 A;  1G6Z A;  2B2W A;  1N32 Q;  1CI3 M;  4UP9 A;  1SYF A;  2MNA A;  4RGN A;  2L55 A;  1FVI A;  3PUZ A;  3CD6 A;  3KJP A;  5ELC A;  4KD3 A;  2PZU A;  4MTN A;  2EXD A;  3E5S A;  1WCM B;  1LT4 D;  1ICF B;  4DV4 Q;  3C1E A;  3UDX A;  2B2Y C;  4M8A A;  3PO3 B;  2CH4 W;  1TWF B;  2B2V C;  1VQ6 A;  4ZK9 B;  5IP7 G;  1IBM Q;  5EBD A;  1F2L A;  4ZKC B;  1Y8N B;  1HUM A;  4JOI A;  5JVH 3;  2JA8 G;  1T5E A;  1YJN A;  5DM6 3;  4LF5 Q;  1SMX A;  2BA0 A;  3VYU A;  4B3S Q;  2KCC A;  1F9Q A;  1S5F D;  4KMU C;  2QDB A;  1NE3 A;  3L7Z C;  1I6H B;  1ML0 D;  4LF7 L;  3DWQ A;  1YJW A;  1O7L A;  4J8Q A;  4J6H A;  3AYH B;  2KHJ A;  4C1N K;  2K03 A;  4DXG A;  2K01 A;  1KLU D;  2AUJ D;  4LF4 Q;  1DOK A;  2NTT A;  3RZD B;  3CHB D;  4A3C H;  1C4Q A;  3J7A V;  1SE3 A;  1C8C A;  1V9P A;  4UDU C;  3KF8 B;  1L0Y B;  4LF5 L;  1LTR D;  4X3U A;  1X6O A;  2E5L Q;  4O2D A;  1PMR A;  1HFN A;  1C48 A;  1EZ8 A;  5GRO A;  3HOW H;  4KN4 C;  3NWS A;  2A8V A;  4DK1 A;  5C3E B;  1VF5 C;  3HKZ E;  5IP9 H;  5M5Y H;  3LWE A;  3H94 A;  3LNN A;  2EYF A;  1UUP A;  1J6Q A;  4IFD J;  4OEL B;  2P5Z X;  1HCZ A;  2LSS A;  3S2D B;  1LT6 D;  1E1T A;  1SNO A;  4BY1 G;  2R92 H;  2ZXO A;  1P8L A;  1UWV A;  3AEV A;  1UNS A;  2I5H A;  1YI2 A;  4C2M H;  1Y69 U;  3F2C A;  4HID A;  2ZJP A;  3CME A;  4XYO A;  4LFA L;  5C44 B;  4A3L H;  4DNI A;  1LM0 A;  2PO4 A;  4YHH L;  1I3Q H;  1EYD A;  5KYI A;  1X54 A;  1MD2 D;  2HQE A;  3QOL A;  1KAA A;  1VMC A;  5CV8 A;  3T1Y L;  1TWF H;  3MFG A;  3PUV A;  1TWC H;  3CRK C;  1JOQ A;  1NUC A;  1KD1 C;  4JK1 C;  4DUZ L;  1QVF A;  2C5C A;  2KQ3 A;  1GUW A;  1IZ6 A;  5I4D A;  1S5D D;  2CWA A;  2KHI A;  3CW2 C;  5LMU L;  3TZU A;  2WII B;  3SK5 A;  1ENF A;  1K3B C;  4NXM L;  4A3I B;  1V1P A;  4A3B B;  1E7Z A;  5ELD A;  1E1O A;  2DNE A;  1HQR D;  1Q3L A;  1DGS A;  2KEC A;  4Y7N H;  1ILP A;  1R4P B;  3CCV A;  4HMI A;  2YU9 H;  3NBI A;  1EIY B;  3DUZ A;  5G3L D;  2B8F A;  5HUR A;  2F0V A;  1FNW A;  2L1B A;  3GV3 A;  4XT3 B;  3V96 A;  1LAC A;  2VUM H;  1N9W A;  2N49 A;  2HQL A;  2JN4 A;  2M00 A;  2XWB B;  3VA7 A;  2RHQ B;  4DAP A;  4JI5 Q;  3RNU A;  1HZC A;  2B2T A;  1WD1 A;  2PZT A;  2B2Y A;  1XNR L;  2F0L A;  1ENC A;  2MJ8 A;  3S1M B;  4XIG S;  5I6Y A;  1H9R A;  3D4R A;  4B9X A;  4OWW B;  4DR4 Q;  1NTG A;  3F2U A;  3RZD H;  4QQB X;  3QR8 A;  5I2Y A;  5IP9 G;  3M3Y B;  1EYG A;  1A2T A;  2FFK B;  1WTR A;  4DFA A;  2WP8 J;  2IPK D;  4E6I A;  3SK4 A;  4BBS G;  1CM9 A;  3RZO H;  5IWA L;  1K8A C;  3K5M A;  1A3V A;  1I6V C;  1TS2 A;  2MO1 A;  1S40 A;  1HR0 Q;  3KUP A;  4DUY L;  5G3L F;  3NEN A;  3PV0 A;  2JEA I;  1NMG A;  3PIP A;  1Z7T A;  2GVA A;  4RAU C;  1VQA A;  4O0A A;  1JOR A;  2BDN A;  4HJ7 A;  5KRU A;  5M3M B;  1N36 L;  5JEA H;  1I4X A;  5IYC G;  1KHI A;  1JE5 A;  2I5M X;  4KHP L;  1N33 Q;  2F0M A;  1TY2 A;  1XPR A;  1YNX A;  2RSO A;  1PV4 A;  5FLX E;  2K5Q A;  4OXP A;  1KDC A;  2E2I H;  1STB A;  4LF8 Q;  2WB1 G;  2XNA C;  1RCV D; 
#chains in the Genus database with same CATH homology
 4TQU S;  4KJO A;  3QO2 A;  3SK6 A;  1QNK A;  5CV4 A;  1RKN A;  1X3Q A;  2F3W A;  2TSS A;  1D1I A;  1V1O A;  4XTC S;  1Y1W B;  5C0X G;  3A8I E;  2L12 A;  3HOY B;  4RH6 A;  2A69 C;  2EY5 A;  2JSO A;  4RCO A;  1ILQ A;  3FVQ A;  1FR3 A;  4NW2 A;  2K6A A;  1Y8P B;  2L0C A;  2NUC A;  2A6E C;  5CV6 A;  1S4Z A;  1G29 1;  4DF7 A;  1E2W A;  2WIN B;  3NSW A;  1EWC A;  4XQQ A;  1YNN C;  1A3T A;  1Q1B A;  4CBV A;  5CV9 A;  4C3H B;  3OPO A;  1ROD A;  1LO5 D;  1TWA B;  1PFN A;  1H9M A;  1JOK A;  3HS0 C;  3S1N B;  2JA8 B;  2K7V A;  2VB2 X;  3MEH A;  1TWC B;  1A6X A;  4CJ2 C;  4WOR A;  1GXD C;  1PRT B;  1JR0 D;  3MAQ A;  3FEW X;  5TSS A;  3J81 L;  2CVR A;  1HFG A;  2BDO A;  1R4Q B;  1PLF A;  1ESF A;  1GUO A;  2KA7 A;  5CGK A;  3OOC A;  3Q24 A;  3J80 L;  4OO1 H;  1KNE A;  2D5D A;  2A6H D;  3Q0A A;  5IGF A;  1S5B D;  1WTX A;  1X3P A;  3GTO B;  4KTA A;  5FO8 B;  3TBI B;  1KAB A;  1G2T A;  2AWN A;  4UAI A;  1CK1 A;  3HZX A;  3HOX B;  1BCP C;  1RF2 D;  4F7X A;  4BBS B;  3URY A;  4ZAI A;  3QJY A;  2ICI A;  3QG1 A;  4IN3 A;  5C3X A;  2D2C C;  3D6C A;  5IGD A;  4R9W A;  5EPK A;  2KVM A;  4EQO A;  1F2Y A;  2B2W C;  3G7L A;  2NWG A;  4B08 A;  1OO9 B;  1I4R A;  5JEA G;  5FOB B;  5CR3 A;  4BWG B;  1CFM A;  4DA2 A;  3K5L A;  3SR1 A;  5I9P A;  1U4M A;  2K33 A;  1EQT A;  2NB0 A;  1EZ6 A;  3Q22 A;  2KHS A;  3PUW A;  3JAM L;  3T13 A;  5JVG 3;  2IJ0 A;  3PUY A;  1NR4 A;  2NVY B;  5FK9 C;  1GUT A;  4N9T A;  3KK7 A;  4IUU A;  1T5X D;  4WRD A;  3MXN A;  1I4Q A;  3VA5 A;  3CRL C;  3MVV A;  4CGY B;  4EVO A;  3TP6 A;  4TSS A;  3L3O C;  4KHZ A;  1HQM C;  2EYO A;  1FNV A;  3VR5 A;  4RKB A;  3QWN A;  1EL0 A;  4QB4 A;  3GTQ B;  1LTI D;  4XQN A;  4BY1 B;  1HA6 A;  3I91 A;  1QCB D;  3BZD B;  1SJH D;  3NTK A;  5J22 A;  3RLF A;  4KK7 A;  1TT2 A;  3TP7 A;  1Q90 A;  3NE5 B;  1PZI D;  3T4A C;  3R2T A;  5D65 A;  2NTS A;  1G91 A;  1HTL D;  1XXG A;  3C2P A;  3NHH A;  4R8I A;  1U4R A;  2E75 C;  3D6W A;  4LJZ C;  3MXG A;  2PPB C;  2AWO A;  2VNU D;  5C4J B;  1STE A;  4DXF A;  3NBH A;  1AN8 A;  3T51 B;  3H3V C;  5CYU A;  1E2Z A;  1E0B A;  1PTO B;  3TN2 A;  1U4L A;  1RHP A;  2PW5 A;  1Z47 A;  2MHV A;  2AQ3 B;  4C3J B;  3GTL B;  2SNM A;  4BS9 A;  2DN8 A;  3S1R B;  1JQY D;  2I07 B;  1JIC A;  1WVL A;  3KBG A;  1NCV A;  2VB3 X;  4OO1 I;  2OEO A;  2PQE A;  1B9N A;  1KDA A;  1LTB D;  1Q12 A;  3TSS A;  3BDL A;  3S15 B;  4RKL A;  3HOW B;  2EYM A;  5KND A;  2VXW A;  4X3K A;  1LTT D;  4AYB B;  1DJR D;  4LAA A;  1IW7 D;  1B50 A;  2JE6 I;  1II3 A;  5CV5 A;  1SMY C;  1A15 A;  4FF2 A;  3QOJ A;  2XRS D;  5C0X I;  2CHB D;  1A3U A;  1OXV A;  5LL6 S;  4HTH A;  1UAP A;  4RGT A;  3VR4 A;  1GUG A;  1NSN S;  3K5N A;  5IOD A;  5M9O A;  5DEH A;  4NMZ A;  1BXT A;  3CU7 A;  2Y0S B;  3ERQ A;  2JA6 B;  4FO2 A;  4A3F B;  1HRJ A;  3OWE B;  2FJ2 A;  1WTP A;  4C1N I;  2H1E A;  3KLR A;  2H4O A;  1DM0 B;  4G7Z C;  3D4D A;  1XTC D;  2HCC A;  4FXK C;  1AZQ A;  5KNC A;  3A54 A;  5NUC A;  1PTO D;  1QE6 A;  3MHB A;  2G9D A;  3H91 A;  5FO7 B;  1TS3 A;  2RDH A;  2X6L A;  3SEB A;  1EYC A;  3SVM A;  4PV1 C;  3BDO A;  1VMP A;  4F88 A;  1I4G A;  3DWP A;  2LS0 1;  2XIW A;  1JCK B;  4S3S A;  5M5W B;  5COY A;  1J9O A;  1MSH A;  4ZKB B;  3AU7 A;  1LV9 A;  1IKM A;  2ZXR A;  3EVQ A;  1KTK A;  2NN6 H;  3NQT A;  5ELE A;  3RD4 A;  1SAP A;  5HGT A;  2L9H A;  2XRQ D;  5LL6 X;  2LKV A;  5M5Y B;  3IL8 A;  5BN5 A;  1TKW B;  1PFB A;  4P2C B;  2ENB A;  4C3I B;  1ONL A;  1F9P A;  2BCO A;  2F0T A;  5FO9 B;  3DM1 A;  5C0X H;  1SDF A;  4U68 A;  3NUC A;  3N6R A;  2ICE C;  2IX3 A;  2FIN B;  4JBW A;  3VYS A;  4CHT B;  3OHX C;  4H13 C;  3GV6 A;  3KLS X;  2YYZ A;  3WOF A;  1STA A;  3M85 A;  5EQ0 A;  4FXD A;  3BYT B;  5JAV A;  2PW7 A;  5IGC A;  4IUR A;  5J39 A;  4KKT A;  4ODG A;  3ONA B;  1LT5 D;  3SK8 A;  4K8J A;  3MC0 B;  2J7Z A;  2EVB A;  3KLS A;  1O7Y A;  1GUN A;  1M8A A;  1V1P B;  2JA7 B;  2SNS A;  1D1K A;  2KJX A;  3N52 A;  2XN9 C;  4Y7N B;  1WTQ A;  3R8B A;  2HDM A;  1VF7 A;  2K5W A;  5C4Z A;  3W2D A;  5ISR A;  1LAB A;  2KUM A;  2E2D C;  1B44 D;  4ZYS A;  3I72 A;  3J80 E;  2JXM B;  3MA2 B;  4DNT B;  1QJO A;  4DAV A;  1I3Q B;  3A7A B;  1LTA D;  2DNC A;  1BCP F;  5I6W A;  1IKL A;  2OT2 A;  3OIQ A;  5KEE A;  4I7Z C;  1DYQ A;  4FF3 A;  2BE5 C;  4IUQ A;  2I46 A;  4FVM A;  2RA4 A;  1D2B A;  4PMB A;  1QOH A;  3IFD A;  1SYC A;  4EQN A;  1FGB D;  1SE2 A;  1JC7 A;  4FYD A;  5JPN C;  4HSP A;  1AEX A;  1BF4 A;  3ITP A;  1F77 A;  1SSO A;  2IWH A;  1RD9 D;  2B2T C;  2WAC A;  1F9R A;  2NN6 G;  3U9O A;  5IOC A;  2RVL A;  2J0T D;  3D4W A;  2AUK A;  1J8I A;  4RWS C;  2F3V A;  3CQZ B;  3A8J E;  1CZW A;  4RHR A;  1QIL A;  4DU9 A;  2EYP A;  3OMC A;  1EY6 A;  1SYE A;  4BBR B;  1QNU A;  2A68 C;  3PIO 3;  3BG3 A;  4L6T B;  4ILW A;  1DOM A;  3A55 A;  2R92 B;  2EE1 A;  2Z4I A;  1Y1V B;  1I50 B;  1JWM D;  1QB5 D;  3X3M A;  2WKD A;  4ID6 A;  2NVQ B;  1BR9 A;  4DNR B;  3WDN A;  3EQL C;  3IKJ A;  1SNM A;  3V2T A;  2A5H A;  4O1N A;  3MWY W;  4ULL A;  1DZ1 A;  4WFN 3;  4FXG C;  1RJT A;  2PZW A;  2F0F A;  4FF1 A;  4OGQ C;  4RGM A;  3VR6 A;  2B63 B;  5EKK A;  4K5X A;  4B9W A;  4QUC A;  3E6Z X;  4MIU A;  3LX0 A;  3W3A A;  2RDG A;  3BVZ A;  1MGS A;  1MSG A;  3A56 A;  4U67 3;  3AMU A;  2WV6 D;  4K5W A;  5T1G A;  5KNB A;  1OXS C;  3Q6S A;  1L0X B;  3I8Z A;  4NP5 A;  3UI2 A;  3P20 A;  3OIP A;  1K83 B;  1TY0 A;  1YNN D;  3K0Y A;  4QMG A;  1CA6 A;  1Z6H A;  2IX1 A;  4DN4 M;  4ABN A;  1EY8 A;  2HCI A;  3HOZ B;  4CKC A;  3D8G A;  5J1Z A;  5D3D A;  3T16 A;  1WTW A;  5IT9 L;  2B2V A;  3MFY A;  4BA2 I;  1S5C D;  3HP3 A;  1X32 A;  4RFB A;  5T1I A;  4RCN A;  3S14 B;  4CJ1 B;  3PUX A;  3HOV B;  2A74 C;  4OIJ A;  2AQ2 B;  1JE4 A;  2F0H A;  4MHE A;  2QCP X;  1PDQ A;  1SYD A;  3RZO B;  1EEF D;  1CQF A;  3RUZ A;  4XXE A;  2PCF B;  2RDF A;  1EY7 A;  5AFW A;  2N55 A;  4WJW A;  5M3F B;  4BA1 I;  2FHT A;  2OXP A;  3DMU A;  3LWU A;  2F4I A;  1H9S A;  2SEB D;  4RGO S;  1ZKO A;  1EY4 A;  5CV7 A;  1SE4 A;  3FPP A;  5IT9 E;  2R3Z A;  2K05 A;  1HA5 A;  1PYW D;  2MP1 A;  1JWS D;  2PNR C;  2NZ1 D;  1D5Z C;  5D3I B;  4KY7 A;  4BY7 B;  1GUS A;  2RSN A;  4HED A;  5BN3 A;  3K59 A;  3I4N B;  3DEO A;  4IUP A;  2C9O A;  1Q1E A;  1PRT F;  3S1Q B;  2XWJ B;  1TU2 B;  3S16 B;  4RHS A;  5IGB A;  4K8I A;  1SBB B;  2A73 B;  1EEI D;  1CZG A;  2KED A;  2BA1 A;  2F1M A;  4CKE A;  2K28 A;  3BDC A;  3JAM E;  3NXW A;  4ZRZ A;  1U9R A;  4GZY C;  4I65 A;  3U9S A;  3NTH A;  3TDQ A;  4N9P A;  1IHZ A;  1PTO F;  1V43 A;  1PZJ D;  4G57 A;  4KN7 C;  1WTO A;  2HUG A;  3OSO A;  2D62 A;  2EOT A;  1IYV A;  3PMF A;  5CBE E;  3MZ5 A;  1TS5 A;  2QF7 A;  2XSC A;  1LLR D;  2O5J C;  2XVS A;  1AW7 A;  2JA5 B;  5DAU A;  2F0D A;  4ZUJ A;  1OXX K;  1EOT A;  4IUT A;  1TQO A;  5D14 A;  1F2M A;  3C1F A;  3HGB A;  3FMC A;  1EU4 A;  4QIW B;  3C46 A;  3P7J A;  3VR2 A;  2F03 A;  2F0O A;  5E4W C;  3H09 A;  2RKS A;  3VYT A;  4A3D B;  1GOZ A;  5A2Q L;  2E2I B;  4G7O C;  1QWY A;  4F8M A;  3WOE A;  4H0L C;  1K8O A;  3K57 A;  5JOB A;  2ZT9 C;  2A6E D;  1EIH A;  1JB3 A;  2B8G A;  1TWG B;  1PZK D;  4DK0 A;  3TZD A;  4PMC A;  3TP5 A;  3BYY B;  1H9S B;  2B39 A;  3CKI B;  1SFO B;  1FD7 D;  1OXU A;  1YNJ D;  3NP8 A;  4IFD G;  2L4N A;  4IAL A;  2MUY A;  4FF4 A;  2R6G A;  3J7Y W;  3GTM B;  5EPL A;  5E3F A;  4X3T A;  1EFI D;  1XYI A;  1B1Z A;  5KYL A;  2F0K A;  3M7G A;  3KBX A;  3C3L A;  1B3A A;  4RA8 A;  2EYH A;  4F87 A;  3QB3 A;  5C0X J;  3V05 A;  1RTO A;  5IGG A;  1W6K A;  4XT1 B;  4ME5 A;  5JPM C;  1D5X C;  1O80 A;  4MN3 A;  4KY5 A;  4C3I G;  4HCS A;  4IZ8 A;  2R61 A;  4A3E B;  2AQ1 B;  1FYC A;  5IIF A;  4DGZ A;  3R2I A;  2LMC B;  1GHJ A;  1IW7 C;  1B9M A;  5EJW A;  3EA6 A;  3MXU A;  1ICW A;  2EY1 A;  3X3N A;  1SMY D;  2QEJ C;  2RQX A;  2R7Z B;  1QG7 A;  4A93 B;  2MPM A;  3SE0 A;  2RBM A;  1XX8 A;  5EKL A;  1A2U A;  3K5O A;  3J7A F;  2KOL A;  2K04 A;  4Q0F A;  5E1F A;  2K5D A;  5DNF A;  3L9A X;  3S2H B;  2EZV A;  2Z8L A;  3I4M B;  3TP8 A;  3E0J A;  4PNY A;  2F0P A;  1E2V A;  1F9S A;  1KNA A;  1SJE D;  2NBF A;  1R9T B;  4X3S A;  3O13 A;  1H9J A;  1HTP A;  1HPC A;  5DM7 3;  3NWT A;  2FMC A;  3DXJ C;  1O7Z A;  1BDO A;  1TS4 A;  3J81 E;  2LFN A;  1CHP D;  3MXP A;  4A3K B;  1DD2 A;  2N88 A;  4Q5V A;  1W6J A;  3NK9 A;  1GHK A;  2F0N A;  4YIJ A;  3R3O A;  1K8M A;  1YNJ C;  2BOS A;  5F2D A;  5I2X A;  2B2U A;  2F0J A;  4A3G B;  1SNQ A;  2EYL A;  4KJN A;  4IFD H;  4HMJ A;  3I70 A;  1S5E D;  5C4H A;  1SYG A;  3IFT A;  3HG9 A;  1TVX A;  3RMH A;  4K6L A;  1PRT C;  4M1U B;  1ZYR D;  2A6H C;  4HSV A;  1KDB A;  2ID0 A;  1EQV A;  1TII D;  4OIK A;  1TWH B;  1CQV A;  4L8J A;  4FNF A;  2X69 A;  3MTS A;  2E2J B;  2CQA A;  2Z1C A;  1CA5 A;  2D9U A;  2YU9 B;  3BVG A;  4PMW A;  2A68 D;  2EPB A;  2R93 B;  4A3J B;  3M4O B;  2PYK A;  1LTS D;  4KD4 A;  1ENA A;  4C3J G;  3A8K E;  4DAY A;  2EJF C;  1STN A;  1CT1 D;  5CBA E;  1IYU A;  3AB9 A;  1SEB D;  1EU3 A;  3FRP B;  4TKO B;  2FMM A;  1VCI A;  1RDP D;  1PXU A;  5EBC A;  1SYB A;  3DWA A;  4ZQ3 A;  1ZEQ X;  2EY2 A;  3DHQ A;  3GTK B;  5EGT A;  1OXT A;  2L5T A;  2KCN A;  3P75 A;  2EXZ A;  2SDF A;  1LTG D;  3GTJ B;  1STY A;  3OWF A;  3K6O A;  2NVX B;  5EKI A;  2B2U C;  5CMD A;  4KKS A;  4HR7 B;  1AP0 A;  1D5M C;  5JEA J;  1UEA B;  5E4X A;  2WAQ B;  3OW7 A;  3GQB A;  1WD0 A;  3K58 A;  5C5M A;  1B4O A;  2K1B A;  4OO1 G;  3DEP A;  3A7L A;  2EDG A;  5KGU A;  4V19 0;  4QUF A;  3BS1 A;  3G6J B;  2KEE A;  2L11 A;  4K6D A;  4LMQ D;  1Y8O B;  1ZXT A;  2IT1 A;  4KKU A;  3M4Y A;  5C3W A;  3R93 A;  2V4D A;  4NDX A;  3GTP B;  2Z4H A;  2JYO A;  3FPU B;  5COR A;  4XDX A;  1HXY D;  1H9K A;  1NR2 A;  3HEJ A;  1EWH A;  4QCL A;  2K32 A;  3ND9 A;  2E76 C;  2F0S A;  3SHL A;  3SDZ A;  5ELB A;  3NTI A;  2J4X A;  4NKL A;  3GTG B;  1WTV A;  1ZYR C;  3SXH A;  4CKB A;  1PRT D;  4HAE A;  2Q8R E;  4EQP A;  2QIL A;  4IQZ A;  1V8Q A;  2CW0 C;  2M2L A;  3I3C A;  1PTO C;  2LY7 A;  4ZUI A;  3NQI A;  1AZP A;  3KF8 A;  3M7N A;  2WKC A;  3ERO A;  1BBX C;  2NN6 I;  5FKA C;  4J1M A;  2DY8 A;  1STH A;  3VR3 A;  5A2Q E;  1RTN A;  3HKZ B;  5LHY 1;  1MI2 A;  4CJ0 B;  1DON A;  2F0I A;  2Q8T A;  2F0G A;  3HOU B;  5I9O A;  2O2L D;  1CHQ D;  2Q8I B;  5ELF A;  1BNZ A;  4KY6 A;  1B53 A;  1BCP B;  4K2K A;  2F0Q A;  1I4P A;  3H6M A;  4IUN A;  4IUV A;  1EY5 A;  1AFP A;  4H7B A;  3ND8 A;  1ET6 A;  3GD7 A;  1O78 A;  4KV6 A;  2EJM A;  3HRZ C;  1EYA A;  1D6E C;  1NAP A;  2EJG C;  4K2L A;  4KI0 A;  2F0E A;  3ZYY X;  2IX0 A;  3D3R A;  3GP7 A;  5EPJ A;  1ESR A;  5A35 A;  1G2S A;  1PTO H;  3VYR A;  3PIP 3;  2EY6 A;  1PFM A;  4Z9C B;  4R8N A;  5IGE A;  5M5X B;  4C2M B;  3PO2 B;  1BCP D;  1XWE A;  4XYQ A;  3TME A;  3K7A B;  4C3H G;  1G8Z D;  3FKI B;  3I4L A;  1M4V A;  4G4K A;  2ZXP A;  3T53 B;  3IAY A;  2NYZ D;  2VUM B;  3FDT A;  2HDL A;  4C56 C;  2OF1 A;  2SOB A;  1HUN A;  1DCZ A;  2NVT B;  3T56 B;  2TMP A;  4V0B A;  1BOS A;  1VDZ A;  1TR5 A;  4L63 B;  1SNP A;  4FP5 D;  2PMZ B;  1HHV A;  1U4P A;  3QIA A;  4LK1 C;  4OHJ A;  1KLG D;  5JJZ A;  4PQX A;  2E74 C;  5C4X B;  1EY9 A;  1JWU D;  4ZLT F;  1FNU A;  5KIX A;  4IFD I;  1MBY A;  2A69 D;  3D31 A;  4H44 C;  4OL7 A;  5C6A A;  3S9W A;  1EIG A;  2CW0 D;  3GO5 A;  1JOO A;  5BN4 A;  1Q8I A;  1BO0 A;  2M9V A;  4QF4 A;  1SNC A;  2IL8 A;  4EGV A;  2JEB I;  1F2Z A;  4O42 A;  4A3M B;  2X6G A;  2BE5 D;  3EJI A;  2EYJ A;  1EY0 A;  1GJX A;  3Q23 A;  1LT3 D;  1SXT A;  1SND A;  2F0U A;  1DXM A;  4K14 A;  5K5P A;  5K36 H;  4TRD A;  2WB1 B;  1STG A;  3EFX D;  2E2H B;  3BVM A;  1IL8 A;  3H0G B;  4HN7 A;  4KHV A;  2G9H D;  1BUV T;  2MGS A;  5CC4 A;  1DOL A;  4G7H C;  5C5L A;  1B2T A;  4K5V A;  3P1H A;  2DY7 A;  1I4H A;  3S17 B;  3OMG A;  2O5I C;  2QKI C;  1ET9 A;  1CTM A;  4XQJ A;  5FLX L;  2IW3 A;  2F0W A;  1BQQ T;  5K36 G;  3I73 A;  2O4X A;  4HCE A;  3NPP A;  3I90 A;  2GA4 B;  2JP1 A;  1G6Z A;  2B2W A;  1CI3 M;  1SYF A;  4RGN A;  2L55 A;  3PUZ A;  5ELC A;  4KD3 A;  2PZU A;  3E5S A;  1WCM B;  1LT4 D;  3C1E A;  3PO3 B;  2B2Y C;  4M8A A;  1TWF B;  2B2V C;  4ZK9 B;  5EBD A;  1F2L A;  4ZKC B;  1Y8N B;  1HUM A;  5JVH 3;  1T5E A;  5DM6 3;  2BA0 A;  3VYU A;  2KCC A;  1F9Q A;  1S5F D;  4KMU C;  2QDB A;  3L7Z C;  1I6H B;  1ML0 D;  3DWQ A;  1O7L A;  4J8Q A;  4J6H A;  4C1N K;  2K03 A;  4DXG A;  2K01 A;  1KLU D;  2AUJ D;  1DOK A;  2NTT A;  3RZD B;  3CHB D;  1C4Q A;  3J7A V;  1C8C A;  1SE3 A;  4UDU C;  1L0Y B;  1LTR D;  4X3U A;  1PMR A;  1HFN A;  1C48 A;  1EZ8 A;  4KN4 C;  3NWS A;  4DK1 A;  5C3E B;  1VF5 C;  3LWE A;  3H94 A;  3LNN A;  2EYF A;  1UUP A;  4IFD J;  1HCZ A;  3S2D B;  1LT6 D;  1SNO A;  2ZXO A;  1UNS A;  1Y69 U;  4XYO A;  5C44 B;  2PO4 A;  5KYI A;  1EYD A;  1MD2 D;  2HQE A;  3QOL A;  1KAA A;  1VMC A;  5CV8 A;  3MFG A;  3PUV A;  3CRK C;  1JOQ A;  1NUC A;  4JK1 C;  2C5C A;  2KQ3 A;  1GUW A;  5I4D A;  1S5D D;  3TZU A;  2WII B;  3SK5 A;  1ENF A;  4A3I B;  1V1P A;  4A3B B;  5ELD A;  2DNE A;  1HQR D;  1Q3L A;  1ILP A;  2KEC A;  1R4P B;  4HMI A;  3NBI A;  3DUZ A;  5G3L D;  5HUR A;  2B8F A;  2F0V A;  1FNW A;  2L1B A;  3GV3 A;  4XT3 B;  3V96 A;  1LAC A;  2M00 A;  2XWB B;  3VA7 A;  4DAP A;  2B2T A;  1WD1 A;  2PZT A;  2B2Y A;  2F0L A;  1ENC A;  2MJ8 A;  3S1M B;  4XIG S;  5I6Y A;  1H9R A;  3D4R A;  4B9X A;  3F2U A;  5I2Y A;  3M3Y B;  1A2T A;  2FFK B;  1WTR A;  4DFA A;  2WP8 J;  2IPK D;  4E6I A;  3SK4 A;  1CM9 A;  3K5M A;  1A3V A;  1I6V C;  1TS2 A;  3KUP A;  5G3L F;  3PV0 A;  2JEA I;  1Z7T A;  4RAU C;  1JOR A;  2BDN A;  5KRU A;  5M3M B;  5JEA H;  1I4X A;  2F0M A;  1TY2 A;  2RSO A;  5FLX E;  2K5Q A;  1KDC A;  1STB A;  2XNA C;  1RCV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...