1HAAA

A beta-hairpin structure in a 13-mer peptide that binds a-bungarotoxin with high affinity and neutralizes its toxicity
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-BUNGAROTOXIN
publication title A Beta-Hairpin Structure in a 13-mer Peptide that Binds Alpha-Bungarotoxin with High Affinity and Neutralizes its Toxicity
pubmed doi rcsb
molecule tags Toxin/peptide
total genus 8
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1haaA00
1CODA 1H0JA 3U74U 1KS6A 1JE9A 3PLCA 3NEQA 2X8BB 4DO8A 2N99A 1KXIA 2OFSA 1CB9A 2K3GA 1B41B 5DU1A 1PLOA 1L4WA 1TGXA 1HOYA 2QJAC 2H8UA 1M9ZA 3BT1U 1LXGA 1UG4A 2LA1A 2PJYB 1NXBA 4RUDA 3VTSA 4BDTB 1TXBA 2H64B 2JQPA 1KC4A 2H64C 1NORA 4FAOE 4P7UA 1FF4A 1W6BA 4BIKB 1JGKA 4FAOC 3EVSC 2MHYA 5IMTD 1MR6A 1S4YA 1CDRA 3NDSA 1KL8A 1KBTA 1I02A 3KFDI 1QKDA 2CCXA 2HLRA 1ES7B 2ERAA 1CCQA 1YWHA 4IYEA 2UX2A 2H62C 2H7ZB 1ERGA 2BTXA 2GOOC 6EBXA 1KBAA 1BXPA 1QKEA 1CDSA 1DRSA 1CHVS 2MFAA 1ABTA 1HC9A 1MAHF 3HH7A 1IQ9A 3QB4B 3LAQU 3U73U 1KBSA 1CTXA 1V6PA 1CREA 2MUPA 1REWC 5DO6A 2QJ9C 2NBTA 1IDHA 2QJBC 1HAJA 2L5SA 2FD6U 2J8BA 1JBDA 1FSCA 1IDGA 2GOOB 2H5FA 3ERAA 5IMYC 1LXHA 1CXNA 2MJ4A 2VLWA 3KFDE 1G6MA 2MJYA 1IJCA 2LCRA 2MUOA 4XJJA 1KU6B 1NTNA 1FSSB 1RGJA 2L03A 1IK8A 2CRTA 4OM5A 4UY2C 1CXOA 3BT2U 1HAAA 1LJZA 2MJ0A 1F94A 1ERAA 3FEVA 1ZADA 1CDQA 1KFHA 1FFJA 1CRFA 1LX5B 2BHIA 1COEA 4EY8B 2ABXA 1LSIA 3NH7A 4QTIU 1KTZB 1FRAA 2H7ZA 1IKCA 5DZ5A 1NYUA 1NTXA 1NYSA 1QM7A 1IDIA 1RL5A 2CDXA 1XT3A 1NEAA 1FASA 2PJYC 4OM4A 2HLQA 1BTEA 2CTXA 1HC9B 4AEAA 2QC1A 2UWRA 4ZQYA 1CVOA 5EBXA 1TXAA 2JVEA 1IDLA 1CDTA 2H62D 1ONJA 1VB0A 4LFTA 2CRSA 2I9BE 1F8UB 1TFSA 4HQPF 3EBXA
chains in the Genus database with same CATH superfamily
1CODA 1H0JA 3U74U 1KS6A 1JE9A 3PLCA 3NEQA 2X8BB 4DO8A 2N99A 1KXIA 2OFSA 1CB9A 2K3GA 1B41B 5DU1A 1PLOA 1L4WA 1TGXA 1HOYA 2QJAC 2H8UA 1M9ZA 3BT1U 1LXGA 1UG4A 2LA1A 2PJYB 1NXBA 4RUDA 3VTSA 4BDTB 1TXBA 2H64B 2JQPA 1KC4A 2H64C 1NORA 4KSNA 4FAOE 4P7UA 1FF4A 1W6BA 4BIKB 1JGKA 4FAOC 3EVSC 2MHYA 5IMTD 1MR6A 1S4YA 1CDRA 3NDSA 1KL8A 1KBTA 1I02A 3KFDI 1QKDA 2CCXA 2HLRA 1ES7B 2ERAA 1CCQA 1YWHA 4IYEA 2UX2A 2H62C 2H7ZB 1ERGA 2BTXA 2GOOC 6EBXA 1KBAA 1BXPA 1QKEA 1CDSA 1DRSA 1CHVS 2MFAA 1ABTA 1HC9A 1MAHF 3HH7A 1IQ9A 3QB4B 3LAQU 3U73U 1KBSA 1CTXA 1V6PA 1CREA 2MUPA 1REWC 5DO6A 2QJ9C 2NBTA 1IDHA 2QJBC 1HAJA 2L5SA 2FD6U 2J8BA 1JBDA 1FSCA 1IDGA 2GOOB 2H5FA 3ERAA 5IMYC 1LXHA 1CXNA 2MJ4A 2VLWA 3KFDE 1G6MA 2MJYA 1IJCA 2LCRA 2MUOA 4XJJA 1KU6B 1NTNA 1FSSB 1RGJA 2L03A 1IK8A 2CRTA 4OM5A 4UY2C 1CXOA 3BT2U 1HAAA 1LJZA 2MJ0A 1F94A 1ERAA 3FEVA 1ZADA 1CDQA 1KFHA 1FFJA 1CRFA 1LX5B 2BHIA 1COEA 4EY8B 2ABXA 1LSIA 3NH7A 4QTIU 1KTZB 1FRAA 2H7ZA 1IKCA 5DZ5A 1NYUA 1NTXA 1NYSA 1QM7A 1IDIA 1RL5A 2CDXA 1XT3A 1NEAA 1FASA 2PJYC 4OM4A 2HLQA 1BTEA 2CTXA 1HC9B 4AEAA 2QC1A 2UWRA 4ZQYA 1CVOA 5EBXA 1TXAA 2JVEA 1IDLA 1CDTA 2H62D 1ONJA 1VB0A 4LFTA 2CRSA 2I9BE 1F8UB 1TFSA 4HQPF 3EBXA
chains in the Genus database with same CATH topology
1CODA 1H0JA 3U74U 1KS6A 1JE9A 3PLCA 3NEQA 2X8BB 4DO8A 2N99A 1KXIA 2OFSA 1CB9A 2K3GA 1B41B 5DU1A 1PLOA 1L4WA 1TGXA 1HOYA 2QJAC 2H8UA 1M9ZA 3BT1U 1LXGA 1UG4A 2LA1A 2PJYB 1NXBA 4RUDA 3VTSA 4BDTB 1TXBA 2H64B 2JQPA 1KC4A 2H64C 1NORA 4KSNA 4FAOE 4P7UA 1FF4A 1W6BA 4BIKB 1JGKA 4FAOC 3EVSC 2MHYA 5IMTD 1MR6A 1S4YA 1CDRA 3NDSA 1KL8A 1KBTA 1I02A 3KFDI 1QKDA 2CCXA 2HLRA 1ES7B 2ERAA 1CCQA 1YWHA 4IYEA 2UX2A 2H62C 2H7ZB 1ERGA 2BTXA 2GOOC 6EBXA 1KBAA 1BXPA 1QKEA 1CDSA 1DRSA 1CHVS 2MFAA 1ABTA 1HC9A 1MAHF 3HH7A 1IQ9A 3QB4B 3LAQU 3U73U 1KBSA 1CTXA 1V6PA 1CREA 2MUPA 1REWC 5DO6A 2QJ9C 2NBTA 1IDHA 2QJBC 1HAJA 2L5SA 2FD6U 2J8BA 1JBDA 1FSCA 1IDGA 2GOOB 2H5FA 3ERAA 5IMYC 1LXHA 1CXNA 2MJ4A 2VLWA 3KFDE 1G6MA 2MJYA 1IJCA 2LCRA 2MUOA 4XJJA 1KU6B 1NTNA 1FSSB 1RGJA 2L03A 1IK8A 2CRTA 4OM5A 4UY2C 1CXOA 3BT2U 1HAAA 1LJZA 2MJ0A 1F94A 1ERAA 3FEVA 1ZADA 1CDQA 1KFHA 1FFJA 1CRFA 1LX5B 2BHIA 1COEA 4EY8B 2ABXA 1LSIA 3NH7A 4QTIU 1KTZB 1FRAA 2H7ZA 1IKCA 5DZ5A 1NYUA 1NTXA 1NYSA 1QM7A 1IDIA 1RL5A 2CDXA 1XT3A 1NEAA 1FASA 2PJYC 4OM4A 2HLQA 1BTEA 2CTXA 1HC9B 4AEAA 2QC1A 2UWRA 4ZQYA 1CVOA 5EBXA 1TXAA 2JVEA 1IDLA 1CDTA 2H62D 1ONJA 1VB0A 4LFTA 2CRSA 2I9BE 1F8UB 1TFSA 4HQPF 3EBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COD A;  1H0J A;  3U74 U;  1KS6 A;  1JE9 A;  3PLC A;  3NEQ A;  2X8B B;  4DO8 A;  2N99 A;  1KXI A;  2OFS A;  1CB9 A;  2K3G A;  1B41 B;  5DU1 A;  1PLO A;  1L4W A;  1TGX A;  1HOY A;  2QJA C;  2H8U A;  1M9Z A;  3BT1 U;  1LXG A;  1UG4 A;  2LA1 A;  2PJY B;  1NXB A;  4RUD A;  3VTS A;  4BDT B;  1TXB A;  2H64 B;  2JQP A;  1KC4 A;  2H64 C;  1NOR A;  4FAO E;  4P7U A;  1FF4 A;  1W6B A;  4BIK B;  1JGK A;  4FAO C;  3EVS C;  2MHY A;  5IMT D;  1MR6 A;  1S4Y A;  1CDR A;  3NDS A;  1KL8 A;  1KBT A;  1I02 A;  3KFD I;  1QKD A;  2CCX A;  2HLR A;  1ES7 B;  2ERA A;  1CCQ A;  1YWH A;  4IYE A;  2UX2 A;  2H62 C;  2H7Z B;  1ERG A;  2BTX A;  2GOO C;  6EBX A;  1KBA A;  1BXP A;  1QKE A;  1CDS A;  1DRS A;  1CHV S;  2MFA A;  1ABT A;  1HC9 A;  1MAH F;  3HH7 A;  1IQ9 A;  3QB4 B;  3LAQ U;  3U73 U;  1KBS A;  1CTX A;  1V6P A;  1CRE A;  2MUP A;  1REW C;  5DO6 A;  2QJ9 C;  2NBT A;  1IDH A;  2QJB C;  1HAJ A;  2L5S A;  2FD6 U;  2J8B A;  1JBD A;  1FSC A;  1IDG A;  2GOO B;  2H5F A;  3ERA A;  5IMY C;  1LXH A;  1CXN A;  2MJ4 A;  2VLW A;  3KFD E;  1G6M A;  2MJY A;  1IJC A;  2LCR A;  2MUO A;  4XJJ A;  1KU6 B;  1NTN A;  1FSS B;  1RGJ A;  2L03 A;  1IK8 A;  2CRT A;  4OM5 A;  4UY2 C;  1CXO A;  3BT2 U;  1HAA A;  1LJZ A;  2MJ0 A;  1F94 A;  1ERA A;  3FEV A;  1ZAD A;  1CDQ A;  1KFH A;  1FFJ A;  1CRF A;  1LX5 B;  2BHI A;  1COE A;  4EY8 B;  2ABX A;  1LSI A;  3NH7 A;  4QTI U;  1KTZ B;  1FRA A;  2H7Z A;  1IKC A;  5DZ5 A;  1NYU A;  1NTX A;  1NYS A;  1QM7 A;  1IDI A;  1RL5 A;  2CDX A;  1XT3 A;  1NEA A;  1FAS A;  2PJY C;  4OM4 A;  2HLQ A;  1BTE A;  2CTX A;  1HC9 B;  4AEA A;  2QC1 A;  2UWR A;  4ZQY A;  1CVO A;  5EBX A;  1TXA A;  2JVE A;  1IDL A;  1CDT A;  2H62 D;  1ONJ A;  1VB0 A;  4LFT A;  2CRS A;  2I9B E;  1F8U B;  1TFS A;  4HQP F;  3EBX A; 
#chains in the Genus database with same CATH topology
 1COD A;  1H0J A;  3U74 U;  1KS6 A;  1JE9 A;  3PLC A;  3NEQ A;  2X8B B;  4DO8 A;  2N99 A;  1KXI A;  2OFS A;  1CB9 A;  2K3G A;  1B41 B;  5DU1 A;  1PLO A;  1L4W A;  1TGX A;  1HOY A;  2QJA C;  2H8U A;  1M9Z A;  3BT1 U;  1LXG A;  1UG4 A;  2LA1 A;  2PJY B;  1NXB A;  4RUD A;  3VTS A;  4BDT B;  1TXB A;  2H64 B;  2JQP A;  1KC4 A;  2H64 C;  1NOR A;  4KSN A;  4FAO E;  4P7U A;  1FF4 A;  1W6B A;  4BIK B;  1JGK A;  4FAO C;  3EVS C;  2MHY A;  5IMT D;  1MR6 A;  1S4Y A;  1CDR A;  3NDS A;  1KL8 A;  1KBT A;  1I02 A;  3KFD I;  1QKD A;  2CCX A;  2HLR A;  1ES7 B;  2ERA A;  1CCQ A;  1YWH A;  4IYE A;  2UX2 A;  2H62 C;  2H7Z B;  1ERG A;  2BTX A;  2GOO C;  6EBX A;  1KBA A;  1BXP A;  1QKE A;  1CDS A;  1DRS A;  1CHV S;  2MFA A;  1ABT A;  1HC9 A;  1MAH F;  3HH7 A;  1IQ9 A;  3QB4 B;  3LAQ U;  3U73 U;  1KBS A;  1CTX A;  1V6P A;  1CRE A;  2MUP A;  1REW C;  5DO6 A;  2QJ9 C;  2NBT A;  1IDH A;  2QJB C;  1HAJ A;  2L5S A;  2FD6 U;  2J8B A;  1JBD A;  1FSC A;  1IDG A;  2GOO B;  2H5F A;  3ERA A;  5IMY C;  1LXH A;  1CXN A;  2MJ4 A;  2VLW A;  3KFD E;  1G6M A;  2MJY A;  1IJC A;  2LCR A;  2MUO A;  4XJJ A;  1KU6 B;  1NTN A;  1FSS B;  1RGJ A;  2L03 A;  1IK8 A;  2CRT A;  4OM5 A;  4UY2 C;  1CXO A;  3BT2 U;  1HAA A;  1LJZ A;  2MJ0 A;  1F94 A;  1ERA A;  3FEV A;  1ZAD A;  1CDQ A;  1KFH A;  1FFJ A;  1CRF A;  1LX5 B;  2BHI A;  1COE A;  4EY8 B;  2ABX A;  1LSI A;  3NH7 A;  4QTI U;  1KTZ B;  1FRA A;  2H7Z A;  1IKC A;  5DZ5 A;  1NYU A;  1NTX A;  1NYS A;  1QM7 A;  1IDI A;  1RL5 A;  2CDX A;  1XT3 A;  1NEA A;  1FAS A;  2PJY C;  4OM4 A;  2HLQ A;  1BTE A;  2CTX A;  1HC9 B;  4AEA A;  2QC1 A;  2UWR A;  4ZQY A;  1CVO A;  5EBX A;  1TXA A;  2JVE A;  1IDL A;  1CDT A;  2H62 D;  1ONJ A;  1VB0 A;  4LFT A;  2CRS A;  2I9B E;  1F8U B;  1TFS A;  4HQP F;  3EBX A; 
#chains in the Genus database with same CATH homology
 1COD A;  1H0J A;  3U74 U;  1KS6 A;  1JE9 A;  3PLC A;  3NEQ A;  2X8B B;  4DO8 A;  2N99 A;  1KXI A;  2OFS A;  1CB9 A;  2K3G A;  1B41 B;  5DU1 A;  1PLO A;  1L4W A;  1TGX A;  1HOY A;  2QJA C;  2H8U A;  1M9Z A;  3BT1 U;  1LXG A;  1UG4 A;  2LA1 A;  2PJY B;  1NXB A;  4RUD A;  3VTS A;  4BDT B;  1TXB A;  2H64 B;  2JQP A;  1KC4 A;  2H64 C;  1NOR A;  4KSN A;  4FAO E;  4P7U A;  1FF4 A;  1W6B A;  4BIK B;  1JGK A;  4FAO C;  3EVS C;  2MHY A;  5IMT D;  1MR6 A;  1S4Y A;  1CDR A;  3NDS A;  1KL8 A;  1KBT A;  1I02 A;  3KFD I;  1QKD A;  2CCX A;  2HLR A;  1ES7 B;  2ERA A;  1CCQ A;  1YWH A;  4IYE A;  2UX2 A;  2H62 C;  2H7Z B;  1ERG A;  2BTX A;  2GOO C;  6EBX A;  1KBA A;  1BXP A;  1QKE A;  1CDS A;  1DRS A;  1CHV S;  2MFA A;  1ABT A;  1HC9 A;  1MAH F;  3HH7 A;  1IQ9 A;  3QB4 B;  3LAQ U;  3U73 U;  1KBS A;  1CTX A;  1V6P A;  1CRE A;  2MUP A;  1REW C;  5DO6 A;  2QJ9 C;  2NBT A;  1IDH A;  2QJB C;  1HAJ A;  2L5S A;  2FD6 U;  2J8B A;  1JBD A;  1FSC A;  1IDG A;  2GOO B;  2H5F A;  3ERA A;  5IMY C;  1LXH A;  1CXN A;  2MJ4 A;  2VLW A;  3KFD E;  1G6M A;  2MJY A;  1IJC A;  2LCR A;  2MUO A;  4XJJ A;  1KU6 B;  1NTN A;  1FSS B;  1RGJ A;  2L03 A;  1IK8 A;  2CRT A;  4OM5 A;  4UY2 C;  1CXO A;  3BT2 U;  1HAA A;  1LJZ A;  2MJ0 A;  1F94 A;  1ERA A;  3FEV A;  1ZAD A;  1CDQ A;  1KFH A;  1FFJ A;  1CRF A;  1LX5 B;  2BHI A;  1COE A;  4EY8 B;  2ABX A;  1LSI A;  3NH7 A;  4QTI U;  1KTZ B;  1FRA A;  2H7Z A;  1IKC A;  5DZ5 A;  1NYU A;  1NTX A;  1NYS A;  1QM7 A;  1IDI A;  1RL5 A;  2CDX A;  1XT3 A;  1NEA A;  1FAS A;  2PJY C;  4OM4 A;  2HLQ A;  1BTE A;  2CTX A;  1HC9 B;  4AEA A;  2QC1 A;  2UWR A;  4ZQY A;  1CVO A;  5EBX A;  1TXA A;  2JVE A;  1IDL A;  1CDT A;  2H62 D;  1ONJ A;  1VB0 A;  4LFT A;  2CRS A;  2I9B E;  1F8U B;  1TFS A;  4HQP F;  3EBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...