1HAFA

Heregulin-alpha epidermal growth factor-like domain, nmr, minimized average structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution solution structure of the EGF-like domain of heregulin-alpha.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Growth factor
molecule keywords HEREGULIN-ALPHA
total genus 13
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1995-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1hafA00
3TH3L 1M1XB 1WHFA 2W2PE 3Q7DA 1IQEL 2BZ6L 1EPHA 1BF9A 4ISIL 1NFXB 4RS0A 3HO4A 4Y7AB 2W2QE 1YO8A 2P26A 2WFXB 2WPIE 1IVOC 1Z6CA 1HT8A 1LPZA 2XBYL 1N7DA 3LTGD 3LAQA 4BXWA 3H5CB 4TGFA 5JBBE 1W8BL 4CUFA 3N8XA 1EPIA 3HS6A 4A7IA 1DIYA 3SOQA 1B9WA 2M74A 2VWMK 1XKBA 1LPKA 2BOKL 2J4IB 4CUEA 5F19A 5CKQA 1F7MA 1XKAL 2P3TA 3ENSA 1AUTL 1IGXA 3HO5A 2XBXL 5CKMA 3LC3B 1NFWB 2Y80B 1KLIL 6COXA 5L2ZL 2YGPA 3CENL 2VVCK 4X8TL 4Y76B 3QMOA 4ZXYL 1Q4GA 2W3KB 3QCWA 2EI8B 1TPGA 4RRXA 2WPLE 2Y7XB 5JBAE 4BTUA 3NJPC 3NTGA 1F0SB 1ATBA 2RA0L 3V65B 1EAIC 4NA9L 3LN1A 1HRFA 2G00L 1LQDA 2FLBL 3M37L 3N8YB 5KN5C 2XBWL 3TBDA 3LC5B 3GCXE 1J9CL 3SOVA 2AYLA 1OB1C 2F9BL 4RUTA 1NFUB 1RFNB 2EI7B 3KK6A 1EPGA 3IITB 5IKQA 3LN0A 4JZDL 2PHBB 5JVZA 1N1IA 1MQ5L 1PFXL 1P0SL 2K2SB 3BT2A 2P16L 3CA7A 1A3PA 2RHPA 2Q1JB 1IQLL 2NPRA 1U8CB 3FCSB 2D1JB 1K36A 2FZZL 1IQML 1U67A 2BO2A 1APQA 2FLGA 4E1GA 4XLWA 5JVYA 5COXA 2P3UA 2Y82B 4COXA 1YGCL 4XL1A 4MMXB 3U7UG 3PGHA 2BOHA 1G1SA 1G2LB 2Y7ZB 2WPKE 2W2NE 4PH9A 1EQGA 1JL9A 1G1RA 3Q3KB 2ADXA 2WYGB 1FE2A 3OLTA 2TGFA 4LORA 1F0RB 1ATAA 3TK6B 3TK5B 5JBCE 5L2YL 1PTHA 1G1QA 3P5BL 2BQWA 3KCGL 4M11A 2WYJB 1KLJL 3N8WB 4Z0LA 2P28B 1CEJA 2JKHL 4RRWA 1NFYB 2Y81B 3KQBL 2W3IB 1PXXA 2WPJE 3SW2A 1CVWL 2UWLB 3N8WA 4JZFL 1MOXC 3ZYIB 2XBVL 3KL6B 2W26B 3GCWE 1IQFL 1HT5A 1HZ8A 1HREA 2VH0B 2P94L 1DDXA 1C5MF 2W86A 4X8UL 1LMJA 2WG3C 5I46L 1CCVA 1K37A 1WHEA 2XC5L 2PR3B 5EGMB 5E8DA 3M36L 1XFEA 4ZH8B 3KRKA 4AQTA 1LPGA 1YUFA 2CJIB 1CVUA 4YT7L 2WG4B 5L30L 1HCGB 1L3YA 1JBUL 2VH6B 1DQBA 1ATDA 4ZHAB 3IJEB 1IP0A 2W2ME 1KSNB 3HS5A 2J94B 4G1MB 3U73A 3FFGL 1HX2A 1FFMA 1NPEB 1V3XB 3QH0A 3V64C 1HAFA 4Y6DB 1O5DL 5FDQA 3POYA 3NT1A 3BPSE 1ZAQA 5IKRA 1UZJA 2BQ7A 5K0HB 2I9BA 1EQHA 3CS7L 5KIRA 4YZUB 4Z0KB 1F7EA 3R05A 2OYEP 4C16A 1NT0A 1EBVA 3LIWB 3DEMA 4FM5A 3GISX 1X7AL 3HO3A 5CISA 3F1SB 2P3FN 3CFWA 2P93L 1YUKB 2BOUA 4D0FA 2UWPB 4XBMA 4NG9L 3TZIA 4Y71B 5JW1A 2K2TA 3NTBA 3LTFB 1IQHL 1IOEL 1I0UA 1NZIA 4CSYA 2VVVL 2KL7A 4BTIA 2H9EL 2OYUP 2Y5FL 1DVAL 2Y5GL 4BDWA 2KV4A 2WFTA 1G1TA 1EMOA 2RNLA 4O02B 1W7XL 1EPJA 2FD6A 1TLEA 2VWNL 1GK5A 1HAEA 1COUA 5JB9E 5JB8E 3HS7A 2XC0L 4CUDA 2WPME 1KIGL 4BTTA 1SZBA 3KQEL 3C9AC 3K9XA 5CKNA 1URKA 1ATEA 1IQJL 4ISHL 2VVUL 1CCFA 3N8VA 2Y38A 3F6UL 4RRYA 2J2UB 4MMZB 4LMFA 1XDTR 4ZAEB 2BOXA 2XC4L 3N8YA 4JZEL 2MGRA 1FAXL 4Z6AL 4YT6L 5IKTA 2P95L 4X8SL 4X8VL 1IQIL 1EZQB 2VJ3A 3KQDL 2BMGA 4OTJA 1PRHA 1L5GB 4O1ZA 3HPTA 1FF7A 2I9AA 5IKVA 3ASIA 1MQ6L 4Y7BB 3TGFA 3ZYGA 2UWOB 1EGFA 1IJQA 1FJSL 2P3FL 2BQ6A 1Z6EL 2EI6B 1WU1B 2DDUA 1APOA 4M10A 1IQKL 1IOXA 4OTYA 4D0EA 4BXSA 1YUGA 2GD4A 3RR3A 1CQEA 1QFKL 3EGFA 3ELAL 1G2MB 2W2OE 1PGEA 4RRZA 1ADXA 2Y5HL 4JYVL 1P9JA 3BT1A 5F1AA 1DX5I 3ZYJB 1FAKL 4MMYB 1UZQA 2FLRL 4Y79B 1TOZA 2KB9A 4JYUL 1IQNL 1IQGL 1HJ7A 1FSBA 4ZXXL 2VWLL 4BDXA 4D90A 2YGOA 1CX2A 1UZPA 3MDLA 2MHPA 3KQCL 1JV2B 2J38B 3N8ZA 2PUQL 4NGAL 3OLUA 2WPHE 2MGPA 3FBYA 1UZKA 1IGZA 1NQLB 1KLOA 3MQEA 3SOBB 1EMNA 2VWOL 2B7DL 2J34B 2J95B
chains in the Genus database with same CATH superfamily
3TH3L 1M1XB 1WHFA 2W2PE 3Q7DA 1IQEL 2BZ6L 1EPHA 1BF9A 4ISIL 2HORA 1NFXB 4RS0A 3HO4A 4Y7AB 2W2QE 1YO8A 2JJLA 2P26A 2WFXB 2WPIE 1IVOC 1Z6CA 1HT8A 1LPZA 2XBYL 1N7DA 3LTGD 3LAQA 4BXWA 3H5CB 4TGFA 5JBBE 1W8BL 4CUFA 3N8XA 1EPIA 3HS6A 4A7IA 1DIYA 3SOQA 1B9WA 2M74A 2VWMK 1XKBA 1LPKA 2BOKL 2J4IB 4CUEA 5F19A 5CKQA 1F7MA 1XKAL 2P3TA 3ENSA 1AUTL 1IGXA 3HO5A 2XBXL 5CKMA 3LC3B 1NFWB 2VRSA 2Y80B 1KLIL 6COXA 5L2ZL 2YGPA 3CENL 2VVCK 4X8TL 4Y76B 3QMOA 4ZXYL 1LK9A 4GU3A 2YGQA 1Q4GA 2W3KB 3QCWA 2EI8B 1TPGA 4RRXA 2WPLE 2KNIA 2Y7XB 5JBAE 4BTUA 3NJPC 3NTGA 1F0SB 1ATBA 2RA0L 3V65B 1EAIC 4NA9L 1V1IA 3LN1A 1HRFA 2G00L 1LQDA 2FLBL 3M37L 3N8YB 5KN5C 2XBWL 3TBDA 3LC5B 3GCXE 1J9CL 3SOVA 2AYLA 2WZPP 1OB1C 2F9BL 4RUTA 1NFUB 1RFNB 2EI7B 3KK6A 1EPGA 3IITB 5IKQA 3LN0A 2BT7A 4JZDL 2PHBB 5JVZA 1N1IA 1MQ5L 1PFXL 1P0SL 2K2SB 3BT2A 2P16L 2HOXA 3CA7A 1A3PA 2RHPA 2Q1JB 1IQLL 2NPRA 1U8CB 3FCSB 2D1JB 1K36A 2BT8A 2FZZL 1IQML 1U67A 2BO2A 1APQA 2FLGA 4E1GA 4XLWA 5JVYA 5COXA 2P3UA 2Y82B 4COXA 1YGCL 4XL1A 4MMXB 3U7UG 3PGHA 2BOHA 1G1SA 1G2LB 2Y7ZB 2WPKE 2W2NE 4PH9A 1EQGA 1JL9A 1G1RA 3Q3KB 2ADXA 2WYGB 1FE2A 3OLTA 2TGFA 4LORA 1F0RB 1ATAA 3TK6B 3TK5B 5JBCE 5L2YL 1PTHA 1G1QA 3P5BL 2BQWA 3KCGL 4M11A 2WYJB 1KLJL 3N8WB 4Z0LA 2P28B 1CEJA 2JKHL 4RRWA 1NFYB 2Y81B 3KQBL 2W3IB 1PXXA 2WPJE 3SW2A 1CVWL 2UWLB 3N8WA 4JZFL 1MOXC 3ZYIB 2XBVL 3KL6B 2W26B 3GCWE 1IQFL 1HT5A 1HZ8A 3S6XA 2BSFA 1HREA 2VH0B 2P94L 1DDXA 1C5MF 2W86A 4X8UL 1LMJA 2WG3C 5I46L 1CCVA 1K37A 1WHEA 2XC5L 2PR3B 5EGMB 5E8DA 3M36L 1XFEA 4ZH8B 3KRKA 4AQTA 1LPGA 1YUFA 2CJIB 1CVUA 4YT7L 2WG4B 5L30L 1HCGB 1L3YA 1JBUL 2VH6B 1DQBA 1ATDA 4ZHAB 3IJEB 1IP0A 2W2ME 1KSNB 3HS5A 2J94B 4G1MB 3U73A 3FFGL 1HX2A 1FFMA 1NPEB 1V3XB 3QH0A 3V64C 1HAFA 4Y6DB 1O5DL 5FDQA 3POYA 3NT1A 3BPSE 1ZAQA 5IKRA 1UZJA 2BQ7A 5K0HB 2I9BA 1EQHA 3CS7L 5KIRA 4YZUB 4Z0KB 1F7EA 3R05A 2OYEP 4C16A 1NT0A 1EBVA 3LIWB 3DEMA 4FM5A 3GISX 1X7AL 3HO3A 5CISA 3F1SB 2P3FN 3CFWA 2P93L 1YUKB 2BOUA 2H9EC 4D0FA 2UWPB 4XBMA 4NG9L 3TZIA 4Y71B 5JW1A 2K2TA 3NTBA 3LTFB 1IQHL 1IOEL 1I0UA 1NZIA 4CSYA 2VVVL 2KL7A 4BTIA 2H9EL 2OYUP 2Y5FL 1DVAL 2Y5GL 4BDWA 2KV4A 2WFTA 1G1TA 1EMOA 2RNLA 4O02B 1W7XL 1EPJA 2FD6A 1TLEA 2VWNL 1GK5A 1HAEA 1COUA 5JB9E 5JB8E 3HS7A 2XC0L 4CUDA 2WPME 1KIGL 4BTTA 1SZBA 3KQEL 3C9AC 3K9XA 5CKNA 1URKA 1ATEA 1IQJL 1V1HA 4ISHL 2VVUL 1CCFA 3N8VA 2Y38A 3F6UL 4RRYA 2J2UB 4MMZB 4LMFA 1XDTR 4ZAEB 2BOXA 2XC4L 3N8YA 4JZEL 2MGRA 1FAXL 4Z6AL 4YT6L 5IKTA 2P95L 4X8SL 4X8VL 1IQIL 1EZQB 2VJ3A 3KQDL 2BMGA 4OTJA 1PRHA 1L5GB 4O1ZA 3HPTA 1FF7A 2I9AA 5IKVA 3ASIA 1MQ6L 4Y7BB 3TGFA 3ZYGA 2UWOB 1EGFA 1IJQA 1FJSL 2P3FL 1QIUA 2BQ6A 1Z6EL 2EI6B 1WU1B 2DDUA 1APOA 4M10A 1IQKL 1IOXA 4OTYA 4D0EA 4BXSA 1YUGA 2GD4A 3RR3A 1CQEA 1QFKL 3EGFA 3ELAL 1LMMA 1G2MB 2W2OE 1PGEA 4RRZA 1ADXA 2Y5HL 4JYVL 1P9JA 3BT1A 5F1AA 1DX5I 3ZYJB 1FAKL 4MMYB 1UZQA 2FLRL 4Y79B 1TOZA 2KB9A 4JYUL 1IQNL 1IQGL 1HJ7A 1FSBA 4ZXXL 2VWLL 4GU4A 4BDXA 4D90A 2YGOA 1CX2A 1UZPA 3MDLA 2MHPA 3KQCL 1JV2B 2J38B 3N8ZA 1KKEA 2PUQL 4NGAL 3OLUA 4A94C 2WPHE 2MGPA 3FBYA 1UZKA 1IGZA 1KLOA 1NQLB 3MQEA 3SOBB 1EMNA 2VWOL 2B7DL 2J34B 2J95B
chains in the Genus database with same CATH topology
3TH3L 1M1XB 1WHFA 2W2PE 3Q7DA 1IQEL 2BZ6L 1EPHA 1BF9A 4ISIL 1NFXB 4RS0A 3HO4A 4Y7AB 2W2QE 1YO8A 2P26A 2WFXB 2WPIE 1IVOC 1Z6CA 1HT8A 1LPZA 2XBYL 1N7DA 3LTGD 3LAQA 4BXWA 3H5CB 4TGFA 5JBBE 1W8BL 4CUFA 3N8XA 1EPIA 3HS6A 4A7IA 1DIYA 3SOQA 1B9WA 2M74A 2VWMK 1XKBA 1LPKA 2BOKL 2J4IB 4CUEA 5F19A 5CKQA 1F7MA 1XKAL 2P3TA 3ENSA 1AUTL 1IGXA 3HO5A 2XBXL 5CKMA 3LC3B 1NFWB 2Y80B 1KLIL 6COXA 5L2ZL 2YGPA 3CENL 2VVCK 4X8TL 4Y76B 3QMOA 4ZXYL 2YGQA 1Q4GA 2W3KB 3QCWA 2EI8B 1TPGA 4RRXA 2WPLE 2KNIA 2Y7XB 5JBAE 4BTUA 3NJPC 3NTGA 1F0SB 1ATBA 2RA0L 3V65B 1EAIC 4NA9L 3LN1A 1HRFA 2G00L 1LQDA 2FLBL 3M37L 3N8YB 5KN5C 2XBWL 3TBDA 3LC5B 3GCXE 1J9CL 3SOVA 2AYLA 2WZPP 1OB1C 2F9BL 4RUTA 1NFUB 1RFNB 2EI7B 3KK6A 1EPGA 3IITB 5IKQA 3LN0A 4JZDL 2PHBB 5JVZA 1N1IA 1MQ5L 1PFXL 1P0SL 2K2SB 3BT2A 2P16L 3CA7A 1A3PA 2RHPA 2Q1JB 1IQLL 2NPRA 1U8CB 3FCSB 2D1JB 1K36A 2FZZL 1IQML 1U67A 2BO2A 1APQA 2FLGA 4E1GA 4XLWA 5JVYA 5COXA 2P3UA 2Y82B 4COXA 1YGCL 4XL1A 4MMXB 3U7UG 3PGHA 2BOHA 1G1SA 1G2LB 2Y7ZB 2WPKE 2W2NE 4PH9A 1EQGA 1JL9A 1G1RA 3Q3KB 2ADXA 2WYGB 1FE2A 3OLTA 2TGFA 4LORA 1F0RB 1ATAA 3TK6B 3TK5B 5JBCE 5L2YL 1PTHA 1G1QA 3P5BL 2BQWA 3KCGL 4M11A 2WYJB 1KLJL 3N8WB 4Z0LA 2P28B 1CEJA 2JKHL 4RRWA 1NFYB 2Y81B 3KQBL 2W3IB 1PXXA 2WPJE 3SW2A 1CVWL 2UWLB 3N8WA 4JZFL 1MOXC 3ZYIB 2XBVL 3KL6B 2W26B 3GCWE 1IQFL 1HT5A 1HZ8A 3S6XA 1HREA 2VH0B 2P94L 1DDXA 1C5MF 2W86A 4X8UL 1LMJA 2WG3C 5I46L 1CCVA 1K37A 1WHEA 2XC5L 2PR3B 5EGMB 5E8DA 3M36L 1XFEA 4ZH8B 3KRKA 4AQTA 1LPGA 1YUFA 2CJIB 1CVUA 4YT7L 2WG4B 5L30L 1HCGB 1L3YA 1JBUL 2VH6B 1DQBA 1ATDA 4ZHAB 3IJEB 1IP0A 2W2ME 1KSNB 3HS5A 2J94B 4G1MB 3U73A 3FFGL 1HX2A 1FFMA 1NPEB 1V3XB 3QH0A 3V64C 1HAFA 4Y6DB 1O5DL 5FDQA 3POYA 3NT1A 3BPSE 1ZAQA 5IKRA 1UZJA 2BQ7A 5K0HB 2I9BA 1EQHA 3CS7L 5KIRA 4YZUB 4Z0KB 1F7EA 3R05A 2OYEP 4C16A 1NT0A 1EBVA 3LIWB 3DEMA 4FM5A 3GISX 1X7AL 3HO3A 5CISA 3F1SB 2P3FN 3CFWA 2P93L 1YUKB 2BOUA 2H9EC 4D0FA 2UWPB 4XBMA 4NG9L 3TZIA 4Y71B 5JW1A 2K2TA 3NTBA 3LTFB 1IQHL 1IOEL 1I0UA 1NZIA 4CSYA 2VVVL 2KL7A 4BTIA 2H9EL 2OYUP 2Y5FL 1DVAL 2Y5GL 4BDWA 2KV4A 2WFTA 1G1TA 1EMOA 2RNLA 4O02B 1W7XL 1EPJA 2FD6A 1TLEA 2VWNL 1GK5A 1HAEA 1COUA 5JB9E 5JB8E 3HS7A 2XC0L 4CUDA 2WPME 1KIGL 4BTTA 1SZBA 3KQEL 3C9AC 3K9XA 5CKNA 1URKA 1ATEA 1IQJL 4ISHL 2VVUL 1CCFA 3N8VA 2Y38A 3F6UL 4RRYA 2J2UB 4MMZB 4LMFA 1XDTR 4ZAEB 2BOXA 2XC4L 3N8YA 4JZEL 2MGRA 1FAXL 4Z6AL 4YT6L 5IKTA 2P95L 4X8SL 4X8VL 1IQIL 1EZQB 2VJ3A 3KQDL 2BMGA 4OTJA 1PRHA 1L5GB 4O1ZA 3HPTA 1FF7A 2I9AA 5IKVA 3ASIA 1MQ6L 4Y7BB 3TGFA 3ZYGA 2UWOB 1EGFA 1IJQA 1FJSL 2P3FL 2BQ6A 1Z6EL 2EI6B 1WU1B 2DDUA 1APOA 4M10A 1IQKL 1IOXA 4OTYA 4D0EA 4BXSA 1YUGA 2GD4A 3RR3A 1CQEA 1QFKL 3EGFA 3ELAL 1LMMA 1G2MB 2W2OE 1PGEA 4RRZA 1ADXA 2Y5HL 4JYVL 1P9JA 3BT1A 5F1AA 1DX5I 3ZYJB 1FAKL 4MMYB 1UZQA 2FLRL 4Y79B 1TOZA 2KB9A 4JYUL 1IQNL 1IQGL 1HJ7A 1FSBA 4ZXXL 2VWLL 4BDXA 4D90A 2YGOA 1CX2A 1UZPA 3MDLA 2MHPA 3KQCL 1JV2B 2J38B 3N8ZA 2PUQL 4NGAL 3OLUA 4A94C 2WPHE 2MGPA 3FBYA 1UZKA 1IGZA 1NQLB 1KLOA 3MQEA 3SOBB 1EMNA 2VWOL 2B7DL 2J34B 2J95B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TH3 L;  1M1X B;  1WHF A;  2W2P E;  3Q7D A;  1IQE L;  2BZ6 L;  1EPH A;  1BF9 A;  4ISI L;  1NFX B;  4RS0 A;  3HO4 A;  4Y7A B;  2W2Q E;  1YO8 A;  2P26 A;  2WFX B;  2WPI E;  1IVO C;  1Z6C A;  1HT8 A;  1LPZ A;  2XBY L;  1N7D A;  3LTG D;  3LAQ A;  4BXW A;  3H5C B;  4TGF A;  5JBB E;  1W8B L;  4CUF A;  3N8X A;  1EPI A;  3HS6 A;  4A7I A;  1DIY A;  3SOQ A;  1B9W A;  2M74 A;  2VWM K;  1XKB A;  1LPK A;  2BOK L;  2J4I B;  4CUE A;  5F19 A;  5CKQ A;  1F7M A;  1XKA L;  2P3T A;  3ENS A;  1AUT L;  1IGX A;  3HO5 A;  2XBX L;  5CKM A;  3LC3 B;  1NFW B;  2Y80 B;  1KLI L;  6COX A;  5L2Z L;  2YGP A;  3CEN L;  2VVC K;  4X8T L;  4Y76 B;  3QMO A;  4ZXY L;  1Q4G A;  2W3K B;  3QCW A;  2EI8 B;  1TPG A;  4RRX A;  2WPL E;  2Y7X B;  5JBA E;  4BTU A;  3NJP C;  3NTG A;  1F0S B;  1ATB A;  2RA0 L;  3V65 B;  1EAI C;  4NA9 L;  3LN1 A;  1HRF A;  2G00 L;  1LQD A;  2FLB L;  3M37 L;  3N8Y B;  5KN5 C;  2XBW L;  3TBD A;  3LC5 B;  3GCX E;  1J9C L;  3SOV A;  2AYL A;  1OB1 C;  2F9B L;  4RUT A;  1NFU B;  1RFN B;  2EI7 B;  3KK6 A;  1EPG A;  3IIT B;  5IKQ A;  3LN0 A;  4JZD L;  2PHB B;  5JVZ A;  1N1I A;  1MQ5 L;  1PFX L;  1P0S L;  2K2S B;  3BT2 A;  2P16 L;  3CA7 A;  1A3P A;  2RHP A;  2Q1J B;  1IQL L;  2NPR A;  1U8C B;  3FCS B;  2D1J B;  1K36 A;  2FZZ L;  1IQM L;  1U67 A;  2BO2 A;  1APQ A;  2FLG A;  4E1G A;  4XLW A;  5JVY A;  5COX A;  2P3U A;  2Y82 B;  4COX A;  1YGC L;  4XL1 A;  4MMX B;  3U7U G;  3PGH A;  2BOH A;  1G1S A;  1G2L B;  2Y7Z B;  2WPK E;  2W2N E;  4PH9 A;  1EQG A;  1JL9 A;  1G1R A;  3Q3K B;  2ADX A;  2WYG B;  1FE2 A;  3OLT A;  2TGF A;  4LOR A;  1F0R B;  1ATA A;  3TK6 B;  3TK5 B;  5JBC E;  5L2Y L;  1PTH A;  1G1Q A;  3P5B L;  2BQW A;  3KCG L;  4M11 A;  2WYJ B;  1KLJ L;  3N8W B;  4Z0L A;  2P28 B;  1CEJ A;  2JKH L;  4RRW A;  1NFY B;  2Y81 B;  3KQB L;  2W3I B;  1PXX A;  2WPJ E;  3SW2 A;  1CVW L;  2UWL B;  3N8W A;  4JZF L;  1MOX C;  3ZYI B;  2XBV L;  3KL6 B;  2W26 B;  3GCW E;  1IQF L;  1HT5 A;  1HZ8 A;  1HRE A;  2VH0 B;  2P94 L;  1DDX A;  1C5M F;  2W86 A;  4X8U L;  1LMJ A;  2WG3 C;  5I46 L;  1CCV A;  1K37 A;  1WHE A;  2XC5 L;  2PR3 B;  5EGM B;  5E8D A;  3M36 L;  1XFE A;  4ZH8 B;  3KRK A;  4AQT A;  1LPG A;  1YUF A;  2CJI B;  1CVU A;  4YT7 L;  2WG4 B;  5L30 L;  1HCG B;  1L3Y A;  1JBU L;  2VH6 B;  1DQB A;  1ATD A;  4ZHA B;  3IJE B;  1IP0 A;  2W2M E;  1KSN B;  3HS5 A;  2J94 B;  4G1M B;  3U73 A;  3FFG L;  1HX2 A;  1FFM A;  1NPE B;  1V3X B;  3QH0 A;  3V64 C;  1HAF A;  4Y6D B;  1O5D L;  5FDQ A;  3POY A;  3NT1 A;  3BPS E;  1ZAQ A;  5IKR A;  1UZJ A;  2BQ7 A;  5K0H B;  2I9B A;  1EQH A;  3CS7 L;  5KIR A;  4YZU B;  4Z0K B;  1F7E A;  3R05 A;  2OYE P;  4C16 A;  1NT0 A;  1EBV A;  3LIW B;  3DEM A;  4FM5 A;  3GIS X;  1X7A L;  3HO3 A;  5CIS A;  3F1S B;  2P3F N;  3CFW A;  2P93 L;  1YUK B;  2BOU A;  4D0F A;  2UWP B;  4XBM A;  4NG9 L;  3TZI A;  4Y71 B;  5JW1 A;  2K2T A;  3NTB A;  3LTF B;  1IQH L;  1IOE L;  1I0U A;  1NZI A;  4CSY A;  2VVV L;  2KL7 A;  4BTI A;  2H9E L;  2OYU P;  2Y5F L;  1DVA L;  2Y5G L;  4BDW A;  2KV4 A;  2WFT A;  1G1T A;  1EMO A;  2RNL A;  4O02 B;  1W7X L;  1EPJ A;  2FD6 A;  1TLE A;  2VWN L;  1GK5 A;  1HAE A;  1COU A;  5JB9 E;  5JB8 E;  3HS7 A;  2XC0 L;  4CUD A;  2WPM E;  1KIG L;  4BTT A;  1SZB A;  3KQE L;  3C9A C;  3K9X A;  5CKN A;  1URK A;  1ATE A;  1IQJ L;  4ISH L;  2VVU L;  1CCF A;  3N8V A;  2Y38 A;  3F6U L;  4RRY A;  2J2U B;  4MMZ B;  4LMF A;  1XDT R;  4ZAE B;  2BOX A;  2XC4 L;  3N8Y A;  4JZE L;  2MGR A;  1FAX L;  4Z6A L;  4YT6 L;  5IKT A;  2P95 L;  4X8S L;  4X8V L;  1IQI L;  1EZQ B;  2VJ3 A;  3KQD L;  2BMG A;  4OTJ A;  1PRH A;  1L5G B;  4O1Z A;  3HPT A;  1FF7 A;  2I9A A;  5IKV A;  3ASI A;  1MQ6 L;  4Y7B B;  3TGF A;  3ZYG A;  2UWO B;  1EGF A;  1IJQ A;  1FJS L;  2P3F L;  2BQ6 A;  1Z6E L;  2EI6 B;  1WU1 B;  2DDU A;  1APO A;  4M10 A;  1IQK L;  1IOX A;  4OTY A;  4D0E A;  4BXS A;  1YUG A;  2GD4 A;  3RR3 A;  1CQE A;  1QFK L;  3EGF A;  3ELA L;  1G2M B;  2W2O E;  1PGE A;  4RRZ A;  1ADX A;  2Y5H L;  4JYV L;  1P9J A;  3BT1 A;  5F1A A;  1DX5 I;  3ZYJ B;  1FAK L;  4MMY B;  1UZQ A;  2FLR L;  4Y79 B;  1TOZ A;  2KB9 A;  4JYU L;  1IQN L;  1IQG L;  1HJ7 A;  1FSB A;  4ZXX L;  2VWL L;  4BDX A;  4D90 A;  2YGO A;  1CX2 A;  1UZP A;  3MDL A;  2MHP A;  3KQC L;  1JV2 B;  2J38 B;  3N8Z A;  2PUQ L;  4NGA L;  3OLU A;  2WPH E;  2MGP A;  3FBY A;  1UZK A;  1IGZ A;  1NQL B;  1KLO A;  3MQE A;  3SOB B;  1EMN A;  2VWO L;  2B7D L;  2J34 B;  2J95 B; 
#chains in the Genus database with same CATH topology
 3TH3 L;  1M1X B;  1WHF A;  2W2P E;  3Q7D A;  1IQE L;  2BZ6 L;  1EPH A;  1BF9 A;  4ISI L;  2HOR A;  1NFX B;  4RS0 A;  3HO4 A;  4Y7A B;  2W2Q E;  1YO8 A;  2JJL A;  2P26 A;  2WFX B;  2WPI E;  1IVO C;  1Z6C A;  1HT8 A;  1LPZ A;  2XBY L;  1N7D A;  3LTG D;  3LAQ A;  4BXW A;  3H5C B;  4TGF A;  5JBB E;  1W8B L;  4CUF A;  3N8X A;  1EPI A;  3HS6 A;  4A7I A;  1DIY A;  3SOQ A;  1B9W A;  2M74 A;  2VWM K;  1XKB A;  1LPK A;  2BOK L;  2J4I B;  4CUE A;  5F19 A;  5CKQ A;  1F7M A;  1XKA L;  2P3T A;  3ENS A;  1AUT L;  1IGX A;  3HO5 A;  2XBX L;  5CKM A;  3LC3 B;  1NFW B;  2VRS A;  2Y80 B;  1KLI L;  6COX A;  5L2Z L;  2YGP A;  3CEN L;  2VVC K;  4X8T L;  4Y76 B;  3QMO A;  4ZXY L;  1LK9 A;  4GU3 A;  2YGQ A;  1Q4G A;  2W3K B;  3QCW A;  2EI8 B;  1TPG A;  4RRX A;  2WPL E;  2KNI A;  2Y7X B;  5JBA E;  4BTU A;  3NJP C;  3NTG A;  1F0S B;  1ATB A;  2RA0 L;  3V65 B;  1EAI C;  4NA9 L;  1V1I A;  3LN1 A;  1HRF A;  2G00 L;  1LQD A;  2FLB L;  3M37 L;  3N8Y B;  5KN5 C;  2XBW L;  3TBD A;  3LC5 B;  3GCX E;  1J9C L;  3SOV A;  2AYL A;  2WZP P;  1OB1 C;  2F9B L;  4RUT A;  1NFU B;  1RFN B;  2EI7 B;  3KK6 A;  1EPG A;  3IIT B;  5IKQ A;  3LN0 A;  2BT7 A;  4JZD L;  2PHB B;  5JVZ A;  1N1I A;  1MQ5 L;  1PFX L;  1P0S L;  2K2S B;  3BT2 A;  2P16 L;  2HOX A;  3CA7 A;  1A3P A;  2RHP A;  2Q1J B;  1IQL L;  2NPR A;  1U8C B;  3FCS B;  2D1J B;  1K36 A;  2BT8 A;  2FZZ L;  1IQM L;  1U67 A;  2BO2 A;  1APQ A;  2FLG A;  4E1G A;  4XLW A;  5JVY A;  5COX A;  2P3U A;  2Y82 B;  4COX A;  1YGC L;  4XL1 A;  4MMX B;  3U7U G;  3PGH A;  2BOH A;  1G1S A;  1G2L B;  2Y7Z B;  2WPK E;  2W2N E;  4PH9 A;  1EQG A;  1JL9 A;  1G1R A;  3Q3K B;  2ADX A;  2WYG B;  1FE2 A;  3OLT A;  2TGF A;  4LOR A;  1F0R B;  1ATA A;  3TK6 B;  3TK5 B;  5JBC E;  5L2Y L;  1PTH A;  1G1Q A;  3P5B L;  2BQW A;  3KCG L;  4M11 A;  2WYJ B;  1KLJ L;  3N8W B;  4Z0L A;  2P28 B;  1CEJ A;  2JKH L;  4RRW A;  1NFY B;  2Y81 B;  3KQB L;  2W3I B;  1PXX A;  2WPJ E;  3SW2 A;  1CVW L;  2UWL B;  3N8W A;  4JZF L;  1MOX C;  3ZYI B;  2XBV L;  3KL6 B;  2W26 B;  3GCW E;  1IQF L;  1HT5 A;  1HZ8 A;  3S6X A;  2BSF A;  1HRE A;  2VH0 B;  2P94 L;  1DDX A;  1C5M F;  2W86 A;  4X8U L;  1LMJ A;  2WG3 C;  5I46 L;  1CCV A;  1K37 A;  1WHE A;  2XC5 L;  2PR3 B;  5EGM B;  5E8D A;  3M36 L;  1XFE A;  4ZH8 B;  3KRK A;  4AQT A;  1LPG A;  1YUF A;  2CJI B;  1CVU A;  4YT7 L;  2WG4 B;  5L30 L;  1HCG B;  1L3Y A;  1JBU L;  2VH6 B;  1DQB A;  1ATD A;  4ZHA B;  3IJE B;  1IP0 A;  2W2M E;  1KSN B;  3HS5 A;  2J94 B;  4G1M B;  3U73 A;  3FFG L;  1HX2 A;  1FFM A;  1NPE B;  1V3X B;  3QH0 A;  3V64 C;  1HAF A;  4Y6D B;  1O5D L;  5FDQ A;  3POY A;  3NT1 A;  3BPS E;  1ZAQ A;  5IKR A;  1UZJ A;  2BQ7 A;  5K0H B;  2I9B A;  1EQH A;  3CS7 L;  5KIR A;  4YZU B;  4Z0K B;  1F7E A;  3R05 A;  2OYE P;  4C16 A;  1NT0 A;  1EBV A;  3LIW B;  3DEM A;  4FM5 A;  3GIS X;  1X7A L;  3HO3 A;  5CIS A;  3F1S B;  2P3F N;  3CFW A;  2P93 L;  1YUK B;  2BOU A;  2H9E C;  4D0F A;  2UWP B;  4XBM A;  4NG9 L;  3TZI A;  4Y71 B;  5JW1 A;  2K2T A;  3NTB A;  3LTF B;  1IQH L;  1IOE L;  1I0U A;  1NZI A;  4CSY A;  2VVV L;  2KL7 A;  4BTI A;  2H9E L;  2OYU P;  2Y5F L;  1DVA L;  2Y5G L;  4BDW A;  2KV4 A;  2WFT A;  1G1T A;  1EMO A;  2RNL A;  4O02 B;  1W7X L;  1EPJ A;  2FD6 A;  1TLE A;  2VWN L;  1GK5 A;  1HAE A;  1COU A;  5JB9 E;  5JB8 E;  3HS7 A;  2XC0 L;  4CUD A;  2WPM E;  1KIG L;  4BTT A;  1SZB A;  3KQE L;  3C9A C;  3K9X A;  5CKN A;  1URK A;  1ATE A;  1IQJ L;  1V1H A;  4ISH L;  2VVU L;  1CCF A;  3N8V A;  2Y38 A;  3F6U L;  4RRY A;  2J2U B;  4MMZ B;  4LMF A;  1XDT R;  4ZAE B;  2BOX A;  2XC4 L;  3N8Y A;  4JZE L;  2MGR A;  1FAX L;  4Z6A L;  4YT6 L;  5IKT A;  2P95 L;  4X8S L;  4X8V L;  1IQI L;  1EZQ B;  2VJ3 A;  3KQD L;  2BMG A;  4OTJ A;  1PRH A;  1L5G B;  4O1Z A;  3HPT A;  1FF7 A;  2I9A A;  5IKV A;  3ASI A;  1MQ6 L;  4Y7B B;  3TGF A;  3ZYG A;  2UWO B;  1EGF A;  1IJQ A;  1FJS L;  2P3F L;  1QIU A;  2BQ6 A;  1Z6E L;  2EI6 B;  1WU1 B;  2DDU A;  1APO A;  4M10 A;  1IQK L;  1IOX A;  4OTY A;  4D0E A;  4BXS A;  1YUG A;  2GD4 A;  3RR3 A;  1CQE A;  1QFK L;  3EGF A;  3ELA L;  1LMM A;  1G2M B;  2W2O E;  1PGE A;  4RRZ A;  1ADX A;  2Y5H L;  4JYV L;  1P9J A;  3BT1 A;  5F1A A;  1DX5 I;  3ZYJ B;  1FAK L;  4MMY B;  1UZQ A;  2FLR L;  4Y79 B;  1TOZ A;  2KB9 A;  4JYU L;  1IQN L;  1IQG L;  1HJ7 A;  1FSB A;  4ZXX L;  2VWL L;  4GU4 A;  4BDX A;  4D90 A;  2YGO A;  1CX2 A;  1UZP A;  3MDL A;  2MHP A;  3KQC L;  1JV2 B;  2J38 B;  3N8Z A;  1KKE A;  2PUQ L;  4NGA L;  3OLU A;  4A94 C;  2WPH E;  2MGP A;  3FBY A;  1UZK A;  1IGZ A;  1KLO A;  1NQL B;  3MQE A;  3SOB B;  1EMN A;  2VWO L;  2B7D L;  2J34 B;  2J95 B; 
#chains in the Genus database with same CATH homology
 3TH3 L;  1M1X B;  1WHF A;  2W2P E;  3Q7D A;  1IQE L;  2BZ6 L;  1EPH A;  1BF9 A;  4ISI L;  1NFX B;  4RS0 A;  3HO4 A;  4Y7A B;  2W2Q E;  1YO8 A;  2P26 A;  2WFX B;  2WPI E;  1IVO C;  1Z6C A;  1HT8 A;  1LPZ A;  2XBY L;  1N7D A;  3LTG D;  3LAQ A;  4BXW A;  3H5C B;  4TGF A;  5JBB E;  1W8B L;  4CUF A;  3N8X A;  1EPI A;  3HS6 A;  4A7I A;  1DIY A;  3SOQ A;  1B9W A;  2M74 A;  2VWM K;  1XKB A;  1LPK A;  2BOK L;  2J4I B;  4CUE A;  5F19 A;  5CKQ A;  1F7M A;  1XKA L;  2P3T A;  3ENS A;  1AUT L;  1IGX A;  3HO5 A;  2XBX L;  5CKM A;  3LC3 B;  1NFW B;  2Y80 B;  1KLI L;  6COX A;  5L2Z L;  2YGP A;  3CEN L;  2VVC K;  4X8T L;  4Y76 B;  3QMO A;  4ZXY L;  2YGQ A;  1Q4G A;  2W3K B;  3QCW A;  2EI8 B;  1TPG A;  4RRX A;  2WPL E;  2KNI A;  2Y7X B;  5JBA E;  4BTU A;  3NJP C;  3NTG A;  1F0S B;  1ATB A;  2RA0 L;  3V65 B;  1EAI C;  4NA9 L;  3LN1 A;  1HRF A;  2G00 L;  1LQD A;  2FLB L;  3M37 L;  3N8Y B;  5KN5 C;  2XBW L;  3TBD A;  3LC5 B;  3GCX E;  1J9C L;  3SOV A;  2AYL A;  2WZP P;  1OB1 C;  2F9B L;  4RUT A;  1NFU B;  1RFN B;  2EI7 B;  3KK6 A;  1EPG A;  3IIT B;  5IKQ A;  3LN0 A;  4JZD L;  2PHB B;  5JVZ A;  1N1I A;  1MQ5 L;  1PFX L;  1P0S L;  2K2S B;  3BT2 A;  2P16 L;  3CA7 A;  1A3P A;  2RHP A;  2Q1J B;  1IQL L;  2NPR A;  1U8C B;  3FCS B;  2D1J B;  1K36 A;  2FZZ L;  1IQM L;  1U67 A;  2BO2 A;  1APQ A;  2FLG A;  4E1G A;  4XLW A;  5JVY A;  5COX A;  2P3U A;  2Y82 B;  4COX A;  1YGC L;  4XL1 A;  4MMX B;  3U7U G;  3PGH A;  2BOH A;  1G1S A;  1G2L B;  2Y7Z B;  2WPK E;  2W2N E;  4PH9 A;  1EQG A;  1JL9 A;  1G1R A;  3Q3K B;  2ADX A;  2WYG B;  1FE2 A;  3OLT A;  2TGF A;  4LOR A;  1F0R B;  1ATA A;  3TK6 B;  3TK5 B;  5JBC E;  5L2Y L;  1PTH A;  1G1Q A;  3P5B L;  2BQW A;  3KCG L;  4M11 A;  2WYJ B;  1KLJ L;  3N8W B;  4Z0L A;  2P28 B;  1CEJ A;  2JKH L;  4RRW A;  1NFY B;  2Y81 B;  3KQB L;  2W3I B;  1PXX A;  2WPJ E;  3SW2 A;  1CVW L;  2UWL B;  3N8W A;  4JZF L;  1MOX C;  3ZYI B;  2XBV L;  3KL6 B;  2W26 B;  3GCW E;  1IQF L;  1HT5 A;  1HZ8 A;  3S6X A;  1HRE A;  2VH0 B;  2P94 L;  1DDX A;  1C5M F;  2W86 A;  4X8U L;  1LMJ A;  2WG3 C;  5I46 L;  1CCV A;  1K37 A;  1WHE A;  2XC5 L;  2PR3 B;  5EGM B;  5E8D A;  3M36 L;  1XFE A;  4ZH8 B;  3KRK A;  4AQT A;  1LPG A;  1YUF A;  2CJI B;  1CVU A;  4YT7 L;  2WG4 B;  5L30 L;  1HCG B;  1L3Y A;  1JBU L;  2VH6 B;  1DQB A;  1ATD A;  4ZHA B;  3IJE B;  1IP0 A;  2W2M E;  1KSN B;  3HS5 A;  2J94 B;  4G1M B;  3U73 A;  3FFG L;  1HX2 A;  1FFM A;  1NPE B;  1V3X B;  3QH0 A;  3V64 C;  1HAF A;  4Y6D B;  1O5D L;  5FDQ A;  3POY A;  3NT1 A;  3BPS E;  1ZAQ A;  5IKR A;  1UZJ A;  2BQ7 A;  5K0H B;  2I9B A;  1EQH A;  3CS7 L;  5KIR A;  4YZU B;  4Z0K B;  1F7E A;  3R05 A;  2OYE P;  4C16 A;  1NT0 A;  1EBV A;  3LIW B;  3DEM A;  4FM5 A;  3GIS X;  1X7A L;  3HO3 A;  5CIS A;  3F1S B;  2P3F N;  3CFW A;  2P93 L;  1YUK B;  2BOU A;  2H9E C;  4D0F A;  2UWP B;  4XBM A;  4NG9 L;  3TZI A;  4Y71 B;  5JW1 A;  2K2T A;  3NTB A;  3LTF B;  1IQH L;  1IOE L;  1I0U A;  1NZI A;  4CSY A;  2VVV L;  2KL7 A;  4BTI A;  2H9E L;  2OYU P;  2Y5F L;  1DVA L;  2Y5G L;  4BDW A;  2KV4 A;  2WFT A;  1G1T A;  1EMO A;  2RNL A;  4O02 B;  1W7X L;  1EPJ A;  2FD6 A;  1TLE A;  2VWN L;  1GK5 A;  1HAE A;  1COU A;  5JB9 E;  5JB8 E;  3HS7 A;  2XC0 L;  4CUD A;  2WPM E;  1KIG L;  4BTT A;  1SZB A;  3KQE L;  3C9A C;  3K9X A;  5CKN A;  1URK A;  1ATE A;  1IQJ L;  4ISH L;  2VVU L;  1CCF A;  3N8V A;  2Y38 A;  3F6U L;  4RRY A;  2J2U B;  4MMZ B;  4LMF A;  1XDT R;  4ZAE B;  2BOX A;  2XC4 L;  3N8Y A;  4JZE L;  2MGR A;  1FAX L;  4Z6A L;  4YT6 L;  5IKT A;  2P95 L;  4X8S L;  4X8V L;  1IQI L;  1EZQ B;  2VJ3 A;  3KQD L;  2BMG A;  4OTJ A;  1PRH A;  1L5G B;  4O1Z A;  3HPT A;  1FF7 A;  2I9A A;  5IKV A;  3ASI A;  1MQ6 L;  4Y7B B;  3TGF A;  3ZYG A;  2UWO B;  1EGF A;  1IJQ A;  1FJS L;  2P3F L;  2BQ6 A;  1Z6E L;  2EI6 B;  1WU1 B;  2DDU A;  1APO A;  4M10 A;  1IQK L;  1IOX A;  4OTY A;  4D0E A;  4BXS A;  1YUG A;  2GD4 A;  3RR3 A;  1CQE A;  1QFK L;  3EGF A;  3ELA L;  1LMM A;  1G2M B;  2W2O E;  1PGE A;  4RRZ A;  1ADX A;  2Y5H L;  4JYV L;  1P9J A;  3BT1 A;  5F1A A;  1DX5 I;  3ZYJ B;  1FAK L;  4MMY B;  1UZQ A;  2FLR L;  4Y79 B;  1TOZ A;  2KB9 A;  4JYU L;  1IQN L;  1IQG L;  1HJ7 A;  1FSB A;  4ZXX L;  2VWL L;  4BDX A;  4D90 A;  2YGO A;  1CX2 A;  1UZP A;  3MDL A;  2MHP A;  3KQC L;  1JV2 B;  2J38 B;  3N8Z A;  2PUQ L;  4NGA L;  3OLU A;  4A94 C;  2WPH E;  2MGP A;  3FBY A;  1UZK A;  1IGZ A;  1NQL B;  1KLO A;  3MQE A;  3SOB B;  1EMN A;  2VWO L;  2B7D L;  2J34 B;  2J95 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...