1HAWA

X-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9 a resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure of a Blue Copper Nitrite Reductase at High Ph and in Copper-Free Form at 1.9 A Resolution
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 90
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hawA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hawA02
4YSDA 1B3IA 3NJNA 2CJ3A 1GY1A 4HALA 3S8FB 4HAKA 2I7SA 3FSWA 4NAJA 2N0MA 2EIKB 2TSBA 5TK4A 1ASOA 1PCSA 1PMYA 1GW0A 3AY2A 1E30A 4GP5B 1TKWA 2OV0A 4UF7C 1NTDA 3BVDB 1AZUA 4YSUA 2A3TA 2LLNA 4GYBA 2J55A 3IN0A 2FT8A 2XX1A 3H4FA 1J5CA 2AANA 3UAEA 1AANA 3WI9A 7PAZA 2Y1AA 3NSCA 2HX7A 3FQ2A 3OMAB 4AKPA 2IWEA 3UAAA 2PPFA 3QPKA 2HXAA 2FNWA 2YAEA 4YVUA 1QLEB 3CVCA 2QPEB 4AZUA 1PY0A 4W1TA 1IBYA 1J9QA 1XB6A 1AAJA 2WO2B 3TU6A 1JXFA 5TK2A 2ZOOA 2OCCB 3WG7B 4A67A 1L9TA 3X2QB 2YAOA 2MTAA 4Q89A 1WAEA 1AG6A 1E5YA 3BQVA 1J9SA 1L9RA 5AZUA 4QKTA 4KO6A 4DP8X 2QT6A 1R1CA 2BZCA 3FSZA 2UX7A 3WNJA 4P5RA 5B1KA 1NDTA 1PLAA 1JZIA 4E9RA 1AS6A 1HAUA 3S3DB 1QHQA 3T6WA 1JZHA 2Q5BA 3ASNB 2ZXWB 4BWTA 4DP4X 3TASA 4A2DA 1RZPA 2AFNA 3FT0A 3IEAA 2PP8A 2E86A 5LDUA 4WTQA 2BP0B 1DZ0A 3GXUB 1SNRA 4A66A 2XX0A 1ET8A 3GDCA 4JHUA 5D4HA 1RCYA 3PCYA 2BZ7A 2VW6A 1TU2A 2GHZA 2HLEB 3ABLB 3JT2A 3EH3B 1PAZA 1PLBA 3FU8A 1YLBB 2OJ1A 1RZQA 1KGYE 5B1JA 1NZRA 4ENZA 2IAAC 3PAVA 3QJQB 1OF0A 3WKPA 4KNTA 1F56A 4BXVA 3EF4A 4DP6X 2JKWA 2IDFA 4BDVB 1CUOA 2NRDA 1GS7A 4KO5A 2MRYA 4G7SB 3WNIA 3SBRA 3PLYA 5B1JC 1ID2A 1AS8A 2PPDA 3EH5B 2UX6A 4Q8BA 2X87A 2XWZA 4UANA 3ABMB 2DY2A 2DV6A 1UATA 4MFHA 2XUWA 1OCCB 2R7EA 9PCYA 2YAQA 3X1GA 4A68A 3NJFA 3AG4B 5A7EA 2FQGA 4TXVB 1EZLA 3FPXA 1V55B 3NJIA 4DP5X 4YSSA 1DYZA 2EINB 1BAWA 3C75A 3MX0B 2W88A 3TA4D 3FSVA 2YAPA 2XYBA 1AS7A 5F7BA 3KW8A 2UXFA 2RACA 3NT0A 2FQFA 4DP0X 4N8UA 1KYAA 1KDJA 3H4HA 5B7MA 2Q9OA 3OMIB 1ZIAA 2IH8A 4BXSV 3OD3A 1I53A 1NICA 1A8ZA 3CVDA 1J9RA 3IN2A 4HHWA 5I5MA 8PAZA 1WA2X 4UAHA 1N68A 1NIEA 3AG2B 1ET5A 1GYCA 1GS6X 2BW5A 3FPYA 4M4RB 2ZONA 1W6WA 2BP8B 1SF5A 2QPDB 2IDSA 5PAZA 1JVLA 1AACA 4RH4A 4GP8B 3MBWB 3ZIYA 2YARA 2BWDA 1MG3C 2EILB 1GR7A 2H5UA 3DTUB 4KOBA 4E9SA 3CDZB 2BO0A 1JXDA 3T6VA 1SDDB 4GY4A 2R7EB 3X1EA 4AI7A 1AR1B 2J56A 1BYOA 2CBPA 3PAUA 3QJVB 4G7QB 3OQRA 2WO3B 1V54B 3QJSB 2BWIA 1NIDA 2BHFA 1NIFA 1CURA 4E9QA 2FQDA 2UXGA 2VMJA 1NWPA 4P5SA 3UGEA 4G70B 1ILUA 5FC9A 2HX9A 3ABGA 3DKHA 3IBOA 1EHKB 2GIMA 1CYWA 4KO7A 5AFAA 1IBZA 3OM3B 2CUAA 3AZUA 1J9TA 1JERA 4KNUA 2BP0A 4A2EA 1ET7A 4BK5C 7PCYA 3FU7B 4HHGA 2QDWA 1XMEB 1FFTB 2EIMB 3EH4B 1ADWA 2YAFA 2AVFA 4YVNA 2H3XC 1AZRA 2J5WA 1IKOP 1QNIA 3L45A 2I85A 2PP9A 3N2JA 3CDZA 4KOCA 1BXAA 1BXUA 2GB2A 3JTBA 3GYRA 4DP9X 3X1BA 2XU9A 3ZBMA 4NB7A 1ZV2A 4EF3A 3UACA 2YQBA 4WKXA 1WA1X 1MZYA 4YSCA 1JXGA 4BDVA 4N4YB 3NP3A 1L9QA 3WIAA 2VM4A 2PPCA 1CYXA 2YAHA 1A3ZA 2QDVA 2YXVA 2GI0A 1ZPUA 1BXVA 1NPJA 3DIVA 1NIBA 4PCYA 1OCOB 5F7AA 3EHBB 1OOWA 1CC3A 4DP1X 3H56A 4HCGA 1W6LA 1NWOA 2FWLB 3FQYA 4A2FA 4AKQA 1PZCA 4HZ1A 2W8CA 2VW7A 1FWXA 1GY2A 1RKRA 3QJUB 3NJHA 4G71B 1AZNA 3CZUB 2AZUA 1JVOA 3WKQA 3V9CA 4AKOA 1J5DA 1L9OA 1MG2C 2VM3A 3TBCA 2XXGA 4YSRA 3V9EA 2P80A 3IE9A 3PXLA 3T71A 2IWKA 2TSAA 2XV0A 1WS8A 1GS8A 4L0PB 4G72B 4BWWA 4GXFA 1AIZA 1V10A 3QQXA 2XXFA 4W9ZA 4YSOA 1E5ZA 1M56B 3NSFA 3CG8A 4A2HA 2BW4A 3ASOB 3NJMA 1JZGA 3U25A 2HX8A 2PPEA 1M9WA 5I26A 3SBPA 4YSTA 4BWUA 1FA4A 3AW5A 2CALA 3T6ZA 1SJMA 3ZX1A 1MDAA 1TEFA 3NYKA 3FQ1A 1SHXA 4YSEA 2EIJB 3PPSA 3FU9A 4E9WA 4HCFA 4E9VA 1BQKA 4NERA 3AG1B 3T6XA 1GSKA 1BEXA 1NINA 3NSDA 3NJKA 1URIA 5B1BB 3FU7A 4A2GA 3ABKB 3AG3B 1A4BA 3UADA 1KCWA 2I7OA 5I28A 3KW7A 2HZHA 3FS9A 4YL4A 1JZJA 2PCYA 1BQRA 4JHVA 3ZDWA 2UXVA 3UABA 2IDTA 3FYEB 5AKRA 4K9JA 5B1AB 2XLLA 1SF3A 1A4CA 4GP4B 2J57A 5I6MA 2DYSB 1WS7A 1E65A 1KDIA 4E9TA 1BYPA 1E67A 1KBWA 2PLTA 1KCBA 2VSMB 2IWFA 3RYMA 5I6NA 3HEIB 2DWSA 1SHWA 3ERXA 1ILSA 4DP7X 3G5WA 1L9SA 2X88A 4JKNA 1W8EA 4DPBX 3FYIB 4DP2X 2IDQA 3NSYA 4E9YA 3PAZA 4X4KA 1PF3A 3OMNB 1PNDA 2FT7A 3QJRB 1VLXA 3S3CB 2IDUA 2VW4A 3FSAA 3NP4A 4E9XA 1HAWA 5I6OA 2FT6A 2YAMA 3SQRA 2HRHA 1NPNA 2FJSA 5PCYA 3SBQA 1A65A 2CCWA 4HCIA 1XB8A 2GSMB 2UXTA 3NJLA 1ASPA 2GBAA 4CSZA 1KV7A 2CAKA 2HRGA 3NJGA 1N70A 1AZBA 4YSQA 3X1NA 1ZIBA 4FAAB 1IC0A 1SDDA 2XVBA 2PCFA 4KO9A 4M3HA 1IUZA 2VN3A 3QJTB 4FA7B 1OE2A 1PZBA 2BP8A 5I5IA 2B08A 3NJJA 1SFDA 1WA0X 2P80D 4YSPA 3HB3B 2Y69B 1ETJA 3CVBA 1XB3A 1PNCA 2FTAA 1OCRB 4AX3A 4CSPA 1JZEA 2DWTA 5EHFA 4YSAA 2PPAA 4DPAX 1OE3A 4F2EA 5IY5B 4F2FA 2GC7C 4QLWA 1ASQA 1AZCA 1M57B 4KNSA 3S3BB 3S8GB 1OCZB 2WSDA 5I6KA 1JOIA 1ZDSA 1X9RA 5I6PA 5B3SB 1X9UA 6PAZA 2YXWA 1A4AA 3T9WA 2B3IA 1NIAA 5B7FA 1PLCA 1AOZA 2DYRB 1PZAA 5B7EA 2AZAA 1AG0A 3TBBA 2JFCA 2GC4C 2PP7A 1HFUA 2XV2A 3N55A 1L9PA 5D4IA 1KBVA 4DPCX 2ZWNA 1AQ8A 1JZFA 4G7RB 1TEGA 6PCYA 1MZZA 5I5JA 4HIPA 3D12B 5ANHA 2FQEA 1ZDQA 1T5KA 5D4JA 4PAZA 1OE1A 1BQ5A 5I6LA 4ZK8A 2VSKB 2JXMA 2IH9A 5E9NA 1OV8A 2XV3A 1SFHA 4F7KA 3X1FA 2H47C
chains in the Genus database with same CATH superfamily
1VADA 2P7TA 4H5SA 1YNLL 5DK0B 2WQRA 3D05A 4KKCC 1Q72L 1RFDH 3N41F 5BRQA 2VDLL 5HY9B 4OCYL 4M4PA 4FF9A 4JFQB 2IC2A 1QMUA 4PJEE 3PU7A 4J3XA 1CL7L 3ARDD 4TUOB 5LVEA 2YHGA 4UF7C 1G1YA 2WKOF 1H3TA 5A6LA 2O6PA 3U6XS 4WFHE 3NPSC 4FXKC 4ZSOB 3ME0A 3N5AA 4WU5A 3WIFA 5BS0D 1T3FB 4PJBE 3RX8A 2YEZA 2ZUVA 4BKSC 3TT1L 2VC2H 3LQZA 1XV8A 3SY0A 3EXLA 3DOIA 5HVHB 5CEZH 4E5XA 4YFEA 2VDLB 2X7LB 1OXYA 2A7BA 3JV6B 3NRFA 2ZSVA 3KPNB 3LEXB 3HC0B 3QORC 2HMID 1GXEA 3CFCL 1FG2B 4IBUA 3EDEA 1T0MA 5EU5B 4ODSH 1V3JA 2QVTA 1A9BB 1FNEA 2E56A 1NFDE 3HRZC 1NLDL 1WAAE 3SE3C 3O0RH 3IU3A 1UM4H 2F54D 4M61B 3P4NB 3V4VA 5HD8C 3FRUA 1LO3H 4GW4B 1E27B 2VDQL 4KRPC 2YR3A 3GGWA 2F6AA 4IRSA 1KIPA 3WS6C 1FFPB 1A9VA 5MP6L 2N59A 1T7XA 3P4LA 4DO6A 3QARA 3ZZSA 2DDQH 1KB9J 2NZ9D 5KSVB 3RGBA 3DIFA 2Q6WB 5DK0A 5JORA 2EO9A 1DQLL 5CFHA 3PNWB 5DZOA 4MDJA 2BINA 4FG6D 5IJKA 1J1XL 4MXVF 5AOIA 4GBXD 3GXUB 3D2UB 5C08A 4DK3A 5JXAL 1SJXA 4OZFA 1JVKA 5ECJE 1ET8A 1RLBA 2BERA 3FONB 4JCWA 5DJYA 2HJLB 2R29H 3Q8FA 5JUEL 1EH9A 1HILA 3KLQA 2MPAH 4IOFD 4Z7WA 4KK9C 3TBVA 5KVFH 2G60L 3ZRFC 5I0VA 4YMPA 3AY4A 3OAYK 1TVBB 3P4MB 2WC7A 3LN5A 3ZQ9A 1PKQE 3FH8A 1ACCA 2X09A 5SWZB 4HS3B 2IPUG 3MCYA 1NZRA 1FORH 3IXAA 4K3GA 4TUKL 4ZO7A 2R2BA 5TTRA 1HHKB 1D5ZA 3RBSA 1OAQL 5AVQB 1UHVA 2QPFA 3IRZA 4JFDA 4WI4A 3ECWA 2ZWKA 3FT9A 1X5LA 4L37A 2WIIB 3KXFD 1F4XL 4JG0H 2X42A 4U3HA 3S8WA 4JRXD 1HC1A 2EH7L 1DVFA 1T1YB 5IJBC 4G7YH 2CRMA 3OJDA 1DQQB 2HRLA 3AACA 3P4NA 4N0UA 1PIGA 3V4VB 5EDSA 4HJGA 9PCYA 2CDEA 4HJ1A 4LLDA 4QF1A 4UV4L 4IRSB 1NBQA 4IOIA 5IB3A 1ZY9A 3BLBA 2GK0A 4OUOA 4X6DB 2FJFA 1FYTA 3O6KH 1FE8H 1NDMA 1DQJA 3IFOB 5DSCB 2ICEA 1VJSA 2CHXA 2W92A 1RJLA 2BOCB 5E08L 1YPZA 4QPEA 3T8VA 2QGEA 2C7UB 1XL4A 2XSKA 4FQJL 3WTXA 2B5IC 5IHWA 2AXFA 5HHXH 1I1CA 1MHEA 3JSSA 3I6SA 1PJ9A 1KB5H 4H8QA 3DMMB 4LSQL 1ZVSA 4HH8A 1A66A 1OAUH 2UY7B 4DP0X 3RGVB 5AVXB 3D69B 3SKNA 3DUSB 5B7MA 3RRQA 5T5NG 5D5ME 2ZX6A 5E6SB 1Y18B 4NHUA 5F9WB 3LN5B 1CLCA 3O3DA 4K2UH 2ZCKH 3RUGA 4HS3A 2Z31B 5LQBL 4ZMTA 1NICA 3D85B 1M6OB 1A8ZA 3OR7B 2A6DA 3OPZH 3WL9B 3IS0X 4PY8J 3RWFA 5LGJB 2ARJB 3S97C 1E6JH 5C0RL 1HKLL 3BFQG 1OAJA 3PGDB 3TXAA 3WEAA 1K8IA 1ZJBA 4K7FB 3I9IA 1TSHA 2NNCA 5EBMB 3MV8E 1S7QA 2BS8A 1THCA 2J8HA 1CBVL 3ARZA 1W91A 2YARA 2CLVA 3BGAA 4O4YH 2ID5A 1FL6A 3K4DA 4OCWL 2V3EA 4R5TA 5DGQA 2XJLA 5IHZB 3IE4A 4XOCA 3DO7A 3QXUA 4MAYC 4XC3L 4HJGB 1ZHKA 2CMRL 1KN2H 1KTRL 5JA8B 1BYOA 5FFGA 2Y07H 4N8VB 2R69L 3R06A 3L7FB 1TMCB 4XP9L 1D5MB 5I30L 5FGBA 3MRRA 2HJFB 2FNBA 2GY5A 4E9QA 4U3CA 5FW8A 1G4RA 4QHMA 1BM7A 3AROA 3TBTA 2CXGA 1Q0XH 4G70B 4LQFL 15C8L 1L0YA 4XP4L 1YEEL 4UOW1 4UM8B 3HB3C 4RGNE 4OFYA 1MVUB 4XVJL 2WTPA 3NA9L 2P8LA 3IWUA 4YHZH 4ZJ9A 5CEYA 1MPAH 1B90A 3BUQA 3RKDC 5HHQA 3QORA 1Q9KB 3QNXA 2WAHA 3LKOB 4NS0A 1JV2B 3RWHB 1S9YA 4IRZH 4JRLA 1XMEB 1BVLA 4P2RB 5I9QB 1FFTB 3SDDD 3CZFA 3H53A 1MFEL 5FK9B 2VXUH 4UMSA 3AGVA 4JK0D 1IKOP 3W9EB 3TESA 2IPKB 4NOBA 1FZKA 1DQIA 1XT5A 5B1CA 3X3FL 4AH2B 4IDLA 2O93L 4S1DD 3ZMEA 4XPGH 4HC1L 5GPRA 1MCFA 5TE4H 4XOBA 4YLQT 5FUZH 3RTLA 3M86A 5BZDA 3LZOA 3P2TA 5J3HC 3LRSB 1PG7X 1S7TA 3QRGH 4U6TA 1U41A 4X50A 1SPDA 4NO3A 1Z0MA 3V6ZB 1D3CA 2NTSP 4K15A 3PWLB 3QDAA 2NPLX 5GS2H 2HTLC 1OTSD 3CVHB 1BQLL 3INOA 1ZK5A 1X4XA 3S37X 1D2PA 1CYXA 4OCRH 4BHUI 1A3ZA 32C2B 3L5XH 3EFFB 1I85A 4QRTB 1OCOB 4HU8A 1G6RA 1L7IL 1P6WA 3KPPA 3ECBA 5FPIA 3KPOA 3P4OB 3QO1B 4JQVA 5EIIB 2NY1B 3SDXF 1BP3B 2AZUA 2HFFA 4HJTA 4Q97A 1YJDH 2D03L 3FC8A 1VKXB 5J6GA 1MXGA 5HGBB 4N25A 3CPLA 4BSWA 4HF5L 2WPGA 3O41B 5FLUA 3HR5B 3IE9A 4WU7A 1S7SB 4NPYA 4P9HC 1WS8A 3I02A 4P23B 5K9OB 4BWWA 1X7QA 2V5YA 5HYJD 1YNTA 1W72B 3H3BC 3QUKB 5JW5B 1J8HD 4PRIA 1IAMA 1CXFA 3Q13A 5DD3H 4GG6E 3QUML 1I9IL 1FVEA 3QUYA 2AXHA 5E1AB 1JGEB 3D4CA 1KPUA 3BISA 4QNPF 3MREA 2RQ8A 1F4WL 4NKMB 1ECZA 4BZ2L 3BX7C 3JV4B 4JM4L 5I73C 4MA1B 2WXRA 5C07E 4Z76B 1LO5A 2CRZA 2X44D 4UTCA 4PHXA 5HDOA 4Z3IA 3TP4A 5E1QA 1LO0L 1P7QB 2FGZA 3NSDA 1NINA 5KOVC 3L9RB 2O5XL 1AD0B 2F9BT 3UADA 4XE0A 4XVUC 1IGYB 4EIGB 1ACXA 4LCIL 5EEVA 5J12C 3ALPA 4YL4A 3WIIH 1KTDB 1ZTXE 3WS3B 4XOEA 3D39A 5L6YL 2EIZA 2E27L 4NPKA 5EC1B 4R2GC 2MCG1 2IQAA 5AL0A 4W4OA 3KLDA 4DKFH 1EEZB 3SYAA 5BV7H 1ZSDB 5E56A 2YMOA 5FYJE 3MYJB 3V7MA 4FQ1H 3B34A 4ANXA 2E7CA 2VQUA 4H1LA 1AXIB 1S7SA 3QNYA 1R3LA 1QSFA 3KYOA 4X7FC 3VH8G 4DP2X 4ONFH 4HKJA 1C08A 3OXSA 1PAMA 4PN6A 3S3CB 2AJ3B 3QUYD 4QY8A 4N2IA 4PRIB 4QWWC 2ZX8A 3Q2CA 5GIRA 1FVDA 5L7XL 1IQWH 3H9SB 1VZIA 5TDOA 5I1LB 1T6VN 2G3NA 1IMHC 3H42L 3PHOA 2YPKB 4F9LA 4HUCA 3SE8H 4XCFL 1TCRB 1V8HA 3VRLE 5BZZA 3VQ1C 4Z76A 2DYPA 1FIGH 4I48A 4MJIE 4WHYG 4Q6YA 4I0KA 3SOBL 3QDGD 4FAAB 5J8OA 4XPFH 1UWGL 5JOPE 3BP6A 3UZEA 4OZGA 2VN3A 1JF5A 2GEEA 4WI8A 1NCGA 4HXBH 1OE2A 4MXQD 4QRFA 4WNJA 4JQXA 2OMXA 1U93A 4WI3A 1E2WA 3NJJA 1OTUD 4ELMF 4CGUB 1W0VB 5GISL 5IIEB 1ETJA 1JE6A 3FN0H 3RL2A 4TTDD 1MCDA 5D1ZA 1RPQA 4H25B 5CR1A 4U1NB 2CUHA 3F58L 1IL1A 4L05A 4MA3A 1NBYA 4IIQB 5CEZE 1PDKB 2Z4QA 2HFEA 5E2JA 3LS5H 2H32A 3PWVB 4H1LB 4WFED 2VDOL 2IG2L 2VXVL 5B21A 4K3EL 4JE0A 2V7HA 3MBXL 2V9TA 4OZGF 1ZLWK 3NIDB 2FHCA 3WJLA 1Y07A 3FBQA 5GGSY 5D71H 4JB9L 1NMCB 1UA6H 1HHGB 3BPOC 3PG2A 1JOIA 1YC7A 3IU4H 3L5WB 1FHGA 5I6PA 2H2PC 3IETB 5IM7B 1Z9PA 5D7IE 1I3GH 1SXAA 3DECA 2NY3D 1SQMA 1OPGH 4LPVA 1NIAA 4C4KT 4MJ5A 5KG9A 2UYLB 1J0JA 5E51A 4FFVD 2YPKA 4OIAA 4PRNA 2NT1A 4MLSA 2AZAA 4I4WA 5FWQA 3DTXB 4MKMA 4XXWA 1FPTH 1I85C 5TDNB 2G2PA 5CEZD 1TMQA 4GW1A 3EYQC 4YAQA 5GRVL 3P69A 4PRPA 1VGKB 3GNML 4W70A 2QVIA 3THML 4BHUA 4LL4A 3EJRA 3TPUB 4P2QB 1IKFH 4TNEA 5ANHA 5I1IL 2NY4B 4X6CB 1B4JH 1YEFL 4G1EA 5D4JA 4HD5A 2AV7B 1R5WB 2J8UA 1BZ7A 2HVKB 3IDYC 3LOWA 3NH7H 2AJSH 2DWEB 3EO0A 1SFHA 3MLUH 3MXWH 4M4RA 4HXAH 4P5TB 4WJ5B 1ZE3H 5C3TA 4GG8B 1W0VA 4BFEA 1AIFA 3OR6B 4PTTB 4M1DL 5EBLA 1MKFA 1TQBB 3U83A 3SDXA 4CAGA 1IGFL 4ZO8A 2EICA 3FQUB 4WDIA 2CJ3A 1QLFB 5F9JB 4GSDL 5SX5K 3NFPB 4TNGA 3TNNB 4FLHA 5HYIA 2NXYC 4XXDA 2FUTA 4M3JA 2N0MA 5EOQH 1D5BA 1MCCA 4EI5A 3VFSA 4R5VA 3V9FA 2ZWSA 2QGCA 1XGUA 3MRCB 3Q8EA 4XH2B 3L1GA 3U36B 5EO0B 4K3HA 3UZVA 1NTDA 4UT7H 4AM0Q 1OF2A 2H9GA 2JB5H 2Q76A 4TNFA 3GSVA 3QYCA 4G9FE 5ESQA 1IAKB 4MNQB 4X6FA 2BVOA 5CCKH 3MO1B 5KJRH 3LXCA 2I60L 3VXRD 2ESVD 5JW4N 2F61A 1OVZA 1U30A 3BT2H 3CZLA 1TZGL 3BZ4A 3OF6A 2LGNA 2VDNB 3OMAB 4JZJC 4KQ4L 3DTDA 3T4YB 2XC8A 3NIGF 3MLYH 1D6EB 1T2XA 3FO2A 5J13C 1TTGA 3GBNL 4FQIL 3T6QC 3BVNA 1QA9B 3HZKA 4YUEL 4EEEA 3MA7B 4H5SB 3I6LD 2BPBA 3POCA 3FN0L 4AYSA 1UASA 5AZUA 4DOHB 5IT2L 1QSVA 4P2AA 1FBIH 2FIRT 3FSZA 3OAUH 1KXTB 1R5WA 3KBEA 1PQZA 2ZCKL 3S5YA 1KLUB 3VXRE 1GOGA 2WNKA 3GEFA 3GSWB 3QHFH 5K39A 3L1FA 1RVFH 4PMFA 2PETA 5GGQL 3ZE0E 1NBVH 1TJIL 1G0XA 4I1NB 4YLBA 4YC2C 2EVGA 4KTEH 3WDHA 1MIEL 2ZXWB 2BIOA 3OAZK 5DFWH 5KSBB 1LVEA 2YEZB 4MJ2A 1XWVA 4XXDB 3Q6FB 5E8PB 1B2YA 1USZA 3KPMA 5IJDC 1I82A 3SHSA 4PJGB 5EEUA 1NGQH 3GTTA 3GMRA 1SUHA 2ZSVB 3KPNA 1A6AB 3DX9B 3ES6B 3AWGA 3F7QA 3MRHA 5EOTA 4WEBH 3ABLB 3P3RA 3ZO0A 43CAB 4YEFA 1O6TA 4KKAC 3II3A 1PG7L 5GS0L 3PWPD 3RP1A 4Y4KC 3MDJA 3BAEH 1IAKA 4MNQA 3ULUH 5EO9B 1TTRA 1YLBB 4K94H 4BYHA 3HG1D 5DA0B 4KUCF 1G7PB 1NCAL 4PW4A 5AZ2H 4F7PB 3MACL 4KNTA 4QKXB 2WLNA 3GJFH 2I9TA 1XH2A 1HDMB 3KGSA 5F8QC 3VGAC 1NGPL 1SYSA 3FO2B 4L4JA 5E4OA 4FD0A 3NCMA 3WNIA 3IJEA 1AS8A 5CILH 3LD8B 3HLKA 1UCTA 1U4EA 1BQUA 1T1XA 3ZKXB 5LAPA 3FT2B 1B0GA 4BKLA 1H6TA 1KY7A 3SSGA 5CGMA 2DQEL 3BWSA 2PWEA 1X5ZA 2WANA 5CO1A 3ELQA 1QNZL 3LB6D 2WOBA 3QZLA 1ITBB 2YAQA 4GBXB 3IFLH 4Y4FB 4NUGH 5AUMA 1G1CA 4QRRD 2G75A 4YPJA 2J6EL 3EFDL 2FQGA 1RL1A 2GIYA 2WGXA 1LGVA 1IM3D 2BSTB 2CH8A 4WFGD 3A4FA 4PJFF 5I1DA 1WG3A 2GTZB 3DV4B 1CFNB 3BD5A 1LXMA 4PCSA 5IMMB 2PKDA 3GO1L 2Z8RA 5HD8D 4OJEH 4AC4A 1KCUH 4N90E 4BD4A 1KJ2A 4LP8A 4LSSL 3KYMA 2PYEA 1REIA 2ZUTA 5MHSD 4Z7VE 3FOMB 4L9LC 1QPPA 2X4UB 4AVJA 2E0PA 1D7FA 4PB9H 1FNGB 4X6EA 5ICXB 5J4MA 5DR5L 1T0NB 1S9VA 5GRYA 2GI7A 43C9B 3GXMA 5CBAB 3QC5X 3FCBA 3L9BA 1A47A 3WY4A 2ZOLB 4EDWH 1KNOB 3I6GA 3QJHA 1UOVA 5I82A 3DI2B 4HC1A 2CGYA 1KGIA 4HLZG 1XTLA 4QRRB 5LNDA 1KLGB 3KBHE 3FAWA 2ENQA 3W11C 2B39A 5DJDB 2IV8A 5E8EB 4NQDD 4OU3A 2QPDB 4R7NB 3NCCB 2VRAA 1K8DB 3L4WA 3A22A 2VXQL 3B2DC 5IBUB 2FEJA 3P9LA 4DVRL 2DI9A 2R8SL 1NKRA 1YPZB 2YRLA 3I9PA 3V4LA 3L5XL 1SEQL 1NAMA 2D7OA 4QO1B 1JL8A 2CBPA 3IGAA 2ZPKH 3E3QC 4WWID 3CK0H 5AQ0A 4GAJH 1JPTH 1Z3GL 1ZVSB 1OALA 4I1PA 2KZ1B 1FH5L 4AYMC 2IBBA 3GFUA 2PR9A 1P6AB 2VMJA 3DGGA 5F71A 2Y0SA 1BZ8A 3ABGA 2AKRB 4MNGB 2EXTA 3BRFA 2YA1A 3BPNC 4KI5F 4I3RL 4EUPG 4QJ5B 1JTPA 2XY1A 2M1KA 4BH8B 2ARWA 3C60B 2NNXA 3IF1B 4HUNB 4M7LL 2BHZA 4TQEH 3RWFB 4RCAA 4BK5C 7PCYA 1JHLH 4LXFA 1BF8A 2PXYD 1OGAD 2FEDC 1DCEA 4G8GD 3O3AB 1KSRA 1C1EL 4ZOEA 3HAEH 3NCYS 4AYFB 1DJZA 2A4EA 5IEHB 3HN8A 43C9A 5IHZA 5DHYB 3MGTA 1NUGA 3JWDC 5KBKA 2GB2A 4LK4A 4PJBF 1DBJL 4N0YL 1PX4A 4KKQA 5E5LA 4N24A 2NR6C 4DN3L 1FN4B 2EH8H 2ATPA 2QTVA 3TNMA 4FI7A 3CK0L 4U1IA 4RGNC 4XP5L 1QI4A 2WGNB 3RIAK 4Y1TA 1UXSA 1T22A 2VM4A 4OTXL 1QBLH 4MHHI 2WUBL 2IANE 1P4UA 3P9LB 3R7RA 2GI0A 2QQKL 4WGKA 5T3ZE 3PJSB 1WWWX 4M48L 3O2VH 1A0QL 3QO0A 1AKPA 4AKQA 3L17A 4OCNC 1GY2A 5FDWA 3GSRB 4PLKC 3SDAD 3V4UL 4NQED 1AGCB 2J12B 4FJYA 3CVIH 4HKZB 4UINL 2FIKB 4WV1C 1L9OA 1EXHA 4OF7A 2A74B 4YHIA 3TBCA 4WF7A 4UQIM 5LBSL 4DGYL 1HIML 1IC1A 5T1LB 5HDBE 1T04A 3RTQD 3VACA 1X5MA 1ZT1B 3HW7A 3VGGA 4QHPA 3O45B 1MN4A 1YCSA 3FZUC 1BEYL 1IZKA 3NQIA 5F21B 3ZDXE 3MBEC 4N0UB 3VYPA 1M56B 3BSHA 4HWUA 5AVRB 5BOJA 1I3RB 3D0VB 4NJAL 1L0XA 1KELL 3OJMB 5BZXA 3ZYIA 3ARUA 4CNIB 2HX8A 1J5HA 2F53D 3GXIA 4OF0A 1OAKL 4L4TD 2W65A 1SMOA 4MYWB 2EDFA 4ZO6A 3RQ3A 4AYFA 4JKWA 4LQ1A 4ZXBB 1PY9A 2LT9A 4AUYA 4PJ6A 4B9FA 3QUXB 1HSBB 5DC9B 3WFEH 3FSOA 1BEXA 3T0XA 4LRNH 1N4XL 2LVEA 2PCPA 2CR0A 4G9DA 4P5TD 4PRHA 2YD7A 5ID0A 1WFMA 4KTDL 3UTZB 2BZDA 4NPYB 2XTJD 5I75B 2UZYA 5AKRA 2X2JA 4P4RB 5EG6C 5TD4A 3VXUA 1SF3A 4ZW8A 1TCMA 1II4E 3RUGB 1HJCA 2CKNA 4LCCC 1X6LA 5I6MA 5GRUH 3L16A 5JHLL 1E65A 2CK0L 4TOYH 1JI1A 2BM3A 3QORD 2JK5B 1QX1A 1UM5H 3H9SE 4PG2C 3OKLA 3IMWA 3HEIB 4OLXH 4Z3JA 5C6WH 4FLRA 2NX5D 1L9SA 2EDEA 4DPBX 4HOMA 2AGJL 4PRDA 1DN0A 4B41A 4W6YB 1QFUH 3MRBB 1FQ9C 4FQHB 2LR4A 1ZK9A 2YC1B 5F7EL 3HAEA 3QDJE 2QQNL 3GI9L 1BVNP 1T2QL 3HZMA 4IKLA 5HVFB 4P57A 3O3UN 3UYRH 1LO2H 4ONGH 3CGTA 5JUEH 1R17A 2WQUA 2J1KA 3MRRB 5ABZA 1YHPA 2WY3B 1MRFL 2NZIA 2UXTA 1CXKA 4HKXB 1BA9A 4AYBA 1KBBA 4ZMZA 3FT3A 1DLFL 1WEJH 2DQCL 1TZIB 4IBVA 1MELA 4UM8A 2JSFA 4JM2B 3HRPA 5BPPA 4FNLH 1AQDB 3VWJB 1LEKB 3AJ7A 3MJ8B 2OYMA 4HLEA 1P2CB 2P46B 1DLHA 5B3JE 5J9PB 1CGSH 1OKEA 1JD7A 1ZHLA 2ZKMX 5FW7A 5D9SA 5KSUB 1DDHB 2YXFA 4J6IA 3ILDA 4N2HA 4LP4A 3P0YH 4EVNA 2GUOB 2P4AB 3CVBA 2AK4A 1A7PL 3KYNA 4YDLC 1WP6A 5EWIL 4PV8B 4CGTA 4LEBA 2YOCA 1K5NB 4DWHA 5A2BA 1OCRB 3MOAL 2X2UA 3G6DH 1L4IA 1FL3B 1NMAH 3V0EA 4GMTH 3RE0A 5BJTB 1HCYA 3O6LH 4Y5VA 1GMEA 2JIXA 2LE9A 4IIZA 5C7XH 4OZIA 3CH1B 3AGWA 1BLNB 4XN9A 1M57B 1W9XA 4N8VG 4JJHA 5DJAB 5E4EC 5F9OH 1SN0A 5IK3B 2XZCH 4LHJB 4HJ0C 4Z7OB 3KZ8A 3FTZA 2R2EA 2V2XB 3E3QE 4EBQH 4XO4A 4D94A 3A23A 4N68A 3VJ6A 1KIRA 1PZDA 1CFSA 2C1PA 3CFBA 5FUCE 1UJTA 1KYOK 1AHWA 3BJ91 3JZYA 4OR1A 4YE0A 4X0NA 5F9AC 3ZJAA 1AO7D 5FOBB 4X98B 4Q9QH 3HR5A 4WI2A 2CKBL 2VZ1A 2YZ1A 5JIIA 1E4KA 2RB8A 5D4IA 1R3KA 4ZPVB 3DC0A 1AQ8A 1EEUA 2A9BA 2ATAA 1TEGA 2H6OA 1A6WH 4HLZH 2CM5A 1BM3L 3T77A 1K6QL 5J9PA 4UB0H 5BO1L 1BQ5A 1EGJH 3K6NA 3S34H 1X5GA 2XWBA 3SEPA 1HQ4B 5E24E 5IQMA 2Z65C 4YDKL 4APXA 5E9NA 3MA9L 4GMTL 1M3JA 1CF8H 3GSOB 1OSZB 4JRYA 4GXUN 3T0AA 1F6LL 4K71B 4LSRH 3GT6A 3H54A 3CFUA 5GRVK 2ZJSL 5EU3B 4AV5A 3K81A 4H2AA 4N0RA 1OHZA 5HGHB 4FRWA 1B4JL 1ZMYA 4NAJA 3WNPA 4O51A 3G08A 1ZAGA 2EAEA 5C0IA 2B77A 1A7NL 2B1HL 4MXQC 4AL8L 4QNPE 2ADIB 4RAVA 1E50A 1BD2A 1H9DA 2VDML 5BUPA 3TWYA 4GXUM 2Q10A 3EBGA 2DYPD 2NQDA 2OJZL 3EOAB 5DZAA 1PGRB 4DAGH 4PY7B 2V7NA 3QG6B 4L3EA 4ZOBA 1K4CA 2HX7A 1NGQL 2W9EL 3IDNA 1EBPA 4J23A 2GEQA 3N9GL 4CW1B 3QIBD 4AZUA 4UTBA 2DWEA 3EO0B 3OBAA 3OG6B 1RZ8A 1YC8A 1NMAL 3CPUA 5DJZB 4JFXA 1E0OB 2XN9A 1XQ4A 1GGCL 3CZGA 4B0MB 3AAZA 2E9IA 3QUYC 5KBLA 3QYNA 2OZ4H 3MZTA 3PHQA 4AQAA 3QSKB 5E94A 2P5WB 5C8JA 1S7UB 4XCNA 1JGLH 1EJFA 2JF1A 2J2ZA 3FUMA 1MNNA 4FGMA 5GZOD 1MAKA 2BIIA 4PCKA 3PP3K 2BSED 1HAUA 1XCTA 2IH1B 1S9KC 4QOKB 5CD3B 2B3RA 3SOBH 1OTTD 1P9MC 4QJ3B 2X4SB 2H1PH 3NESA 5C7ZA 2EUXA 2EABA 2RR3A 2VITA 1M2VA 1YYMH 3ILQC 4DKFL 3ARQA 1FL5B 3CIAA 3BFOA 3GKWH 3FT4B 3HRZA 4X9YA 3QA3A 2DQFB 1O7DE 3K3QA 3RWJA 2XX0A 5HVHC 4J7RA 3BJLA 5E6YA 1P7KB 1RCYA 3PCYA 4POZC 1JPSL 1C5BH 3GXDA 1MUJA 2ADIA 3JT2A 4R0LB 4RAVB 1KJ2L 5D7LD 5IROC 3IFLL 3T04D 5C7XL 3EKCA 1PAZA 3SD2A 3SE8L 1VAHA 2JE8A 1XDTT 2FEEI 3EYQD 3MLWH 4IHOB 4ORZC 4DZBA 1RD6A 3C6LC 1P1ZA 4FADA 4PG9A 4ODTH 2VB5A 5D7SH 2KDGA 3RWGB 1CIDA 2OJ1A 2VMEA 3AXLB 1J8SA 1U8IA 5DJ8B 5FCSH 2XFXA 1YYLH 3WFBL 2AQPA 2IDFA 5TFSH 2C26A 4ODXA 3QDGB 5JPMB 1LNUA 5CP7A 3S9DB 1IGTA 3ROOB 4AIOA 5B1JC 3KXFE 5EIIG 4LHUG 3PQYA 2O61B 4DKEL 2Y06L 4MB5A 3CXHJ 1DJSA 1L0QA 1MI5A 3RVXD 3TIEA 3VFRA 5KSBA 3T1FA 1VFBA 3EGSA 4UI2A 1INDH 2P5WA 4LCWE 4AV0A 2YK1H 5C8JB 1OCCB 3R1GH 2EC9U 2WQ8A 3H9HB 2X70B 5EUOF 4BGLA 1I8KB 1AH1A 2AJXL 4M6NL 3ZE2B 5JIPA 1B6UA 3LKQB 1CCZA 3OKKB 3MFFB 4HFWA 3R0MA 4WFGE 1CD1A 4XC1H 4KKAD 4S2SB 1E4JA 2VDKL 1ZS2A 2EINB 5KBMA 1KMGA 2PTVA 2VJ8A 5DEZA 2OJZH 1QBLL 4DAGL 4E68A 3UZQB 3VFTA 3U9PH 1JPFA 2J73A 3OMZA 1AS7A 1H3GA 5HY9A 3GSNB 2FVNA 2OTUA 1HH9A 1ED3A 2FQFA 3B2XA 3DMMD 4JFPA 4OLWH 3FN9A 1YQVH 3BUDA 4I7ZC 1A6UH 2WNGA 4JFEB 1R33A 2N7AA 2G3MA 3U82B 4LLAA 1KBGL 3FT2A 4WU5B 2KT6A 3D3VE 5EZOH 2V17H 4ZTOL 3MRNA 3KPSA 2GSIB 3TTSA 4HHAA 1E8YA 4RWHA 4YBLC 3JV6A 1ET5A 3SDDC 1KULA 2BP8B 3I74A 2YRZA 1MNUL 2VE6B 2VN4A 2NY0B 1JK8B 3UPCA 1BM3H 3GZPA 3ZKMD 1TZHB 2Q7AA 3IMRA 4PJIB 2FATH 4PREB 4I18C 1GCFA 4M61A 3BIAX 3DUHA 2H3NB 4NQDB 3WNOA 3NZSA 3F5WA 1NIDA 1JPTL 1Z3GH 3LKQA 1CDGA 2JLPA 3ZTNH 2WP3T 3OKKA 1J0HA 1QWNA 1WTLA 4J27A 1UKQA 5FYKD 2WXJA 3GRWL 1YMHA 4ABUA 3TEZA 4XCFH 4XCEA 4HUWB 2VAJA 1KEML 5IMKB 4L1HA 2V37A 3OZ9L 2GTQA 4PJ8D 1T5WA 3ATBA 1N19A 1C1EH 1M4KA 4A2EA 4MMYB 1QRNB 4RDQF 4IRZL 2FK9A 3OKOA 2WQVA 4JO1H 3RI5K 1FAKT 3B7UX 5ADOH 2VTFA 3X12B 1RUKL 1AKJD 1INDL 4FDWA 2VLJB 4G8GE 1TSRA 2ICEB 4K8RC 2DBJA 1CK0H 2M2DA 1FYHB 4L3CA 4GG6A 3FAXA 4KC3B 3EOTH 1DVTA 2NTFB 5CMAB 4K23H 4PGEB 4S1QH 3WTVA 1EVUA 2PWGA 3LDBB 1P5UB 3MRFB 3ZZLA 3VDBA 4V2BA 3IGAB 2GJPA 2LLLA 2LOEA 2QQKH 2OL3A 1F6FB 4DGIL 4TM9A 5AVTB 1D6VH 3QE5A 4L8BA 5F7DB 4ODTL 2CMRH 4Q0XL 4KX7A 4XP5H 5DJ0B 5K9KA 3F85A 2PPCA 4Z3FA 2WP3O 3F7VB 3K8MA 4PCYA 5I30H 3FUJA 5C0BB 1UA6L 2XWRA 3UMTA 2NX5E 4DP1X 1A14L 3GHBH 1RULH 1W6LA 5ERWA 2X4QA 3UYRL 1C5DB 2FRGP 3NJHA 3PE9A 4Z78B 4NKIH 4NGHH 4I5BB 3AT0A 5B22A 5DZPA 2KS0A 2IBGA 4KKCD 3SQOH 1BJ8A 3V9CA 1NAKH 2NXZD 2GKIA 4UTAH 2VO8A 4OIIL 2XXGA 4KZCA 3WKNA 2ZSWB 5JXED 2PXYC 1GGIH 2XV0A 4FHBD 1UVQA 4OSUL 4FYTA 2ILLA 4MASA 5TGBB 4G6FB 3TN0A 4L3AA 3QIWD 1HINL 3BP5B 4M8QB 4YHKL 5ETUB 1F97A 4UT6A 3VWKA 1WBXB 5CILL 3CG8A 1NOFA 3OKOB 4U2YA 3ML9A 4AC2A 5DU7A 4L5FH 1A25A 4XN4A 4NBXB 4ZX3A 2PPEA 1U3YA 5I8EA 1AI1L 2H1LM 1VPOH 2IAMC 1SJMA 3ZX1A 3D39D 2BSTA 4NWTH 2C7FA 1TEFA 8FABB 1CI5A 1I3VA 3L48A 3QR1A 1HOEA 5MEOA 3KHOA 4HF5H 4R83A 3AWEA 4D9QE 1BQKA 3MODL 1R34A 3EFOB 2ADJA 4ZMLA 4WTWA 4R7LA 1K4DB 4ONGL 4UV4H 3ARFC 3LHAA 4NYLA 5C0GB 4CL7A 5I2IA 1VRSA 2NY1C 3NQKA 4N2DA 5D6DA 4YOKA 1WO2A 1KJ3L 1LILA 4AK2A 1YMME 2X4UA 4M1CC 3ZE1F 1T0MB 3PABA 4NBYB 5EU5A 1T03H 1KC5L 2GT9B 2VERN 3FF7A 1ZLVH 5HJ3B 5GXBB 3ZYZA 5T1LA 4CBZA 4OQ1A 4Z3HA 1OLLA 3C9NB 3JVGC 4FFTA 5K59E 4XNUH 5FUCC 3UGUA 3VXPA 4O00A 2J1WA 1EK3A 1VSCA 3TWCH 1KCBA 5GRJL 4Q52A 2AK4E 4V2CB 1JMZA 2QVMA 1CMOA 4N2AA 3QZWG 5T3XE 4XPBL 4OJCA 4QXWA 1AQHA 2FWUA 4YDZA 5CM1A 4PRID 5T1KA 1TJXA 3M8OL 1U42A 3MLTA 4UT6L 3L3OC 1LO3L 3PAZA 3P30H 3OMNB 5ICYA 4MDJB 1IEBA 2XOTA 2MNUA 3TM6A 3VXUD 3BKJH 5ETUA 3GBML 2ATKA 1HAWA 1CFVL 4JO1L 5IQOA 1NPNA 2WIMA 1JV2A 1S5HA 2CCWA 3WIHL 5D7IA 1PZ5B 2CHWA 5GZNA 2R23A 2IAND 3NJGA 4Q9QL 3BZDA 4MBRA 1AZBA 1PD0A 5LDSA 1W72A 1ZIBA 2VC2L 1NKOA 5T3ZD 1N8ZA 2PCXA 1T6WA 2GTWA 4KO9A 4FQXB 2BS71 4WNSA 1NEPA 4PRPE 2LHAA 2R1WB 4EBQL 2ZOUA 4LKXA 4G6JL 1FRGL 1KTJA 3HZYB 2AK1H 1NFDA 4JFFE 3CFQA 3BESR 2J8UE 1N59A 3BPCB 2X4NB 1DVFB 1RUPL 4JRYD 3I9GL 1WPCA 4JFHE 1G0YR 1GIGL 1S9XA 1N3NA 4B5EA 2EEBA 3D2UD 3BAIA 3L6FB 2QVKA 2ATPB 1IGYA 3CU1A 3S36X 3FNKA 1FCCA 1L3NA 3MJWA 1CLOH 2JKNA 4L4TA 1A7PH 1BW8A 5CINH 4PI0A 4WU7B 3BUPA 2J8UF 5A2FA 3FHEA 3S3BB 5DK3A 1HE8A 2N7BA 2PR4H 4PHZA 1ZDSA 3FK3A 3TCTA 3VWJA 3BRDA 1FZMB 2XA3A 1QR4A 4Y5YB 2G5BB 4Q0XH 4XXCA 2DYRB 4S11A 2RGSA 1WFUA 5CR8A 2F08A 1PZAA 4N2GA 1A9EA 3RNKB 1AZVA 5I15L 3QDMD 5DYOA 3E2HB 3TBBA 1T89C 3FTGA 5JHDE 4EXPX 2C5DC 5HI4D 4K4KA 4PJHB 2GUOA 4W6WB 2ZWNA 4ALAL 4CBPA 4JDZA 3O6KL 3WLWD 1KWGA 2BLFA 1IKNA 3GXTA 2BC4B 3D12B 4FQXA 5T8IA 3AADB 4Y2DD 4CMHB 2NUPB 1FL3A 2MWCA 3LS5L 2XQYK 1S7VB 3TX4A 3Q0HA 3MXWL 5FM5O 1OV8A 3W57A 2DQUL 3L95A 1XF3A 1N6QH 1Y0LB 1H0DB 3QZNA 3HZYA 3TJEL 2EH7H 3AM8A 5JLZB 5CCGE 1LTXA 2FZ3A 5I66B 1ZANL 1MFBH 2VR8A 4K3JH 1CE1L 5FYKE 4JZNA 4NN5C 1BOYA 2K9UA 3NG5A 5J56B 1E90A 2NW2A 4G80B 1KBPA 4NUQA 4BUGA 5DS8A 5CAYB 4TSCL 5KW9H 1K85A 1UZ6E 1OAQH 1JV5A 3RDTB 1WITA 3AY2A 3LS4H 1Y1UA 2BOBA 3CBKB 5TDPA 4O2CA 3UTSA 5K59F 3SCMB 5EUOA 3CHSA 1CQYA 5HDRA 3IDIB 4NQQA 5AKTA 5FO8B 2QPUA 4GEIA 5LXGL 3TBTB 4DVRH 1ZHBA 3IU4L 3VFUA 1JYNA 5C09A 1J5CA 3SYOA 1WFNA 5CEYB 1HQRA 3GTVA 1V3MA 1T7WA 2ZOKA 4NLHA 4OLVH 4C4UA 5TH2B 1UZ8B 4LRNL 3LNIA 1UD5A 3M17A 5J1AA 1H3XA 4YXLL 1DUYA 4BE6A 2UVEA 4DZ8B 1R6VA 1NAMH 4HBCH 4XBEL 3TCLA 1KXVA 2Z8WC 3QFJD 5HHOD 3S7GA 3HHRB 5IM7A 1HE7A 1Z9SB 5DUBA 4LSPL 3T0EB 1N0XH 1L9RA 4LIQE 1A6UL 5FO2A 2FHFA 2KHAA 2UX7A 4XXCC 2DH2A 3L3KB 3IJYB 5L2KA 2Q8AH 3HUJF 4I4WB 2O5YL 3NAAH 5EZLB 4E9RA 1FPTL 3F7PC 1XHHA 3QWQB 1L9NA 4FNLL 2X4RB 4ERSH 2E6PA 4JNXA 4AEHH 4HH9A 1J0YA 3AS1A 5E5MB 1RZPA 3FT0A 3TVMD 1EWHA 4UAOB 2GITA 1MRFH 2B4CC 4UINH 4MD0A 2BHYA 1SNRA 4O02B 3UTQA 1ORSA 2V3DA 4NEHB 3LHPH 1CLZL 4PP2A 2EZ0C 3CDFA 4P23C 2C9PA 4O2CB 3STBA 5GZOA 5DZVA 2GHZA 5EBLB 1IT9L 2RQEA 3BAYA 2BSSA 5F1SA 4NKOA 5BVJA 1PLBA 3FUNA 2OMBA 3IRPX 4NCDA 2XN9B 3UGXA 4DFHA 4ZO9A 4WWKC 3CFMA 1KGYE 5AB0A 5GS0C 2WLIB 5C92A 5EF2A 3WKPA 1F56A 2CK2A 3QQ3B 4X0KB 4P5KB 3QNZA 4JFSA 1QLRB 1H6EA 3RWCB 1GS7A 4O02L 3W56A 1RFDL 5GRUL 4G7SB 5IQNA 5JHLH 4N28A 1RPKA 4ISVA 4C83A 5KS9B 2K70A 4QOKA 3TCLB 1O9WA 2VDQB 2Y23A 3T65B 2NY3C 4E42B 5CJQL 4LLVA 4Y1SA 3U9WA 1JZ5A 4WI0A 3NCJL 2R7EA 1KCSH 1YECL 3TPUA 5C2BL 4JVWA 1KGWA 1W0WA 2J44A 2L0DA 1HKFA 1BLIA 5FB8A 3FU5A 2DMHA 3CUPA 3VFPA 3N42F 2A9ML 1TZGH 2QMKA 1R3KB 4ZPVA 4PV9A 4XNYL 5EFIA 3FCTB 3GMNB 5CP3H 3MX0B 3B3BA 4FI6A 3BO8A 5F1IB 4YR6B 4Q6KA 3C5ZC 1WT5A 1G6RH 1QI3A 3V4VL 3EYFA 4JZJA 4P2RD 4UQBA 3LNGA 4PLJC 4WZ9A 1FH2A 3BKCH 5GJTL 1SEQH 2X6VA 2I07B 3SDCC 4ZW5A 3HOGA 4H7VA 3WE6A 4MCYA 1K3IA 2FSEB 4OZFG 3E6HA 3ET9F 3MCKA 5D2LF 5IW1B 1IJNA 3N85L 3SDDA 1ROCA 4HKJB 2EC9T 3O2WH 4OT1L 3ZKXC 4HHWA 4HK0A 1YEFH 1A5FL 2IWGA 3PIQB 3CQFA 2C1OB 4QTHB 3WNLA 1WA2X 3RIAF 1XIWC 1E8WA 3C09C 1N68A 1YNTF 3DX9A 3MNVB 3QFGA 4ZUTA 5I18H 1GYCA 2NY6B 2P26A 2VR7A 4ZS6D 1W6WA 5DFVD 4Y4FD 3MFFA 4LGSB 1MJ8H 5I8OH 4XVUD 1U92A 4B53A 1T1ZA 4BQ6A 1P4LB 4BIKA 5KBPA 3GS7A 1QRND 1AR1B 3B9DA 1CGSL 2VDMH 3U7AA 4L9DA 2WO3B 3SE9H 4XN1A 3TBSA 3W0WE 1V54B 2QADB 1HH9B 2DQJH 3KS0H 1P6FA 2P44B 4POZD 4OI8A 4OQTA 3CBJB 3OXRA 5DZ9A 2BDNH 4UT9H 3L2LA 1CE1H 3PP4L 4Z7WE 2ZAHA 1OAXL 1FO0A 5E99H 3AAZB 3S0PA 2CZNA 2L3BA 3H2WA 4UQCA 5ACZB 2DM7A 2WZ5A 5DHVA 4EN2A 4KNUA 2Q7YA 3IDXL 3L08A 4UBDD 4Y16A 3HG3A 2B1AH 3FRPG 4LPWA 3WLBA 3BN9D 3D7PA 4LARL 2YLKA 5AZEH 1FZJB 4U49A 1JF1A 3CDYA 3FL7A 3BPOB 1EGJL 4W9JC 1UT1A 5ALBL 3S34L 3K6DA 3V0IA 4E9LA 3DSFL 2KDYA 3VW3H 3TVMB 3FFCE 2BCMA 1R75A 3IJHB 2CJUL 2ZF9A 4A63A 5IOKA 3UCRA 1D5IL 5D7JD 3QEHB 1F3DH 3B2VL 5TE6L 2LU4A 5KWYC 3T2OA 5CGTA 3TA3D 2WN2A 1PZUB 2YQBA 1QSED 2Y5TA 4YSCA 1MWAL 1P7KA 2D2CC 4R0LA 1C7SA 2AXWA 2DQDL 2LU5A 3DRTA 1FYTE 4O5LH 5DRNA 5TDNA 2R8SH 1HH6A 1U92B 4W4OC 1TTUA 4IHOA 4F9PC 2UZXB 4LVEA 1MCNA 3K71B 4XPFL 3T3MF 4HZ1A 5HHOB 4P5TC 4PJFA 3EJYD 1AZNA 5DUPH 2NCMA 1Z9OA 5I0ZA 3DBXA 4JPIB 1OARL 2GSGB 3HI5H 1JVOA 2HFTA 2ZT9C 1E9QB 4IMKC 2PWHA 3WGUB 4WJ5A 4LEOB 1A3QA 2DQHH 4DN4L 2O61A 3H0TA 5C2BH 1J8RA 4L0PB 5D5MA 4P4KA 5B4MD 5SWZD 1TQVA 5E1HB 4AIZA 4QO1A 4ZFGH 1G1OA 1NBZA 5F0PB 1MPAL 1FO0H 3GPSA 4YNYB 3RUGE 4JDEB 1FFOB 2BW4A 3AT8A 4QXTA 1SXZA 4ONFL 4ANVA 3NABH 2CBQA 3U25A 3BD4A 4NQSB 4OF5A 1CDIA 3PGCA 5ITBL 4L8BB 1KB5L 2APSA 3HKZA 2FJGA 4LSQH 1U8PB 5E2UH 2AKRA 4MNGA 4QCIA 4AQ8A 5FUOH 4O9HL 3FQ1A 3F12B 4YSEA 3GIZL 3VRJB 2G0LA 4E9WA 1YY9C 3EYSH 3DROA 3C60A 2JWYA 3IF1A 5TF1L 3QRLA 5DDHA 3NJKA 1E27A 3AG3B 1A4BA 5FECA 3QYMA 1BIIA 3TV3L 3T0DA 4X6CF 4Y2NA 4JX0A 1A0QH 1O6SB 1WHPA 3PDOB 5CLXA 4WFFD 1BAFL 5DHMC 4X4YA 1XCXA 1BQRA 4EN3C 3F7YB 4MVBD 4P04A 5D1ZC 2J6WA 5AAMC 2OSYA 3C5ZA 3GM8A 3JBG7 2HAZA 4XPBH 3ROLA 1N7ML 3SKJL 5EORL 4JQIL 4WY7H 5I8KH 1U91A 1WZ1L 4RGOH 3SJVA 4KRPB 4OLXL 2B2XH 2HKHH 2XQBL 1J8HE 2GJRA 4QRQB 4ATWA 5F6HJ 1ILSA 3QQ9D 4PJ5B 3G5WA 2X88A 4V1DD 4X5RA 4V11A 1MF2L 1NFKA 1BQSA 2IPTL 2X6MA 1HIMH 4U0RB 5LBGA 3VG9C 2Q3AA 1J7VR 5C0DB 3CFJA 3QIUA 4U1SA 2KZWA 3H3KA 1OPOA 3IXAB 3G04B 1O5DT 4R97B 2ADJB 1YAZA 2G5UA 2XFGB 2IJ0C 4RAUA 4EDXA 4NYLB 4PPTA 4LCCA 1AMYA 1IKFL 5C0AD 2ALWA 3PGCB 4H2CA 5E2WH 2CU9A 2XG4A 3X11B 4LEXH 2OYLA 2JV6A 4DGVL 4NX0A 4TQHA 4LHQB 4MA7H 4QHNB 4AEIL 3VB8A 1CGTA 1N4XH 3DK2A 1UENA 4WW2A 1AXTL 1KYDA 5DD6A 3IB4A 5AAWA 2YGNA 3ILPB 2EEAA 4L29B 5DURD 1RK0B 2XTJB 3DROB 4N8PA 2IADA 4M3HA 3VFGH 4LDOB 4MA1C 4WLCA 4X9IA 5K5YA 1SUJA 2AQ2A 4AQEA 5JHDA 2Y1YA 2HT4D 3B9KC 3F05A 4FA7B 1KJMA 4JPSA 4UT6H 3WBDA 4EKJA 4X5XB 3US0A 1MLCA 4TVPL 5I8CA 2ICWI 3VRIB 3BPLB 3WELA 2Y7MA 4EI6B 2Q3ZA 3VFWA 5D1QD 3N44B 1TO5A 4TVPE 3I84A 3LH8A 3CSGA 5SX4H 4LMQE 1O9VA 2HRPH 3C2SA 3UJTH 4KJYA 7FABL 5C08B 1IEHA 3HE6A 4J5VA 3ATDA 2EE6A 3FBKA 5IB2B 4JPKL 3RGHA 1OO2A 4NPJA 1U91B 3SJVB 3ARFD 5ID0B 5HI5D 2QGBA 4Y9CA 3SD5A 2D4FA 2NYKA 5CZXC 5E8OA 3BH9B 3VXQB 4DN4H 4Q4IA 4X2UA 1FG2A 1E4XL 5AAMA 1OARH 3HI5L 2WXGA 4ODHL 1KY6A 1GC1L 3FN3A 2K4WA 4KVNH 4GI9A 4XNXL 3LRMA 4RZCB 4TS6A 1QACA 2ZKHL 2XWJB 4LPXA 2XG4B 1FFPA 2XWCA 3GINA 4AK1A 4IEFB 4UNUA 5DRWA 3T2QA 3L3IA 4GSRA 4X5QA 2FAUA 1FAIH 3NIFE 3FFDB 3H3PL 2XQYG 3GMOB 3MV8D 5JORB 4G7RB 3EJQA 5F6HI 4XNQB 4I9WD 4Z23A 3U9UB 2OP4L 4AQEB 4L23A 5DWUH 4PAZA 2QQLH 3BGMB 2W38A 4LPCA 2VSKB 4OGAD 4OZFB 5B3NA 3L7FA 1A4KB 2XHNA 2JKRM 1Q9LA 2BNRD 4EIBA 1XBDA 1R9FA 4LCUB 3FT3B 5BRZB 4FNSA 3HC3H 4Z7WB 1PKOA 4QEGA 3I3BA 3UP1A 2O72A 3H7BB 4GMSH 5BS0A 3HS0C 2R9HD 3CC5B 2DH3A 3MLXL 1C12B 1FGVH 2F7RA 4P4RA 3V6FB 1X5JA 2OCFD 2P8LB 2N0KA 1WLHA 4M43L 1I8AA 1D7BA 1UD8A 2IEPA 3LY6A 5E5RB 2W0PA 1PCSA 1GW0A 1LK3H 4FQPA 2AQSA 2V5MA 4BE5A 5C0AB 4L1TA 1NCAH 4Y16D 3Q8BA 3HKFA 1CLVA 3MRQA 4ZD3L 4PRBA 1F4HA 3FTGB 2A83B 2WMPB 1KB3A 1UM6H 3S5ZA 4PRDB 3K6FA 4UIKL 1VEMA 2CIKB 5D7IF 4J8RB 4RNRB 4GO8A 2MCPH 1U58B 1KOAA 4RGMB 2BC4A 2F58H 2OR7A 2CIIA 2IWEA 5BJTA 1U8JA 3QPKA 4KI1A 1ZKAA 1QW8A 5IQLA 1JYWA 4FFZA 5E6ID 1M42A 1BYNA 5EBMA 3HFFA 4F7TA 1FYTB 3J2PA 2XZAH 4JPKH 3IPBA 3CVHA 4NAMA 2YO3A 1P4BH 1AC0A 3QDMB 4HG4K 1CFVH 5C0BD 2DD8L 1RJLB 1FFNA 1WHOA 1MCBA 4MS8C 1WAEA 3VI4A 1J9SA 3FB8B 5LGHL 4CN1A 2MEJB 4P46A 2C4XA 3AQDA 4PJ9A 1I8MA 4OT1H 1QTPA 5FYLL 4U1KA 3DURA 5J11C 2NXYD 3BEWB 3Q3GA 1L6PA 3KWWA 3VXSE 3ZDXF 1KLFB 5HGBA 3AQZA 4LSSH 5M94B 3RVXC 1CB4A 1QUNB 5DEJA 3VFGL 3ASNB 1YEWA 4QXVA 5CD5C 5KZCB 1GGBL 1TYJA 3UDWC 1X7QB 1NSNL 5C9JA 4PB0H 5LDUA 4P4KD 4RZKA 5D7KD 1RIHH 1AXTH 2Z31A 3QORB 5MENE 4CMMA 4IBWA 1K9TA 4AT6B 1AKJB 4JCLA 5TH2A 5L2KD 4IBQA 2Q20A 4NQXB 1OSZA 4JRYB 1L7IH 3O8XB 4Y5VB 2Z7WA 2I25N 4GAFB 1MCIA 2O1AA 5I0YA 4H88H 4MZ2A 2YIHA 3DK0A 3HZVA 4UU9A 2EYSA 4BZ1H 2VXSH 1WUZA 2H26A 1M3IA 2EIBA 4ENZA 4OJFH 4YHNB 2WJ7A 1UA7A 1ZHKB 1OF0A 5IHUH 4FQXD 2DB8A 1FLRH 1CG9B 3WHE1 4N5UA 5KYWA 1DEEB 4XNAA 5IGXL 2OSWA 1B0WA 2XN9D 5EZLA 1AHWB 3BEVB 4NQCE 5DVPA 1ID2A 3NK3A 1JNNH 1XCWA 2ZAGA 5AKVA 1IGJB 4PJDA 5IROA 1A1OA 3CLWA 5L6YH 3K2MC 2NY0D 1CDCA 4PH8A 2DY2A 3ARED 3PWPE 3QCTL 5CSZB 1U95B 1KCVL 3KPRE 5D2LA 3D3VB 1C5BL 4ZNEA 2X0VA 4HUVA 1PKQB 5AEAA 4U1HA 4O02A 2AJVH 4H8VA 1R3HA 2ZYHA 3WEXB 2BOLA 2Z8VC 1JZ4A 3MV7A 3WAJA 5C0FA 3MU3A 5A7EA 4N2NA 3ISWA 3BXNA 4JL2A 2PMZA 2APVA 4IGBB 4XR8C 4NKOB 5CZXD 3NJIA 2E7MA 3SGKC 4Z0BL 4DP5X 2HT3D 3CFDA 5ALCH 1YNTB 3PHQB 3QUKA 4AQAB 4HJIA 2B0SH 1JFQH 2XYBA 3SKMB 2WLIA 1HNFA 1NKGA 1CS6A 5IFJA 4XMZA 4GRWE 2YZ8A 3FQ4A 5BOZG 3T0ED 2QEJA 2B14A 1ZV9A 4OZFH 4B50A 1KYAA 1RZJL 5CJOH 1XF3B 2A1WL 5E7BA 4U3SB 1S3RA 1GYUA 2OZ4L 3ARGD 3OAUL 4PEEA 4BJLA 1FUNA 5FLVA 4ECNA 1D5IH 4G2AA 4QRPE 1J0IA 2DJSA 1MW3A 2IH8A 2IG2H 2EYSB 1YDPB 4ELDA 5CZVL 3FT4A 1JPEA 1MW0A 3FO9A 3VE0A 4Z8FL 3P4OA 3QO1A 3LJ3A 3KEHA 2GBVA 2EVHA 4DT2A 4R3SA 4QHLB 3WO4B 4DEWA 4Z7OF 4ZDHA 2VLJE 1PIFA 3D39B 4G8GB 4ZAKB 3ZO9A 4KZ0A 2O6CA 1HXYA 3SCMD 2DBLH 2YPLB 4KOBA 5E6UB 5L4IA 5KN5B 1CWVA 1KPVB 2BO0A 3FCTA 3VMPA 2EDYA 2ZAIA 3MCLH 4UT9L 5INCA 3GUTB 5ELIA 2FUQA 3MPCA 5GSRA 2JKIS 1YYCA 3QJSB 1ZLVK 3SE9L 2BRQA 1R3LB 2X89D 4Y4FC 1XGQA 3UJIH 5CFAA 4NKMA 4AVIA 1I7TA 4PVLA 4BQ9A 4G9FB 3QUHA 1XSOA 1YN6A 2CKBB 3WFHA 1RZFL 3AZUA 3T0EA 2PABA 1JERA 5FA4A 4BGDA 2A6IA 4PV1C 3K91A 1NPUA 2CO2A 4Z7UF 1JRHI 3CFEB 4XI5C 1XR9B 2HKFL 2OMUA 3CZEA 3MGAA 4XN7A 3O9WA 4U0QB 5T5FL 2DPKA 2X9XA 4PB9L 3EJZD 4BRVA 3ZDZE 5DHXB 3UBXI 2A38A 2XRAH 1FG9C 2F53A 5JIKA 3B9EA 3RB7A 3ARWA 2CKBH 3U0PA 1P1ZB 1XXFC 4NRZA 1JPFB 4K0OA 5BZWB 1BJMA 3QJOA 4FQ1L 4KNQA 4BFNA 4MD0B 1TQCB 1EHLH 2D3LA 4MNGE 3VFMB 5FEBA 3WNNA 3NFNA 4OLYH 3CFBB 5KANG 3GO1H 3MYJA 2CUMA 5D2NB 4LL9A 3Q48A 3M1BA 3RJDA 1JPST 3ZXAC 3QNYB 4XB7A 1OM3L 2F54B 1NPJA 3CQQA 4ETYA 5HYJA 2X6BA 3WN6A 35C8L 3VFNA 4GT0A 5KYXA 2ZUQB 3VH8A 1IGMH 4RFEB 4ATTA 5DHVB 2HVBA 3QJUB 5ISZD 3QWNA 3EJSA 5GIRB 4X0KA 5AW5B 2A9CA 4HHAB 2IOMA 1O0VA 1UWXH 4MQXC 1S7RA 2WYZA 4N2EA 4NQVB 3G5XB 1VFMA 3IDYB 1J88A 1MG2C 2K9FB 4ZFFA 1YRKA 3CN4A 4QR7A 4RA0C 3D8MA 3UZVB 2ZOTA 1YMMB 1JK8A 3B3IB 1OK8A 5JO5A 5DD5H 3IJHA 4G72B 2LTQC 3KCPB 2MTPA 5EU3A 2DYPB 4PS8A 3QPQD 4Z77A 4YSOA 4ZFZA 4A39A 3MNZA 3MYZA 4AGMA 4A2HA 4QIRA 3ASOB 4FMFA 3GSNA 2YSSB 1IM9A 4PJBB 4OZIE 5AW2B 1D6EA 1FA4A 1QBAA 1NCWL 5LCVL 1VADB 4B3EA 1RZJH 4X6BB 2HLAB 7CGTA 5EORH 1SXCA 4FFZL 2V8LA 3L8QA 3MA7A 2OSLB 5CBEB 2E27H 4E9VA 4TTDC 4NRZB 1NGYA 1SGKA 3AG1B 3ATFA 2A0LC 4YR6A 2A9MH 1WC7A 2X1OA 2W9EH 2BNRB 2O6FA 2A77L 4QRSB 1AQKH 4XO8A 5DRXA 5EEXA 3B8YA 5E00B 3X14B 2VLRE 3SY6A 3VXSB 3DWTA 1AIFB 4MCYB 5HHVH 4ZRGA 3RL1A 3FYEB 2JKLA 5DA4A 4PRPD 4K73A 5E8PA 1W8NA 1T2JA 1A6VL 1BYPA 3MOQA 1UFGA 3ZPDA 3FTYA 3N85H 3STZB 4CVWA 1DE4B 4PJIF 3DVNB 2P8MA 3CLFH 4YDMA 4JRYE 3VTMA 1OB1B 1D5XA 4JKPH 5M95B 1SMDA 4DP7X 3GSVB 4N9OB 1SN2A 1W8EA 1ZLUK 1A9BA 5CIPA 4CC4C 4D0BB 3F3HA 3SO3B 2ZXBA 3S96A 4H0IA 1D9KA 1SY6L 2FT7A 3EBIA 3A6CL 2XTJE 4PIRF 4YIQA 4YK4C 2CLZB 1SDYA 1E9OA 2OZ4A 4DEPC 4U6YB 4UB0L 3ETBF 5BO1H 3EGXA 5PCYA 1UD4A 2EDOA 3ARFB 4J3BA 5D8JL 5JXAH 1HHIA 1MIML 3PDOA 2P49B 3GRGA 4LEXL 4OGAC 5FIEA 3IGLA 2FGWL 4IDJH 3B5HA 5TGBA 3SDXB 4LSVH 3Q5TA 3GI8L 1N70A 2GPZA 4BFJA 4IRJD 1SHSA 4M8QA 1SBSH 1SDDA 1UACL 3FQWA 2BJML 1U3JA 3GSNH 4KDWA 1IIKA 5MP6H 1ONQA 2F74B 5K39B 2I27N 1D5BB 4IS6B 2X6UA 2BH0A 4BH7A 2M26A 1PX3A 1TPXB 1EHLL 5CP7B 4FXTA 5F7FA 2B08A 4FZEH 2GUYA 4KZDL 2DBLL 5MEQB 5LHDA 2CPUA 5E7FA 3ZGHA 2EE9A 1CBVH 3LD8C 5H35A 2JI1A 4IM8A 1MI5B 4JM2D 3TIEB 5IFHH 2L7JA 5SWZA 4YXHL 2WQXA 5CJ5A 2A99A 1E43A 2XZAL 1J86A 3G5ZA 3QEHA 3MLXH 5IB1A 3FUEA 2VXUL 1ZTXH 3C08H 4LSRL 5ANME 3JUZA 3L81A 3B43A 4Z78A 1DE4A 5L8KB 1T1WB 1Y6KR 5DFVC 3UH8A 43CAA 4RFOH 5LJYH 3K80A 3ZKND 5I74C 4JMNA 4ADIA 1ZLEA 2YPVL 3KR3H 1Z7JA 4QTIH 2ETWA 4TLTA 5G4OA 3A6OA 1RZFH 3APMA 4N20A 4AOFA 3MV8A 4GIPD 4LHUD 4KX8A 2H0EA 1UB6A 4OZHB 3CCHA 1RK0A 2EDQA 5FAAA 4YHLH 1NA8A 1NDGA 1WBXA 3T9WA 1R5IA 3M1CA 2XWTB 2X4PA 4MA8H 3ARFA 2FJFB 5D71L 3SYCA 1UADC 1DQJB 4WJG3 2JFCA 4ELKB 2PP7A 4KKBD 2G30A 3WFCL 5DQ9A 1AR2A 4XVTL 3G6JF 1RU9H 1OAYL 1KGXA 3LIZA 3LPOA 1NBZB 3F2LA 5GS0D 5CINL 3ZIMA 4G5ZL 2JKSA 1DQMH 4BRJA 3F58H 3HHMA 3VQMA 3QUZD 2FYVA 1T66D 2WKLA 2BNQB 2QR0A 4LNRB 5A2AA 5SWQA 2B5IB 3N1MC 4PLKD 1DANT 5JW3L 3ES6A 4D3CH 4MJID 1QFHA 5DD1H 1QYGH 4F2ME 2VZ3A 3FHQA 4JDVB 5KSAA 4ENEC 3QUXD 4K2UL 1CDYA 3B37A 5MERB 3LXUX 3C9NA 4FNRA 3TH4T 3SQBB 3WL9A 4E5XB 3O2VL 2FWOB 4JFOA 3DX0A 4HPYH 4KTGA 1SBBA 5JR1H 4HUMB 4MQTB 3QDHA 4U6XA 3NJVA 1RJZA 1MHPL 1TKWA 4HV8B 1O6SA 3HB3D 2HA1A 3RIFK 3RFZB 4S1RH 3QFJA 4M93C 4QRUB 2P52A 2PR4L 2J55A 4GYBA 4AGQA 4LSVL 1IFRA 4IU2A 3C5SA 2IFFL 4FTVB 2XPYA 4TUUA 1FE8L 4FJ6A 3LQAL 4XO9A 5IVXA 1R5IB 5F3FA 3ZMRA 2PTTB 1KLGA 2R4SL 4H1LH 2FNWA 4JFQA 5HI5C 1RZKL 4I1RA 1AGDA 3CVCA 2QPEB 4ZX4A 1A4KA 4JFED 5TE7L 4E41E 4JGNA 3R8QA 5JW4Q 3A47A 4O2FA 3W5NA 2BIMA 3VD3A 2Y7SA 5AD0B 4LDCA 1W72L 2JTYA 1BECA 4EUPB 3NIGB 4ZFQA 1V7ML 4K9EL 3P2DA 4LEEA 4FHJA 2QQNH 2R9HC 1JK9B 5KEZA 1QR1A 5JMRA 3U30B 4PRIE 2GTWB 3KL5A 1WFTA 1S9YB 4ZUWB 4FG0A 3RNKA 3S36L 2OR9H 2CD0A 3RDTC 4CU6A 3KNBB 3PWPA 1JZ6A 5LAXA 4PRBB 1XD1A 4PJHA 2AMGA 1B0RB 5M7QA 3TASA 3Q5YA 4JG5A 1V05A 2XJKA 1T04B 4EO5A 2QV4A 1LDPL 4K71C 1I1RA 4F8NA 6CGTA 3QWOB 1ES0A 4N8CH 2P28B 3P0VH 2IGTA 4GW4A 1I3RA 4HIJA 5IF0A 3ULUD 1EANA 2PXYB 3QQNA 4JFDB 2W07A 2BZ7A 3M7FB 1N6VA 1RJZB 1TKWB 5E95B 1MLCB 1FFQA 3TT1H 2BK8A 2PYFA 4DQOH 1PD6A 2AJVL 3NUKA 1X4YA 2ITCA 3NPSB 1SJEA 1OP3K 3S2AA 4AJ0A 2DEYX 4IK7A 3EOYG 2XQ0A 1JMXA 2VLKA 2NYYD 5KYUA 2IBZX 3OGOE 2VR3A 4ZXBA 1MDTA 2MFNA 1HNYA 3KPOB 4FTVD 2EVJA 2KLRA 4Z0XB 5H2BB 5TDPB 4U1IB 4Z18A 4A2MA 5C07B 3KGRA 1MF2H 1BG9A 2MRYA 2CDFA 3FONA 4FFYA 3KLAB 4PJGE 5E0FA 4G6JH 4X80H 1MVFA 2F19H 3S36H 4TUJB 5JIDA 4N3TA 3EH5B 4YHKH 1M1XB 4NJAH 5JOEA 2ED7A 3KPLB 4OM1L 2X87A 4FQLH 4UANA 2R1YA 5IVOA 3WEOA 4AUUA 3KPQB 1JK9A 3ZHNA 1DBKH 1UEMA 1HOCA 3QUXC 2OAAA 3QB7C 1XD0A 3X1GA 3LZQA 2NY6D 3NJFA 3QGVA 3V7AE 3AG4B 5I23A 1S7VA 3NIDF 4B9ZA 1OT2A 1A6TA 1A2YA 3MUJA 4WENB 6FABL 5C6TH 3OLDA 3MODH 2V2TB 2IQ9L 3O45A 3GMOA 2VDPH 4F9LC 1Q9OA 5JHMA 1DTUA 5CEXA 4ZUVB 4KK5D 3HAEB 4L3EE 2HT4C 5SWSA 2D3NA 4MMZB 1A21A 1OP3H 5EF0A 4KVNL 4Y1AB 4FLQA 5E8NB 4LLDB 4QF1B 1BZOA 3L3OB 1M53A 3RIKA 4WHDA 2EEXA 4JY4B 2ITCB 5H4ZA 5JR1L 1BF5A 2NUTA 3MUHL 1HL8A 3ZE2E 2VZSA 5KYUB 4XCYA 4G9FD 1ZVYA 1NLDH 2NY3B 2VWEE 3HUJA 3K0WA 3CVDA 1GOHA 3QVAA 3BGFB 2DMGA 3ARBC 2ESVE 1ORQB 3HJ0A 4WUUA 5F70A 3DJ9A 1X44A 3LPPA 3FDWA 1NAKL 2TAAA 4QHMB 3BXNB 1SF5A 4NGHL 4KWUA 3LSOB 4M6ML 3NTCH 4MKTA 1AGFB 3NJXA 1GR7A 2ZXQA 3G7TA 2X4OB 4QY8B 1EHAA 1LQBC 3TONA 2ERJB 3ORJA 4EE2A 2F18A 1FYTD 4P5KA 1CDUA 2WINB 4G7QB 4IRSC 3WS6A 4X8XA 4UOW0 4J1UB 4KXAA 4BFGA 3L9EA 5ILTL 1FVCB 1CL7H 3DX3A 2WB7A 3F7RA 3IJYA 4F7EB 4K94C 4FABL 4C83B 3R4RA 4XNXH 4ZYKB 3U46B 2JIXB 3JWNH 2GBTA 4LP5A 2YD1A 5AW9B 4H20L 4KHXL 3IBOA 4D0CA 4P05A 5AFAA 4YDLB 1FGVL 4GKZB 4BFIB 4ELMB 4A38A 1ZOXA 5DLLA 4GXVL 2IALB 4NQEB 3PDGA 5SWSB 5HHOE 5MEND 2B1AL 5FB8B 2XIIA 3TF4A 1CE6B 3U0WL 4KXZH 1TG8A 4G3YH 1HHHB 2EIMB 5D1QC 3A67H 3TF7C 1G7MB 3NIFF 2BSSB 1OD7A 5FHBL 5IB4A 4XBGB 3L45A 4YDIL 2ZCLL 5T33L 1KBGH 3Q06A 4ZMNA 4U1NA 3K0YA 2P5WE 2B59A 5DMGD 3DVGA 4V33A 5DZJA 1LYQA 1A7QH 4LBEA 4EF3A 1I1YB 2BNQE 2CHZA 3TEYA 4AENB 4RDBA 5AG9A 1UXWB 2HFEB 1RHHA 4QGYA 3SPVB 3O8XA 2YBRB 2CA4A 4P2QE 1GYAA 2HG5A 4Y4KD 4OBSA 3TFKD 2YAHA 1ZPUA 3MLVH 1BXVA 1K5NA 3MNWB 3BDYL 4ZPTA 5FX3A 1BZ9A 2F7OA 5I76A 1PZCA 5AALA 4LLWA 1S46A 5LCVA 3UTPE 1BPVA 4JO2H 4ZS6C 4J1UA 2G4GA 4UM9A 5E5UB 5I18L 1F45A 2XRAL 3NK4A 4KBPA 2VR5A 4I18B 4NN7C 5LO7A 3HG4A 4AYEC 1JWMA 4OZIB 4HIIB 4GFXA 3BEVA 4GW1B 3PXLA 1MIEH 3FW6A 2NQ3A 4HIQA 4XO3A 1GS8A 3MUGA 1A7BA 3TURA 1DBAL 1VGKA 3ZDYB 1NGWB 4W9CC 5KTEH 3B1TA 3MLRH 4R4BA 1SY6H 5CSZA 2P1YA 2QSQA 3L9RA 2ZG1A 5JTWA 3V0DA 4YBQD 1DLHB 4KTYA 1E2VA 1NUDA 2C9UA 5KVDL 3U2IA 4JKPL 1EO8H 4YSTA 3SKJH 1ZLDA 2DQIL 3WS3A 4OCMC 5FYLE 3LX9A 2WLJA 2WBJC 1NC4D 1IGIH 1SHXA 1S7WA 1NMBL 4UIMA 5C09B 3BSZL 4XPTH 3F8UB 1MREH 1AP2A 4OD3H 4X5WB 4IKNA 4PGJA 3WY2A 4F91B 3MBXH 4GKOA 2NXYB 3U0TB 2COQA 2NCEA 1K2DA 1NUNB 5JHBA 2EE0A 4Y2DB 3IFNH 4OAWB 1Q4NX 2PCYA 2X89A 4RQQA 3RWEA 1EAPA 1NSNH 2RIKA 1D9KD 1OT4A 1YA5A 2Y36L 4GS7B 1UWFA 4LOUC 5HGHA 5HDQH 2NY2B 1DVSA 1A22B 1KENH 2PCFB 4H0LC 5ISZB 1P7QA 4P48A 1DO6A 4PR5A 4PJEF 4KRMB 1D9KC 3EGDB 5HYEA 1USQA 4I0PA 2CBTA 1BMGA 1FFRA 3NAAL 1KGCD 2DWSA 1HZLA 4Y4HC 1U3HA 3TYGH 4B95C 1EHXA 3U1PA 3FYIB 4X98A 1MLBB 3S37H 3WMSA 2I69A 3K72B 4P9HL 5ANMA 3BH8A 2EIZB 5EC1A 4D3CL 2WNWA 4DGWC 1JFQL 3SBWC 1WISA 1WGVA 2CK0H 4TOYL 3ZE1B 3HN3A 1RZJC 2RTTA 3JQOB 1MH5B 2R56H 2Z7YA 3UTQB 4ZW3A 3LHPL 2ROYA 4K3DH 1QSZA 3SGKA 3UTSE 4N86A 3DYMA 1N5AB 2DEXX 4G7VH 5DUJA 1LO0H 3FQTA 4FYQA 4WWKB 25C8L 1Q94A 1PFCA 1FI8C 5CF3A 3O6MH 4APQD 4J39A 4R90L 3GUFA 4NM8H 1UH4A 3HA0A 1KTLB 5DCCA 1KACB 1Z5LB 3GIZH 3LKSA 1CR9H 4LOFA 5F0JB 4PJAE 1F3RB 2X9WA 3WGVB 3HMXH 4M6OL 4Y19B 4C57C 2JJTC 4OCLC 1JZ7A 1A64A 4WKZB 4HEPG 2Z4QB 1PDKA 1DJYA 1I9RL 2ZYIA 3KH3A 3L4XA 3VXTA 1XEUA 2PYEE 5I1LA 1A7QL 3ARGC 5I5IA 4Y2DA 3VAEA 2VZUA 5JQ6H 4TL4A 1P7HL 5B39A 2VSCA 2UZXA 3Q9PA 4ACTA 3CVHL 3HNTL 2I9LB 2NSXA 3ZR5A 2QLVB 1MRDL 2C8NA 1K4CB 4UQ9A 3DBXB 2PPAA 4JPIA 3VD1A 5IWLC 2OK0H 3NRPA 1F0LA 4F2EA 2BVUA 2OP4H 5CNHA 4R4ND 4BQBA 1RZ8B 1MLBA 1R3IL 3C8KB 1QRKA 4NUMA 5EU4B 4ZMWA 5C0CA 3S8GB 2EEDA 2OJEB 4UNTA 3VXMD 1LQSR 3QXAB 3VMOA 1F8TL 5HHNA 1IL1B 4UZUA 1BZ7B 1U21A 2BY2A 3SPGA 2H6PA 4AL8H 1DSWA 2JKTM 1N5AA 3LAFA 4Y2OA 3D0AA 2OMTB 4R7VA 1HXMA 3PQYB 3RZCC 3W38A 2H32B 5KSAD 5MEQA 1JGVL 1VB9A 1OGAB 3BKML 5CZKA 2XZCL 3N55A 4GH7B 4A6YB 1D7CA 2XKNA 1KTLA 2XN0A 3QFDA 1GHFH 3QIUB 5IJKC 3NCEB 1BVZA 2P8PB 1DBJH 3L5WA 4N0YH 5A40E 1XF5B 5IB1B 4HK0B 4AV4A 2B4CH 1T5KA 5L7XH 4R4FH 3CVHH 3HNTH 4ZK8A 5E2TL 3OAZH 4F7CB 2DQFA 4X99B 4PJCF 5DHVH 3WV0A 4ZMOA 3CMOL 2FO8A 1AFVL 4I77L 1U3ZA 3MZGB 4NQCD 2OM5A 3X1FA 3BW9B 1YEKH 1A3RH 4CJ1A 2HRPL 1T0OA 5FGSA 1YEJH 2ZNXA 2WXIA 1GIGH 4HAKA 5CZVH 4ANKA 2P48B 4TQEL 4B96A 4YO0A 4NQEE 3RWGA 4WHCA 4XZ4A 1UOWA 4PJHE 4QRRA 4YDVB 2MMXA 1E30A 2VXQA 4F8OA 2CWRA 2BHUA 1IAOA 3M7OA 2RCSL 4H26A 4JRXB 5GGTA 1WH0A 4DFIA 5A16B 3II2A 4U1MA 1H19A 1WCQA 5CJXC 4XNYH 5AAPA 2ADGB 2IANA 1ML0A 2YFNA 2KZKA 4PGEA 1QP1A 1AANA 3PDDA 1BPLB 4Y19D 1CLZH 3CFJB 1EXUA 1FV1A 2Z93A 3UAAA 4G43A 4EAEA 5K93A 1QLEB 1ZA6B 4UQ2B 3WLBB 1RUAH 1P4IH 2OMTA 2IOIA 3B2UD 4KRPD 4P2CG 3HG1E 4OJYA 5CUSL 5L4MA 3C5JA 1XB6A 4IU3A 5F7UA 2R0WH 1WVZA 3O8XD 4GAGL 3VD0A 1EA9C 1JWUA 3MRDA 3P73B 4N6RA 3HTLX 3HI6L 5DD6B 1HU8A 3QFDB 4L4VB 2JH2A 3U4EB 2NY4C 3ILPA 3WUWA 2QT6A 3LDBC 1R1CA 4F3FA 4PM1A 1C5DA 1NCHA 5IR1A 1AO7E 4X99A 1NDTA 2Y7NA 3EJCA 4LIQL 3KDMA 4BZ1L 2DJMA 4IEFA 4RMBA 1ZCRA 3EH2A 3C6LA 3NZUA 2AK1L 1QHQA 3V4VH 1JZHA 1ZVHA 4PJXA 1FLRL 4KROB 4XCEB 5F7NC 2ODHA 4KITB 4D2NA 3ZDYE 2RH0A 4IU2B 1YEHL 4WTQA 3EXJA 3BI9X 3MLWL 4OCWH 4MB4A 3MVSA 2F74A 3VWKD 4A66A 4AVHA 5I6XC 1T80A 1GGYA 2PTTA 2VW6A 1S9WB 2HH0H 2IPUK 2QTEA 4L3CB 2KMWA 2FSDA 5DMGC 5JOPD 4GG6B 4LEOA 5CWSB 3KD4A 4B27A 8FABA 3BE1L 5FYLD 5C0EA 3DIDA 4YNYA 4GBXA 3N04A 1DZBA 3MXVL 1RIVH 4XCCH 3ZTDC 4G6KH 1CUOA 4FQLL 3GMPB 1ZLWH 3DARA 4KO5A 3B5TA 1OAZL 2CGRH 5J13B 3QJXA 5EZPA 4WUUD 3OKDA 4X80L 2JCWA 5F88B 4AGNA 1EAOA 4GB9A 1RUQH 1BF2A 1XZWA 2WNXA 3BP4A 2B7DT 3LEYH 2DV6A 4MFHA 3QDJA 4XRCA 5IMKA 1JRHH 3VFOA 2HTKD 4G82A 3FRPB 3LRKA 4X4ME 1RIUL 2AITA 4XNMA 4GRLB 4UIKH 1MFAH 1RIHL 5KYWB 2AK4D 4TNVF 3FPXA 3D18A 4X6EB 2JJWA 3IJEB 5ICXA 3DIFB 2Q6WA 3LN4B 3VUAA 2Z31D 4YSSA 3PV6A 3BIKB 1AQMA 2DL2A 3UJJH 4CN4A 5ICYB 3R1GL 3DSNB 1ZT7B 4J4PA 3EDJA 5EC2B 1I8MB 4OLUL 1WIUA 2KLTA 3DURB 4M03A 5F7BA 4H13C 4OM0H 1KN2L 3KWTA 4AJYV 3FTSA 1KDJA 5TE6H 5CS7A 4BK4A 4G8EB 4Y4KB 1OAZH 2CGRL 3IKCA 4M1GH 4HUXA 1KN4L 1OGSA 4GLRI 5HVGB 3QAZC 1ZANH 4J2XA 4JQIH 1PTZA 1DBBH 2ZUSA 5HI4C 1TUPA 1FDLL 1EMTH 4CMMB 1OK0A