1HAWA

X-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9 a resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title X-Ray Structure of a Blue Copper Nitrite Reductase at High Ph and in Copper-Free Form at 1.9 A Resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 90
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hawA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hawA02
4YSSA 1GS6X 1OE3A 2PPAA 4NB7A 4Q8BA 2IAAC 1MG3C 3AZUA 3NJHA 3CVBA 4WKXA 2OJ1A 2BHFA 2FQFA 3X1GA 3TBBA 1JVLA 1V55B 2AZUA 2WO2B 2HRGA 2FQGA 1QHQA 1OV8A 3CZUB 4AKOA 3AG3B 2FT6A 2FTAA 2A3TA 2QPEB 2CALA 1AZUA 2TSAA 3WKPA 3X1NA 1URIA 1A4CA 1RZQA 2ZONA 2PP8A 3G5WA 2BW4A 1GS8A 1MG2C 1KCWA 5FC9A 5I26A 3PPSA 2FWLB 4UF7C 1CURA 5PAZA 2YAQA 3MBWB 1TEGA 3BVDB 1AG6A 5I5MA 4YSQA 5B3SB 2YAHA 2B08A 3QJQB 3CG8A 4A2FA 3SBQA 4YSAA 1L9PA 3H4HA 5I6KA 5A7EA 1NIBA 1JZHA 2VSKB 1J5CA 5I5IA 1YLBB 2P80A 1PF3A 3UGEA 4W1TA 4G7RB 3SQRA 2GC7C 5AKRA 1ZIAA 2PP7A 3UAAA 2PPFA 1NIAA 2Y1AA 3SBRA 2DYRB 2Y69B 3FU9A 1XB3A 2TSBA 1L9TA 3FYIB 3QJUB 2J5WA 4YVUA 4BK5C 5LDUA 3N55A 4BDVB 4BWUA 4YSEA 3FT0A 1E65A 3NT0A 2IDFA 4A68A 2WO3B 2IWEA 2R7EB 4KO9A 1KDJA 2BWIA 1NIEA 4NAJA 3NJLA 1PY0A 1FWXA 2HZHA 3IN0A 3AG2B 3NYKA 2Q9OA 2J55A 3IN2A 2CCWA 2PP9A 3ABLB 1KV7A 3OQRA 2HLEB 4AX3A 4DP9X 3UAEA 2FT7A 1QLEB 5E9NA 3T71A 1PNDA 4L0PB 4HHWA 5IY5B 2IDTA 1MZZA 2VW6A 3NJIA 3QPKA 2NRDA 4BWWA 2QPDB 5D4HA 2XXFA 1L9OA 2WSDA 3AW5A 1JXFA 4DP5X 4AKPA 1XMEB 1SDDA 1HAWA 5B7EA 3NJJA 1JZGA 1JERA 2GBAA 1OOWA 2H47C 4NERA 3T6XA 4G72B 1J9QA 3UABA 5AZUA 1IBYA 2R7EA 1IKOP 2ZXWB 1NPNA 3OMAB 2PPCA 2XU9A 1NTDA 2UX7A 1RKRA 3ZDWA 4E9TA 2BP8A 1AR1B 5AFAA 1ETJA 1JZFA 1PLBA 4M4RB 1PLCA 2RACA 5F7AA 4DPBX 1X9UA 2DYSB 3V9EA 5I28A 2BW5A 1RCYA 3FSWA 3FU8A 1ASPA 1KDIA 2QT6A 7PCYA 4KNTA 1FA4A 3U25A 3V9CA 1HAUA 6PCYA 3FQYA 4GYBA 4DP2X 4PAZA 1TKWA 2ZWNA 3X2QB 4MFHA 1DYZA 1AS8A 4G70B 1PLAA 2BP0B 1GS7A 3H4FA 1OE1A 2I7SA 3T6WA 3NSYA 1VLXA 1JZEA 2DY2A 2VW4A 1AIZA 4YSRA 2W8CA 3NSDA 5ANHA 4DP6X 3IE9A 1BXAA 2IDSA 4ENZA 2N0MA 2GHZA 2BO0A 4HZ1A 2YQBA 2XV3A 2XUWA 3WI9A 3S3BB 3TA4D 1TU2A 2YXVA 4G7SB 3ASOB 3BQVA 3NJMA 4DP7X 1NWOA 4FAAB 2W88A 1E5YA 4HCFA 4BXVA 5PCYA 2EIJB 2H5UA 3KW8A 4GP4B 4GXFA 2IWKA 4AZUA 4CSPA 2MTAA 1JVOA 1F56A 1EZLA 4UAHA 2VM4A 4G7QB 1XB8A 1SF3A 3AY2A 2BP0A 1W6LA 1J9SA 1NZRA 1ET7A 1WA1X 4A2EA 1BQRA 2YARA 4KO7A 2H3XC 2I7OA 2EIKB 4Q89A 1AS7A 1GR7A 2UXFA 5B7FA 3ABGA 1ZV2A 4YL4A 3TBCA 3AG1B 5F7BA 2AZAA 2JFCA 1BYOA 1V10A 2IDUA 3HEIB 1V54B 1WAEA 1GY1A 1IC0A 3FU7A 4F2EA 2GI0A 3EH3B 2J57A 1SDDB 2CBPA 1PMYA 2UXVA 2YAMA 2PCYA 3H56A 1SHXA 2VM3A 4AKQA 8PAZA 2EILB 1R1CA 4KNSA 2UXGA 2IH9A 3D12B 4JHVA 1BXVA 2HX9A 3OD3A 4KNUA 1M9WA 4F7KA 1CYWA 2GIMA 2BP8B 4HALA 4DPCX 3WKQA 3WNIA 1W8EA 1OF0A 1TEFA 3FQ1A 1SFDA 4ZK8A 2AFNA 3FYEB 1GYCA 3CDZA 1ASQA 5I6NA 4HHGA 3T9WA 1ZPUA 3JT2A 1SHWA 1WS7A 2JKWA 3WIAA 3TASA 4HCGA 3FPYA 4KO6A 2YXWA 3NSFA 3PXLA 1OCOB 2FNWA 3OMIB 4GY4A 1ZIBA 1E5ZA 1L9RA 1NWPA 2XYBA 5D4JA 1OE2A 3C75A 3QJVB 3ASNB 1GW0A 1ET8A 3T6ZA 1BXUA 2BZ7A 4BXSV 4HIPA 3NSCA 2AVFA 7PAZA 1JZJA 3QJSB 3EF4A 2VSMB 1PZBA 2XVBA 4K9JA 2UX6A 1BEXA 2CUAA 3DKHA 1W6WA 4YSDA 1CC3A 3DIVA 1QNIA 2Q5BA 4G71B 2GC4C 4E9VA 4AI7A 1WS8A 1NICA 1B3IA 2DWSA 1A8ZA 3HB3B 3NP3A 5I6MA 3NJGA 5B1JA 5I6LA 2AANA 2B3IA 2JXMA 1J9TA 1AACA 1NIFA 1ILSA 3RYMA 3PAZA 1SJMA 1MDAA 4KOCA 4RH4A 1BQKA 1BQ5A 2OV0A 1BYPA 5D4IA 4FA7B 2CAKA 4E9QA 4P5RA 1AOZA 4PCYA 4A67A 1AS6A 5EHFA 4E9YA 2HXAA 1XB6A 3QJTB 2VW7A 4A2DA 1OCCB 1WA0X 1AANA 4DP1X 1OCRB 3GYRA 5B7MA 3L45A 6PAZA 3NJFA 4TXVB 5B1AB 3FSZA 3S8GB 1X9RA 3UADA 2HX7A 3S8FB 1PNCA 3JTBA 4P5SA 3FU7B 1N68A 3N2JA 4QLWA 1GY2A 3CVCA 3GXUB 1NINA 1ASOA 3NP4A 1DZ0A 1RZPA 2OCCB 5I5JA 1AAJA 2E86A 4DP0X 2FQDA 1M56B 1PAZA 3PAUA 3EH5B 2XLLA 4KOBA 1E30A 2GB2A 4M3HA 1JOIA 4N4YB 1IBZA 4KO5A 5I6PA 1FFTB 4EF3A 3X1EA 4YSTA 1PZCA 1ZDQA 3QJRB 2BZCA 2HX8A 4QKTA 5TK4A 3ZX1A 1A4BA 3CDZB 1SF5A 1KGYE 3TU6A 4A66A 1BAWA 4BWTA 2XV2A 2QDVA 2MRYA 1AZRA 4E9SA 3S3CB 1ZDSA 1ADWA 2IWFA 4E9RA 4YSOA 2PPDA 2XV0A 5B1JC 3EHBB 1KBWA 1MZYA 2IDQA 4X4KA 1KBVA 2VN3A 5B1KA 1KCBA 2PCFA 1AZCA 3DTUB 1M57B 1NIDA 2XX1A 3OMNB 2ZOOA 3PCYA 4YVNA 1PCSA 3PLYA 4GP8B 1ET5A 2UXTA 1OCZB 1AG0A 2FQEA 1A4AA 3IEAA 3GDCA 5I6OA 1CYXA 1L9SA 2XX0A 3FSVA 4YSUA 1I53A 2PPEA 4N8UA 4DP4X 5TK2A 4E9XA 1N70A 3OM3B 1J9RA 3WNJA 3WG7B 4A2GA 4DPAX 4E9WA 3S3DB 3PAVA 3X1FA 1AQ8A 1GSKA 2CJ3A 2XWZA 1WA2X 4F2FA 3FPXA 4HCIA 1J5DA 4DP8X 4YSPA 2YAOA 4CSZA 2YAFA 1NDTA 1CUOA 3ZIYA 9PCYA 3ABKB 4YSCA 3FQ2A 3CVDA 5B1BB 3AG4B 3T6VA 1AZBA 2X88A 2VMJA 1SFHA 2J56A 2XXGA 2DV6A 2GSMB 1JXGA 1L9QA 2FT8A 4JHUA 1ILUA 3EH4B 1SNRA 2YAEA 4GP5B 1EHKB 2LLNA 2QDWA 4JKNA 2BWDA 3MX0B 3QQXA 3NJKA 2HRHA 1E67A 3SBPA 1AZNA 4BDVA 1JZIA 2FJSA 1PZAA 2PLTA 3UACA 3FSAA 2IH8A 2EINB 3NJNA 3IBOA 2DWTA 1A65A 1T5KA 4HAKA 2YAPA 1JXDA 1A3ZA 1UATA 3ERXA 4UANA 4WTQA 3FS9A 3ZBMA 1ID2A 2X87A 1KYAA 2P80D 3KW7A 3X1BA 4A2HA 1HFUA 2EIMB 4W9ZA 1NPJA 3ABMB 1IUZA 2I85A
chains in the Genus database with same CATH superfamily
4YSSA 3MLPA 4XXDA 4ZMXA 3KPRB 2NZIA 4PGEB 5C7ZA 5IMLA 2X2YA 4L2YA 5JO5B 2HWZH 5C3TA 5EG6C 3CVBA 2NY4B 4N2DA 5CINH 3X1GA 1AD9A 4NPYA 3X3FL 1DL7L 3GJFA 3T65A 1CLYL 4UDUA 5JR1H 3L9RB 3WFCL 2GFBA 2HG5A 2ESVD 1CFNA 3SGJC 3RB7A 1BAFL 2VXSL 5C0AD 2VSCA 1QFWH 4L4VE 1NCTA 4XMLH 2BWQA 4HQQL 3HLAB 4MA8H 4PRHE 1RHHA 3PPSA 5AUMA 1CURA 4F7MA 1AQHA 4Z7UB 4HJGB 3RTLA 3BAIA 4YHLL 3HZYB 1X44A 5KYWA 1JZDC 4HT1H 4XB8A 3KCPB 2YAHA 1XGRA 4XRCA 4I9XA 2DLIA 1RUAH 3Q6FA 4XVOA 5I1LA 1WWAX 5AVUB 2VMCA 3CFJA 1J8RA 5KSBE 3CNKA 1EMTH 4QI3A 4AENA 3ALWA 2SEBA 4H5SB 1NIBA 1JZHA 4WHDA 2X09A 4RWHA 1IBGL 1EQWA 3ZDYF 5IQ7L 3N5AA 3QDGE 4FLHA 2ISDA 3DURA 4Z7IA 4Z95L 3QRFM 2F18A 3U7YH 3BRDA 4D9LL 1X5YA 2E8YA 1CF8H 5C0IB 4ZFFB 4CC0A 4EDXB 3K2UH 4OCSL 2ZOUA 5HI3C 4Z5RA 3R06A 3FF7A 1HQ4B 4KROD 2JLLA 4ZOCA 5D6CA 1ZANH 2IAND 3MLYH 2O4EA 3QUXA 4YVUA 3RWGB 3BJ91 5A2JH 4EI5B 3VWJC 3H9SE 2CRIA 4JCMA 3WLWC 1RJYA 3VU1A 3PWPA 4NO5A 3EOAA 2IWEA 2B4CC 2ZCHH 3TYFB 4PVLA 5CEZD 3MZGB 5D2NA 1PY0A 3EJJX 2OQJA 5HD8D 3VRIA 1HWWA 2PYEA 3BPLB 1LO4L 1U93B 3JWNE 3N40F 2WC7A 1TJHL 3TOPA 1WBYA 5H2BA 5JW4N 2EYSA 4DP9X 1OTUD 1HHGB 5K59E 4LBEB 1HU8A 4B0MB 3VI3F 4AYMC 2VDPL 4RAHA 3WFBL 1ADQL 3RUGE 1MZZA 3RB5A 3MLUL 5HYSG 2JJSC 4JO4L 5LAXA 2QPDB 3T3ME 2I32A 3SQOL 1AHMA 4ZXBB 3W5MA 3AT9A 4X9GA 1J5OL 4DSYA 1ITBB 5KANI 4AKPA 1O7SA 1SY6A 2GTZA 4HD5A 4O2FA 1UVQA 3FOMA 4A6YB 1ZWIB 1E0OB 2CM6A 1IGYA 4IMKA 4KGJA 3V0FA 2YN3A 3VFSA 2R8SL 5TFSL 1XFPA 1AXTL 4TVPD 1AHWA 5C0GB 3HG3A 5JA8B 3TFBA 3RZWA 2C1OB 3V5HB 2Z31A 3FTSA 1TQVA 2WLIA 2YMTA 2HTLD 2R69H 5FCUH 3V9CA 5JPMC 3BYTA 5KSBB 3EOYG 3VQLA 3E8UH 4XVTH 4BZYA 3ULVE 3IF1B 1Y6KR 1PLAA 4P23B 4K7PL 2AGJH 1RSFA 1IAOA 2WXLA 4AQ1A 3RHWK 4B9KC 4LB8A 3ARXA 3WSQL 1XBRA 1PZ5B 1U3HC 2R27A 2XWTB 2WINA 5D2LE 1NANI 3IJYA 4UCFA 5F9JA 5EZOH 2Y6SC 1VPOL 2KKQA 4WK0B 1LQBC 1M42A 5BRPA 3G08B 3Q8BA 2OK0H 1FVCA 1MNUH 5FFGA 4G7SB 5DD3H 2X4RB 4DW2H 5J6GB 3D05A 4N0FB 2WBJB 1EDHA 4RSVA 4UT9A 3RWEA 1U6AH 1QQDA 5JDSB 1H15A 4XAWH 4ZX6A 4FJ6A 3I50H 4H88L 1CDHA 1WC7A 3WTTA 1JVOA 1KCLA 4Y1AE 1XCQB 1XCTA 2MNUA 2VM4A 3KPPA 5ILTL 3KYKL 3BUYB 3L7FA 4M7LT 4FZ8L 4YHML 4GLRI 1EFQA 1N3NA 4MB1A 1QSEE 4Q4IA 3VD1A 3QG7L 3FOLB 3PHQB 4KO7A 4KDVA 3W81A 3FMGH 1JWMA 3DBXA 3IMBA 3TBCA 1M4KA 3GNML 3WBDA 1HHJA 2Z91B 2JFCA 3AQDA 4M43L 3FULA 3VYNA 4HXAH 3A47A 4F15C 3DPDA 4GFTB 4B9CA 3ZGHA 1MKFA 4PB9L 5T3XL 1QBAA 3FNKA 2WM0A 4DGIL 5JQHC 1IRAY 4HBQA 2DTMH 3OKMB 2CBPA 4FQHA 2UXVA 4X0KB 4AGQA 4IIZA 2EDHA 3IJHB 4U1GB 5ESVA 2VM3A 2YC1B 2EZ0D 5I8OL 4LVOB 5EB9A 4WF7A 4OLVL 1CLOL 5JHDE 5D55A 5F96H 2F1AA 1M71A 2WD0A 4FE9A 4IHOB 3ARYA 4NC1C 4P9HH 1CQKA 4OQTH 4A7GF 5GS0H 4MX7B 1IGJA 4BUQA 4J1UA 2AERT 3FQ1A 2VC2L 1WGVA 4EIZC 1T1YA 3NFNA 1GYCA 4AJYV 2EEFA 4XPHL 3FHAA 4QRPE 2XG5A 5IVZB 3TZVB 4YHPB 2DM4A 3MHZA 1QFUL 1Z5YD 1X5AA 2JKWA 2ZYIA 5J11B 1CFQA 1ZGLP 2DLHA 3GIVB 2Y7OA 1HCYA 5B8CC 4NJAH 4LLVB 5D2LB 2AMUA 1Q9WB 2ITDA 3D3VA 1LEIB 5IKCB 4JRYE 3EUUA 3F7LA 2J4WL 4MXVF 2FJHB 1MIMH 1WBZB 3QDMB 2Z1PA 3DK0A 1G7HA 5DMKB 1N9PA 1XGUA 3S48A 4HJ0C 3FB8A 2M1KA 4K9JA 2UX6A 4LGRB 1W2KT 1NMAH 2ADIA 3C60D 1NDGA 3ETTA 3PHAA 4FQLL 1JPSH 3GLEA 3SKJL 1ED3B 5BRZD 1IL1B 4UM9D 5DJAB 3UIZA 4J3OD 3CXFA 4IK7A 3IDJA 4FNSA 2OSYA 4Y1AB 1IGMH 1ZY9A 4HEME 5CP7B 1CK0L 3FK3A 3SE9L 4GKSB 1NL0L 1ILSA 4QRFA 3S36L 5DHMC 4WJG3 1DHKA 1MDAA 2OP4H 2K8QA 5ANMA 5DRWB 3H2WA 5EOCL 2ZF9A 4Z7UF 5GRJL 4AW4A 4P5RA 3O3AA 4GKLA 2Y7MA 4OM1L 1DJGA 1U4FA 1OAQL 3D34A 3OAUH 4LNRB 4AVHA 4LSRH 2NY3C 1M1XB 3CFMA 2AQTA 3L4TA 3VXUE 4UZGA 2CGRH 2AXHA 1I3GL 2NY2D 5HJ3B 3NJFA 1KB5H 3CFBB 2BVYA 4LHUB 2WXRA 2PR4H 3EJZD 3FSZA 4QHNA 5BW7C 3BDYL 1B3JA 1COBA 1YNLL 5BVPH 3PNWB 4OF8A 1PVHA 3OAYK 1MI5D 4YC2B 1CDIA 3UTTA 2X1XR 4JHAL 1IGTB 3CFKB 5DD0L 5K9OA 1OLLA 5D4QA 3MRDB 3QDJE 3QJFA 5D5MA 3QZOA 1ZV9A 5IK3A 3WNLA 3CVCA 3KXFE 4NUGL 3ELQA 2F1EA 4LLMB 1CGXA 3B9KC 1DLFL 4AGOA 5IESH 2D31B 5C0BE 2B1AH 2ARJQ 4W9EC 2C5DC 2AQ1A 2HH0H 2ARJA 5HTSA 2R0KH 3IMRA 2X1WL 2BY1A 4FDWA 2FIKB 4FQXA 1PZCA 1UB6B 3AAZB 1JGUH 3D4YA 4ISVB 3NPSB 4M4PA 5FYKU 5CAYB 2AQPA 3LN5B 3QORA 1TSHA 1SF5A 4MJ2A 3QYCA 5CSZA 5EOQL 4A66A 1TPXC 4JDEB 1S8DB 2RJMA 1DBBL 1T83C 4JRYB 5FAAA 5JMOC 1T03H 2OTWA 3Q3GA 3QWNA 1E9OA 1KZQA 3MUY1 1ZLWK 5DLML 2Y7QB 1IGFL 5GS1C 5KBPA 4R97C 3FQUA 4UT6H 2VRQA 3JSSA 4JDZA 3VH8G 4K7PY 4GMTH 3QUYD 4YNYB 2RQEA 2A9ML 1KBWA 2H1LM 4UTCA 5LDSA 4F57L 1QLFB 4ZODA 3NEOA 5BO1L 2HT4C 1FYTB 2ZX9A 3UZEA 5I76A 1HX0A 3CZFB 5BV7L 1UEYA 1BQUA 3D39D 2ZP0T 3P4NB 5TDNA 1KGWA 2BVEA 4MS8D 1U58A 2C7UB 3E6HB 4KHXH 1UD5A 4F24A 4OI9A 1INDL 1SXCA 1TQCC 4APXB 4MD0B 2WBWB 3HZVB 2Y72A 4QRQA 4YK4C 2NW3B 4L37A 1DJYA 3O2DH 4Z78A 3D51A 2XG4A 4P2QE 5EU4A 3ARGC 4KI5C 3VWJD 3BPCA 3WLWD 2ZOLB 5KSBF 2IIJA 5ITFA 3UZVA 2F54A 4NZ8A 3NA9L 4TYUA 4HKZA 1YQ2A 4AVKA 1MHCA 4ZMWA 4L0YA 3NN8A 4OD2B 4WUUD 2DWYA 4G6FB 1IT9L 2HJKA 1B4JL 4L29B 3AY4A 3RE0A 5ICUA 2W81C 2H32H 2IAMB 3I6LE 3QDJB 1MLCB 5L8KB 4E41E 3PHOB 1E43A 4GKNB 4YHKL 4ETQB 1UOKA 1SFHA 4NQED 4LQFL 3MMEA 3F6IA 2P52A 4HC1L 2MHAB 4JS7A 1U8IB 3COOA 1E8ZA 3MROA 4GT7A 4AQZA 5LGJB 5C0BB 4RX4A 1B0WA 1ZA6A 4M8QA 3PDGA 4Y2DA 1XZ0B 3IRZA 3QO1A 4OIFA 3CH8A 5DRZB 4YHZL 4MGXA 2FJSA 4WHTA 3VFOA 2R2BB 3P69A 3Q6GH 3HR5A 4O2CB 3SY0B 2TRHA 4W70A 5FYJD 1HNYA 2P5WD 2VR9A 1F58L 3RWCB 1A2YA 1QFHA 1KPUA 2LE9A 3QC6X 1JXDA 4FJYA 4IBQA 2IEPA 4QOKA 5HGAB 1SJEB 1A3ZA 4HEPA 4E68A 3ERXA 5D1ZI 3K2IA 5T3ZE 2DDQH 3TO4B 4IS6A 4NZTL 3QXUA 3A6CH 3UAJC 3VXPB 1F11A 4WW2A 5C07A 4Q2ZA 2D3VA 4BCXA 4OLZL 3MV9E 3UPRB 4ELME 3TL5A 5LLIC 1MWAH 5I74B 3EFOB 2EDEA 2NYKA 4XNDA 3QFDA 2ENQA 3L4UA 2PCPB 1ZJAA 5AOZA 3TS8A 1Y0LA 1T2JA 4HHAB 4YHYC 4UOQA 5CP3H 5FM5M 4O00A 4APQC 1A14L 5BZDA 25C8H 3F85A 3VFNB 4DAGH 2NDGA 1VIWA 4OF3A 1VSCA 3AITA 3C5ZA 3CLFL 1G7PB 1U91B 4KY2A 3CZUB 1SM3H 3L54A 2Y6SD 4M5ZH 2B0SH 3G04B 2ZCKH 5F0LB 3EHBC 1B2YA 3TA3D 3X12B 1TZ8A 1XIWC 2CALA 5DGQA 1RUQH 4KKLC 4B53A 1S7SA 4M6MH 4NLHA 1U8MB 2OCFD 3FB6A 1CE1H 1JPTL 4PWIA 3ZUNC 2PP8A 2JV6A 4Y16D 3RI5F 5D96C 1MEXL 3LEXB 4W4OC 1FHNA 1CU4L 5F97E 4F80A 1N6QH 4K3DL 5PAZA 1C08B 4X50A 3MVSA 2E6JA 1UT2A 4E41B 2OMYB 1WD9A 5D2LF 5CJOL 2YPVH 5CMAB 1X4YA 1KN4L 3ZHKA 5IWLA 1DTUA 1WAPA 2EDOA 1OEZW 2VSKB 1TVHA 5I30H 2IG2L 1SXBA 4K2UH 3PGCB 4U6YA 1M2OA 4XN1A 3F84A 3K8MA 1G87A 3WU1A 4BK8A 1V3MA 1I3RB 3KPOA 3QXDA 1L7TH 4TUKH 5JHBA 3PABA 3SQBA 4WSGA 5L2KD 3PJNA 3KWWA 5HVWA 3WIFA 2XNAA 1KBPA 3D08A 4L3AA 3VD9A 3V5DB 1NCHA 1UJTA 1A3RH 4R7XA 3VD7A 1UXWA 3MJ8B 1QFWM 3MSPA 1ZGLB 5E08L 1DQTA 1UASA 3KBPA 4YXKH 3ROLB 3ZDZE 2FL5B 1WWBX 4UOW1 3DV4A 3AG2B 3PWPE 3TVMA 3MV9B 1VF5C 4ELMB 4LASH 5DURB 2O1AA 4FFYL 2JLPA 3QJXA 3FXIC 4NP9A 2ICWI 5D2NE 4YE0A 43C9B 1I9JL 4JZJC 4V1DA 2PYEE 1HL8A 3KNBA 4FMFA 3FUMA 4P2AA 1U8HB 1XGTA 5F89B 4JGJA 1U8QA 4N9GB 5F3HB 3T71A 1W80A 4UQ9A 4HKXA 4ZNCD 2WXOA 3IJ9A 3NJIA 4XXDB 5EZJA 4Y9CA 5E94B 4PV8A 3UAFA 5TDOB 4C57C 5IMLB 1WZMA 1ZKAA 1JXFA 3FUJA 4U05A 2BHZA 1KXHA 1KPVB 4AQEA 1AD9B 4FYSA 4WEBL 1Z9NA 4NPYB 5CGTA 3GJFB 3LPOA 1ZK5A 4R0LC 3T65B 1IC7H 4LEXH 3RLSA 3EOTL 3IDIA 3L9YA 4HJ0D 3SDAA 4JFDA 4JO3L 5CJ5A 1WE5A 5I1KH 5L0QC 1RL1A 3AU1A 2NY5H 1DQQB 3QQDA 3KDPB 1CFNB 5TD4A 2H9GA 3V0IA 4YS4A 4ELDA 2LU3A 5IQOA 2VDRH 1YN7B 4MHHI 2WWKO 4L23A 3SYAA 4DPBX 3LNHA 1HYRC 5B38G 1LLAA 3TT1L 5ICXB 4N2EA 2Y5TA 5CKAA 1CDGA 1NLDL 4PJ5B 3TWCL 1IGCL 4NGHL 2Q1EA 2WNGA 3Q7JA 1SRDA 1QBLH 1TKWA 3O3BA 4Y2NA 1XGRB 1RMFL 4M7ZC 5EDXA 5I1LB 4K94C 3I9IA 4YPJA 4KTYA 3CFJB 2QFRA 3L4WA 3V0WH 4LGPB 3DK2A 3PQYB 1BM3H 2FZ3B 5A43C 4NQDD 3S3PA 5KYXA 2JKTM 1A6ZA 1S7VB 1O5PA 3DURB 5CO1A 3ROOA 1CTNA 3SKOB 1BXAA 3HPLA 5I15H 4PW4A 4D9RE 2GPZA 2IJ0C 5E24E 3HLKA 1GYUA 1KEML 4EUPA 3S3BB 2YA2A 2P48B 2K3HA 2QVIA 3QR2A 4PJ7A 4Z5RB 5ACLA 5KVGE 2ERJC 5D6CB 1KGJA 2DH3A 3VI4B 5LNGA 4N3UA 1NCWL 3ZDZB 3GMOB 1LDPH 4RNRB 5DFAA 3V7AE 1MELA 1RJYB 3BT0A 3PWPB 4NO5B 3W11D 4D0BA 4R26L 2FYYA 4CSPA 5I19L 4I18A 4NHCL 3B9KD 3KLDA 1AJ7L 2WY3B 5DS1A 1FO0L 5CIPA 3V0VB 1F56A 5IFHL 5D2NB 1OTTC 2OQJB 3T2PA 3ULUF 3X3GL 3E2HC 2L3BA 2PYEB 3VWKA 5KS9A 4OB5H 5K1JA 4JQVA 1FVEA 3EYUL 5AW2B 4KWUA 3QNXA 1MVFA 1WA1X 3JQOB 1BQRA 3UO1L 3WUWB 1NLBH 1WBYB 5H2BB 5KW9L 5F7NC 1VFBA 4KMTL 4LVHB 4CU6A 2VQTA 3CDCA 5B7FA 2Q76A 4FNLH 4QGTA 1JDDA 1WFUA 2CBOA 3D69A 3AQXA 1NCBH 4NC2B 4MMZA 3LH9A 2F61A 3MAWA 3OGCA 2IQAA 1TVBA 3RZCA 1WT5A 1A02N 1XO8A 1RZKC 2NSQA 1G0DA 1OAKL 3SGKA 1PMYA 1NCGA 2GTZB 1OM3L 2HFEB 2F74A 3H56A 4O2FB 1GHFH 3CD4A 4AKQA 2HT4D 3QZWB 1HCVA 4Q56A 4YDKL 4XP5L 1NAMB 4NN5C 1IGYB 4NCC1 5IQNA 5HDRA 3WTVA 3VFSB 3PIQA 1ODAA 1OB1A 4HALA 4PD4J 1AHWB 3VM7A 4I0PC 1TEFA 4X6BB 1JJUA 4HKBB 4JG1L 1L4IA 2Z8SA 5DUBA 2UWEA 2HLAA 4JKPL 1I1RA 2O6DA 4QHUB 1IAKA 5JQIB 1AIFA 1OANA 2WLIB 5MEQA 1H3XA 1PSKH 1EZSA 4M61B 3JT2A 5IGXH 1DVXA 1GIGH 1ZSDA 3ARGD 2P47B 1TNMA 5CFHA 4ZUTA 1IAOB 1TJMA 1EH9A 5D4JA 4AQ1B 1OPGL 3QRGL 1GW0A 4HIEA 4NZJA 3FCTA 1F8TH 1VADA 4HC1A 5ENWA 3BAKA 2WINB 1E7UA 3BESR 3D3VE 4YHIA 1RJZA 1CGYA 1DBJH 4YEFA 2OCJA 1MCQA 1OP4A 5ALBL 3E3QC 1XF4B 3CXDH 1S9YB 3EJYD 1U2CA 5HHXL 4IRJB 1TO4A 1GGIH 5MHSD 1Y1DA 4WY7L 4YDIL 1FNSH 2FHCA 3I6KA 4TNWK 2IBGA 2OZ4L 3RWEB 1LE5B 2BXZA 1QQDB 1CWVA 2LVEA 3MKKA 1WC7B 2EDQA 1CE6A 2ZAHA 3ATBA 3RYMA 2EKJA 3QISA 4GIPD 3GEWB 2DWDB 3QUMB 4HKJA 4ZSOB 4NSKA 1IE5A 1XCTB 3VGBA 1AOZA 4G8EB 1FNEA 3L7FB 3NH7L 4KU1A 3KH4A 3MUZ1 4XBEL 5KVFE 1RZIA 1NFDB 3NACH 2D7QA 2D7PA 5ANME 2HPOA 3T3PE 3LMJH 4R6UA 3KLAB 1JWMB 2QKIC 5JW4M 5KJ4A 5LNDA 3AC0A 1YHPA 3UAJD 3TN0B 4NKDA 1QFWI 4FHKA 1JNHA 3FHEA 1HE7A 2CR6A 3VGHA 3P4LA 1F4WL 3F6LA 5GJSH 3KG5A 3UTTE 1CDCA 4WO4A 3PL6A 5ESVB 4M6OL 4O5LH 4ZO7A 5D7LA 4NM4H 5I5JA 4APQD 5C6PB 5D5ME 2DM2A 4JM0A 3D1MC 5DS2A 4R7VA 4JFOA 3OHXB 2B1HL 4FNUA 1RVFH 4IKIA 2F0CA 4P59L 3PWUA 4RDBA 3MBED 4HXBH 3HE7B 3LD8C 1XCXA 3MDJA 4G80B 4EF3A 2P5EA 3EO0A 2IF7A 4J1UB 4OVVA 3MACL 5GRWA 1YMMD 5EFIB 3VXRD 3NFNB 4H8PA 2HX8A 3LXCA 2X9YA 4KKLD 4HFWA 4ELMF 2O93L 1G1KA 1TTBA 5GSRA 2O6FA 3Q1EA 5HHOD 4NNYA 4C56D 4FMKA 4DGVL 3T0WA 3F65A 4U6VL 4ZQKA 1Q9LA 3PF2A 4CA4A 2L7QA 4RGNE 3D4CA 2G5BA 3P4OA 1GGBH 4GJTB 3M8OL 5FV1L 3RL2B 1UGNA 2QQLH 4CBPA 1QZ1A 4V33A 1T0OA 2ITDB 3D3VB 2Y5EA 3VCLB 4CW1A 4I1PA 4OFQA 4BE6A 3DOHA 5BOZG 4L1HA 3QIWB 4RFOL 1AO7B 4XMPH 1I9RL 3T1WA 3KPNB 3VFPA 2YXFA 3KEDA 1CF1A 1OF2A 2DQEL 1XGUB 2ADJB 2PCFA 4IW4C 4WUKL 4B96A 1J8HA 3R4DA 3Q44A 2XHNA 4H8VA 1NDGB 2X4NA 1N18A 3B7YA 1QRND 3GK8H 1S9KC 1EUTA 1SVZA 3SE4A 5FOBA 1F42A 3RKPA 3GDCA 3APFA 3VU2A 2XX0A 5AVZB 1K9TA 2ZKHH 4TSCL 5E6YA 3DIDA 5C0DA 1N70A 3TH4T 5ANMB 1MJJA 3T3PB 4KRPD 1DN2A 3O3AB 2MFNA 4AC4A 5D7SH 1DSWA 5DO2C 5FLUA 1J5IA 3FO1B 5E1IA 4L18A 1SEQH 3L6FA 1BQHG 1LO3L 2F54E 1NMBH 1S7TA 4QHNB 3KL5A 3IDYC 1Y6NR 5DD5L 4R4FH 4AQAB 2ICWA 1AZBA 2G2PA 3S8WA 3UTTB 4XO9A 3PE9A 5IUCA 1KG0A 2CHDA 3U48A 4G42A 3PWNA 2VXTH 3QJFB 5I1EL 4ZUWA 5HXMA 1B2WL 5DJ2A 5IOKA 4N2HA 2K1MA 2X4SB 3O6LH 2BNRD 2QDWA 2NX5B 4AQ8A 2D7OA 3VI4F 1TQBC 4R96A 3GLZA 1JPGA 5F7EH 3ZDZF 4TUJA 1T66C 3BFWA 4NZUH 3Q9QA 4ZT1A 4RA0C 4K55A 4GRLC 1G9NL 3BP6A 2DJSA 2EINB 4G7YH 1OQXA 3NJNA 1CO1A 5D7HA 4ZFOL 3DV6A 7FABL 1QO3A 2YGPA 1WCBA 4FQXB 1R4XA 5EEYA 3O45A 1Q9KA 2AEPL 3GSWA 3ILPA 5C0RH 4WTQA 3QORB 2D7MA 3SSGA 4LSQL 2NY4C 2H0PA 1S7UB 1UM5L 4QOKE 4Y7MA 4PWEA 1E9OB 1HZHH 3HI5H 1B9KA 2WYIA 3O4LD 4MVBC 3FTGB 2VLKA 1HFUA 3VGAB 3V9FA 5CWSB 2Z7ZA 5C07E 3MX0A 3BVWA 3UBHA 2APFA 5I76B 3OKOA 3EYQD 2H45A 4YBLB 3VG0H 5TDNB 3F8UB 3QA3A 4DQOL 4U1NB 2GQHA 4FYRA 4MB4A 3TURA 2Z9TA 3HRZA 4UMGA 4PRBB 3ZT6A 4P3DA 2FR4A 3M1CA 1A6WH 4XPBH 2A3TA 2HPTA 4BZ2A 1ETZB 1AZUA 5FHBH 4XWOD 5GRXG 3S96A 2FBOJ 3X11B 3ZTDC 3BX7C 1EBAA 5DHXB 4LSVL 2XG4B 1JCKA 3BXNA 2NLJB 4HDIB 2OSWA 3S3JA 3UC0L 5KG9A 5F3BB 4M03A 5FDYA 3N6YA 3WDHA 4PS4H 1TEGA 2OA9A 5ITFB 3UZVB 4U1MB 1AG6A 2Y36L 5DJ0B 4BH8A 1GGCH 1MHCB 2HKFL 3FO9A 5D71H 5DZ9A 1BBJA 2B08A 3NN8B 4MXQC 4Q52A 3HW7A 5JZ7C 4DKDC 3QSKB 3EZJB 4NQUA 4NWUH 5KSAC 1JBJA 4KUZH 1L9PA 4LCYA 3BKJH 3IMSA 4EI5C 5EEUA 2BC4A 4IBZA 4L3CA 2X4OA 1AE6H 4QHKI 5F7KC 1QVOB 1RZ7H 2UVFA 5IW3A 2KDGA 3SGEH 3G6DL 4R8WH 3FT2B 1F4YL 2XRAH 3MJWA 1RURH 3MROB 4BRJA 1KBGH 4M02A 2QSCL 3TCLA 5T3XE 3QO1B 5ESAB 1T0MB 3FYIB 5JIQA 3CFQA 4CC1A 4ZX5A 4WHTB 1MRFH 2ODIA 2IDFA 2R4RL 5EO0B 4BFFA 4FEMA 4O9HH 4XP4L 4FZEL 2BCKA 1QWUA 2N7BA 3BPNB 4PCTA 4AGLA 2AC0A 5C1MB 1A2YB 4HLEA 3MLSL 4M7JH 4QOKB 3WELA 3APCA 2K6ZA 3BIKB 3MOQA 1JZ3A 2A9NL 1EO8H 1NFDF 5E2WL 4QHLB 2J44A 4ZXBC 1Z3GH 3B2UC 4I0PD 5DC4B 1T2QH 3MLRL 2L7UA 4GIOA 4IS6B 5L4MA 3K80A 4AX3A 4WW2B 5C07B 4DJMA 1CXKA 3S9DB 1EHXA 5B4MC 1BZ9B 1ODUA 4YHNA 3P30H 3MO1A 4UT7L 5IY5B 4MAZA 4CU8A 2UZIL 1MFAH 4X8CA 3SYQA 1MXGA 2VKXA 2IDTA 4V1DE 4DTGL 2DQCH 1CMOA 1NBVL 2OL3L 3CFDA 2ATPB 2G30A 5DQJB 1UURA 4IBYA 1L9OA 5AYQA 4PJBA 2BS9A 2HAZA 4XVJH 3NIFE 1KULA 3BUIA 2E59A 1CVSC 1M7IA 4GI9A 4NERA 3G3LA 1GZHA 3FRUA 2VN5A 2IFFL 3HIZA 4P23C 2PPCA 2XU9A 3I2CL 2BP8A 5DVKA 5AFAA 2X0UA 1CD9B 4JFDE 2NW2A 4LCWA 1HL4A 4NXSA 1QBML 1X9UA 2FGWL 2VERN 2VAAA 4FNRA 3FU8A 5ECJE 3I9AA 4H0HB 1LM8V 4D7PA 4ZYKA 1FA4A 1MCEA 2IGLA 2DIJA 1AFVL 5SX4H 1OL0A 2X9XA 1JZ2A 3OAZK 4U1JB 15C8L 4PAZA 3OLEA 5AG9A 4KBPA 5EF0A 4DIXA 4XR8C 1AZZC 3IU4H 3APDA 5J12C 4BELD 1FNFA 2WBJC 2VDKH 1S5HA 3ZKXB 2DY2A 4R4NC 3JWNC 4X5WB 3GXPA 1E42A 3OXRA 4HUCA 4X5XB 3FQ4A 2R1WA 2D0HA 4U6HA 3KPOB 1RIUH 2VR4A 4H13C 2MQGA 1WHPA 3L1FA 3SQBB 5C0CB 2CO7A 4LLAA 1TU2A 4W9KC 3KWWB 4J6RL 5E6IA 2KHAA 1AKJA 3HHSB 3MRJA 4P9ML 4AYID 2XNAB 4DP7X 4FQJL 4BZ1H 5EBMA 5F7HA 5CGMA 3RX7A 2VZ1A 1ZEAH 1U42A 3DARA 3SJVD 4PJ7E 3UTSB 1UXWB 1UUSA 3L4XA 2CUIA 3SE6A 4QRRA 1XGZA 3T3PF 1JN6A 3LRLA 2KS0A 3QNYB 4PSRA 1EEZA 3TVMB 3ZTNH 4U4BA 2C9SA 3KCWA 5C08A 4OFVA 1H0DA 1AHKA 1XT5A 2BIQA 4JO1H 1SLXA 2WB1A 4DK5A 5KAQF 1T89A 3KNBB 5DT1L 5KS9E 2ZXQA 4LVOC 3JWDC 3ZE1E 3Q8AA 1U8QB 3L5HA 1UYWL 2BINA 4YDZA 4ZD3L 1CLZH 2VIRB 2NT1A 3QRLA 5F1KC 1WFTA 4U1SA 3NIFB 5CKGA 5CZRA 1D5ZA 5EZJB 1M3JA 1OTSC 1WAEA 4PV8B 2Z7UA 1J1OH 1OK0A 5CN1A 2OYLA 3UEZA 4IOIA 4NN7B 2CO6A 4U2ZA 4AQEB 2P26A 3BD3A 4AV5A 2PCYA 3ZTJG 4UTAL 2W9DH 2OMWB 1HWHB 1U3NA 4BFIA 3IDIB 3BN3B 3SDAB 3D12B 4JFDB 5J11C 2AXJA 4OM0H 1JZ6A 4JR9L 4JHVA 3AU1B 2HX9A 5I8KL 1NC4A 2FEEI 3QQDB 5TE7H 3LHAA 4FKKA 5TQ0H 4ODHH 5C09A 4P5MA 1X5ZA 2QVTA 3WMSA 4L5FL 4X8XA 4M1DL 5BZXA 4G8GA 3RDJA 1CBVH 1FDLH 4AYDC 4Z8FH 3U0PA 2Y5TB 1C7SA 2CKBB 5F8RC 3EO9L 5JQ6H 1SHWA 1CR9L 2OMXA 3II2A 5GXBB 2UWEE 3D85D 1TKWB 3O3BB 1A7NL 3S4SA 2AI0L 4FQ1H 3AB0B 2CO1A 1KCSH 1AGDB 5DO2D 5AB1A 2OMNA 1SOSA 1P4IH 3GEFA 4V11A 2UZPA 4ZMLA 2RGSA 1ZTXH 4FC3E 3VSVA 1PAMA 2A9DA 2K8MA 2QTVA 1A6ZB 2Y2WA 2NZ9C 3QCTH 4EZJA 4X8JA 1R5VA 2BH0A 2AAAA 1WO2A 4LOUC 3C08L 2BSBA 5JXAL 2LLGA 4R7NA 3UJIL 4AVIA 4PRNA 2X2UA 1NICA 1B3IA 3P77A 1OY3B 2AJVL 1F1DA 1J0KA 2C8NA 2K78A 1Y18B 1AQKL 2R69A 1B0GB 4D0BB 5TPWH 4R9HA 3T8XB 4I18B 4L1TA 3UGUA 4D8OA 1T66D 2B5IC 5CIPB 4RH4A 4YC2C 4GRLD 4TM9A 2YMOA 2G2RA 1FL3B 5KS9B 2P43B 3VWKB 4BHUI 5HYJB 1LO5B 1FVEB 3TBYA 4HIXL 3WFDL 3ZE1B 1R3JA 5DQDL 4XMKH 3ELAT 1IC4H 1U8JA 2BNQA 3AM8A 4D9QE 1O75A 3KPRD 2H0EA 1BG1A 3RI5K 4I3RH 3D4GA 1V7NL 4TXVB 3A0OA 3N85H 2EEBA 2NY4D 2XETA 4I3SL 3D69B 1P84J 4ZMAT 2EJ1A 2GABA 2VLJA 5HHQA 1LYQA 1PNCA 4MVBD 2BOCA 2IQAB 4P5SA 1TVBB 3RU8H 1KJVA 4QAMB 2EQDA 4BQBA 3NPSC 2FYVA 2AJSH 4NAMA 3QIUB 3S98A 4ENEC 3OF6D 2OCCB 1G5GA 3U2SB 1BF5A 4TF4A 1CLVA 2FQDA 4O58H 3PAUA 5FUOL 3GSXA 3VE0B 1LGVA 2X4UA 4P2YA 5D7LE 2J43A 3ZTJH 4F27A 3HFFA 2I07A 3DUSB 4Z7VA 2JB6A 2WLNA 4RETB 3TBVB 3ZRFC 4DN3H 1OAYL 1X5FA 2UWEB 5DUBB 5GZNC 3RDTC 4KXAA 1AI1H 4AUYA 4BKSC 1KY6A 1AIFB 5E51A 2YD3A 1JDAA 1Q0XH 2P5EE 1PU0A 1UM6L 4JMXA 4PMEA 1ZSDB 4ZO6A 5TDPB 4UINH 4WW2F 3B4NA 5E9DD 4MJ5A 3LH2H 3JWOL 4ZUTB 2H1PL 4QRUB 1YY8A 2IWFA 3QQ4A 3K3QA 4YSOA 2HA1A 2A73B 4XWGL 2N1KA 3FCTB 4MXQD 5JZ7D 1VADB 3L3DA 4F7EB 5ENWB 2Y23A 3QUZC 5ACMA 3UG3A 1AGFA 2FEDD 4S2SA 5GGUA 1D9KB 2Y3AA 1QI3A 3MREA 4I0CC 5GISL 4GB9A 2FB4H 2XDHA 2Q8AL 1E6JL 1UWXK 2J6WA 4PUBL 4OQTA 1ET5A 5GIRA 2CDGB 2AQ2A 4FG6C 1LEKA 2Q86B 3UMNA 4UQIM 1ORQA 4DZ8A 2YUVA 1J8HE 2FQEA 3MLWH 4LCVA 5HHNA 5CCKH 3I6KB 1WFNA 3QJZA 4MD5A 4G6ML 3LV3A 4Y0GA 4TPRL 2EE3A 3JUYA 4FABH 1EPFA 1RUKL 1QSVA 4LVNB 3OB0H 3BMWA 3K6FA 1UXLA 2VDMH 1UJ3B 3D6GA 4UUJB 4F93B 1GZPA 4HKJB 5LCVA 3LH8A 1FNEB 2ORBL 5FYKH 1M6OA 3BKMH 4Y4KC 3FW6A 4MB5A 5CUSL 5SWQB 1KELL 4U1IA 4Y89A 3KS0H 3P0VL 3RPKA 2XQBL 3MZTA 3NMEA 1NBQA 4MDRA 4ZXBD 1G43A 3NEEA 3BAWA 1KZYA 2C3VA 5D1ZB 2K7QA 3B2UD 1H8LA 2NY1B 3RWDA 1X4XA 3AG4B 4N0YL 3IFNL 4NKDB 2X88A 3EUDA 3L4ZA 3MPCA 2WP3T 1CD0A 1IVLA 4OZGB 2BXYA 5B4MD 5E99H 3ZRCC 3CIAA 4ZMOA 2FT8A 5EBGA 2OMUA 5D1QB 2CIKB 2YAEA 4DOHE 4WO4B 4M5TA 4XVUC 1EAOA 2R2EA 3PL6B 3ESNA 5D72L 2PTVA 5D7LB 2HRHA 3DVGB 1DSFH 4NJ9L 4JFOB 3PWUB 5I74C 1FI8C 2P46B 2E7DA 4I1NB 4MAUH 4UQ3B 1HXKA 2P5EB 2CZNA 4P23D 3S5LG 4N22A 4WI0A 1KB5A 4HFWB 1JGVH 1KNOA 4LCCA 3MR9A 2DWEA 4NNYB 4ZQKB 2WZ5A 1Q9LB 4PTUA 4XC1L 2DI7A 4JN1L 4KHTL 3LPWA 1D7CA 2E6QA 1AGCA 2EIEA 1MUJA 1G4RA 2KERA 2ZJSL 3BSGA 5IROC 3BAEL 4AUUA 4CW1B 2YJQA 2YD6A 5JLZA 3NIFF 3MOBL 1ZE3C 5IB4B 1GS6X 3S5YA 5AW6B 1CTMA 5DR5L 3EGDB 1OGAA 4WEMB 2HG0A 3VFPB 2VLKE 3UH8A 2GW5A 2PCFB 4ETYA 2WBJD 2EE0A 2VLLA 3BH9A 3WCYA 4R4ND 4I48B 1KLUB 4ZAKC 3TBBA 1PFOA 2X4NB 4URKA 5D8JH 1MRDL 2X2IA 3H3BC 2FQGA 2GJZA 5FOBB 4KX9A 1CICA 3HCVB 4PLOB 3QVAA 4PG9B 1H3GA 4YXHH 5C0DB 3NCMA 3HUJB 3DO7A 2YPLB 3IWVA 4K3HA 3W1ZA 3APNA 4WKZB 3BVDB 2VE6B 5A16B 1IU1A 5FM5O 2GITB 4W9HC 2DEWX 1KUMA 5B3SB 1KCVH 1KJ2L 4FP8H 1R3LA 2YKKA 1WITA 3IMUA 5IV2A 2EDBA 1HDMB 1S7TB 1I1CA 1ML0A 1LO2H 1PLGL 3AREB 1U9KA 4ONGL 4DOHB 2ICWB 3ZO0A 1VESA 2ZUXA 4UNIA 1FZMA 1MCLA 4OFIA 1SYVB 3D2UB 2GC7C 1BLNA 1KG0B 4XPAH 4GW1A 2AS5M 2CHWA 2QJDA 3PWNB 3WJJA 4ZUWB 4M6AA 2BNUB 3D09A 3DBSA 2LFGA 3S37H 2QQNH 1XB3A 1SN0A 3QJUB 4R96B 1JGEB 3RG1C 2ENYA 1ZLEA 3N55A 1E65A 4ZJ9A 1GRWA 3RURA 3BP6B 5GS2D 1LP9A 2VDOB 1MW2A 1U8PB 3TZVD 3DV6B 4Z0BL 4K7PX 1JF6A 1U8CB 2APBA 5KS9F 2XVKA 4PPTA 5FFOA 2CWRA 2E56A 3O45B 1Q9KB 4PBDA 3ZE1F 3ILPB 1MF2H 2CLZA 4N25A 4B50A 1HEJC 1JE6A 2Z7YA 4N8VB 4PRAA 3UPCA 2YD4A 3QDMD 4EQ3A 5IFAH 1L7IL 1INEH 3ZK0A 4O02L 5HHVL 1TZIA 3LOWA 5L7XH 2VLKB 4KZEH 4FHBD 4TUOB 1SUHA 1K6QL 3O41A 4OF0A 1MPAH 4TLSA 5EORL 1WD8A 3WNKA 4Y1AD 2KL6A 1CGSH 3T0AA 4CDHA 4S1RL 4S1DC 4F9PA 4DH2A 1TLKA 5KVDL 4H44C 4WEUD 3V4VL 3F64A 5CLZA 2JSFA 4LPTA 2CA4A 2ENJA 4KJPC 4NHUA 4LF3A 4PJBE 3DPBA 4P3DB 2HP4A 3OKKA 2FR4B 1BFVL 1IZJA 1QKZL 3DVNA 4FFWD 1JAEA 2W94A 1HHIB 1JZFA 1PLBA 3FCSA 4UI2A 3TNMA 1XAUA 4KXZH 2UWEF 3WHE1 5INDA 2VZ3A 1JF1A 1G9HA 5BUAA 3HFML 1RCYA 3BXNB 1D5IL 3JWNG 2DQDH 5KG9B 5IB2B 3NA4A 4LHUD 1ASPA 2X3BA 4HJJH 4AMWA 4ALAC 1W8OA 1MAML 4LCWE 3FQYA 4LU5H 4F8NA 1HE8A 1YEDA 5E6SB 5J89A 3WHXA 4AMKL 2VZTA 4KH9A 4OJFL 4G8IA 5CP3A 1GS7A 4X7DC 1ZT1B 3QUXC 1GPOH 4BHUA 3H4FA 4NZRH 1J87A 4B60A 3D06A 4DN4H 4LCYB 4XGZA 5DK0B 2DYPB 2WPGA 3LZOA 3VH8A 2VZSA 4L3CB 2X4OB 2GSIA 1W0WA 4OZ4A 2PWFA 2ICES 4QT5A 3O6MH 5D2NC 2EYRA 4HZ1A 3ULAB 1FF5A 8CGTA 4U3XA 2J1WA 3F01A 1E4WL 2NTFA 3RWJA 2CH8A 4M4RA 1DQMH 2GBVA 2C34A 2CJSA 4LVHC 3H9YA 1MFDL 1QUPA 2H4EA 2JK5B 2BCKB 3GTVA 4JRYD 3PJSA 2AK4A 3QS3A 4K8RC 3UBGA 4EN3A 1WK0A 3KR3L 5H94A 2LHAA 4XNZB 3GFUA 4LDEB 3TFKC 1SF3A 3UERA 5J1AA 2D03L 4XCFL 2VUOA 1KLFA 4QRRE 4QO1B 3H42H 1AS7A 3PGDA 5GZND 2O5NA 3FQTA 4JHWL 5BXFA 1MJUH 2J8UB 3CDGA 1FYTD 2F7IA 5C08E 4YHNB 2ZPKH 1BXXA 4ZW5A 4DEPB 3MO1B 1T7ZA 4OZGF 5DJ6A 5TE6H 1F5WA 3I6GA 5I66A 3ZE0E 3CFDB 1XVSA 1AHWC 1Q4NX 1H3UA 4J3XA 5IMOA 4PJBB 2BIIA 4G82A 3S36X 4EE2A 1I8IA 3WL9A 1YUHB 3ME0B 3EJTA 3IJEB 5AZEL 5ID1A 3FRUB 2DQTH 4KY1H 3ULUD 2BP8B 4AQ1C 4F58H 3MRFB 4FG6D 1D7FA 3IGUA 2ZWKA 4LARH 1ZLVH 3WKQA 4LLDA 4JPSA 1EFXA 2NW2B 4LCWB 2BM3A 2CLRA 3ULSA 2VAAB 4G6FD 2C3WA 4ZYKB 3CH1A 5CZVL 1NBZB 2IAMD 3IM1A 3QDJD 4YX2L 5C09E 1K5WA 3LKQA 5F1NB 4G8GE 1TZGL 4B7LA 1YQVL 4KO6A 2YXWA 4M1CC 4Q58C 2B1OA 4IRJC 3JWNH 3EZ8A 4G8FB 3SZKC 2Q6WA 3G5XB 4W9CC 3R1GH 2WNXA 3UYRH 5C0BD 3N91A 3ZL4H 5INCB 1S5HB 3SPCA 4LSUH 4QTHB 5K1VA 1RK1A 4EBQL 3M46A 4NO2A 3IAGC 4LHUG 1ECZA 4YE4L 1Q8MA 4QEGA 3OXRB 2EEXA 2R1WB 2EE9A 3WIIH 3M86A 4U6HB 3LZPA 4PRDA 4RMVA 2D4FA 4IKLA 4QGYA 4JUTA 3ISYA 5L6YL 4JFYB 5E6IB 3P0YL 1Z5HA 1A8ZA 3MRJB 3QT2A 4IHBA 4QXWA 5I6MA 1RZ8B 4OZFG 1N2RA 3R7QA 1I8AA 1NUGA 4F7CB 4XVUD 1YYMH 3INOA 3LRHA 5ADOH 1BOYA 5KEZA 1T1XB 2C9UA 2ILLA 4X99A 3TO4D 1DVQA 4X9FA 3PAZA 4P5TA 4QRRB 3HUJF 1JN6B 3RPBA 2P7TA 1DR9A 5A2CA 2X4TA 4BUHA 3OLGA 3VD0A 4YBQC 4IJTA 3HRPA 3SPGA 2HRLA 2RCSL 5C08B 4C83A 5FPIA 1J5HA 2FK9A 5GGTH 4HGKC 2WTOA 4YH6A 1JZ7A 5L88H 4E0RA 3HI6L 1DVYA 1FSKC 4MCYA 3ZE0B 1BF8A 2DQJH 1FH5H 3UYPA 1TR7A 2GVYA 4LSSL 4WVRA 2AXWA 1H5BA 3OHXC 2BNQE 3ULVH 4U1SB 3RIFF 3OWRA 2JJWA 3HE7C 4XZ4A 5GRVL 1N5YL 2D8KA 5DVLA 1QLEH 5IROD 4EN2A 3RA7L 4IOIB 3PHSA 2CO6B 1GY2A 2OMBA 1NINA 2VLJE 1ASOA 3CV5A 2MCMA 1NGWA 1KCRL 4ODVL 2F7OA 3QNZB 2DLFL 1EXUA 2F19L 4BFIB 2PTUA 3Q8EA 4WU5A 1WSST 5A2KH 5J7CC 1KB3A 5GJTH 4F7EA 3O6FA 5DUML 1BV8A 4A39A 2PO6A 1E30A 4JFZL 4E5XG 3I6LD 3NCJL 4N6RA 1G9ML 4E41D 1OT1A 1PDKA 5FW6A 1W72L 5J0BA 4G8GB 2GUOA 2XWRA 3QJRB 1WF5A 2BSTA 4RQQB 3U0PB 4WO0A 1RP8A 3ZYZA 1ZTMA 1KJ2A 2X4QA 1KGYE 4M48L 4LZKA 4UNTA 4KRNA 4Z7VE 2XV2A 2QDVA 2ZZUT 2OMXB 2QHRL 1XSIA 4F3FB 5IBTH 3LEYL 5K93A 3ARWA 3RJDA 4H8WL 4KPHH 4HLZG 4XO5A 3RWFA 3SDXA 2AMGA 2DQFA 3LXBA 2VN3A 3B9VA 4DGYL 3RJQB 2MCPL 2DJ4A 4X8JB 1R5VB 3W3BA 3HG2A 2XX1A 3FQWA 3HVNA 1FQ9C 2H2PC 3DETC 5LGYA 3HI1A 3IKCA 3ETBJ 5DJ8A 2W92A 1J7VR 4ZMPA 2ED7A 3STLA 4PRNB 4TOYL 1BQLL 1JV5A 2ROYA 1HINH 3P77B 2R1YB 1BPLB 4NRXB 1J10A 1YEGL 3MV9D 4PJHB 5DURD 2OI9C 2PPEA 2ITCA 3QQ3B 2RALA 5AWNL 2WVVA 5DD6B 5T5NG 3BSZH 3V6FA 2VXUL 4OZFH 1FZKA 4RESB 1KGXA 2G2RB 3E9TA 3AU0A 4PJCA 3WN5B 3MLZL 1KJMA 3TBYB 2BIPA 3GHEL 4UYPA 1R3JB 3EFDL 5AVTB 1J5DA 3NESA 1U8JB 2MKLC 3FN0L 2Y07L 2DBLH 3D5OF 2H3KA 4GO9A 1YDPA 1PYWA 4PYGA 3QCVH 1T21A 1FL5A 3FQ2A 3CVDA 3FT4A 5ABDE 5DJXA 4U31A 3J2PA 3OAWA 2PWEA 4ZX4A 2VXQL 2VLJB 1OAXL 4CBZA 2G3ZA 1CG9B 5HDBE 5HHQB 4UTBH 2AK1L 1ACZA 5C0JA 5HHPA 4FQXC 4IRZL 1KJVB 4DVRH 3IFOB 5A1AA 1GXEA 5J56B 2CO4A 4HSQA 4YGAB 1NQBA 2IQ9H 3QORC 1A6TA 2L7JA 1PJWA 1NFKA 3MV7A 4BDVA 4WCYH 1A6VH 1KTRL 4PJ5D 3VGAC 5T1DH 2FATL 6CGTA 3C5JB 3FFCA 2I07B 3RVUC 1EX0A 1MLBA 1JS4A 1FAIL 3IXAA 3EBHA 3PQYD 1KXTA 3UZEC 1TSRA 1DQDL 4ODSL 2GSGA 2KZ1B 2CDEA 3OKDB 2E9JA 5TGBA 3W5NA 4YBLC 4IGBA 2J8UF 5D70H 3I3BA 4PJ9B 1YY8B 3QQ4B 3L3IA 1OCWL 4M56A 4HULB 1JDCA 1YEIH 5HYQA 5HYSB 1OE3A 1JRHH 1XEDA 1AGFB 2BMKB 4S2SB 4K3JL 4PJBF 3UJTL 4PP2B 3NJHA 3V4PL 3ES6A 3TIDA 4HLZH 1OGAE 1V55B 4TQHA 5GIRB 3BKYH 2AZUA 1A6AA 1N0LB 1LEKB 4I9WE 4NZDA 5E0QA 3PGFL 3ZL2A 4DZ8B 3MNWA 4K5MA 2PYED 5AW8B 1A6UH 2FTAA 3K5RA 3JZYA 1CFMA 4GSDL 1JZ8A 3CVIH 3CZLA 5FGSA 3AY4C 3RKDC 3B2MA 2BVTA 2F5BH 1IMHC 3G5WA 1GZPB 1QFPA 2W65B 3QWQB 3DXAA 4NO0A 4OLWL 1X5MA 1PKQA 2XY2A 3SDYL 3DYOA 5LUMA 3ATEA 4Y5VA 4LCUA 2JNZA 4K8RD 4U1IB 4TSBH 5AYUH 4HG4J 4DVBA 1WP6A 3KHOA 1WZ1L 3C5SA 5I16B 3TFKD 1INQA 4S0SD 5JW5A 5HDBB 1BSIA 2C3VB 1QNZL 2EEAA 1X9LA 4R2GB 3ARTA 4WGWB 1V7MH 2EH8L 5A7EA 3CVHL 5ICYA 3CC5B 1V3KA 3F00A 1PD1A 3NZSA 4OF6A 2P80A 3V2AR 3BPNC 1F4HA 4JJ5A 3UJJL 5KVEL 5I18L 2GTWA 1FP5A 4I13B 4D0CA 5CJXA 1GC1C 1T4KB 2OMUB 1RFDH 4J2QA 5EULV 4AYEC 1TTCA 5K1NA 5M94B 3LTVA 2DQUL 3SBWA 2XKNB 5G55A 3WO4B 1XCWA 3BI9X 3E6FB 3MODL 4WW2C 1G94A 1NCAL 2V5SA 5C2BL 2EABA 3DGGB 1FV1A 3MKGA 1DFXA 1UHVA 1ANUA 5MP6L 1KDJA 1BZ7B 4ONHA 3BO8B 5JORA 3QFJA 4DK6A 5EUOA 3G7TA 3JV4A 4LRIA 5E1AA 1LP9E 1KB5B 1NCUA 2VYRE 3KWVA 4XPFH 4D9RD 1Z9SA 4HH9B 4KAQL 1J8KA 3KWUA 1BD2A 1F6FB 4YAQB 4XCCL 1U3YA 3Q1SL 3CWGA 5DQ9B 3S88L 3ZE0F 1C5BH 3RNKB 2WKOF 1MAJA 5E2UL 1MUJB 3EDFA 1ZCRA 5EA0H 3L3KB 2R39A 1UOVA 4GQ9H 1P4BH 4MJIA 1FZJA 4YPGA 2HB0A 3O9WB 4O2EA 2VW6A 2NRDA 2XA8H 4IRJD 1SLVA 5GZOA 3FTUA 1ROCA 4ZZKA 3SE3A 2AKRA 2VLLB 3BH9B 2VL5B 3II3A 4NNPH 3A67H 1SDDA 2QMJA 3P2TA 3H85A 1BA9A 1OOWA 1R3IL 2F6AA 3CK0L 4JDTH 3WTXA 3PDOA 1BJ8A 4ZTPL 5J9PA 1GA2A 2GJZB 4FXTA 5AW9B 2YD2A 2Y0SA 3RL1A 2A4EA 5IMMA 4EOWL 2F8VA 5IB3A 1I85A 1CICB 1X6LA 2BFVH 3CQQA 3EGSA 4PEEA 1KOAA 4YO0A 3H6AA 5IWLC 4UQEA 3ZKXC 3C6SA 5GGQL 5F7AA 2XFGB 3T2OA 4M8RA 5I28A 4G43B 3DO7B 1XXDC 4CMMA 1MQKL 3F5WB 3IU3A 3V0EA 4HH8A 4JPQA 3LX9A 5CINL 1HAUA 2YD1A 3TN0D 2DQGH 2ADYA 3FBKA 3GS0A 1WEJL 1OLZA 3N44B 5MEOB 2JE8A 5DC2A 1OP5K 4CN6A 3QR1A 4XP1L 1NH6A 1XGYL 3BZ4A 1HYSC 3CFIC 5IV2B 3QCUH 3WIHH 1X7TA 1ZAGA 4I4WA 5T3ZH 3OZ9H 4X7CC 3TPUA 1JZEA 5ANHA 1CB4A 5LWYL 3EADA 4K5OA 2IDSA 1BLNB 3VRLE 1UWGH 4JPWL 2COVD 1NGPH 3C6EA 2YQBA 4LIQE 5MI0B 1BQSA 4XXCA 3TVMC 3TA4D 3HE7D 4HUNB 4PQXA 3THMH 2RIKA 2FH8A 3HMXL 3PU7A 2OYPA 1K2DA 4OLEA 4PJHF 2EXTA 2ZX8A 1KEGH 3KW8A 3L08A 3JV6B 4P3WA 4BIKA 1EMTL 1NC2A 2IWKA 3HNTH 4MMXA 3HKFA 5FS5A 2X0WA 3IS0X 1BJ1J 2WQUA 3O4OB 4G1EA 1AC0A 1EZLA 5IMKA 3U7YL 2J88L 2EVJA 3GJFH 1CF8L 2CLZB 3D3VD 1SPDA 2GHWB 5C0FA 2AK4E 3P11L 1X7SA 3QIWD 1AO7D 4OFDA 4PRAB 2H3XC 2QGBA 2TRYA 1BQHA 3I3DA 2H1XA 1Q94A 2Z6FA 1TZIB 3FH8A 1SXAA 4PHXA 3SDAC 4UNVA 4CAGA 5FUZH 1NCCL 3DMMA 1XBDA 4HLJA 5KSUA 5T1KA 3U2IA 3A4AA 4PTTA 1F4AA 2NXZB 4RAVA 4HOXA 4ZUVB 1OWRM 1RPUA 4FQCH 5DYFA 4HIJA 4IMLB 4XNYL 2GI0A 5L8JB 6FABH 2TAAA 3FTZA 4LHQB 1KENL 4Z1PA 4NHUB 3DPBB 2MOGA 3TT3H 2FUTA 1WFMA 3V7AG 4NI6A 1Z6JT 3AB0C 3EYSH 3NFSL 1VFUA 2VH5L 3GT6A 3VFVB 3DVNB 4R7LA 4DPCX 3TNMB 3BKCH 1W8EA 3FCSB 4NRYB 3OBAA 5F0PB 3HS0B 2APXA 2DMGA 3EJUA 1MWAB 4OV6F 4HHGA 1UFUA 2L04A 4LEOA 1R5IA 5BZZA 5EZLA 1KTDA 3P2DA 3UTTD 4HCGA 2EH7L 2CM5A 1AR1C 4EI0A 4MJ6A 1I9EA 3F7VA 3P40A 2XYBA 3F7PC 2GJPA 2VXQA 4R83A 3VH8B 3U1QA 3K72A 2NX5D 2UY6A 4DKFL 3BP4A 3B9AA 2YQGA 5HDWA 4IRZA 1W0WB 4ZS6D 3EYFA 4I18C 4JFVA 2E7CA 4L2LA 4N3TA 4QT5B 1MJ8H 3ORJA 2P8MA 3EF7A 1MCRA 3VWKC 1MFBH 3WFEL 5G2NA 2GC4C 3QPXH 4W9FC 4E9VA 4XVTL 3PPEA 5L8LB 4OCRL 1F3DJ 4JVWA 2DWSA 4FQXD 5DDHA 5HVGB 3HB3B 3RWJB 1GYAA 4K8RH 2AGJL 2B20A 3NJGA 2ZT9C 3QORD 2NDFA 4X80H 2AQSA 3HMWH 3NJVA 2ZYSA 3PJSB 4F20A 4EN3B 5FW8A 1VFOA 1SY6H 5D4IA 5H94B 2CAKA 1C5DA 4PCYA 5BV7C 5SWZA 2J1ZA 4A67A 4QTIL 1JGDB 3TYGH 3H3PL 3RZCC 3LNGA 4B9PA 1D7DA 5J1AB 1WT5C 1ID5I 1KLFB 4FD0A 2G60L 3VSTA 3RVUD 4IIQA 3VD4A 3QIUC 3SGKC 3CFNA 1SYSA 3ARDB 4YDLB 3GYRA 3PGDB 5HDBF 5BXFB 5E7BA 4FLOA 4AH2A 1EV2E 3CDGB 3OX8B 4B7IA 1FUNA 3EDDA 3UADA 3DJRA 3RGVA 2X7LA 3Q8CA 5SWSA 5DJ6B 3I6GB 3MNVA 3LRKA 1MCPH 2X6AA 3V4PA 3PNRB 4ZPTB 2AQ3A 3SPHA 2AF2A 5DK2A 3QAQA 5IMOB 5A6IA 1HH6B 2O26U 3Q2WA 1AR2A 5AOIA 1O9VA 4H20L 3GBLA 3ML9A 3ET9F 4NUJA 4AL8C 4FQ2L 4U6XA 4DUXA 4Q6IB 2MQ3A 3WD5H 3T77A 1E8YA 1BZOA 1XSKA 2Z65C 5IHUH 3U46B 3MA9H 1ZT7A 4J4PA 1NCIA 4ZFGL 4Y2OA 4J28A 3GF8A 3VFRA 2CRMA 4M3HA 4LLDB 1EFXB 4YSTA 1G5AA 4G6JH 2CLRB 3ULSB 1RUPL 4PG2A 4PWFA 5TK4A 4TL5A 1AP2B 1YEKL 2G0LA 3AQZA 5EN2A 4PWHA 3NDYE 1HHKA 4UT9H 5J1SC 5IF0A 1ADWA 1UWEH 4CVWA 1XMWA 3CVHA 2Q6WB 5DI8A 2D7TH 2WTPA 4E9RA 1KBBA 4GW5B 2PPDA 4KKCC 4RWYH 4P9HL 5FKPA 1JHLL 1HSBB 1RK1B 2EO9A 4XOAA 3CSPA 2W95A 4NO2B 1CTOA 5GS0L 4LVNC 1C7TA 4TULH 2DTSA 5GGSY 1KCBA 2OFQA 3MYJB 4BGLA 3WO3B 1UJ3C 1YPZA 2ZOOA 3SDXE 4PRDB 3EIFA 3BP7A 1EAQA 2O6CA 2PXYA 3UPAA 3BZFA 2X53A 1JXJA 4QOKD 4LK4A 2WLMA 1EA9C 2H0FA 3L95A 5ERWA 1RSYA 2B16A 3V4UL 5D1ZC 4P2RA 4TQEL 4N8UA 1IKFH 3T4AA 1CD1A 2NY1C 3SPIA 1FLRH 2OMVA 4ZTOL 4P5TB 1J9RA 1MIML 1B0RA 4J3TA 5C07D 3SDDD 2P7TB 4NNXB 5DD1H 3X1FA 4Z7OE 3QH3A 3O3DB 2X9WA 5JUEL 3CGTA 4I87A 3QEHB 3FPXA 1JNNL 3N44F 1M7DA 3H9HB 1JPSL 3L8QA 4JX0A 4I2XA 4WO4C 4WU7A 2J8OA 2DW5A 2YSSB 3JVGA 4M62L 4ODTH 3PL6C 4E0RB 1VKXA 2YAFA 2Y06L 4PJCE 4MCYB 3BUBA 5EO9A 1H19A 5AVQB 3WEXB 4YHOH 3FFDB 3ISRA 2E47A 3KLLA 2G5RA 3MYZA 3FU3A 5AW3B 4QD2E 4XO4A 2XXGA 1JXGA 4PWJA 1GVIA 2CRYA 2E27L 4FL4C 3OZLA 2IOIA 4GP5B 2FCBA 4BH7A 1IZKA 3NJKA 1EGJH 4LSRL 2IOMA 3BWUF 5KVDE 4TSAH 1UACH 4WU5B 3B5GA 4NP4L 2K3TA 1UQSA 2R0WL 3O6FB 3PV6A 2ATKA 3FO0H 1KIQB 5M95B 4N6RB 1BJ1H 2VR3A 1JHKH 3MV7E 1T5KA 2BSCA 1UD4A 3O81A 2BSTB 1I9IL 2OW7A 1BM7A 1DVZA 3F3HA 4YDJB 2X4QB 4CKVX 3IMTA 3FFCE 5CEZL 1C8QA 3UO8B 2FX7H 3KW7A 2YD9A 5EIIA 2YKLL 1YEHL 2BIOA 2IDCA 2XTLA 3X14A 5DWUH 2ZXAA 2BP5M 2DM3A 2B15A 4CMHB 5C0CD 4RGOL 4RZCA 1HYSD 3GZQA 3EW3B 1YSOA 1MG3C 3Q9PA 3FQWB 4YXLH 1ZVYA 2BHFA 1A66A 4EAEA 3HI1B 3IKCB 2XZCH 3UTSD 3B2XA 5DJ8B 3HMXA 1Q0YL 2WQRA 1A7RL 3PWLB 3STLB 1WUNT 1VGEL 2QKSA 4X5QA 3Q2VA 2DS4A 4AKOA 4Z23A 3FCGA 3WLBA 3TVMD 4FF9A 4IYKA 3GB7B 4GG8B 4Z7OB 4KKAC 1KYFA 1WPCA 2CK2A 2ITCB 3AREC 4LLYA 3DDGA 2WVVB 2ZONA 3NRPA 3X3FH 2XN9A 1DL7H 5KANG 1GKEA 3V6FB 4LOFA 3WFHB 3WNPA 1CLYH 1U3HB 3C6LA 3V95A 4W81A 5J8OA 1IKNA 3WFCH 3MBWB 1NBYA 4PJCB 4TVPL 9CGTA 2CJUL 1KJMB 3STBA 1UM4L 5HDOA 1A64A 3MRCB 1BAFH 4N2KA 2VXSH 2WIMA 3DXAE 3ALXA 1PKQE 3KLQA 4FXKA 3GPEA 4EDWL 4BGDA 4N87A 4OFKA 3VRLF 4HQQH 4KHXL 1YDPB 4PFEA 1PYWB 4FS0A 5J5EA 5EOCJ 1HZKA 1T21B 2HN7A 2RQ8A 3VXMA 3VMNA 2UUDK 1YLBB 4YHLH 2JCCA 4RLDA 3SDAD 3O2DL 3QO0A 4JFDD 5IW6B 4FMVA 3TEXA 3AABA 3PDDA 3VD3A 1JPFB 2VMEA 4KKNA 4FFZA 2XWDA 4QHPA 1F3DH 1CGUA 4X6FA 1A6TB 2XY1A 1IBGH 3QDHA 2CE6A 4Y5XB 5IQ7H 3MV7B 4NWTH 4Z95H 4BDVB 4BWUA 4A63A 3KBHE 4NUQA 3VW3L 2QEJA 4ZI8A 3WNOA 4D9LH 3FQXA 1XF2A 2R7EB 4KO9A 1AH1A 4OCSH 4WSKA 3FFCB 5I1GH 3NJLA 3P3UA 1MLBB 4JFFB 3J8F7 4F15B 2K0RA 4YUEL 4XX1E 4KV5E 1DVSA 4ZPVB 2PP9A 4WFEE 2GSGB 2CDEB 3KYNA 3QFJE 5EUOE 1DO6A 4NQSA 2FLBT 3SOBL 4IGBB 5E8PA 4MLIA 1IBHA 3UAEA 3AWFA 1R9FA 4HGWA 3QQ9D 3L3IB 1BD2E 1LO4H 2CHNA 4OCMC 3BFQG 3DO3A 3QI9B 1CFVL 2IADB 4PJDA 5HHMB 2JI2A 3S35L 3ZE2E 1PG7L 1TJHH 4LL1A 2CMRL 2CPUA 3G5YB 3NGBB 1IBDA 4WDIA 3AW5A 3F58L 3HR6A 3HG1B 4MJIE 3ES6B 4ZO8A 1IEBA 1XMEB 2V9QA 3NJJA 1I8LC 1ZS2A 3WXWH 2VDPH 3WFBH 1ADQH 4KK9D 3MLUH 3RIFK 4LFHG 4YOKA 3DROA 3SQOH 5HDLA 2JQMA 2OXGA 3VWKD 2UX7A 4JGUA 4GSQA 5HYJD 1J5OH 5B8CB 1I8UA 4E9TA 4KTDL 5D6DA 4KX7A 1PLCA 4GRMB 1IBBA 1I7RA 3MCLL 2Q0ZX 4NO0B 3DXAB 4RAUA 5BS0B 1JK9A 1PKQB 4K9EL 4OLUH 3KWXA 1XWVA 4KK8C 3U9PL 5JA9A 4Y5VB 1DQJA 5DUPL 1R3HA 2X44D 3NIDE 5DC0A 2R8SH 5TFSH 1P9MA 3R0MA 4QRTA 4P0DA 4DVBB 2I5YL 3QEUA 1AXTH 1IARB 1O6VA 1P6AB 1W0YT 4G70B 2CSPA 2BP0B 3LYRA 5DVNA 3M17A 1INQB 4UB0L 4EZLA 3CFUA 4KK5C 1PX4A 2YOCA 4N68A 3QIUD 2QL1A 1EANA 2QZ5A 1CIDA 3IE9A 1TJGL 4AEHH 4JJ5B 1EBPA 4UILL 2BVQA 2GTWB 1TVDA 1P0SE 1RUML 2GHZA 5FKAB 3OR6A 4D0CB 3AS2A 3QULA 4K7PH 1F18A 1YYLL 4LSTL 4B9ZA 3CXHK 4PH8A 4XNZC 5DYOA 1KFGA 2BSEA 3W9DA 1P6FA 2P28B 1Q0EA 4LDLB 1GMEA 4P07A 3WSQH 4H7VA 5L4JA 4I77L 2NY3B 1MHPL 2WXNA 4ZDHA 5IVNA 2YPVL 5DZAA 4ANXA 3B56A 1JHTB 1JYVA 2H5UA 5JW3H 5T1LB 1VPOH 1FV1B 3FU6A 2MTAA 4MD4A 2CPCA 5F21B 3WFZA 2WSKA 4ONHB 4WWKA 4ABUA 4JHBA 5JORB 3QFJB 2Z0BA 1WGOA 4I88A 3IB4A 5EUOB 3JV4B 1I8MA 5E1AB 3DSNA 3AY2A 5GRYA 1W6LA 5JOPD 5CBEB 2FBJL 1O7VA 1YECH 3FDWA 1ZS8B 2GIXA 1NKOA 1S3KL 3VDBA 4H88H 4WGVB 2NNAA 4ES8A 4HFUH 1D9KD 3ABGA 3JXAA 3MV8D 3ZE2B 1MQ8A 3AWEA 4OTXL 3ZUCA 5DZNA 1FNGA 1CDYA 1D5RA 1AGBA 1GZHC 2X89A 3RY4A 3UFIA 1QEWB 3KYKH 3WNMA 4YHMH 4XNXL 5ILTH 4FZ8H 3TC9A 2V7NA 3U4KA 5DZLA 5FO2A 1CIUA 3QG7H 2JVUA 5CS7A 1MH5A 4PB0L 5CCJA 1ZVSB 1TCRB 2ZUQB 4KKCD 3L1GA 1DZBA 4U1HB 1PW3A 3GNMH 4FXGA 1SDDB 3D7PA 4M43H 5FYLD 4XP9L 8PAZA 1FLTX 4KNSA 4KTEL 5JW4Q 1E2VA 3PDOB 5J9PB 4Y8AA 3WXVL 4D9QD 1E27A 2PW2A 3EDJA 1Q1PA 4I5BA 5D7IA 3RL1B 2WXHA 4OBRA 4EUPG 5IMMB 4QR7A 5IB3B 5T3XH 3EJQA 2WUCL 4DGIH 4URTB 5BO0D 2AJXL 4FG2A 3D0LB 4N1HB 3T0DA 5D1ZD 2F58L 4OLVH 2ENSA 4CMMB 4BEIA 4JCLA 1CLOH 2NY1D 3JTTA 3IBEA 4Q97A 3ETSA 3TF7C 3RFZA 5D7KD 2X38A 3MLXL 1YEFL 5AW5B 2DM7A 8FABA 1IC7L 4LEXL 5E6IC 4PHZA 4PJ6A 4GY4A 2VC2H 1ZIBA 5D1QD 2JKIS 1I4FB 5H4YA 3L2LA 4WO4D 4MDJA 4XPHH 3PL6D 5DMIL 2VDRL 4BSWA 5BUGA 1QFUH 3EF4A 3CBRA 1KGCE 5I73B 1YUKB 2RA1A 4MBOA 3DKHA 1ZK9A 2XKUA 1JV2B 2J4WH 3NIGB 4WJ5A 2P5ED 2H7WA 2WQWA 1RAMA 1L0QA 3C2AL 2IANA 1T89C 4Z7OF 4JN2A 4QXGL 3ZQWA 1FFNB 2JXMA 1NC2B 1AACA 1CDJA 1FFOB 4MMXB 4F7TA 4FQLH 3OKNA 4LT7A 3SKJH 1X4ZA 4G1EB 4D0DA 2IPKB 3QWRD 2Z7WA 4PJCF 5IMKB 1ORSB 4E9YA 3L9BA 1CK0H 5HI5C 4DO5A 1I7UA 3SE9H 1IQWL 1NL0H 1VFAB 5B7MA 1BQHB 3BD4A 3BOVA 5SWZE 3S36H 2B4CL 4JFEB 4L4TA 1Q94B 5EOCH 2CLVB 3ZJAA 5GRJH 2OZNA 4TNVK 3ZVVA 5T1KB 5KSUB 3KYOA 4OM1H 1ZOXA 4N90E 1XH3A 5EN3A 2IBBA 2QQKL 2R23A 3BN9C 4WK2B 3U1SL 4JO8A 3DTXA 1GJWA 5EEVA 4HIJB 5SWSE 4PLJC 1DUYB 1EAPA 1MN4A 1JGIA 3M7FB 2J20A 4GAYB 3BDYH 4KKBC 4KXCA 1YNLH 2D3NA 4XN2A 4EI6A 2ZG1A 5FV2A 2QADB 4J23A 4JHAH 5D1XA 2DQIL 3IFPA 2YPLD 1DJZA 5DD0H 3EH5B 3MRRA 4YLBA 2ICWJ 2ZG2A 1NCBL 1ZPLA 4FI7A 3UL4A 3O3EB 4NUGH 5IM7B 5I6PA 4Z7WB 1U8OB 2XXMB 5FGBA 4EUPH 4WI2A 4HIIA 1DLFH 5FYJL 3EXJA 4YHYB 3ARED 3MNZB 1S4IA 3NK4A 4LEOB 1R5IB 2IV9A 1BWWA 2MRYA 4IOSD 1TQSA 2FBRA 3D2UD 3QZPA 4U33A 4PIBA 4ANUA 4GMSL 2M2DA 2MQ0A 4L9DA 4LKXB 5E0FA 4IBLT 5GSVB 3EHBB 1JWSA 1ZRUA 3K72B 4XAKE 2UY6B 3B2DC 4YZWA 1MZYA 1VAHA 1XIWB 5EOQH 4AWJC 4DUVA 1DBBH 1XF5A 1AGEB 3EYFB 1JYNA 5LN8A 3DTUB 5DLMH 2XA3A 1IGFH 4AMXA 2CO2A 5E2TL 2WQXA 2P8MB 1PCSA 5D96B 4JAMA 4AM0A 3OXSB 3U36B 1MCOL 1XTMA 2A9MH 4K23L 4WHYG 2W60B 3CX2A 1YPZE 5DDHB 3AM8C 1DVFA 4F57H 3SKNA 4OIAA 1CGTA 3AQYA 3QARA 5DRNA 2QZQA 1R0AL 1KTBA 2J5LB 5BV7H 2E4TA 3EBGA 2VDLL 3UCQA 4IQHA 5CN3A 4KNQA 2ZCLL 3CFTA 3KLSA 3CUPA 1WAAA 5T1MB 3Q5TA 3WG7B 1LXMA 1C5DB 1TLMA 2VLKD 4P2RE 5GGRY 1XTLA 4X7TA 2EDFA 1HEZA 2VDKB 1OPOA 4UIKL 1ZT4B 3UBXA 3MXWL 1REIA 1SYSB 1IFHL 1KWGA 4AH2B 1FNSL 4OLYH 1WJ3A 4RFEA 3ZSSA 2BHUA 1J05B 4ZMZA 1ZTXE 3ABKB 2W0FB 2FX9L 4I2XE 5KBNC 3RGVB 3NA9H 5SWSB 2Z35A 2WTRB 4GKOA 3RVTC 3RY5A 4AL8H 3LKNA 3RQ3A 2ZYHA 4FN0A 1CL7L 1K5NA 3QHFL 5DK2B 1GKOA 1IT9H 2A74A 1B4JH 1QSFA 2DOCA 3FU5A 5I0WA 3AVEA 4CJ0A 2M83A 3KWTA 4U6XB 3PRZA 4YHKH 2P42B 3C9NA 2V8MA 4AYBA 5AVRB 3C8KB 4LQFH 4G9DA 1ZT7B 1IM9A 4HC1H 4C8XA 3HC3L 2AXFA 1OIOA 3VXSA 5F7DA 3ZKMC 3VFRB 4X7EC 3UTOA 1AMYA 3TESA 1S9XA 3WKNA 5EUOF 5GGTA 4PJGB 1M2VB 1U0QA 2WBXA 4L8BA 2A6IA 5EF2A 4YHZH 3TBSA 1IEAA 4NKQB 1T6WA 3ATAA 1WVZA 2DYPD 2J8HA 3IXTB 5DRXA 5C2UB 3VFWA 4JKLA 4WI5A 3ZE2F 2GK0B 3KPMA 1F58H 3RTQA 4KK8D 4AUJA 1EIBA 5I23A 2EIMB 4W9ZA 3GBML 4TNFA 5FKPB 2ICEA 2V5RA 1ECYA 5C70A 3GO1L 2A1WL 1D5XB 4NQCA 4KVPA 3H8NA 1ZLSL 3K6SA 2HVKA 4NZTH 4P4KB 4OD3L 1NA8A 4OZIB 4FNQA 3GKWL 4OLZH 1DN0A 4F7PA 2J7LA 4LQ1A 1WIOA 4H2AA 2Z93A 4G5ZL 4NFDA 5TTRA 4BQ8A 2ZP8A 1S9VA 3BZFB 1YJDC 2OR9H 5F7MC 2VR6A 5ERWB 5FO9B 4Q9QL 1A14H 4ORGA 5GGRA 4AT6A 4R2GC 1FFQA 5LB1A 4WHYH 2OMVB 1D7BA 1X7QA 4GO8A 3TH2T 1RV6X 3CLFH 1V8HA 3EYOA 3OHMB 5KN5B 1G1CA 3QH3B 4RMQA 5FGCE 2HFGL 5I5MA 2UY7B 2XN9E 2YD0A 4N8CL 2WXGA 4I2XB 5KUMA 4OU3A 1JPTH 1VKXB 2PKDA 3WO4C 2NCEA 2ERJB 2PW1A 4PI0A 5EO9B 2NUTB 1JXKA 1CU4H 4YSAA 2A0LD 2XICA 2ZUWA 3M7OA 5I5IA 4KH2A 2ZKMX 1C12B 1PF3A 3BAXA 3MRQA 4IJ3B 4OGXL 3LSOA 4A38A 4CNIB 4G7RB 3AGVA 1MI5A 4KUCF 4KI5F 4X5PA 5FFLA 2ZTBA 1KGUA 5CJOH 3VXME 2WKLA 3SBRA 1PL3A 2A9CA 2V17L 1HTYA 1KN4H 4PJXA 1TCMA 5AG8A 3NIGF 5HGHA 3I75A 1MCBA 2ALWA 2J71A 2JCCE 3INUL 4LCCC 3TPKA 1KJ3H 4BH7B 4LCWD 2IG2H 2CBQA 2QGEA 2EECA 2CIIB 3D87B 3IWUA 4YSEA 2AQNA 2COQA 2DWXA 4Z7AA 2ATKB 4XNQB 5CU9A 2D0FA 4DFHA 1NGXA 1VACA 4FERA 4NAJA 5K33A 4P4RB 4OIIL 4XMVA 4NN6C 2WUBL 2XIDA 1F4XL 1JD7A 1P7KB 1QOKA 5EIIB 3L5IA 2X28A 5I9QB 4IK6A 5E08H 1QLRA 2VT0A 3X14B 2ZX7A 5EOTA 4L0PB 3OJDA 5LJYH 4G7YL 1CICC 3RBGA 3QPKA 3WYRA 5E6ID 3QUYA 5E8EB 4FFYH 3G5VA 1UA6L 1I9JH 4TTDD 2WSDA 3QHZL 2RTTA 3M07A 1E50A 1F3RB 4PJDE 3OPZL 4NPJA 1ZHLB 1KYUA 3DA0A 2LLLA 4Y9BA 3D39A 4QRRD 5AZUA 4N28A 2VQ1A 3OMAB 4HS8L 4F8TA 5L2JB 1G7IA 2NY7L 1PJ9A 5C08D 4MKMA 5FGCB 3L2MA 4LLYB 4Z7WF 4WEBH 3O11A 1ETA1 2CKNA 5B3JE 3EOTH 4A04A 4JO3H 1A1NA 3C6LB 1WCQA 2B9BA 1NGZB 3FZUC 3FTYA 3F12A 2VABB 4JY4A 3WJJC 43CAA 2XSKA 5EO1A 4FXKB 2XWJA 4PGCA 3NQKA 3ZR6A 1V3LA 2QGDA 4WUUA 4OLXL 1MCHA 2ODHA 4M6NL 3TT1H 5GGVL 4C54A 4CVZB 2YHGA 3CFCL 1HVXA 1EEYA 2VRAA 5HI5D 5HYFA 1FL6A 1IGCH 4NGHH 5FHBL 3TWCH 1UH4A 2W9EH 3IE4A 4JFUA 2VDNL 5J1TC 1RMFH 1NM4A 3O4OC 4EIGB 4NQEA 4OZHB 3VXNB 3KPSA 1R24A 3SHSA 4Z7NE 3DRTB 4X6FB 3BN9D 2VDMB