1HAWA

X-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9 a resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure of a Blue Copper Nitrite Reductase at High Ph and in Copper-Free Form at 1.9 A Resolution
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 90
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hawA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hawA02
1RCYA 2JXMA 4BDVB 4K9JA 1X9UA 3TA4D 3GYRA 5B1KA 1RKRA 2PCFA 3UAEA 1NWOA 1KDIA 1ASPA 1L9TA 1NIBA 2YAQA 3TBCA 2X88A 3ZBMA 3EH5B 3H56A 4DPAX 5A7EA 5I6NA 2GC7C 1E5ZA 2GHZA 4HAKA 1SF5A 3NJIA 1FWXA 1PLCA 4A2FA 4KNUA 1FA4A 1BXUA 2BP8B 3KW7A 1J9TA 4YVUA 3DTUB 5TK2A 1KYAA 1PZCA 3X1FA 2FQEA 1PZAA 2JKWA 1NIAA 4E9YA 4YL4A 1V10A 3T6ZA 2E86A 3QPKA 5I5MA 3JTBA 1SJMA 2R7EA 1ZDSA 1JVOA 2LLNA 4A68A 3QJQB 2UXFA 1A8ZA 3X1BA 4FA7B 3WIAA 2QDWA 1W6LA 2OV0A 1NWPA 5I6LA 1ILUA 1AANA 2TSBA 2XU9A 1ASQA 3SQRA 1J5CA 1JZGA 3S8FB 3RYMA 3FSWA 2MTAA 1DYZA 1HAUA 3FSAA 4AKQA 4DP9X 5B7MA 3ERXA 2PP8A 2ZWNA 5TK4A 4JKNA 3H4FA 2J56A 4BWTA 1EHKB 3SBQA 1AQ8A 3AY2A 9PCYA 2YAOA 2PP9A 1ZIBA 5AZUA 3UADA 1BQRA 1ET8A 2MRYA 4G70B 1TEGA 1L9OA 1NIFA 2CJ3A 2H3XC 2HX9A 3S3CB 4GYBA 4AKOA 4HIPA 1KV7A 1AOZA 3FT0A 1JZIA 1GY2A 1AG0A 1V54B 1B3IA 4E9XA 1SDDA 2EILB 4YSCA 3ABLB 3AG1B 2HRGA 1J5DA 3FQYA 4E9TA 4E9QA 1ZPUA 3SBPA 2YAFA 1E30A 2QPDB 2RACA 3NJHA 3UGEA 4QLWA 2IWEA 2OCCB 2PPDA 1WS8A 4UANA 2BP0A 3WNIA 3ASNB 3HB3B 3EH3B 2VMJA 1L9SA 1V55B 3CVDA 3BQVA 2DYRB 2WO3B 3ZDWA 4G7RB 2XV2A 2FNWA 1OE3A 5F7BA 2VM3A 2YAHA 4GP5B 3N2JA 3AG4B 1KCBA 4PCYA 2PPCA 1JZEA 2Y69B 2XUWA 4TXVB 1AG6A 1PCSA 4BXVA 1TKWA 1KDJA 3NSYA 2IWFA 2YQBA 2EIMB 4FAAB 2FT7A 3NJGA 1XB6A 1E65A 1GYCA 3NJJA 4CSPA 4F2EA 3AZUA 3CDZA 3MBWB 4G72B 2IDFA 2WO2B 3C75A 1IUZA 1J9RA 4E9VA 5B1JA 1WA0X 5EHFA 1BYOA 1FFTB 5B7EA 2FJSA 2VW7A 4KNSA 2J55A 3G5WA 1PF3A 1OCOB 3CVCA 4CSZA 1AZCA 3L45A 1AAJA 2A3TA 5D4IA 2QT6A 4L0PB 3QJVB 1ZIAA 4A66A 3FU9A 2BW5A 2DY2A 3T6WA 3FPYA 3FPXA 2XV3A 3QQXA 3NJKA 1OOWA 3DKHA 3IE9A 2CCWA 4KO9A 3NSCA 1NDTA 5I5JA 4ENZA 1CC3A 3IN2A 2UXVA 1WAEA 3ZX1A 2XXFA 2TSAA 6PCYA 3ASOB 2AZUA 3UACA 4HZ1A 2B08A 3EF4A 2GIMA 2YAPA 3NSFA 1GS8A 3AW5A 1E5YA 3JT2A 2ZOOA 2W8CA 4G7SB 3OM3B 3QJUB 1BYPA 1SHXA 1T5KA 5PCYA 2YAEA 1OE1A 4DP8X 1BQKA 1KGYE 2VSMB 3PAUA 1M57B 3OMIB 5I26A 3FYEB 2BO0A 2AANA 3ABMB 2CUAA 1NIEA 1L9PA 1ID2A 3V9CA 1J9SA 2GB2A 5B1JC 5FC9A 2XWZA 4YSDA 5AFAA 4HHWA 4Q89A 2IWKA 3ZIYA 1GR7A 1JXDA 6PAZA 4DP1X 3PPSA 3MX0B 1OV8A 2I7OA 2W88A 3FU7B 4KNTA 1UATA 2FT6A 3OMAB 3NJFA 3PAZA 4DP0X 1A4CA 1MZYA 3X1EA 3CZUB 3ABKB 2XV0A 1ADWA 3NSDA 4P5SA 1AZBA 1JOIA 4GP4B 1CYXA 2XVBA 3IBOA 3N55A 4DPBX 4F2FA 1XB3A 3HEIB 4UAHA 3TU6A 4DP4X 3V9EA 1W8EA 2ZONA 3EH4B 3IN0A 2HLEB 1KCWA 1PLAA 1ZDQA 2UXGA 2YXWA 1PZBA 3QJRB 1SFDA 1MDAA 2XLLA 2IDSA 1EZLA 1E67A 3EHBB 2BP8A 1BEXA 3KW8A 1SHWA 5D4HA 2BWDA 1J9QA 3FQ2A 3FSZA 2DWSA 2UX7A 3NP4A 2Y1AA 3PXLA 3WI9A 4YSEA 2PPAA 3PCYA 2VM4A 1NIDA 4GY4A 3TBBA 4NERA 2N0MA 1SF3A 1SDDB 4AKPA 2YARA 1PLBA 5PAZA 3TASA 5I6KA 1GS6X 1PY0A 2I7SA 4G7QB 2HX8A 3WKPA 1GW0A 5D4JA 1N68A 5LDUA 5B1AB 2DYSB 2NRDA 3T6VA 2IDUA 2PCYA 4KO5A 4DP7X 4E9SA 1JXGA 3D12B 1AS7A 3FU7A 1NICA 4M3HA 1A4BA 2IAAC 2PLTA 2YAMA 1MZZA 3NJMA 3UABA 2AVFA 5E9NA 1OF0A 3X1GA 4KO6A 1BXAA 1W6WA 2BZCA 2CBPA 2FQDA 4YSRA 1WA1X 2HZHA 4N8UA 2GI0A 1QLEB 5I28A 1WS7A 1RZPA 4RH4A 1OCZB 4KO7A 1SNRA 2IDTA 1AS6A 5F7AA 4BWWA 5B3SB 2DV6A 3S8GB 3FYIB 2BHFA 4A2HA 3FU8A 4E9WA 3WKQA 4YSUA 1AIZA 1ETJA 4YVNA 4KOBA 2XYBA 4NB7A 3NJLA 4DP2X 1CUOA 3S3BB 2HRHA 3QJTB 3NT0A 2IH8A 2QPEB 3BVDB 2HXAA 2BZ7A 3AG3B 5AKRA 4YSTA 1R1CA 1GY1A 1BAWA 1PNDA 1AR1B 2GC4C 1IKOP 3X2QB 1DZ0A 2GBAA 3GXUB 1NPNA 1JERA 1ILSA 1N70A 1M56B 4F7KA 1ET7A 2FT8A 4N4YB 4YSOA 3FS9A 4HCIA 1IBZA 2GSMB 4JHVA 4A2DA 3WG7B 1URIA 1VLXA 4GXFA 2XX0A 2OJ1A 4Q8BA 5I6PA 2J57A 3T71A 2AZAA 1KBWA 4GP8B 4A2EA 2PP7A 4NAJA 1L9RA 3ABGA 3PLYA 2BP0B 2QDVA 3OD3A 3NP3A 1TEFA 1TU2A 2IH9A 3WNJA 1CYWA 1JZJA 3CDZB 4G71B 1ZV2A 4P5RA 4YSSA 1BQ5A 2HX7A 2X87A 3OQRA 4MFHA 2EINB 3H4HA 1YLBB 4BK5C 7PCYA 2XX1A 4X4KA 2VW6A 1M9WA 3IEAA 1AACA 1GSKA 4W1TA 5I6OA 4JHUA 3DIVA 5IY5B 1A3ZA 1AZUA 1KBVA 4UF7C 4ZK8A 3S3DB 3UAAA 4YSQA 2AFNA 5I6MA 4KOCA 1L9QA 3FQ1A 2IDQA 1JVLA 2BW4A 1PNCA 4DP6X 2P80D 3PAVA 3U25A 4YSAA 2I85A 1RZQA 4HHGA 4EF3A 4E9RA 4WKXA 3T6XA 1A4AA 3CVBA 1F56A 3SBRA 2UXTA 1OE2A 3NYKA 2FQGA 2H5UA 1NZRA 3QJSB 4BDVA 2JFCA 2Q9OA 2J5WA 2CALA 2DWTA 2EIKB 1OCCB 2FWLB 1ASOA 1JZHA 2P80A 1GS7A 1JXFA 1I53A 2VN3A 1AS8A 3X1NA 4AX3A 2ZXWB 2PPFA 4A2GA 1HFUA 1HAWA 1NPJA 2FTAA 1QNIA 1NINA 4HCFA 1AZNA 1QHQA 4W9ZA 4AI7A 5B7FA 3CG8A 1ET5A 4DP5X 2XXGA 4BXSV 4A67A 4WTQA 2YXVA 1NTDA 2EIJB 4HALA 4M4RB 2R7EB 4YSPA 2Q5BA 1OCRB 1XMEB 5I5IA 2FQFA 4HCGA 2PPEA 1BXVA 2B3IA 3T9WA 3NJNA 2UX6A 1X9RA 1MG2C 1AZRA 1XB8A 3AG2B 1SFHA 1A65A 4QKTA 5B1BB 2WSDA 1WA2X 2BWIA 2CAKA 3FSVA 4DPCX 7PAZA 1PAZA 1JZFA 1IBYA 1PMYA 1MG3C 1CURA 8PAZA 4BWUA 2VW4A 3OMNB 5ANHA 4AZUA 4PAZA 1IC0A 2H47C 2VSKB 3GDCA
chains in the Genus database with same CATH superfamily
1RCYA 2G0KA 2WLHA 4BZ1L 5K59E 3MBXH 3ARTA 4FYRA 4HEME 4MQXD 1ZRUA 2FEJA 2Z35B 5D96C 5HJBA 1MJJA 1I3VA 4Z7WB 1U8IA 4R97C 3DOIA 2QHRL 1E4KA 2XN9A 2YBGA 2E76C 1E27B 2QQKL 3TIEB 1M3JA 4GXVH 2WBWB 1DVFB 4OZ4B 1NCBL 3HG0A 3H9SD 3NJIA 1MH5B 3HE7C 4G9FD 2VN7A 4WZ9A 3BLKA 1WUZA 3U1PA 3QCVH 1KCVH 4X5LA 1SXBA 4QRPE 3FONB 5K59F 2X6UA 1X6LA 3TM6A 4LP5A 6FABH 2VERN 5I0YA 4A68A 4O02B 2IADA 3G5VA 3L4UA 4O00A 3HKFA 3LQZB 3QRBA 4TSAH 1YO4A 4G83A 4HS6B 3RRQA 2GHWB 2FECL 3OSKA 4EO5A 2JVUA 1UM6H 3FTWA 4X8JA 5ALBH 1R75A 2GFBB 1OAJA 3ECBB 3FSWA 4XXDA 3UBFA 3UO8B 2LV4A 4NHUA 1LWHA 1NL0H 3PP3K 2KL6A 5BQ7A 4LAJH 3BZ5A 4KKLC 3F58H 4XP9L 3VFGH 1TETL 5C0GA 4AH2A 2ZG3A 2J56A 3D3VE 4I77L 4QHKJ 4U1MB 4HULB 1CGTA 4V1DE 3U0WH 4Z3FA 5DU7A 1PIFA 2AJYL 3MRPB 4CN6A 3UPRB 4AIZB 5C9JA 3NCCB 1GPOH 2BNUB 2QFPA 3EDDA 3T8XA 4BKLB 4K55A 1O6SB 4MKTA 2X4OB 2PR9A 3RZCB 3ZTNH 3O6FC 1E4XL 1WAAE 2ZCZA 3WFZA 1NL0L 1N6QH 3IPFA 1YNTF 3AQDA 5DRNA 1UJ3A 2YGQA 3CCHA 4ZO9A 2MCAA 3KYNA 4N2BA 5B8CC 1MY7A 2WP3T 5GRXG 5T5NG 1YNKH 2CO6B 1UWGH 3G6JB 1TU2B 3V95A 3D3VA 1IAKA 2VLME 4PG2C 4N86A 4P3CH 4EEEA 3DVGB 3V4VL 1H8NA 3CZKA 2FYYA 1WAAF 1SJEB 5E7BA 4X6FB 3GSNL 4X8JB 3IJHA 5C0BB 2GFBA 4XXDB 3NA4A 4HH8A 2G9HA 2C9VA 2J72A 3BKJH 3UJJH 4U3XA 5FYKL 1RK0B 1WJ3A 4QRPB 1LP9E 3HAEA 4BFRA 1SMAA 4O51A 3B2XA 2QMKA 3KWWB 2J25A 1P1VA 4LCYA 4QRRB 5I74C 3ZRSA 4ZT1A 3FU3A 3U4KA 1NDMB 1GYCA 2MQ3A 4ADIA 3C6LB 2OZ4H 2B3RA 3CSPA 4N8VB 2X5PA 1IC7L 3WTXA 4GRWF 1YN6B 3KDMA 4ONHA 3NA9L 1GOGA 5I18H 4X5RA 4OV5B 1QTYT 3EADA 5JYLA 5BVPL 3X3FL 4F57L 2WNWA 3TC9A 4MRCA 4RAHA 1O9ZA 1NGQH 4K94L 4RLDA 4N5ED 4GEIA 1FSKC 3W37A 3PNWA 1MOEA 2FLRT 3MC0A 1OLLA 3NFSL 4OCNC 3EJYD 3BSGA 1AE6H 4UZUA 3GKWL 3L5XL 5T1KB 3J2PA 1TQTA 2OXGA 3MOQA 4IK7A 4YFEA 1UACH 1RJZB 2BNQA 3F12B 2J1YA 3DMMA 3HC0A 1VJSA 4Y5XB 3TZVC 4W81A 1A7RL 1QOKA 5G4OA 2JB6A 4P49A 3MACH 4PJ8B 3KJ6L 2CM6A 5INDA 2QQNH 2MNUA 2GSIB 3VA2C 3KWWA 5J1AB 1L6ZA 2UXVA 4Y2LA 4FLRA 3LHPH 4N85A 2EQDA 4H20L 2XQYA 5DK2B 4A7TA 4QHUB 2I60L 3HI5H 1FVDA 4NM4L 4UMSA 5DMGD 1BOGB 4OIIL 1MCSA 3BPLC 3VWJB 5EU3A 5B38B 3MN8A 1JL8A 5ID0B 3CH8A 4IRSC 5KBDA 1SOKA 4KQ4L 1SHMA 4WWID 1BQKA 1ZLWK 5CM1A 1RQ5A 1QLEL 1JZ3A 2XQYK 3OMIB 3G6AB 1F6AA 3ARBA 5KSUA 2F19H 3UTTA 3POCA 4OCWL 3L1FA 5HJ3B 2AANA 3F64A 3ZK0A 4N90E 4BV1A 2VDNB 1JMXA 4KHXH 1L9PA 2EJ1A 1F6LL 4YPGA 4WFHD 3O6KL 4LF3A 2E7LC 3UBXB 2HT3D 4JFEE 4P4RA 5DJYB 2OXGB 3IFPA 3O6LL 4NC1C 4KROD 1TR7A 3UTTD 5AWNH 1I1RA 1K8IA 4OCRH 5C0FB 1ZVYA 2W88A 3QAZB 2IADB 1KZYA 3BO8A 4U7MA 2AABL 5IFAL 1W0WB 1A4CA 1M2OA 4LSPH 4UDUB 2R2BB 1GMEA 3SDCC 4I0PD 5ALCH 2RB8A 3EGSB 4KY1H 4XCYA 2YUXA 2VLKB 1XZ0A 4N0YH 3CHXA 2ESVB 2Q8BH 3T2NH 5I1KH 5HHOD 3VO0A 3I9GH 4R7NB 1Q9WA 4IIQA 2O6PA 5SWSA 3TZVA 4G1EB 1R24A 1W8EA 4L8DB 4MA7L 4QXWA 2LFGA 3B7UX 1QNZH 5D70H 3PG2A 5FW6A 4QHNA 1EEQA 4E0RA 4PJAE 5FK9B 3NGBC 3AT9A 5SV3A 5CCKH 1NGWA 4Q9QH 5K1VA 1OP4A 3VMPA 3PRZA 4X9YA 3HI1A 4Z76B 4FP8L 1YEJL 3W5NA 3IJEA 2EICA 5I1JL 3RGVC 4EI6A 3WI9A 1CLOL 3MLSH 2CLZB 5DMKB 1CFNA 1KB9J 2VISB 4HUUB 4OM1L 4W9HC 3ZDXB 1CL7I 3KBFA 1DDTA 4JZNB 4DKFH 3ATBA 1ZS8A 2NY6D 4K7PH 5GGUB 1I31A 4MAUH 2FBOJ 3GRBA 3IFPB 4OD3H 3UIZA 4GRLD 2DYSB 2NRDA 3T6VA 1X7TA 2D7MA 3T6QC 5JOFA 3QHTC 3KEHA 1GMIA 4BFIB 2FYVA 1I1AD 2VO5A 2WBJB 3B43A 1W0WA 2WO4A 4HWZA 1CLVA 2FX8L 3MRNB 3IDIB 2A73B 2BZCA 2QHLA 3IFOB 1FZJB 2Y07L 3B1TA 3SGEH 2EO7A 2Y7LA 4FQ1H 2ESVA 3BZEA 1G0XA 1OCZB 4KO7A 4V1DA 2IAND 3QUYC 4HHAA 1C7TA 3RDJA 3HA0A 4FNUA 2NNRA 2FIRT 3KLSA 1R3LB 3O9WB 4L8DA 2ZWZA 1HKLL 1T0MA 3RA7H 4XMLL 2OI9C 3FCSB 3WO4C 5C0BE 3LKOB 4K2UL 2OQJB 1INDL 3C6LA 2EEAA 1DN0B 2YBRA 3LQMA 5DEGA 1OAKL 2QPEB 3BVDB 2WKLA 1HZHL 3RE0A 2GY5A 1A6TA 3IDUA 1CO1A 2VISA 4HUUA 1BVLA 3F62A 2BSSA 3CFBA 3EUDA 3RVWC 1EEUA 1HCVA 4LVHB 1UZ6E 4QT5A 4NT6B 3FB8B 5IG7A 2KDGA 1FBIH 1FP5A 4LVOB 1NPNA 4PRDA 5CLZA 4QTFA 1LJMA 3FBKA 4XNYH 3WNKA 2Q6WB 5JOFB 1DJWA 2WVTA 1QUPA 2ZCKH 1UB5A 4K07A 4Y4FD 4XX5A 4X9BA 1BJMA 2N7AA 4JG5A 3L4YA 3VXSA 4UT7H 2XX0A 4Q8BA 2H8PA 4HMCA 3MRNA 3Q8FA 3A22A 3CNKA 2XA3A 3TCLB 3RA7L 1VADB 3IJSA 5E9DB 4NAJA 4PIBA 2W0FB 1QQDB 4NQCA 1QASA 3QDGB 4XP1H 1S7RB 3TWYA 5KVDH 1Z6JT 4WFFE 2X4TA 5DD3H 4IGBA 5BS0D 1J18A 4PJEE 1CFSA 2GSIA 3LKQA 2WCGA 4M02A 5J1AA 5AVSB 2XICA 2C3VB 2EINB 4LEXL 3LKOA 3VJ6B 1U21A 3O3BB 1U8MA 3OR6A 3AS1A 4W1TA 5EN3A 4ZK8A 4HDIA 3UAAA 4KJQD 4PV1C 4A04A 4IM8A 3L2NA 5KVEH 3WHE0 3V0AC 3ULVF 4R0LB 3VFNA 1P4LA 4H88L 3QQDA 1WC7B 3DX3A 1VPOH 1HHKB 3PAVA 4N2KA 4QRTB 3TBSA 2G3MA 3M8OH 5HVHB 4XBEL 5DQDL 1UA3A 2KH2B 5IMOA 1IU1A 4FG0A 1CLOH 4ZX3A 2PCPB 4KRNA 1JF6A 1WBXB 4M4PA 1OE2A 1NMBH 4WUKL 3U1SL 5KSUB 2YS4A 3OKDA 4JKPL 1JPST 4NSKA 3EXLA 4QJ5B 3OC8A 2KKQA 3IF1B 3B2UC 3FB7B 2Q9OA 4G80B 4PJHA 3VFSB 3CIQA 1QEWB 2CALA 5E8DL 4NUGL 5ETUA 3LZPA 1THCA 5IVZB 4XE5B 1XH3A 4ZOBA 5E9DA 4Y4KB 4P2QA 1IAII 4MCMA 5IK3B 4QLRA 5T1MA 3GS4A 3N3EA 4P5MA 1HFUA 3MRBB 5E5MB 1QTPA 1DO6A 3T2PA 5C3IA 1EZUA 2L3BA 3QG6B 1D7FA 4OF8A 3IWUA 2X70B 3QVAA 1KJVB 2JJTC 4L2LA 5F3BB 2EE9A 1J8HE 1PU0A 3REVA 4J39A 2ZXEB 3DX9B 3I50L 2EIJB 3D4CA 3GHPA 2R7EB 1IEHA 2BFGA 3VFMA 5HJGA 1Q0YL 4ICWA 4X5XA 4IIQB 5D7SL 1UD6A 3FUFA 3H2QA 4NAMA 1MG2C 5AYQA 4UTAH 1AQHA 3O6LH 4U1NB 3GFUA 2DWEB 2CAKA 1GGIL 1ADQL 1VCBC 4TN9A 5DD0H 4I1PA 2A6JA 4U3SA 4Y5YA 2ZCHH 4KHXL 1MG3C 3APFA 4K8RC 2BNRE 3L4CA 3LZRA 3QIWB 4TPRL 4MZRA 2KLRA 5HSFA 4CRPA 4HGKC 2ICWB 1WBXA 4P23D 5CEXA 3S2AA 1N0LA 1ZE3H 4Y4KD 2IQ9H 1B6DA 4S1DD 4H44C 5IB5B 3TA4D 1RVFL 4ONOA 2X6AA 4JZNA 4NNPH 1D3CA 1P7KA 4PRAB 1KGXA 3VGAB 4Q58C 3WFHB 1ES0B 1RSFA 2W0LA 1OAZL 4Y4KA 4HUKB 4N2HA 4F33A 1OGTA 4GMTL 4KKNA 4XH2A 1WZAA 1MJUH 3Q8EA 3FRPA 4Z3IA 3QB7C 1Q1JL 4LDOB 1UM4H 3WLBB 1S9WB 3QHFH 1D2OA 3PWPB 3QFJE 4L8SA 3SCMC 3BP6A 5GQBA 3JTBA 1CK0L 1SJMA 4JDZB 3CVIH 5CLTA 1D5RA 3K6IA 5I71C 2RBLA 1TNNA 1QR4A 2VTFA 3P69A 4JREB 3MA7A 5L88H 2V17H 3MGTA 3VI4E 1OKEA 5G55A 1NWPA 2R9HC 1ZVSB 4M6MH 1S7UA 2VDQH 3MODL 1VSCA 2NTFA 4TSCH 1S9KC 1KGCD 4DZBA 1M7IA 5AVRB 4JO4L 4UTBH 1HAUA 4PJIE 5F71A 4YHMH 1GJUA 3ERXA 3D7PA 1VB9A 4FFZH 5D1QA 2Y1VA 4Q4IA 5LXVA 4ODWB 2DLFH 1VACA 3BWSA 2Q7NA 3QA3A 3VWJC 2O5NA 5HHXH 5E1IA 4GRLA 4X0KB 4DUWA 3JTSB 3DX7B 3GLZA 5D7KD 2QFRA 5AOLA 1TQUA 4XPAH 2CJ3A 1KJ2B 2ZUWA 3WFHA 3D9AL 3O3EA 4PJBE 3QNZA 3ZYIA 1GZHA 1JPSH 3FFOA 3IU4H 5IKCB 3FT0A 3PQYA 1HSAB 1MCOH 1V5JA 2ZOKB 4Y2OA 1O9VA 4HH9A 2X89D 3VXSB 5IJBC 2BXYA 1IEAA 4TMPA 1S9WA 1AR1D 3DJ9A 1ZPUA 3BUYA 2NT1A 4DO4A 4N3UA 15C8L 5CLXA 2BP0A 1SJHB 3CJJA 4HZLB 1T04A 2D7OA 3HG2A 3FUNA 3FT3B 1R9FA 3WXVL 4WTZA 3T0DA 2G30A 3P11L 3JVFC 3MLWH 3QUYD 4A7GA 3LZFH 4MZ3A 2O1AA 4PCYA 4IDJH 1PAMA 1CF1A 1X5GA 4UCFA 5I8OH 4HDIB 1U8QA 2NY6C 3MA9L 5A1AA 4NRYB 2YQBA 4HJ1A 4ANXA 2Z1PA 3VXSE 4EZMA 3GSXA 2ILLA 3CN2A 1TUPA 4R5VA 4CADB 3NJJA 2WLJA 4CSPA 2FJGA 4F2EA 4J2QA 3EOBA 2CO2A 3VXSD 4ICXA 5CNHA 1P84J 4NQVA 1G84A 1GHFL 3MRQB 2DQUH 1HSAA 4PREA 1QSFD 1B0IA 3DTXA 4P2OC 5E8NA 4L1DA 3EBGA 3CFCH 4IRZL 2LABA 3ORJA 5IWLA 4CAGA 3KPNA 1C5CL 3WTSA 5IMKB 4MXWL 4ZW6A 5EOCL 2ORBH 4X0NA 2HG5B 4LEXH 4P5MB 3L6FA 4ELMA 1BBJA 5KVGL 5IOKA 4JFFA 2DKMA 3FCGA 2VR9A 4HUNB 4ZQTA 1QI3A 3LIZL 3MUZ1 1NBZB 4KH9A 5BV7C 1H9VA 4ADGA 5GGVL 4CW1A 1P2CA 3DIDA 3FB6B 2CCWA 1T7WA 4W9GC 3IN2A 4U1NA 1HEHC 2OL3L 3BPNC 4JPIA 4KTDL 4PD4K 4Q6IC 2AZUA 2R29H 2YGPA 3QIBC 4G8AC 1J8SA 4ZTOL 1BG9A 4WW2F 5LVEA 4GKZB 4YQXH 3P02A 1J0JA 2WBXA 1M6OB 3CFDA 4ZMZA 2IGFL 4HUXB 4FFZA 3MRQA 3HG1B 2H0JA 3DSFH 1N0LB 1XF5B 5D5ME 3JWDH 4WO4C 3SDDB 3SO3B 2DDQL 3TYGL 4APQB 1JWSB 1R5WA 3EG9A 3EDFA 3VMNA 2HUEA 4FQXD 2NY0C 4W68A 5CFAA 3KYKL 1ZTMA 2IXQB 1ZA6B 4GQZA 3BRDA 4IMLA 2XHNA 3BYTA 5DO8A 5I15H 1OTTD 1N4XL 2JI3A 2GUOA 5D93B 5K9JH 3QXAA 4WUUD 2D9CA 2OMYB 2Z4TA 4P2OA 4IJ3C 2BP3A 5E8OA 3QXVA 1B4RA 1OP5H 3B4NA 2FX9H 1BM7A 1TJHL 2D7TL 3BP6B 2VXQH 3C5ZA 1DQDH 1UB6A 2DAVA 2J3SA 3EO1A 2HMIC 1NGZA 3QJFB 1KLFA 5JIIA 1UATA 1BVKA 3IMVA 1H6FA 1IEBB 1NEPA 3F83A 1K2DB 3EBHA 4U1JB 3WE1A 3ECQA 5FUCE 1ZVSA 3BFWA 4KZEL 3FC8A 4MASA 4XO9A 1CZ8H 5HDOA 4AUUA 5IR1A 3N55A 2VQ4A 4ZNEA 1KBGL 4F2FA 2AJ3A 3MV9A 5EN2B 1EXUA 3GI9L 3D3VD 3GZPA 4KTEH 3O4OB 4Y5VB 1YYLH 1QRNB 1ZDQA 3TNMA 2XWJA 1XR8B 2YQ3A 5DJAA 4XPFH 5FHBL 5I23A 3IMUA 3RDTB 4JRYD 1GYUA 2BP8A 2EKSB 3WN5C 3LZQA 4FLQA 5IW6A 4TLTA 5IBTL 1OAZH 1ZA6A 4GRWB 2UX7A 4Y9FA 4NOBA 3RX8A 1LK2B 1C12B 1RVFH 3UG5A 1QSZA 4S1DC 2QLYA 4MQSB 4BUGA 1SDDB 3UTSA 5AVWB 5LBSL 5C0RH 4HOMA 2BY3A 1NBYB 4M9PA 1VFBB 1J8HD 5L8KB 2XG4A 2BM3A 3DGCR 4XHJC 2F8OA 4TPRH 4DHLA 2ZX7A 3KLHD 4E9SA 3EO1B 2CR0A 2VLRD 3JZ7A 4GI9A 1YEHH 4KVCL 2IMNA 1SJHA 1ADQH 1D5MB 3B2PA 1AXSB 5DO2D 4AEHL 4IRJB 4DVRL 2PLTA 2IAAC 3L08A 2X6MA 5L0QC 2EH7H 1TVHB 2CDEA 3OLIA 5FGCE 4P2CG 3SKUD 5JPNA 3V0GA 1RZPA 2P45B 4NHCH 5DJXA 4BH7A 1F4AA 5KEZA 4TKWA 5E9DE 2QKSA 4A2HA 1NSNH 4YR6B 4DQAA 3G6JF 4Y5VA 3AQXA 4OR1A 1A5FH 1CB4A 4J27A 1DVUA 3LV3B 5CD3A 2PTTA 4LVNC 1BPVA 3H0TB 3NCYS 1M7XA 5EG6C 2VZVA 3GSOA 1BM3H 4PMFA 5FLVA 1ZVNA 1N4XH 1QP1A 3NCFB 5DSCA 3L3HB 4OFYA 2VAAA 3LRGA 1CIUA 5HGBA 4KQ0A 5AKTA 1WITA 1ZS2A 1MFVA 2O5YH 2HKAA 1Z9MA 3LRHA 5C1MB 4YSTA 4P59L 4L1HA 5EULV 3JWDL 1RZGB 2VT0A 5FYLL 5AW0B 1U3HC 4YHZH 3DO3A 3GINA 1DVYA 5IBTH 5M95B 1XAKA 1XGQB 4EOWH 2ZXGA 3QIWC 1J8KA 5DJ0B 1GXEA 2YOCA 2YOAA 4HS3A 5DMIL 4N9OB 4X4YA 1HCZA 3I3BA 2LT9A 4ALAC 1IBZA 4XHQA 4OGAC 1MRCH 3T71A 3UYRL 4XNQB 3PREA 1IGJA 4HP5A 2JTDA 4MLIA 3UEQA 2EYTA 4XWOC 2R51A 3CDCA 4HT1L 5C08D 1DSWA 1KZQA 2XBZA 3WS6C 2YKLL 2D73A 1A1NA 1UCTA 2I26N 1IARB 3RFRA 2PWGA 3B8YA 4P5RA 2VC2B 4FZ8L 3OQRA 5HHMB 3RNKB 3ZKMD 1HTYA 2OSYA 4J3OD 5CJXA 1KN4L 2D3LA 4KK9D 2ORBL 5DHVA 4G6FB 2FX9L 4KFZC 4X4KA 3C6LD 2VXVL 3O2WL 3WIFB 3T8MA 4YSQA 2WLIA 1CDIA 5AVYB 5KVFL 3CQFA 1OGSA 5DRWA 5LJYH 1SJXA 3U4EA 4JHAL 4R4FH 5TPWL 2EP6A 1T7YA 4XE0A 5AVUB 3QHZH 3KYKH 5I18L 1NC2B 1YG9A 3BT2H 4LPXA 5HI5C 5CP3H 3GSVB 1UUNA 4TSBH 1FDLL 1P7BA 2IXQA 1SOSA 2VXTL 4GW1B 5EEYA 1H5BA 3AS3A 5HDBE 4RRPG 1SXCA 4APQC 3NIFE 5I1HH 4M7ZC 4OGYL 2IOOA 2IGFH 4I2XA 4M00A 3HR5A 3OR7B 5IQMA 3T0EC 4A37A 5JHBA 1VESA 4L9LC 5EF1A 2J2ZA 3QORC 3OF6D 3RKDD 1ITCA 1WT5A 1VEOA 3BT2L 4B9FA 3B7RL 1DE4B 2JI1A 3SKJH 2EYTB 4CN1A 3FFCB 5J0BA 5AZEH 3C5ZB 2AAVA 3IDJB 4E42B 2G60L 4XAKE 4OY9A 1SXZA 1IGTA 1KTCA 2P4AB 1T20B 3H42H 4XBGA 5DJ6B 2PW1B 5MHSD 3R0NA 1A6AB 3AWEA 2FLBT 1FNGA 4UQ3B 5F89B 3FF7A 2R1WB 4FQLH 1AGBB 1SLWA 4WCYL 1EBPA 4F2MB 1OSZA 3CFNA 4JM2B 5LXGH 3AWFA 4ZTEA 4GI8A 1TZGL 32C2B 3K0YA 4MJ6B 4O9HL 3O6FB 4NC2B 4NLAA 1GH7A 4YZFF 5B1BB 2VN4A 1AYRA 3SDAD 4DPCX 3ME0B 3OV6A 2TRHA 3FO9A 2W60B 1UVQB 2BNQE 3QXTA 3S4SG 1JZFA 3GRWH 4FFYH 3BDYH 3P3SA 4FOMA 3H7BA 1HE7A 1SN2A 3SDXB 3JV4B 4UTCA 5CD5D 3QCUH 1HI6A 4OLVL 5L2KB 1MVYA 2BS71 2X38A 3IXAB 2V7NB 5GGRB 3RWEB 3UTSB 3UDWC 3MGOB 1J5IA 2NY0D 2F1BA 4JX0A 4YZFE 1S5HB 4J7RA 3TO4A 4GS7C 2P8PB 2VMEA 3EH5B 4U1GC 1KCRL 4GUOA 3FOMB 3AREC 4JM2F 1NBVH 2ZSVB 1UM6L 5E2WL 2K4AA 1PLCA 3MODH 1JHKH 5L0QB 1T20A 1RULL 4M8RA 2DQTH 3LEXA 2ZJSH 3VA6A 1AXSA 1X5IA 3QFDA 3VD9A 1YN7A 2J5LC 5TF0A 4OQTH 4J28A 1I4FA 4G8FA 3II3A 1U95A 5I8CB 1BXXA 1FO0H 4I3SL 3G9VA 4Y4FA 1QLFB 3FT2A 4HJGA 2CBQA 1A8ZA 5G5DA 4JANB 3OB8A 4HLZH 4QOKB 5C0IA 5DEZA 3LQAL 3O6FA 15C8H 3MMEB 3VSUA 3QCVL 4GG6F 25C8H 4PBVC 5CD3B 2PTTB 4Y2DB 2X4UB 1G1KA 3ME0A 1UTDA 3FO9B 3ZPDA 3CQPA 1Z0MA 3LN5A 4LHUA 2J44A 2K9UA 4YXHL 2ZWNA 4QHLB 2WINA 4PWHA 3X13B 3E9TA 4KU1A 5E94A 4JKNA 4P46D 3VXPA 5B21A 3ZE0F 3QDJE 3KVPA 1RUPL 4G43A 4JRYE 4X8GA 3L3DA 2IQ9L 3ZKND 2ZUQB 3LY6A 4XVJL 5DMGC 3BPNB 4JGUA 5AZUA 3RWEA 5T3ZE 1BQRA 4H1LH 1YEEL 2ENQA 3TT1H 4Z78B 3T3PB 3UOAB 2WYTA 3NEOA 4G6KL 3UH8A 1HHJA 1OM3H 4AL8C 4TNFA 5F93C 1MQKH 3QDGD 5IEKA 1W8OA 3I9AA 1AHWB 4HIXH 1ZT7B 1KNOB 5J1TC 4UV4H 1UCBH 2CZNA 3DGGB 2W95A 5DJ8A 3BWZA 3KR3L 4G8GB 3UTZA 3CBJB 3MXVH 5IFHH 4UTBL 4E9TA 1YN7B 5TD4A 4AIZA 5C9JB 5IW3A 2Y3NA 2PWDA 1L7TL 1EIBA 3L7EA 4JFQB 1QSEA 3T8XB 2AGJH 2CBMA 1YNTA 3I50H 5GGSA 4Y2NA 2CLRA 3FNKA 4GB9A 4KROC 5E23A 4B95C 5CGYD 1IAIL 4DN4L 5EPMA 4YZWA 4BSWA 4H1LA 5AW3B 3GI9H 2FX7H 2F6AA 4DGVL 3P0YL 4ABWA 3E9UA 3N42F 3KYNB 2V5SA 4M1DL 1DLHA 1BIHA 2MTPA 5HGGS 3D87B 3SDCD 3SE8H 4E36A 4NQDB 1IAKB 1A7NL 4OW6A 5AW1B 3MV8D 3IDXL 4JUTA 4KJQC 5BZZA 1JJUA 2DL9A 3OHXA 4NKDB 1N3NA 2IWFA 2ZT9C 1CICA 1MHCA 1KLGA 4IBWA 1ZV9A 5ABDE 4KAQL 3RLSA 5IB2B 1UZ6F 1OD7A 1HJBC 3F6JA 3MRFB 4N6RB 4ZJ9A 5FGBA 2NW2B 3UZEC 2V3FA 5C0AD 3QYCA 1J5OL 4GW1A 2WUBL 4C83B 5LWYL 3WJJA 4NM8H 1M7DA 3HN3A 2PO6C 1ZD6A 5EEWA 5FYJE 3TT1L 1A7OL 2E7LA 1HOEA 5JLZA 3B2UD 4JZJA 4OFKA 4JEGB 2JLLA 2F54D 4C4KO 3Q6FA 1QSEB 3U36B 2FJSA 4JB9L 4L3AA 5A2KH 2V9RA 4L9LB 2J55A 4H0HB 3UTTE 3G5WA 5HPOA 3DRQA 4NPKA 1PF3A 3QRFM 4QHPA 3CVCA 3EJSA 1T22B 1N8OE 1DUZA 5DFVD 2EC9T 3GEWB 4L2YA 3VE0B 4YEEA 2OYLA 5I6XC 1BAFL 2A83B 3B7SA 5AKSA 3DC0A 1RHFA 2NY3C 3LNFA 2VKWA 1T0PB 4LLDB 2JJUA 4K3EH 2DY2A 4QF1B 2XG5A 4XMKH 1XX9C 4X6CA 3RGVB 3FPYA 4KVPA 2ITDB 1OOWA 2X4NB 32C2A 2ERJB 4MJ6A 4ENZA 4LEOA 4G3YL 3LSOB 4LHJB 3WV0A 2KUTA 1HVXA 1SEQH 3L16A 3BXNA 1PG7X 1HXYB 3HR6A 2N7BA 3BKMH 5IQLA 3S37X 3GTNA 5T1LB 3WFDH 3DVIA 2N1KA 2Y0SA 2GAZB 4N2EA 5A16A 5FDWB 2VWEE 1PL3A 1RUKL 1ZSHA 2ED8A 4LP8A 3PIQB 2VMDA 3JZYA 1HI6B 3VG9B 3T3ME 5GZOA 4QXGL 5EOCH 5G2NA 5KBNC 1JHTA 3KPQA 3IXAA 5GGRA 5F9WB 3MGOA 4XBEH 5CMAA 5DQDH 4YXKL 5KYNA 4WJ5A 1KIRA 2VLRE 3N85L 3MR9A 4Y16B 1NOAA 3ZKMC 4F8TA 1RZ8B 1HH6B 3TJEL 5HVFB 2E0PA 2CUAA 1DJZA 5ECGA 5ID0A 3T0ED 5ACMA 3KMDA 1F3RB 2E7HA 5BO0D 5I1IL 3T3MF 1S7SB 4JN1H 1MWAA 3FAWA 2A83A 4AENB 4BQCA 4XN2A 1IB5A 4PS8A 3ZIYA 4P06A 1JK8B 4OZHB 4AYBA 3HBQA 3H6AA 3MFFA 4PWIA 3DI3B 4YPGB 4B5ZA 1NMCB 4PJHF 4EKJA 5K69A 1JZDC 3ZHFA 4OCXL 3ILEA 3RJOA 3X3GH 2RA1A 1G6RA 3O45B 1SEQL 3HE7A 3I6LE 4YHLH 3SDDD 4APQD 3DUSA 4LLUB 5D2NE 1IGIH 3TN0B 1GSMA 3TBVA 2JKXA 3G5ZA 2ZONA 4XMKL 3FHQA 1T1WA 2YXWA 1FI8C 3QS3A 4IJTA 5J6GB 1PKQE 2W0KA 2BVEA 1HH9B 1PY4A 4QDGA 5BXFA 2QPFA 4WV1A 1FBIL 2P24B 4UV7L 1JHTB 1CU4L 2LAAA 3KPQB 4QD2E 2FGZA 4HW6A 5LLIC 1KCUL 4PJ8C 4G1EA 3MR9B 1R24B 1J9QA 1IQDA 3DDFA 2KPNA 4Q0XH 2C9XA 4YIQB 3FTVA 4CILA 5C2BL 1SYVA 1HL8A 1JCKA 4GY4A 4AMKH 3TEUA 1KNOA 2NLJB 4D3CH 5C0CE 2VITB 3EO9L 3UXFA 3NN8B 4L4VA 2Z8SA 3V4UL 1PY0A 4Z76A 1MWAB 4ZW3A 3IJEB 2QLVB 1BFVH 3B5GA 4J3UA 4OGZA 3VXME 4LVEA 3EYUH 2QTEA 5IVXE 3VVVA 2BINA 4OZHA 2Q8AL 3CTTA 5DS2A 1AH1A 1F8TH 2AEPL 3V6ZA 1G5AA 2K9FB 1CGVA 1MZZA 1RJYB 1ZS8B 3QZMA 1KEGH 1OF0A 2ZYHA 5BOZG 3BIKA 1OAXH 3ESNA 5JW3L 1SPDA 3FH7A 2BRRL 4ZMYA 5CZKA 1YPZA 3AREA 1I85C 4NS0A 4TQPA 3GIZH 4O02A 2YKLH 4I0CC 1CLYH 3Q3GB 2DV6A 2WWKO 1U8HA 2XZAL 3VXUA 3G5ZB 4HT1H 3OZKA 3W57A 1D5BA 5SWZA 1TQCB 2K6ZA 4GSDL 4PTUA 2IO5A 2A0LC 3WKQA 4OSUL 1HH9A 1JRHL 1AIZA 1S7VB 4IYKA 3FQRB 3GD1C 3P0YH 1MRCL 2NY5C 2I9LB 1AI1L 3FFDB 4WWOA 2V37A 4DKFL 2WVSA 4HXAH 3VFRB 1R3LA 4EMZA 2BY2A 3O2VH 4JCMA 5T5NF 4UINH 1FYTD 4EIZC 1GY1A 1BAWA 1BCIA 1L7TH 4W6YB 3QZNA 3MJGX 1PNDA 2XZZA 1WICA 1I1YA 4OFVA 2EDEA 5F0LB 4L4VB 3IGAB 4CA4A 1DN0A 3E3QC 2WXRA 1T66D 2EXWD 1ORQA 4Z23A 3KPTA 3P2BA 3HI5L 4XPFL 5FHBH 2MQGA 4MA3B 2BNUA 3QCTL 4Y9EA 4O5LH 1ET7A 1LO3H 3CSGA 2GVYA 4GAAA 3TP4A 4M6NH 3NGBB 5FUCC 1XFPA 4Z3HA 1FYHB 5T5FH 4KKZA 3DYOA 3MI6A 3QJHB 4NT6A 5T3XL 1FCCA 5BZDA 3FB8A 4KMTL 1IX2A 3KJ6H 3GO1L 3V2AR 4XVJH 3CFEB 4AJYV 2ITEA 2WB1A 1HT6A 1R3JB 4FI6A 1A5FL 5GRJH 1A9EA 3HUJE 2QVTA 2Q76B 3S96B 1FZMA 1LO2H 2E46A 4AQAB 1TU2A 2IH9A 4KK6D 1HOCA 3CDGA 2YUZA 3AFLA 5DLLA 2AKRB 4PTUB 1HL4A 2VZSA 5IMLB 3I6GA 4X6DF 5DZOA 5T1LD 3DBSA 4Z7AA 1NA8A 4F9LC 1D6EA 4BFEA 4Q9RH 4KZDL 2OSWA 3F04A 3QFGA 3T09A 5CS7A 3T3PF 2YSSB 3GIVA 2Z65C 4RSVA 4AM0A 3HKZA 4GH7B 4O51B 3FQ1A 4MTMA 2FUTA 5HGHA 3THML 4BHUI 1HYSC 4NWTL 1UWFA 1ZY9A 5FUOH 4KXCA 4NO0D 4N1CA 3RBGA 5B22A 3ETBJ 4MD4B 4WJ5B 1I7TB 3WKML 4AGNA 2EO1A 4HK0A 1OHQA 3SBRA 1FL3A 3ZE1E 1GKOA 3WMPA 4OIIH 4AY0A 5DCCA 5J3HD 4Z7WA 3TBSB 5I73C 3OSVA 3K4ZA 3TBWA 2JTYA 3SDCA 3GXIA 4H20H 1OWRM 3BP5A 4JZOA 1JXFA 1PW3A 2OL3H 2PCPA 3MRGA 4YDVB 3EJTA 3T08A 1JK8A 4CJ1A 5DUPH 1EVUA 1Q9KB 2VYRE 4A2GA 1AR1C 4JFPB 2E27L 2QEJA 2HMID 4OCSH 5FLUA 2VDOB 2J8UA 4Z8FL 2X1QA 3B9AA 3FSOA 3BDYL 4GOSA 3U4BH 3CGTA 2Z91A 4JR9L 4Z7VB 4GLRI 4J3OG 4P5TA 1NTDA 3MJ8B 2BNQB 3F12A 4RWYH 5BUGA 4BQ6A 1PJ9A 3ZR5A 3G08B 1MCQA 1MFCH 4HCRA 3GIVB 1CDYA 3K0WA 1KF9B 2WWOA 1P7QD 3QG6A 1N64L 2JB6B 4NN6B 4S11A 5EU5B 3TBVB 3BVNA 4OZGE 3P73A 3T9WA 5HGAB 3EYOA 1YEIL 3ZSSA 3NCYP 5F3BA 2HTKD 1MWOA 1P6AB 3L17A 5GRZA 2IDCA 1E4XH 3MZGB 4RGND 1BG1A 4OAWB 1GIGL 2DI8A 1L6XA 3LIUA 2CGYA 2GQHA 4J8QA 4NQTA 1PZDA 2RCSL 3K74B 1IBYA 4RETB 4WHTA 1CXFA 3RWGA 1JYVA 5ENWB 1YYMH 3FFCD 4HK0B 3VRLE 4FHJA 4ONFH 5LN4A 2VDRB 4P5KA 3QDMD 2ALWA 5J11B 2NY3D 3HNVL 4F7CA 3MRDA 2AV7B 3O9WC 5EIVA 1IC7H 3IDNB 3NN8A 5JIHA 5MEPA 2I5YL 1L9TA 2IPTH 1NIBA 4JLRA 4YHOL 5A7EA 2BSEA 3MRGB 1F6AB 3ARBB 5JHAA 5I1HL 1IJ9A 5HJ3A 1ZXQA 5L9DH 2NY4B 4JQXA 1EVTC 5IB5A 3V6ZB 4MS8C 3HNVH 2K78A 1WFNA 3KH4A 2GY7B 5TK2A 3RUGA 1UQSB 4JO2L 3B7TA 4ONFL 3OX8B 5HHOB 5DR5L 4IKIA 3VD2A 3K1KC 4JM4H 5GGVH 2UXFA 2ZKXA 4JO1H 5CJOL 1DJGA 2E75C 3TYFB 5HYJB 1HESA 4OH2A 3WLBA 1CMOA 2VJ0A 3DVGA 3C5JB 4AC4A 1BAFH 2C26A 3PWPA 4L8SB 5GGTH 3UJIH 3VNYA 2DQCH 1ILUA 2YR3A 5KG9B 3S7GA 2XU9A 2VKXA 2XTSA 1JZGA 3J7HA 4NN7C 2F53D 5KVGH 2EVJA 2QGBA 4WHYH 2XIIA 3AWGA 2C9QA 5SWSB 3TZVB 1KTLA 1UJTA 2I5YH 2VDPH 4JB9H 2EKJA 2N3JA 3MDJA 2WQWA 1YC8A 4QRRA 5JNYB 2NTFB 2YAOA 1Q90A 3QUZD 4A55A 1NGWB 1IJNA 4J3VA 3TJEH 1I1YB 3FUJA 1ET8A 1QSFE 1MCBA 2MRYA 1B0WA 5ABAA 3ESVF 1NH6A 5DLML 1BLNB 2WUBH 2HWZL 2W9EL 4DOHB 3CLFL 2CO1A 1I1CA 1TPXB 3IB4A 3ZKSD 2HLFD 4AYDC 3PQYE 4MZIA 1TETH 5SV4A 4YSCA 1NANH 4LBAA 1YEDB 4G82A 1UQSA 3V0WH 2WZ0A 5CCJA 1WD9A 1PD1A 1WHPA 3J27A 3O3EB 1K5NA 3HE6A 5HPMB 2YAFA 4OT1L 1XF2A 1EWHA 1UA6H 4JRXD 2VCOA 4UM8B 4OBRA 2NYYD 2DI9A 2ZPKH 5JQ6H 2BDNL 3SDXE 1EBAA 4QRSA 1QR1B 3VI4B 2A73A 3IFOA 2D3JA 4XXWA 1E6OL 1YEFL 1RIVL 1UYWH 1KYUA 5KG9A 4G7RB 2FNWA 2VLJA 2ZOLB 3I9PA 4K3JL 1O7DC 5IUCA 3EYSH 5GZNC 2CGRH 3B9KA 4Y5XA 3OAYK 1T04B 1ZOXA 1YECH 2BVQA 4QRUB 4MGXA 1T89C 1A1OA 3V7AE 3H8NA 3IDGA 2WHVA 3W0WE 3BEVB 4R4ND 3L3OC 4XVUD 1CGXA 1A4KB 1P4IL 4EXPX 3RWIA 3COOA 5DK2A 1PKQB 5KN5A 2C1PB 2ZYSA 3M6DA 4M7KH 4QHUA 3TVMB 3WKMH 5DHXB 1I1AC 2PTUA 1X5JA 2YWZA 3AZUA 4CSTA 1YEHL 4FZEH 4KVCH 4G72B 1BOGA 3VQ2C 3S98A 4NRYA 4NQSA 3NFPA 2ZXCA 3C75A 3F85A 2KMWA 4E9VA 5T3XH 4Q52A 2WVVB 5LBSH 5C0RL 5DYFA 4Y5XC 5LAXA 3QCTH 4UU9A 3BP5B 1QW9A 4ZW8A 2X4QB 4HIIB 4JPQA 1OTSD 5GPRA 1Q9KA 1UB5B 4YXHH 1KACB 1PX8A 1YY9C 4BCZA 1T83C 2FH8A 2X1XR 5E8NB 4S0TD 4J2XA 2VDLB 1IBGL 4OLYH 2A3TA 4QTIL 2H1PL 5C0EB 2YD1A 4OF3A 4W9KC 3GC3A 1EGJA 4NN6C 1B2WL 3WE6B 2CGRL 2YPKB 2WTOA 4LHQB 3CBKB 4NQCB 1DBBL 4M7JH 4PJ7F 5D9SB 5L88L 5F7YC 4ELMB 5FB8B 4ZUVA 2BVQB 4QRUA 2WXHA 4JFFB 3BVNB 4IGBB 4Z3JA 1KSRA 3MV8A 4JFZL 5HGAA 4CVZB 4L5FH 5L2JB 3BEVA 1UURA 4XC1L 2WV3A 2EZ0D 1DR9A 4QRBA 4HMDA 4O5LL 4N5UA 2NY3B 1FZKB 2YXFA 5CXPA 1EZSA 3P3TA 3RPBA 1GS8A 1E5YA 3X14A 2AERT 5ENWA 3ATEA 1NBVL 4GI6A 5A6LA 4NQSB 4QYAA 4PCTA 4R0LA 3JWOH 3U1SH 3GHBH 1D9KC 4U0RB 1URZA 4DN3H 3U6RA 5CEZL 2FEEL 1WWBX 1SHXA 2Q8AH 3MCLH 2YAEA 3NABH 1D6VL 5KVGE 3UX9B 1R4XA 2O26U 4NZJA 3S36L 9CGTA 4UU9B 4H88H 1AI1H 4EJ1C 3GK8L 4FG6C 2BNRD 4S0SD 3FYEB 4F57H 2BO0A 4WI3A 5H8DA 3M86A 3D48R 3NCMA 3UO1L 1KFAH 1J9SA 2GB2A 4LSSH 1WWWX 3SGJC 3US9A 4DEWA 5FC9A 5GGUA 3RUGB 3TYGH 2IFGA 3V5DA 1H3TA 4LVOC 5FUZH 1MCCA 1C9SA 2LVEA 3MRBA 3QWRD 2QSTA 2X9XA 3GMPA 5D1QC 2MKLC 3FT4B 4KI5F 3MV01 3OAYH 2DQEL 4CDHA 4RFOH 5TQ0L 2GT9B 5L2JA 4AEFA 3GS0A 3HRPA 4OF5A 4QXUL 3C5SB 4OM0H 5FM5M 4DPBX 2C4FT 3ZDZF 2ARJA 2MPAH 5A2JH 1M6UA 1M1XA 5I16B 4GRWH 4FYSA 4ETQB 2OLDA 3ALPA 3Q5YA 3EH4B 5CZVH 5I1GH 2EABA 2UXGA 4QR7A 3R4DA 1LILA 3DARA 1MFAH 4NQCE 2O5ZL 4H0GA 4QNPE 3EHBB 1YEKH 2VR6A 3QIWA 4OGYH 2ADYA 1B4JH 4XPHH 5D4HA 3ZE2E 2QSQA 3T0XA 2Y1AA 2XJKA 2BIIA 1EJOL 35C8L 1DZBA 2G2NA 2Q86A 3IKCB 3LKSA 2BC4A 1EO5A 5E70A 1CFVL 4HZAA 4ZAKD 4WFED 3EKCA 3ZDYE 4OLVH 4MZ2A 3KGUA 3M8OL 1N5YL 2HWZH 2W9EH 2YARA 4M5YL 2WJ7A 3DO7B 1GS6X 3A5VA 1JZ5A 2HX8A 4BZ2A 5FGBC 2NY5L 1W8NA 3V5DB 5F0PB 5JHDE 2NSXA 4EAEA 4D9QD 1U2YA 1WFTA 1SUJA 1KENL 2Q6WA 2DL2A 1JXGA 4YXKH 3FU7A 1WO2A 1CFVH 2JIXA 4UUJB 2WY3B 4N0FB 3BSZL 3FOLB 3PGCB 3CHSA 5MENA 5GSVA 1Z5HA 4DK5A 4MRBA 2W0FA 5I1AB 2EDQA 3BSZH 1MFCL 4YBHA 4ZFZA 4LBEB 1XO8A 4WCYH 3LRLA 4KUCF 5IW1A 3IWVA 4JN1L 4ZMOA 4MJ4A 3FYIB 3FU8A 1QPXA 1JTPA 3VQLA 3OJDA 5DJZB 5E4AA 1JPFB 1K8DA 2R2EB 3H42L 3MAWA 4LCCA 2UWEF 1Z5LB 4ZO8A 2VZUA 2RAMA 5KZCB 3N6YA 1HKFA 1ONQA 2HRHA 4Y19B 1B0GB 3SYQA 5GS1C 4FMFA 3WO3B 1NGPL 4G59C 4WSGA 3GSOB 5CINL 3SZKC 4YLQT 1LEGB 3JTTA 5F9AC 1AR1B 1EPFA 2UZYA 1B4JL 2F2HA 3HN5A 5KSBA 4HV8A 5I8EA 1NLDL 2IPTL 3N1QC 4YHOH 1KXVA 3ARUA 1GZQA 1J0HA 2BPBA 3GLDA 3UG3A 2VIRB 2HLFC 2HRLA 4UBDD 4K7FA 4WJG3 1NJ9A 3NZUA 1CGUA 3ZGIA 1JGVH 3OB0K 5DRXA 3IF1A 1A7OH 4ABUA 3VFSA 4CMHC 1YUKB 4Q56A 3BPLB 3VGEA 2NW3B 1ZSDA 2ZYIA 5E6ZA 5TDPB 2Q8BL 4N0YL 4RRPA 3T2NL 3G6DH 2BSCA 4HS3B 5IHHA 5GSVB 3VX1A 5TDOB 4ALAH 2WYZA 3H2PA 5KYXA 1ZHKB 1HWHB 2BP0B 4XX1E 3RTQC 2QVKA 2X70A 4YHML 4AYSA 1HL9A 2CG9X 5LUMA 4CVZA 4NWUL 3ULUL 4TNWK 2X7LA 4JFTA 5DJZA 3C5ZC 1YPZF 4JM2C 2A6IB 4XZ4A 3SKOB 5IF0B 5B8CA 2UWEA 4UQ2B 4F8NA 4ZS6C 2DW5A 4ZUSA 3MQIA 2OKMA 4MYWB 1AZUA 5AAMA 4B9YA 4G8IA 2AFNA 1S3KL 1TCRA 4P04A 3BE1H 5LBSA 1FV1B 3TIDB 3ZL4L 5F96L 4WY7H 5ERWA 4CGTA 2C4FU 4PG2A 3RILA 4O2CB 4AL8L 1PNCA 2AXFB 3GZOA 4K7PL 4GQ9L 1YCSA 1GGBL 2JKLA 3QHFL 1UXWB 2A6JB 2JQAA 1ZWIB 4U3SB 3HAEG 3S36H 2VLMD 3VNZA 3A4EA 1WFMA 4BUQA 1I8LA 4ZMPA 3FN0H 3DPBA 3RJQB 4PRPD 5F9OH 4KV5F 5A40E 3OXRB 1WFOA 5IROC 3QEHA 3V10A 1NZRA 5FYJH 5B1CA 1I9EA 2H0FA 3KBEA 4Y2DC 1WGVA 4EQ3A 3GUTA 3US1A 4UINL 4HF5H 4JFXA 3DO4A 1JZHA 1GS7A 1SLXA 2ZQKA 4KJYB 3U9WA 1H5BB 5TDOA 3PWNA 3B5HA 5E0QA 1U8PA 5B39B 1HAWA 1GW6A 1S9YB 1UT2A 1N19A 1XAUA 4I2XB 3C6EA 3I6KB 1RPQA 4MB1A 4XCEB 3THMH 4F7PA 1JRHH 2UVFA 4HCFA 2Y5TB 4HIQA 3BC9A 5C86A 4FTVB 5D1XA 5F1NA 1IAIH 2XCMC 5J1SC 4ZODA 1RUPH 4DP5X 2WUCH 1F86A 4PH8A 5AD0B 5D6CB 2M83A 2FWSA 1OW0C 1XMEB 4UTBA 1KBBA 3D69A 5FKAB 1IGTB 3RX5A 4P2OD 4UQ2A 4ZUSB 5D7SH 1M1XB 2ZZUT 4ETQA 1FV1A 1X9RA 4TUUA 4U7SA 3GBML 2CIKB 1LO2L 2VDPB 1J11A 4ELDA 5KSAB 3KD4A 4D7PA 2AEPH 3MUUA 1PZ5A 1QUNA 1OTUC 4J3WA 4ZSOA 4BA8A 2X0VA 1O5PA 3TVMC 4DK6A 2WQ8A 2VW4A 1L7IL 2X0WA 4TNVK 1BFVL 5ANHA 3DPBB 4F27A 2H47C 1Z1WA 2YPLE 2Y7MA 4H0IA 4Z3TA 2JXMA 3VD1A 1HZKA 1NM9A 4PS4L 3NA9H 1SZNA 3N91A 2W60A 1A6UL 2YPVL 1NLBH 3JUZA 2GSGA 4M1GL 5B1KA 5FF6B 2D31A 2FSEA 1UOVA 1TTGA 1NWOA 3CFJA 1TXKA 1XMWA 3ESMA 4AXWB 1DDHB 4QEGA 2ICWJ 4FTVD 4PRHA 4AE0A 4X6EA 5E0FA 3NH7H 3FMGL 3BH8A 1AGFA 1MHHA 4HAKA 4LOEA 4N5EC 3N5AA 3PQYB 5HGDB 1X6NA 3FN0L 3TPKA 3O8XC 2B1HH 5F88A 1D9KA 4X5QA 3S35H 1NGPH 1SY6A 1RI8A 3O2VL 3QGVA 1J9TA 5GZOC 4Z3EA 1VENA 5I8KH 4HA1A 3NCWA 3EJYC 3HMWL 4YL4A 1FO0L 4I3SH 5KSBE 4D9RD 3MJWA 2FIKA 5F96H 3U46B 2VR8A 4QJ4B 5E2VL 2LLNA 2UY7A 4Z7VF 3U9PL 2DMBA 4ENED 4FFYL 2A9AA 5IW1B 4FA7B 2BDNH 5AW5B 2ZWLT 1IT9H 1HWGB 3FT3A 3OJDB 1NC2D 1QKZL 4G9DA 5DTFB 1QUNB 3ULUH 1HQRB 3D0LA 3GM0A 4Q9CA 1XR9B 2ED7A 4JFDE 3N9GH 1EMTH 1PEZA 5DWUH 1S3RA 1U8QB 2IMMA 1JP5A 1BVOA 4G8GE 1C5CH 3FCBA 3E0GA 3F05A 4MAYC 1KBPA 2H2SC 3CHOA 4AVKA 3AS2A 4Z7UB 3U0PA 4FHKA 3RDTA 2UZYB 4UAOB 3Q2VA 5DR5H 2CUMA 2WVUA 2WN2A 4UYPA 3RB7A 4QHLA 4XX1G 1KT2B 3POHA 4JGMA 2L04A 5E2UH 3S3CB 1LK2A 2BIQA 5EU6E 3U9UB 4XWGL 4F7EA 4JKLA 3ZRFC 4DF9A 1D9KB 5J6HA 1G1YA 1SDDA 5HYJD 1NCCH 5DRXB 1ITBB 5EOTB 3S5LB 3Q2WA 2I07A 3UZQA 2XG4B 4WFGE 4HFWA 3DX6B 4NQDE 2VABA 5BW7C 5KVFE 3HFFA 2AXHA 3UJIL 1XXFC 1KIUA 3Q2LA 2R29L 1TPXC 2IALA 3K91A 5D96B 5IREA 4ZUUB 1ACXA 1DQTA 4G8GA 4JO1L 4LCVA 3UBXI 3WFBH 2BOBA 3OAUH 4K2UH 4D7BA 2A9BA 2GABA 4IOSD 1TVHA 1NFIA 4IW4C 3IGLA 5ANMB 1XGYH 1ZTXE 4LDCA 3MTRA 3SKJL 1IAMA 4KI1A 1KCBA 4CW1B 5IQ9B 4JCWA 4BFKA 4Z7NE 3L4XA 1BIIA 4QAMB 1NCBH 2WZPD 2BY0A 4IU3B 1XB6A 3RTQA 3IRPX 3HE6C 4L37B 2FX8H 5ISZA 3WY4A 4GPVA 4TVUA 1A3RL 1D5XB 1KT2A 4CC4C 3ARGB 3MBXL 1UFUA 5F8QC 5JUEL 4JDEA 1T5WA 2R0KL 3AC0A 1LGVA 3WIHA 2C3WA 4EN3D 4YWGH 2VH5L 1JWSA 1R5WB 3QZWA 3RDTC 3WN5B 1SJVA 2WXKA 2ZUVA 3MRFA 2K7QA 5DJ0A 1TOXA 4IMLB 4N2FA 2R1XB 4N2IA 4PVBA 4UDTB 3TH4T 1JNLH 3QXAB 1OCOB 4OFYD 2EDKA 3D85D 4R0LC 1AZCA 4NEHB 4PJDF 4YHZL 3GMRB 2NY7L 3LEVL 3IDXH 1IGJB 2G2PA 2O5ZH 5D4IA 3J8F7 5GS3A 3LB6D 3QI9D 4BD4A 5FUOL 4RQQB 3QORA 3T6WA 1NGZB 3DRQB 1MJ8L 2MWCA 1BVKB 2XV3A 5E2VH 4D9RE 3OGCA 4NRXB 6FABL 4ZX6A 2C9RA 1E90A 3KLDA 3LH2H 5K9QI 3RWFB 1PFCA 1CDUA 5B39G 2DJUA 3OQ3B 3D5OF 5BVJA 3JT0A 4OGXL 1FFOB 4QF1A 3I6LD 1OPGL 1DLFH 4JVWA 2H1PH 1TVBA 4ORGA 3WMSA 3NSFA 5C6TH 3DJRA 4LSTL 5HHVL 1T1ZA 1OB1A 1PD6A 3BN9C 3N1PC 5FUZL 3V0HA 4LEOB 4B5EA 2NOYA 2R0ZL 1BFTA 3BQUC 1XHHA 4AEIL 3E80A 2YPLB 4MMYA 1T5KA 5GRJL 3VGGA 2D31B 1CF8L 2FSEB 3CFJB 5E7FA 1EFXA 3CH1B 2VSMB 2ODIA 4JRXB 2CKNA 4W6WB 3V6OC 5DK0A 5ACZA 2BS8A 5HYSA 1VGKA 3GZKA 2PKDA 1U8KA 2SEBA 2VC2H 1Y1DA 4HX1A 4YXLH 1D5IH 2OW7A 2Z3FA 3FUMA 4R84A 1YY8B 4F8PA 5E6SB 1V3LA 1KIRB 1OANA 1Z9PA 4K4KA 4KH2A 3FKUS 5DXWA 2Q20A 4X4XB 1HHHB 4B9GA 2OMXB 2J8OA 1HH6A 3PPSA 4NM4H 4TVPL 2EH7L 1M53A 2X40A 3VI3F 1U8IB 1QX1A 4JPSA 5DJ6A 3K6DA 3FUKA 3VI3A 1S7SA 5MHSE 2CDEB 4IJ3B 1WWCA 2R1WA 3KNBB 5EOCJ 2B2XH 4FYTA 4EI0A 1B0RB 2Z8RA 4KMTH 1YEGH 2PCFB 3KE0A 4P57B 3SO3C 3W9DB 2B2XL 4U1LA 1A9BA 3PNRB 4YDLB 3S9DB 3K2KA 3LXAA 3RKDC 1DJXA 3WMQA 3ARDC 3CN3A 4D9LL 1SFDA 5FM8A 3ZN6A 4F1SA 4C4UA 4JFWA 5HYSG 1EZLA 1JGIA 2BSBA 2YPLA 2BRRH 4OLYL 3TN0A 3ZR6A 4UMGA 5T3XE 3ZYJA 2IOIA 4XGZB 3NACH 3MUHL 5L4IA 3SDXA 3LHAA 4XN7A 5ICUA 3VSTA 3TBBA 4BQ9A 2B5IB 2NX5B 1D5IL 4G2AA 4EVNB 3BP4B 4R2GB 3BVTA 1OM3L 1TJGL 3TO4B 4Y0GA 3KJ4B 4EN2A 5BQ7B 2VH5H 1H6EA 1JD7A 1XGQA 3CPLB 5D4JA 5AAPA 2J1WA 4HFWB 3FOMA 1I7RA 2VDNH 2VABB 3VD4A 3F7RA 4BQBA 4YIQA 3QJZA 2ZCHL 3CMOH 1SYVB 1TQBC 2ZOTA 3ISYA 1KIUB 2BCMA 5C2BH 4HPHA 2XZAH 2ENJA 4A2MA 1RPKA 5KJ4A 3K8LA 1PIGA 3ENEA 4MNGB 2AVFA 3CSBA 3QEQB 4XNQA 1BXAA 4ODVH 4DTGL 4YSRA 3DUUB 3ALXA 5KVEE 2PABA 2Z92A 2JMRA 1X9LA 4PLKC 1B0RA 3RZCA 4YK4C 3FT2B 4HJGB 5IQ9A 4U1LB 3ZZLA 4PB9L 3UBGA 5I0XA 3ZTEA 1RJYA 1F8TL 4X9HA 1G4RA 3MUGA 2FGWH 1IM9D 5FS5A 1PYWB 2FBJH 1LWRA 3D08A 2VLKE 4WEMB 2CO6A 2AEQL 2VZ1A 1U4EA 4EKXA 2IG2H 3OTTA 5CN2A 5ICZA 1TTUA 3WIFA 3VXUB 1LNUA 3WIIL 1D5BB 1REIA 1YNKL 2K45A 3X13A 3ARGA 2BZ7A 1IIKA 2F5AL 3LZLA 1AKPA 3NQIA 5EUOB 2L7UA 3O4LD 1S7VA 1OK0A 4RGOL 2NX5A 2QTVA 1A1MA 5IP4A 4HVBA 5C0JB 3GSVA 4GW5A 2ADGA 4PWKA 1JERA 1C5DB 1ILSA 2B59A 5LGHL 4G8EB 1SN5A 3QDAA 4JM0A 3CLFH 4FFWD 1GKEA 4QIRA 3QDGE 4YSOA 1EUUA 3W9EA 1G6RL 3F7VB 4MVBC 5JHLL 1NDMA 4UDTA 3IJYB 3WXWH 5HHOE 4UOZA 1U4FA 2J57A 2AJYH 5DQ9A 3RIFK 5IB1B 3KYOB 2XWCA 5CIPA 2O6FA 3GRWL 3HZYA 2PP7A 4H8WC 1XGPA 5E00B 3PP4L 4GIAA 4GSUA 3LXUX 3STZA 1T2XA 2IANA 5GGSB 4LLQB 5DRZA 5LNEA 2HT4D 3V5HB 4H1LB 1JZJA 4FZ8H 1D7CA 1ZV2A 1X5KA 2N0KA 2F5BH 5DD6B 1R3JA 3MA9H 1F4YL 3MRRB 3CSFA 5F21B 5BVJB 4JO3L 3PDOB 5AW9B 2OBGA 4XP1L 3WBDA 4HOWA 5DS1A 1IO4C 3CMGA 2E9WA 3NTCL 4DKEL 4G3YH 3BD5A 3VX0A 2ZIDA 1Z7JA 1TF4A 4HJ0D 4NKDA 4PWFA 2YXMA 1FH5L 3Q43A 1NFDF 4L05A 4OKDA 2NY5H 1D6EB 1JS4A 1AD9A 3DMMB 1G6RH 1GHFH 5DA0B 2UYLA 2YD9A 2UZXB 3HVDA 3N1MC 4HD5A 3UAJA 1MNNA 3QBTB 4XCFL 1KCVL 4UQAA 3PGDA 3CH1A 3QUZC 1UZ8B 4O58H 2J6EA 4Y88A 1A4AA 3CVBA 1UG9A 5HYEA 4Z95L 1F56A 1FG2B 2UXTA 3JWNC 1M4KA 2FQGA 1KN2H 1J1OH 3NYKA 4ZFQA 3U2JA 1FFPB 4NZRH 2LU5A 5L2KA 2JFCA 2QHRH 2A9DA 2V7NA 5DQ9B 1HL5A 1MCOL 5GRUH 2FWLB 4TQHA 4Q6KA 1LO0H 1YDPA 3TFKC 5CIPB 3HZYB 1UWXK 3DJZA 5LG1A 2P5EA 2BZDA 1NCTA 1HHHA 4MA7H 5EU3B 1GCYA 1NCOA 2OMXA 2OTUB 3DRTB 5I74B 5BRZA 4MJIE 1PSKH 3E6HB 2FBJL 1U91B 3I9GL 5D1QD 5ESQB 4DGIH 4IBYA 2VL4A 3HZMA 4S1SL 4ZFOL 3NIGB 4AI7A 4JK0D 2VR3A 3BCDA 3OKNA 5CGMA 3CG8A 4F3FA 1E8WA 1EDQA 4R7LA 1XBDA 4BXSV 3NZ8B 4UT6L 3RGBA 3ZY7A 1MRFH 1K9TA 5A3IC 3KGTA 4JFPA 4JFUA 1YEIH 3Q0HA 1N7MH 3V4PA 2Q2EB 1EXHA 4P57A 2V5MA 3T0AA 4U6XB 5I0VA 2F53E 2D0FA 5DFTA 3AG2B 4JFOA 4K0OA 4ES8A 5IHZB 4PJXE 4XP6H 1UM5H 3O3DB 5I19L 1G7LA 1R3IL 4M1DH 3ARSA 3NOIA 2CHXA 2XWRA 4D0BB 4OD3L 3TO4D 1BOYA 4A2LA 3GMMB 1FG2A 3QRGL 2R2BA 3FUHA 5IBLC 3PIQA 3S4SB 1KTBA 2RFXB 3BHBB 4POUB 1BYNA 1D6VH 3WIHH 4N2DA 1CBVL 2NNAB 5DF0A 3WS6A 3NPSB 4MXVF 4EVNA 4GMTH 3STLA 5JA8B 3CDFA 3F3HA 4DPAX 2H32A 4PY7B 4P2QD 1E5ZA 4QHNB 1ZLSL 4A2FA 3E6HA 1ZT7A 3MRDB 3QQNA 5ITFB 5CD5C 3SGDH 5MEPB 2VQUA 4JLRB 5T1KD 2JKWA 1PZAA 1E27A 1K3ZA 1N5AA 1FFQA 2C9PA 2EAEA 1V3KA 3TN0D 2HVJB 2RQ8A 4NN7B 1EJ8A 2HFTA 4HGWB 4JFZH 5D1ZA 1CFNB 1XVSA 1MH5A 3V6OA 4B9IA 3DVFA 2YD2A 1YNTB 3M7OA 4P46C 3IMBA 4OQTA 4I3RH 4OZFG 4XTRC 3VG0H 5EPMB 1Q1JH 3CU7A 4JFOB 3RI5F 2QPSA 3OKOB 5EO9A 4Q9RL 1NANI 3GBMH 3HE7B 4JKKA 3V7MA 1VGEL 3S35X 2Y24A 2M1KA 5A2BA 4BFIA 4KKCD 1MFDL 2P47B 5TK4A 3LQZA 25C8L 4S10A 3OZ9L 4LHUG 3GMMA 3LOWA 3AT8A 3MRLB 5AKVA 4I3RL 5C08E 1CICB 4PIRF 4E41E 1ZIBA 2CJTA 3KWVA 3NCBB 4GUQA 2P24A 2G3XA 5A2AA 4HHAB 3WD5L 4ZYKA 1SMDA 2NR6A 1JGVL 4D8PA 4AH2B 5SWQA 2DIJA 5C0GB 1XF4B 4M6NL 4BE5A 1HINH 4FI8A 4FZEL 4AMKL 4RZKA 5DC9B 1AG0A 4FXKA 1MAMH 2VITA 5E2WH 2Q3ZA 3U0TB 2OQJA 4NFDA 3MRPA 1SN0A 1I85A 4NZRL 4DO5A 5CP7B 3GSNB 1N5AB 4TTDC 1PQZA 4B0MB 5I66B 3CUPB 1A47A 1HNFA 4ZTOH 1YJDC 5GS1B 3ELAT 3O11B 4HCRH 3FQNB 3UAEA 1YYLL 1VPOL 1XWVA 2FO4B 3CVDA 3N50A 4N2MA 1A8JH 3BIKB 2QZQA 3WEXB 4MNHB 3DNKA 4F93B 1A4JB 3T0EE 1KIQB 4HEPG 4M1CD 2X53A 3PDOA 5F9DC 3KHOA 4GP5B 3N2JA 2XQ0A 1R47A 4IMKC 3FU6A 1ZLUK 3K5RA 4OCXH 3UTSD 4QRSB 1QR1A 3BFQG 5H37A 2OYKA 2Q10A 1T5XB 4FA8A 4CL7A 4YMPA 4JY5H 2WIIB 1SY6H 1SJEA 2D9QB 2EIMB 4FJZA 3EJCA 1JNLL 2VM9A 1N6QL 3HMXA 4NO2A 3HI6H 3QDGA 1WT5C 4P9MH 5EUOF 4G1MA 1S7RA 3BXNB 1HXYA 2LW3A 2OX5A 3P30L 4XNAA 4BELD 3PJLA 3PGDB 3EOAA 3S0PA 3MBWB 4JJHA 4RRPM 1WZ1L 3SQBA 1OM9A 4LCYB 1A6ZA 1Z9OA 2C9SA 3VCLA 4JBSA 3NJVA 3O3BA 1BVNP 3RWIB 4ODXB 1DVTA 1U8OB 3NCJH 1E7VA 1XSJA 4I77H 5B7EA 2Q3XA 3IS0X 4OV5A 35C8H 3UAJC 4OUOA 3VFGL 3VFNB 3DSFL 4PGZA 1NDGB 1UD8A 5E8PA 2PO6B 1J1OL 2GEEA 4ZPVB 1I7ZB 3KLQA 1F4WL 1IVLA 1EAJA 4MNHA 4KITB 1MFAL 2B15A 5B4MD 3D05A 4H26A 4UIMA 5DEFB 2Q76A 4WF7A 3OKDB 4NSKB 1FZMB 4RZCA 5I1GL 5CUSL 5E1AB 1INDH 2HT4C 4R4FL 3CZFA 2BH0A 4RSYA 2AKRA 1NGYA 3QR2A 2EDWA 5IMLA 3SE3C 2EDOA 1OIOA 1KPVB 3ESUF 4HLJA 3ARFA 4XMXA 3QC6X 3UACA 4BK8A 4FFTA 2AF2A 2B08A 4R8WL 4ZUVB 1CIDA 1J8HA 1RZIB 3QW9A 4AM0B 1TTAA 1MCPL 3MLRH 3QE5A 4XB8A 3SQBB 2DLHA 4BBWA 4HS8L 2QQKH 1V27A 3FO2B 3BHBA 1UEMA 4N8PA 2W8CA 2KERA 4XBMA 3UTOA 1TQBB 1Y1UA 4WV1B 3TEWA 5FGRA 1FZKA 2MSPA 4LSSL 1FAIL 3GGWB 2WAHA 1U3HD 3QWOA 4OBSA 1CL7H 3UG4A 3HHRB 5IM7A 3EOYG 3VWJA 2HRPL 4D2NA 3L4TA 1F0LA 2ZYRA 3DETC 5JHLH 2DQUL 2WYIA 1WZ1H 2PO6A 2WCPA 4GIOA 3V9CA 3R7RA 3TBWB 2DTML 4I0PC 3SDCB 2Y9RT 1EK3A 5AFAA 5FO8A 4ODBD 2WXQA 1M2VB 4FQ2L 3IAGC 1MFBH 4KAQH 3BD3A 4YDVA 5HYIA 4L4TE 1JXDA 5EO1A 1BQLL 4G6AC 3BUIA 4H25A 5DUJA 1OOAA 2YN5A 4LCWE 4KK5C 4K7PY 2Z91B 1SRDA 1P7KB 1MZYA 3Q1SL 4PRAA 2CRYA 4U05A 2H1LM 4E68A 4TSAL 1UXMA 4A6YB 1LQBC 2XV0A 3CZLA 4XNXH 1JOIA 2IPKA 3GTVA 1YEGL 3D18A 4G8GD 3TU6A 1YUHA 2L7QA 2JKRM 2B4CL 1R6VA 5T5FA 2VRAA 1G9EA 3EOTL 2VQ1B 3FO1A 4FLSA 2X28A 3QAZC 3CLEL 3FQRA 1XZ0B 3NZSA 3QJOA 2VUOA 3KW8A 4WHTB 5EMYA 1S8DA 1I8KB 4DTGH 5AWNL 3O2DL 3MXVL 3BD4A 5TE7H 2D03H 5C07A 3T65A 3PCYA 4AYID 5HI5D 4HJTA 3DIFB 2VM4A 1NIDA 1BDYA 1HINL 1P5UB 2IBBA 4H2CA 3H3KA 4PJXA 4QYOA 4FNPA 4CC4A 3HI1B 4N90D 2P52A 3GK8H 3OHMB 1NEZA 4R7VA 1M2VA 3KWXA 1VACB 3HB3C 5I66A 2EIBA 2BC4B 2IDUA 1GOFA 2PCYA 3BQUB 3HZVA 3D12B 2ZAIA 1N26A 1XDTT 3QQ9C 1JNNL 2DWDB 3LN4A 4MAYB 5I1LA 3VXOB 1N67A 5D1XE 2N1TE 3X1GA 2OR9L 4N0UB 3WLWD 2AC0A 2FR4B 3TN0C 5IROA 2EUXA 4LRNH 1EDHA 2Y6SC 3W0WD 4PBWD 4ZXBA 1EA9C 4HH9B 4ERSH 3K2UH 4N0CD 1HOCB 3CDGB 3EOTH 2PYFB 2GIYA 1FUNA 3C5JA 1U58A 3RWCB 4MNQB 3VUAA 4YSUA 5IJVA 1WRFA 2ADJB 2LAGB 3ESPA 3VMOA 4G9FA 4K94C 2JCWA 4XZUA 3E2HC 4QGYA 3NDZE 4NPJA 3RVVD 3CU1A 1BA9A 2ZXBA 3NIDB 2HA1A 4XI5D 1JHKL 3JVGC 5HGHB 3DIFA 4TVPH 4NZUH 2V3EA 4YX2H 1BP3B 2GJ6D 3UMNA 3B5TA 1A0QH 3GBEA 5DEGB 4NQCD 1UCBL 1SEBB 4YBQC 2JQZA 4FG2A 2V9UA 2R4RL 4NO3A 4J3SA 4QGTA 4HU8A 2NY2D 1BX2B 2AJVL 1NGQL 4I8DA 3ABZA 4B3EA 5KSBB 4PJFF 5I1LB 2OJ1A 4HV8B 1DQKA 5IB3A 1DL7L 1JZ7A 1WISA 2ODHA 3ULSB 5KS9A 1G7HB 3PHQA 1U8LB 2YPVA 1Q1PA 4GSDH 1N12A 3MRHA 5AB0A 1UACL 5LB1A 2AJSL 5D7LB 1UM5L 5DGRA 3DTXB 4U6YB 3NP3A 5F9WC 3V6FB 3O3UN 3WNJA 2MNJB 4K9EH 4PCSA 1CYWA 2J8UB 3CDZB 3PUUA 3QR0A 1OPOA 1LP9F 3D1MC 4ETYA 1CVRA 1OAXL 5F7HA 3CZEA 4PLJD 5C0AB 2ADJA 2J7LA 3AM8C 3TV3L 1TJHH 2D7TH 4GUPA 2NXYC 4AQ1B 4CBZA 3G08A 4ALAL 1FRGH 4H13C 4AQOA 5FO9B 5EU5A 1A3ZA 1RZIA 4ATTA 2HKHL 3EYUL 1UYWL 5JHMA 2IDQA 1EQWA 2I32A 4Z7UF 1A4KA 4R2GD 3QWNA 1DANT 1N59A 1FQ9C 1OT4A 2DQIH 1FHGA 4YSAA 2R2CA 2QMJA 5GS0L 1FGNL 3HC2A 4E9RA 3TA3A 3T6XA 3GPSA 3W5MA 3IXTB 4IEFA 5GJTH 2R23A 1JUFB 1XD1A 4RWHA 5GGTA 1T03H 2J20A 1CU4H 5CWSA 1KTDB 4OZHF 5LAXB 3K72A 1G7HA 3PHQB 4JMXA 3HG1A 1U8JB 3QDME 3TL5A 4PG9B 4U6YA 1FH5H 2FTAA 4IHBA 3WKYA 4E41B 2GITA 5HJDA 3RAJH 5KAQG 1BVNT 4KRMB 5ESVB 1QHQA 2R8SH 1CE1L 3BAYA 3H1ZA 4MDIA 4KDVA 3VXTA 1XH3B 2WSKA 5C0AA 3WE6A 2YPKA 3TTYA 5IJKA 1EMTL 1MY5A 2IPKB 4OZHE 4Y4HD 2FEDC 4XCEA 3I6KA 4UZSA 2FQFA 3BDBA 5DMJB 4KRPC 5FB8A 1NOLA 3UCRA 1U3YA 2UX6A 3P9WB 3ZE2B 3MREB 5F1NB 1RK7A 1CD9B 2UV3A 1GCFA 1UUSA 1S9VA 4OJEH 2R29A 2RH0A 1AMYA 1MVUA 2CR6A 3DX9A 1TFPA 3H85A 4UZGA 1M05A 4Y4HA 3WJMA 1WA2X 4EQ2A 1PAZA 2CRZA 3ASWA 2FD6H 3U9PH 4BWUA 1S8DB 3RAJL 2WXNA 3RI5K 2P26A 3T0BA 1KTLB 5JR1H 1EAPB 2DN7A 3IXTA 3WXWL 4U1JA 3O8XB 1UH2A 4EIUA 1UD2A 4E9LA 2VE6A 1MELA 4QYOB 4X50A 4WTXA 2MEJB 4AQEA 4LL1A 3ZL1A 4FNSA 1ZANL 4KGJA 4XN8A 5JPNC 3QISA 5K39B 4DETA 4I1RA 2XWJB 4R7XA 3ULUC 2AITA 3STBA 3L4ZA 5HDLA 4X98A 1WTLA 2H6UA 4GT0A 1FA4A 4P23C 1JE6A 2BP8B 2EKSA 4MAYA 5D70L 1YEDA 1JPSL 2OXHB 2VRKA 1I3RB 1TTRA 1VFAA 4N0UA 3MRKA 3EJUA 4OZGA 5CZVL 1FC1A 4AJVA 1AOHA 1UASA 4JHAH 1AMXA 4FCHA 3WD5H 5C2UB 4OM0L 4JVPA 5F88B 2XVLA 1GL4B 4YDKH 5HHXL 4FLHA 5DVOA 3IDMB 1LQSR 1F2XK 4JG0H 3HOGA 3MREA 1S9VB 2A6KB 1VFBA 3DHJA 3AY4C 3TV3H 5D7IE 1E3XA 3ISRA 4MMZA 3WJLC 1F18A 2Y7QB 1G9MC 4FG6D 4NZTH 4Q4EA 4PJAF 3T4AB 1JBJA 4CMHB 3B3BA 1MI5D 4EZLA 3W1ZA 4PJEB 3MGTB 3N40F 4AEHH 4DERA 3WNOA 1IGYB 3HN8A 2AV1A 2P8MA 4X7TB 3AXIA 4LDEB 2FJHA 1IZKA 4YDLC 1PTZA 5DTFA 2YD4A 4JREC 3HHSB 3U4BL 4EIBA 1BMWA 5ADPL 1NIFA 4JQIA 1SEBA 4M8QB 5FW8A 3QQ4A 3QUXB 4ODWA 4ANVA 2Q86B 3Q2CA 2YMTA 1UOWA 1Q9OA 3D09A 1YJDH 1VFMA 3F7LA 4EOWL 4M9OA 5DSCB 3KM1A 3ZE0E 3NH7L 1I3RA 4HG4J 4BK5A 4YX2L 2IFFL 3MZTA 2CO7B 3SBPA 2ZAGA 5KS9B 1JYXA 3L3JA 4PJCA 1OARL 4QLWA 2IV8A 1WCBB 2O5YL 3WENA 2BK8A 3S5LG 4DW2L 1RAMA 2I9TB 3QP3A 3QQ9D 3KPRB 5EOTA 2JIXB 4UUJA 1IEAB 2CA3A 2WM0A 3D4YA 5E1QA 2EDXA 4LCUA 3UZQB 4PJFB 3V0DA 2DYRB 3GEFA 3F7PC 4ZTPL 3RVUC 3UFIA 5MENB 3IRZA 1AC6A 5F7BA 3SBWA 3T4AA 3TWCL 4GUPB 4KUZH 2X2UA 4MYPA 1UGKA 2X2JA 4ZFZB 1PD0A 4PJAA 5GRVK 1K5WA 1PEWA 4ZUUA 4YFLF 5IEHA 3DLQR 2CMRL 1IKNA 3IJ8A 1AO7B 1EERB 3WOVA 1LK3H 4PHXA 1WIOA 4JFHE 3HHSA 2H32H 3NIDF 1KEGL 2DMHA 4FLOA 5HDBB 1WCQA 4OLWH 4A7GF 3AT0A 4K5MA 1JNNH 3GJFK 1A1NB 4WEUD 2OJZL 3TCXA 4ZMAT 2Y1ZA 4MA1C 1CDBA 5ES4B 5EEXA 1GYVA 3H9SA 1BIIB 4DGIL 1FNSL 2E6PA 2V33A 2IH3B 4L37A 3W11C 3V6BR 3K6FA 4XO4A 1C7SA 2B39A 3NRFA 2FVNA 2WLIB 4D3CL 5DYOA 4FFYA 3K72B 4RGNE 4H1LG 4NUGH 4IRZA 3AXLB 1L9MA 1MUJA 4QOKD 1AKJD 1MREL 5F97E 4AVHA 1AZVA 4JDEB 3M17B 4K7FB 1WCBA 2XRAL 5FYKE 5FHAH 1F13A 4PJBF 1DCLA 2X3CA 2YD8A 4YE0A 3DYMA 5EEZA 1I8AA 3OKYA 4MJ2A 4LSTH 1Q0YH 5HHVH 3I74A 1PFOA 4PJEF 3IGFA 2C7UA 3TFBA 1V05A 4Y9GA 1HXMA 1ZHKA 4HXAL 1NMCC 4GQ9H 3GMPB 3LH2L 3FT4A 3NJKA 4IHOA 1A7QL 3ZT5A 4TV3A 2YLKA 2X1OA 1S3KH 3KWUA 1IC5H 2RGSA 5I5JA 3GI8H 1QHOA 4PLJC 3UROR 1NBZA 4XNXL 5D1ZC 3WJMB 2TSAA 4FQXC 2Z0BA 3GMQA 2VDKH 3MO1B 4JO3H 1BPLB 3SE6A 1JXKA 3GIZL 4P5TC 2GIMA 3AW5A 1F90H 4G8IB 5EF3A 3ZKNC 4OI7A 2GTWB 1BQLH 1KCRH 3H9SB 1IKNC 5EDSA 2C34A 3QEUA 4HC1L 4BFGA 5IV2A 3EGXB 1BFSA 1BREA 2CCLA 1AGCA